4GOFA

Crystal structure of the sgta homodimerization domain with covalent modifications to both c38
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
52
Chain Sequence
MKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGVTVEDSDLAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Small glutamine-rich tetratricopeptide repeat-containing pro
publication title Structures of the Sgt2/SGTA Dimerization Domain with the Get5/UBL4A UBL Domain Reveal an Interaction that Forms a Conserved Dynamic Interface.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4gofA00
3PH0A 2P58A 2LR2A 2B89A 4NPFX 5CBOA 1OVUA 2JWDA 2WMMA 2RKLA 1H0TA 2ZAEB 1DEEG 1Q2NA 2M0BA 1JMBA 2B87B 2R44A 1EDKA 4GOFA 1LP1A 2UWJE 5EFWB 2KI7B 4K3AA 3RGUA 1EDLA 1ZXGA 1JM0A 2Q1KA 4CPGA 1OVRA 1BDCA 4ZNCA 1X0TA 2SPZA 3MHVA 2KZJA 2QVAA 3S1KA 5DJUB 4K35A 2KUBA 4HB1A 1FC2C 4GODA 1U7MA 2QRXA 1MFTA 4ZMDA 3QWOC 2HR3A 2K3RA 5DJTB 2M5AA 3FXDA 4ASVA 2B88A 4JBZA 4WWIA 1EC5A 2LXCB 5C39A 2LXBA 1H0TB 2OTKE 3ZDMA 1LP1B 1NVOA 1BDDA 4EYYQ 5K5GB 2KS1B 4GOEA 2I8DA 3FXEA 2KIKA 4NPDA 1LT1A 2KZIA 4IOIH 2M5AB 1S3JA 1ZW0A 3MZWB 1U7JA 1SS1A 4HKZH 5CBNA 4ASWA 4BXLA 4KJMA 1EDIA 4MN4C 2B87A 1Y47A 4NPEA 1OVVA 1EDJA 4HJGH
chains in the Genus database with same CATH superfamily
1KILB 1S5LH 2LR2A 1RF1B 1SLQA 1PPJE 2BCCG 2FYNB 3M9HA 2ZYDA 2NPSA 2R44A 1PZQA 3E1RA 4K3AA 3D6ZA 1KQSO 1FE6A 1JM0A 1CI6B 2HG5D 2Q1KA 3USSA 1OVRA 1NAYA 3IAOA 3CMEP 3RK3D 3KXDA 2KZJA 1FDMA 3W68A 3CL3D 2JKVA 1SQVJ 1URQB 4GODA 1ZOYC 3L74D 1Z56A 1S9KD 1KB9H 3KZIE 1NU1K 4H13D 1FOSF 2OTLP 1IFNA 3TF5A 2LXBA 4RESB 5KTBA 3VMXA 3L72E 1AQTA 3GHGB 1FZFA 2WSSH 2Q3EA 4GOEA 4H44B 3TK1A 2D2CC 3FXEA 1LWUA 3TNUA 3F5HA 2Q6QA 1GL2D 1P84E 4IFMA 3LIEA 4PV1D 1USDA 5APXA 1SQPJ 3VTPC 5CBNA 4DCKA 4WB4A 1ZRTE 5E79H 2N9YB 4NPEA 4UB8E 1NTKJ 4YXDC 3BCCG 2WPSA 4O9BA 4JQ0D 1SQVE 2KOGA 4NPFX 3Q5SA 1PP9D 1M1KQ 1K05A 5CCGD 1HF9A 2K88A 1QL2A 2QJYB 2KSEA 2KI7B 2OTJP 3KDPB 1N86A 2POHA 3VP8A 2KNCA 2FYUG 2LKMA 1M57D 4KT0J 5CCGC 2L91A 3HE5A 1YQ3C 1SQQK 1AQ5A 2FFDC 4A7PA 3UIAA 2G8YA 5KJ7D 1EXJA 3HD7A 1K8AQ 1MZ9A 2QRXA 1SQPE 4Z1MH 1DX7A 2ZJSE 5CMZA 2H88C 3MUDA 3N4XA 2M5AA 3MTUE 5KJ7C 3RL0B 1NTMD 1KD1Q 1HJBA 1Q90D 1FBMA 1YYCA 2CPSA 1MFZA 3H1HJ 1FAVA 2HFED 5AVXB 1YBKA 1KB9I 1NO4A 3GW6A 2KYVA 3H1LD 3CCUP 3VYIA 1JOCA 5AVQB 4ASWA 1HGVA 2OYHC 2ZT9B 1SQBD 3AE9C 3H1JG 1NHLA 2JEEA 1SFCA 1VL2A 2YKQA 1J1EC 1KILD 1FDIA 2XKMA 3S9OA 1JY3O 2QM8A 4KHXA 3U1CA 1KZUB 2O01N 1IFDA 3CLQA 3HE4A 1EDKA 3P8CD 5M1BA 1LTBC 3L37A 1KILC 1VQNP 1RF1C 5KLVD 1G1JA 2FYNC 3H1KG 1JY3P 1IFPA 1AVOA 1T2KC 2NPSB 2KUBA 3H1HE 1CW5A 2Y9YA 1IO4A 3V2RA 1YJWP 4XFJA 1X22A 3I5CA 1L2PA 1X8YA 3CCRP 2P10A 3QWOC 4PD4E 2WPVB 3LIDA 4D6TG 2ZFCA 2FYUK 3WU2E 1JY2N 1NTZE 2J5UA 1URQC 3V5BA 1QL1A 3H1IJ 5CCHD 2JWAA 1J1DB 1YTZI 3VMAA 3B4SA 2E75B 2BEZF 4NPDA 1S5LE 3L72D 2YXQB 1AFOA 3L73G 1AV1A 4EIJA 3FX0A 2O1KA 1P84D 5KKZB 3WUUA 1KTMA 5AVYB 4H44C 1KQFB 1VQMP 1GDTA 2WVRA 3LW5J 2H43A 1NTMK 2QM7A 1LWUB 2WITA 1ZRTD 3TNUB 2Q7CA 3WUVA 1OVUA 2R3CA 1SQVD 3CMAP 1AA0A 2E76B 4GOFA 1N7LA 1FZBA 3ITKA 3L35A 4PJ0H 3CCSP 2CK3H 1SQBK 3H1IE 2DW3A 3MHVA 2QVAA 2QJYC 2FKWB 3IR9A 2AXTE 2KNCB 3PRJA 3OAKA 3FXDA 5AW1B 1Q81Q 1X79B 3Q2YA 2NRGA 1EZVD 1SQPD 3HE5B 2PP6A 1SVFA 5KLVK 3RL0D 4N78E 3HD7B 3SWKA 1PL5A 1S4XA 3SSUA 3A2AA 1NTKD 1VQ8P 1GW4A 3V2PA 2A06G 1L0LG 1BSNA 1A02J 1LTIC 2JDIH 2M5AB 1RE4C 3RL0C 3F89A 4U3FG 2PFXA 2O3JA 2IBZI 2ZT9D 3M0DC 3B5ND 1YIJP 2FXMA 2YO3A 5CBOA 3OW2O 5BU5A 2E5TA 1PGPA 2QA4P 1SP4A 1AJYA 3RK2D 1XTGB 3CI9A 3NTNA 1BGYG 1SFCB 1S1CX 3V6IA 1OX3A 3AE5C 3L71G 1ZP0C 1U57A 2NPSD 3HE4B 2IFMA 3G71P 2E74B 1WT6A 1SQXJ 3H1HD 1SQVK 3CX5H 1NU1G 1HBWA 2ZYAA 3A0HE 3OJAB 3E7KA 1P84I 2NPSC 3BATA 3T97A 1N8RQ 3NMDA 4PD4D 2YMKA 3H32B 1YI2P 2H7HA 5AW6B 3VN0A 1LP1B 5AW7B 1BCCJ 2A45I 2E75D 1PFIA 3M0DA 1W5CE 3P7KA 5GTIE 3GLMA 4I6MC 2OQQA 2C9LY 2Q9IA 2IX7C 3A5TA 1GK6A 1Y47A 1SQPK 4I1LA 1BE3G 3L75J 4B86A 1UIIA 2WPQA 1L4AD 1NYHA 1HWTC 1LTTC 1H8AA 1NTKK 2E43A 2WSFH 1SQXE 3D6YA 1JMBA 4D6TJ 2P1JA 2E76D 1LWUC 3TGUJ 2PAJA 2K9JA 1UIXA 3HUSA 3HTKA 3KQGA 1WRGA 5AW0B 1SQQG 1W2BO 1KB9D 1BCCE 3S1KA 3M9BA 1LNQA 2E76C 5BVZA 2IBZE 3H1ID 2XDJA 2E5YA 1U7MA 3CCQP 3VOPA 2QJPB 1OW8A 3L75E 1OWAA 1KORA 1YTZT 3G4SP 4EYYQ 1VPCA 3CWBJ 4L76A 4N78D 5AVUB 3B8EB 3L74G 5AVRB 5APQA 4D6TE 1VQOP 2D2CD 1N2DC 3AEFC 4R4LA 1CZQA 3TGUE 2M3BA 3HD7C 2YXRB 2KK7A 4I2LC 3MUDC 4PJ0E 3CCJP 3CXHH 3PH0A 2AXTH 4N3YB 3VMZA 3MGNA 1H0TA 3N7NA 3LW5H 5EFWB 3RGUA 2OYIA 2JJLA 3KHUA 1IK9A 1ZN5A 2XNXA 1SFCD 4CPGA 4PD4I 2IZ1A 2FXOA 2KB7P 2Q3IA 1PP9G 2AEMA 3CWBE 4BRYA 1SFCC 3L4FA 4WY4A 5TJHA 2HR3A 1OW7A 4XE5B 4ZKUA 3IFMA 3P8MC 4C7NA 3AE7C 4GT1A 3O6QA 2NZ2A 2E74C 1PGJA 1ZR4A 1RH5B 2KXPB 1AVYA 1LGHB 1M56D 3D71A 2N9BA 3K5BA 1EQ7A 4U7JA 4QMAA 1G1IA 1S3JA 4WBAA 3T97B 1EDJA 1RY3A 1NTMG 1JCCA 2WQYC 3PLNA 1L0NJ 3PP5A 3A0HH 2RN0A 2FYZA 2RH0A 3ABVC 3H1LG 1Q2NA 1NU1J 4U3FE 3I56P 2OARA 1NTZJ 2WSFJ 4EDFA 1EDLA 1GL2A 1JY3N 3CX5E 1G2CA 1SQXD 1SQBG 1NOHA 3JSVC 3M91A 1K04A 1JO5A 5GTIH 3BRVB 1N73C 1T8ZA 1GU4A 2E42A 1PPJD 1T2KD 1BCCD 2K9JB 1KFNA 2IBZD 1NH4A 4YTPC 5DJTB 3HUSB 1GD2E 4UB6H 3AE8C 5KLVG 3OA7A 3BASA 2JO1A 3QH9A 1L0NE 1VF5B 3L75D 3VP9A 4C46A 1URQD 1KYOH 1E5WA 1H88A 2QJPC 3M0AA 1NU1E 5APWA 3G3ZA 2GUVA 3IN6A 5APUA 4OGQB 1M7LA 4MN4C 2WT7A 4D6TD 2KP8A 4IFFA 3SFDC 3TGUD 2BCCJ 1FZCA 2ZYGA 4H44D 1NAFA 2P58A 2K1AA 2FY8A 2ZVOB 2K37A 3L72G 2JWDA 2RKLA 4JPZB 2YIUB 2W83C 4TLFA 1N73A 1VQLP 1TU3F 1Y8AA 1NGMB 1X9VA 1RF0C 2BEQD 2W27A 5H2FH 2HODA 1VQPP 1LTGC 3EFFK 1X0TA 2IYPA 3V2NA 2KLUA 2WTYA 2A45G 4DZOA 5APVA 1HUCA 1FZGA 4IL6X 2KS1A 5AW5B 2OYIB 1NJIQ 1SQVG 4ZMDA 3H25A 3HRNA 2W6AA 3CWBD 1FOSE 1LT9A 5GTHE 1SQXK 2BCCE 1SQQE 1N7SA 2IPPA 3W67A 4WY4B 3CXHE 4WVZA 2V7QH 3PHLA 3CC7P 2R32A 1M8OB 2AXCA 1DD4A 2Q5UA 3U1AA 3FWNA 3BCCJ 3O6QB 2ITAA 3Q1MA 1EZVG 1LTJA 1SQPG 2QJKB 4HJGH 2J59M 1PIXA 3KPEA 2YKPA 4EI2A 1KYOI 4OH8B 1JNMA 3G9RA 3RK3B 1FS0E 1RF0A 1NTKG 3AE2C 1DH3A 2W6BA 2FBWC 5CCHA 3EFGA 3L70G 1Q7YQ 2FYUJ 3GHGA 2K9YA 1NWQA 4AQRD 1RE3A 4I7ZC 1HGZA 1R8EA 1GZLA 5TISH 5KAIH 3S4RA 2GA1A 1JUNA 3CX5D 5DJUB 4K35A 1GMJA 1RQUA 1S72P 4H0LC 4RJTA 1MFTA 2FXPA 1G2CB 3L36A 1DIPA 4PV1B 3BCCE 3MIWA 4JBZA 1IFIA 1QVGO 3PJSK 5AW8B 2O1JA 1ZLLA 5L8RJ 2B9BA 2AEFA 3HUSC 1YITP 3M9QA 5B66H 2P2UA 4Y99C 3SWFA 5APSA 1L0ND 2H8PD 2FYUE 2OGUA 2V4HA 3EQ2A 3H1HG 3H1JJ 4BXLA 1M1JA 3RL0g 3GMAA 2OYOA 1VF5C 2BASA 4Y28J 1JEKA 1HJ0A 1NU1D 3AEBC 1ZMEC 1OVVA 3AE6C 1JB0J 1NTZD 3GG2A 4LLHA 4W7YA 3PTZA 4OGQC 2WT7B 3B71A 2C0WA 2HPCA 3H1KJ 4M3LA 1FZCB 2PGDA 4OVNF 4UB6E 2WPRA 1VQ6P 5CHXA 2YIUC 1KV4A 1QX8A 5KAFH 4DOJA 5AW3B 1MUUA 1IC2A 1QGKB 3B5NA 4R4MA 1N73B 1KYOE 1VQ9P 3H1JE 3Q5RA 4ASVA 3CCMP 2Y0DA 1YJ9P 1S2EA 5C39A 2R3SA 2OYIC 3C8VA 1NVOA 3L73J 2I1KA 2KS1B 2BCCD 1LT1A 2W8ZA 3H1IG 3H6PA 4TT3H 3CC4P 3P8CE 1LT9B 1U7JA 1ZV8A 2JP3A 3CXHD 2V7QJ 3H1KE 1R5LA 2YO2A 1N7SB 5KLVE 2B87A 2YNYA 4WY4C 1JMMA 3HD7D 3BVHA 2WWWA 5H2FE 3CC2P 2R5BA 5AVWB 2N1TA 3CX5I 5CJ0A 3Q5PA 3CCEP 2M8RA 2WMMA 2IZ0A 2QJKC 5GTHH 4AUWA 1L0NK 1LTJB 1R5SA 1DD3A 4L74A 2RMZA 3RK3C 2J58A 4HH2A 2Y9ZA 3R2PA 1NTZK 1YQ4C 1OW6A 3E1IA 5BU8B 3L73E 1VQKP 1BSHA 1IJDB 4RKUJ 2QSIA 2YMYA 2Z4EA 2W90A 4H13C 1L4AA 1M90Q 2I1JA 1MKMA 1GU5A 3R4YA 3BCCD 3WUTA 1KFMA 3JCUE 1L0LJ 1GL2C 1VQ5P 4PV1C 2KZIA 2E74D 4IOIH 3SWYA 1VQ7P 4U3FJ 3A0BE 3L70J 1IFJA 4DJGA 1KMIZ 2C0XA 3JC22 2FYUD 4IL6H 2MKVA 5KAIE 5TISE 2XZRA 1PGOA 1FDOA 1RHZB 1M1JB 1DEEG 1BGYJ 1PGQA 4AYCA 2UWJE 1EZVE 3U59A 1MV8A 1ZXGA 5B5EH 4JYBA 3AEDC 5KLIB 3L71J 5APYA 1VDFA 1JTHA 1Y9BA 2A06E 1L0LE 3WMM0 4I7ZB 1NTKE 1T3JA 1FJPA 2YKOA 2H89C 3O8ZA 1OXZA 2WSCH 3AE3C 1A02F 1S5LX 3TSIA 3L70E 1FZCC 2HPCB 4IFDK 5B66E 4L73A 3CXHI 3M06A 2VRSA 1GTWA 4H0LB 2K3RA 3CPWO 1KYOD 1SQXG 2C9NY 2QIWA 3H1JD 2G3AA 3D70A 4XA4A 3NXSA 3B5NB 3RBXA 3SFEC 3V2QA 2O01H 1PPJG 1BGYE 2IDBA 1BCCG 3HTKB 5CCGA 4Y99B 1EXIA 1BE3J 4JYCA 2IBZG 1N7SD 3RK2B 1KQGB 2FFDA 2ZXXA 2CPBA 3L71E 1YJNP 2HLOA 1IFMA 2R5DA 1WMKA 3H1KD 1LT9C 3L75G 2P7JA 2XV5A 1N7SC 2QE7H 5KAFE 1KC8Q 3H32A 5KJ7A 3MP7B 3GF7A 2B87B 1LP1A 4W80A 3FWLA 1SQQJ 3A3YB 4C7RA 2N1TB 3AECC 1BDCA 3TGUG 2GM4A 2SPZA 1LTJC 3A7OA 1HVVA 3AEGC 2W6JH 2OYHA 3V4WA 1JY2O 3P32A 3L73D 2Y0EA 2MJZA 1BE3E 3NFQA 3AE4C 1QEXA 1QVFO 5AVZB 1Q86Q 1H89A 2WSEH 5CCHC 1FU1A 2HYNA 4GDOA 3GHGC 1H0TB 5AW4B 1OFCX 1JY2P 1BDDA 3L74J 1RE3C 1L4AB 2KIKA 1PV3A 5AVTB 1KILA 1RF1A 3G6EP 3KZIH 1ZW0A 1SS1A 2Z5HA 1YHQP 1VQ4P 3CWBG 2AEJA 2JR8A 4BRYB 3CCVP 3TDKA 1KB9E 1CI6A 2QG4A 1P84H 5AVSB 1Q82Q 4C7NB 5AVVB 2ZAEB 2M0BA 5AW2B 1URQA 1NKNA 3JCUH 2A45H 4OWFA 3RK3E 4UB8H 1FZEA 1JCDA 1J2JB 1PP9J 4ZNCA 1M1JC 3A0BH 3CD6P 4YPCA 3MD0A 3L74E 5E79E 4LGDE 1S9KE 4RO0A 2A06D 2L5GB 1FC2C 1L0LD 2KSJA 4W7ZA 5KLIC 2WSCJ 2Z5IA 3AEEC 4H13B 1DEBA 1OIPA 2D2CB 3AE1C 4U3FD 1JTHB 3L70D 4H0LD 1EC5A 2OTKE 1FJKA 1IZNB 2PRRA 3C1LA 3V4QA 2M3EA 3FGAD 1GL2B 4IL6E 3BRTB 4JF7A 2IFNA 2ZT9C 1IK7A 2O01J 3CCLP 1T6AA 1HTLC 1NTMJ 4KJMA 1EDIA 3B5NC 1BGYD 1CSBA 2P67A 2ZXEB 5B5EE 1PP9E 3KYQA 4GKGA 1VF5D 2KLVA 2Y0CA 2XU6A 1W2EA 3H1LJ 2B89A 3L71D 3Q3DA 1T3UA 4LC1A 5APTA 1ZR2A 1K9MQ 1LJ2A 3RK2C 4GIFA 4HYTB 1L0NG 1SQBJ 3EWKA 2FFDB 2ZVNB 4OGQD 4N6JA 5CJ4A 1OMIA 1K73Q 1NKZB 4BWNA 1GK4A 1HH0A 2N1TD 1NTZG 4L75A 3II6A 2GUSA 1RE4A 4EOTA 1USEA 4HB1A 3RBZA 1LTSC 2IYOA 1D7MA 4YXWH 1E79H 5AW9B 1KN7A 1KQLA 2N1TC 3VMYA 3IF4A 5KLVJ 1NTME 3C9IA 2WZ7A 1XTCC 2B88A 1LTAC 4WWIA 1BE3D 1J1DC 1GW3A 2LXCB 4ZKPA 3ZDMA 1RQVA 2E75C 2WSEJ 2OYHB 3H1LE 5K5GB 3AEAC 2I8DA 2XNDH 1L0LK 2HODB 3MZWB 4PD4H 3I55P 1SQBE 3WU2H 1J1EB 4DT0A 2QEXP 5KKZC 4HKZH 1OZHA 3TYYA 1FZAA 1KILE 1L4AC 3GF3A 1EZVI 1SQQD 3L72J 4WY4D 1QLED
chains in the Genus database with same CATH topology
3PH0A 2P58A 2LR2A 2B89A 4NPFX 5CBOA 1OVUA 2JWDA 2WMMA 2RKLA 1H0TA 2ZAEB 1DEEG 1Q2NA 2M0BA 1JMBA 2B87B 2R44A 1EDKA 4GOFA 1LP1A 2UWJE 5EFWB 2KI7B 4K3AA 3RGUA 1EDLA 1ZXGA 1JM0A 2Q1KA 4CPGA 1OVRA 1BDCA 4ZNCA 1X0TA 2SPZA 3MHVA 2KZJA 2QVAA 3S1KA 5DJUB 4K35A 2KUBA 4HB1A 1FC2C 4GODA 1U7MA 2QRXA 1MFTA 4ZMDA 3QWOC 2HR3A 2K3RA 5DJTB 2M5AA 3FXDA 4ASVA 2B88A 4JBZA 4WWIA 1EC5A 2LXCB 5C39A 2LXBA 1H0TB 2OTKE 3ZDMA 1LP1B 1NVOA 1BDDA 4EYYQ 5K5GB 2KS1B 4GOEA 2I8DA 3FXEA 2KIKA 4NPDA 1LT1A 2KZIA 4IOIH 2M5AB 1S3JA 1ZW0A 3MZWB 1U7JA 1SS1A 4HKZH 5CBNA 4ASWA 4BXLA 4KJMA 1EDIA 4MN4C 2B87A 1Y47A 4NPEA 1OVVA 1EDJA 4HJGH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PH0 A;  2P58 A;  2LR2 A;  2B89 A;  4NPF X;  5CBO A;  1OVU A;  2JWD A;  2WMM A;  2RKL A;  1H0T A;  2ZAE B;  1DEE G;  1Q2N A;  2M0B A;  1JMB A;  2B87 B;  2R44 A;  1EDK A;  4GOF A;  1LP1 A;  2UWJ E;  5EFW B;  2KI7 B;  4K3A A;  3RGU A;  1EDL A;  1ZXG A;  1JM0 A;  2Q1K A;  4CPG A;  1OVR A;  1BDC A;  4ZNC A;  1X0T A;  2SPZ A;  3MHV A;  2KZJ A;  2QVA A;  3S1K A;  5DJU B;  4K35 A;  2KUB A;  4HB1 A;  1FC2 C;  4GOD A;  1U7M A;  2QRX A;  1MFT A;  4ZMD A;  3QWO C;  2HR3 A;  2K3R A;  5DJT B;  2M5A A;  3FXD A;  4ASV A;  2B88 A;  4JBZ A;  4WWI A;  1EC5 A;  2LXC B;  5C39 A;  2LXB A;  1H0T B;  2OTK E;  3ZDM A;  1LP1 B;  1NVO A;  1BDD A;  4EYY Q;  5K5G B;  2KS1 B;  4GOE A;  2I8D A;  3FXE A;  2KIK A;  4NPD A;  1LT1 A;  2KZI A;  4IOI H;  2M5A B;  1S3J A;  1ZW0 A;  3MZW B;  1U7J A;  1SS1 A;  4HKZ H;  5CBN A;  4ASW A;  4BXL A;  4KJM A;  1EDI A;  4MN4 C;  2B87 A;  1Y47 A;  4NPE A;  1OVV A;  1EDJ A;  4HJG H; 
#chains in the Genus database with same CATH topology
 1KIL B;  1S5L H;  2LR2 A;  1RF1 B;  1SLQ A;  1PPJ E;  2BCC G;  2FYN B;  3M9H A;  2ZYD A;  2NPS A;  2R44 A;  1PZQ A;  3E1R A;  4K3A A;  3D6Z A;  1KQS O;  1FE6 A;  1JM0 A;  1CI6 B;  2HG5 D;  2Q1K A;  3USS A;  1OVR A;  1NAY A;  3IAO A;  3CME P;  3RK3 D;  3KXD A;  2KZJ A;  1FDM A;  3W68 A;  3CL3 D;  2JKV A;  1SQV J;  1URQ B;  4GOD A;  1ZOY C;  3L74 D;  1Z56 A;  1S9K D;  1KB9 H;  3KZI E;  1NU1 K;  4H13 D;  1FOS F;  2OTL P;  1IFN A;  3TF5 A;  2LXB A;  4RES B;  5KTB A;  3VMX A;  3L72 E;  1AQT A;  3GHG B;  1FZF A;  2WSS H;  2Q3E A;  4GOE A;  4H44 B;  3TK1 A;  2D2C C;  3FXE A;  1LWU A;  3TNU A;  3F5H A;  2Q6Q A;  1GL2 D;  1P84 E;  4IFM A;  3LIE A;  4PV1 D;  1USD A;  5APX A;  1SQP J;  3VTP C;  5CBN A;  4DCK A;  4WB4 A;  1ZRT E;  5E79 H;  2N9Y B;  4NPE A;  4UB8 E;  1NTK J;  4YXD C;  3BCC G;  2WPS A;  4O9B A;  4JQ0 D;  1SQV E;  2KOG A;  4NPF X;  3Q5S A;  1PP9 D;  1M1K Q;  1K05 A;  5CCG D;  1HF9 A;  2K88 A;  1QL2 A;  2QJY B;  2KSE A;  2KI7 B;  2OTJ P;  3KDP B;  1N86 A;  2POH A;  3VP8 A;  2KNC A;  2FYU G;  2LKM A;  1M57 D;  4KT0 J;  5CCG C;  2L91 A;  3HE5 A;  1YQ3 C;  1SQQ K;  1AQ5 A;  2FFD C;  4A7P A;  3UIA A;  2G8Y A;  5KJ7 D;  1EXJ A;  3HD7 A;  1K8A Q;  1MZ9 A;  2QRX A;  1SQP E;  4Z1M H;  1DX7 A;  2ZJS E;  5CMZ A;  2H88 C;  3MUD A;  3N4X A;  2M5A A;  3MTU E;  5KJ7 C;  3RL0 B;  1NTM D;  1KD1 Q;  1HJB A;  1Q90 D;  1FBM A;  1YYC A;  2CPS A;  1MFZ A;  3H1H J;  1FAV A;  2HFE D;  5AVX B;  1YBK A;  1KB9 I;  1NO4 A;  3GW6 A;  2KYV A;  3H1L D;  3CCU P;  3VYI A;  1JOC A;  5AVQ B;  4ASW A;  1HGV A;  2OYH C;  2ZT9 B;  1SQB D;  3AE9 C;  3H1J G;  1NHL A;  2JEE A;  1SFC A;  1VL2 A;  2YKQ A;  1J1E C;  1KIL D;  1FDI A;  2XKM A;  3S9O A;  1JY3 O;  2QM8 A;  4KHX A;  3U1C A;  1KZU B;  2O01 N;  1IFD A;  3CLQ A;  3HE4 A;  1EDK A;  3P8C D;  5M1B A;  1LTB C;  3L37 A;  1KIL C;  1VQN P;  1RF1 C;  5KLV D;  1G1J A;  2FYN C;  3H1K G;  1JY3 P;  1IFP A;  1AVO A;  1T2K C;  2NPS B;  2KUB A;  3H1H E;  1CW5 A;  2Y9Y A;  1IO4 A;  3V2R A;  1YJW P;  4XFJ A;  1X22 A;  3I5C A;  1L2P A;  1X8Y A;  3CCR P;  2P10 A;  3QWO C;  4PD4 E;  2WPV B;  3LID A;  4D6T G;  2ZFC A;  2FYU K;  3WU2 E;  1JY2 N;  1NTZ E;  2J5U A;  1URQ C;  3V5B A;  1QL1 A;  3H1I J;  5CCH D;  2JWA A;  1J1D B;  1YTZ I;  3VMA A;  3B4S A;  2E75 B;  2BEZ F;  4NPD A;  1S5L E;  3L72 D;  2YXQ B;  1AFO A;  3L73 G;  1AV1 A;  4EIJ A;  3FX0 A;  2O1K A;  1P84 D;  5KKZ B;  3WUU A;  1KTM A;  5AVY B;  4H44 C;  1KQF B;  1VQM P;  1GDT A;  2WVR A;  3LW5 J;  2H43 A;  1NTM K;  2QM7 A;  1LWU B;  2WIT A;  1ZRT D;  3TNU B;  2Q7C A;  3WUV A;  1OVU A;  2R3C A;  1SQV D;  3CMA P;  1AA0 A;  2E76 B;  4GOF A;  1N7L A;  1FZB A;  3ITK A;  3L35 A;  4PJ0 H;  3CCS P;  2CK3 H;  1SQB K;  3H1I E;  2DW3 A;  3MHV A;  2QVA A;  2QJY C;  2FKW B;  3IR9 A;  2AXT E;  2KNC B;  3PRJ A;  3OAK A;  3FXD A;  5AW1 B;  1Q81 Q;  1X79 B;  3Q2Y A;  2NRG A;  1EZV D;  1SQP D;  3HE5 B;  2PP6 A;  1SVF A;  5KLV K;  3RL0 D;  4N78 E;  3HD7 B;  3SWK A;  1PL5 A;  1S4X A;  3SSU A;  3A2A A;  1NTK D;  1VQ8 P;  1GW4 A;  3V2P A;  2A06 G;  1L0L G;  1BSN A;  1A02 J;  1LTI C;  2JDI H;  2M5A B;  1RE4 C;  3RL0 C;  3F89 A;  4U3F G;  2PFX A;  2O3J A;  2IBZ I;  2ZT9 D;  3M0D C;  3B5N D;  1YIJ P;  2FXM A;  2YO3 A;  5CBO A;  3OW2 O;  5BU5 A;  2E5T A;  1PGP A;  2QA4 P;  1SP4 A;  1AJY A;  3RK2 D;  1XTG B;  3CI9 A;  3NTN A;  1BGY G;  1SFC B;  1S1C X;  3V6I A;  1OX3 A;  3AE5 C;  3L71 G;  1ZP0 C;  1U57 A;  2NPS D;  3HE4 B;  2IFM A;  3G71 P;  2E74 B;  1WT6 A;  1SQX J;  3H1H D;  1SQV K;  3CX5 H;  1NU1 G;  1HBW A;  2ZYA A;  3A0H E;  3OJA B;  3E7K A;  1P84 I;  2NPS C;  3BAT A;  3T97 A;  1N8R Q;  3NMD A;  4PD4 D;  2YMK A;  3H32 B;  1YI2 P;  2H7H A;  5AW6 B;  3VN0 A;  1LP1 B;  5AW7 B;  1BCC J;  2A45 I;  2E75 D;  1PFI A;  3M0D A;  1W5C E;  3P7K A;  5GTI E;  3GLM A;  4I6M C;  2OQQ A;  2C9L Y;  2Q9I A;  2IX7 C;  3A5T A;  1GK6 A;  1Y47 A;  1SQP K;  4I1L A;  1BE3 G;  3L75 J;  4B86 A;  1UII A;  2WPQ A;  1L4A D;  1NYH A;  1HWT C;  1LTT C;  1H8A A;  1NTK K;  2E43 A;  2WSF H;  1SQX E;  3D6Y A;  1JMB A;  4D6T J;  2P1J A;  2E76 D;  1LWU C;  3TGU J;  2PAJ A;  2K9J A;  1UIX A;  3HUS A;  3HTK A;  3KQG A;  1WRG A;  5AW0 B;  1SQQ G;  1W2B O;  1KB9 D;  1BCC E;  3S1K A;  3M9B A;  1LNQ A;  2E76 C;  5BVZ A;  2IBZ E;  3H1I D;  2XDJ A;  2E5Y A;  1U7M A;  3CCQ P;  3VOP A;  2QJP B;  1OW8 A;  3L75 E;  1OWA A;  1KOR A;  1YTZ T;  3G4S P;  4EYY Q;  1VPC A;  3CWB J;  4L76 A;  4N78 D;  5AVU B;  3B8E B;  3L74 G;  5AVR B;  5APQ A;  4D6T E;  1VQO P;  2D2C D;  1N2D C;  3AEF C;  4R4L A;  1CZQ A;  3TGU E;  2M3B A;  3HD7 C;  2YXR B;  2KK7 A;  4I2L C;  3MUD C;  4PJ0 E;  3CCJ P;  3CXH H;  3PH0 A;  2AXT H;  4N3Y B;  3VMZ A;  3MGN A;  1H0T A;  3N7N A;  3LW5 H;  5EFW B;  3RGU A;  2OYI A;  2JJL A;  3KHU A;  1IK9 A;  1ZN5 A;  2XNX A;  1SFC D;  4CPG A;  4PD4 I;  2IZ1 A;  2FXO A;  2KB7 P;  2Q3I A;  1PP9 G;  2AEM A;  3CWB E;  4BRY A;  1SFC C;  3L4F A;  4WY4 A;  5TJH A;  2HR3 A;  1OW7 A;  4XE5 B;  4ZKU A;  3IFM A;  3P8M C;  4C7N A;  3AE7 C;  4GT1 A;  3O6Q A;  2NZ2 A;  2E74 C;  1PGJ A;  1ZR4 A;  1RH5 B;  2KXP B;  1AVY A;  1LGH B;  1M56 D;  3D71 A;  2N9B A;  3K5B A;  1EQ7 A;  4U7J A;  4QMA A;  1G1I A;  1S3J A;  4WBA A;  3T97 B;  1EDJ A;  1RY3 A;  1NTM G;  1JCC A;  2WQY C;  3PLN A;  1L0N J;  3PP5 A;  3A0H H;  2RN0 A;  2FYZ A;  2RH0 A;  3ABV C;  3H1L G;  1Q2N A;  1NU1 J;  4U3F E;  3I56 P;  2OAR A;  1NTZ J;  2WSF J;  4EDF A;  1EDL A;  1GL2 A;  1JY3 N;  3CX5 E;  1G2C A;  1SQX D;  1SQB G;  1NOH A;  3JSV C;  3M91 A;  1K04 A;  1JO5 A;  5GTI H;  3BRV B;  1N73 C;  1T8Z A;  1GU4 A;  2E42 A;  1PPJ D;  1T2K D;  1BCC D;  2K9J B;  1KFN A;  2IBZ D;  1NH4 A;  4YTP C;  5DJT B;  3HUS B;  1GD2 E;  4UB6 H;  3AE8 C;  5KLV G;  3OA7 A;  3BAS A;  2JO1 A;  3QH9 A;  1L0N E;  1VF5 B;  3L75 D;  3VP9 A;  4C46 A;  1URQ D;  1KYO H;  1E5W A;  1H88 A;  2QJP C;  3M0A A;  1NU1 E;  5APW A;  3G3Z A;  2GUV A;  3IN6 A;  5APU A;  4OGQ B;  1M7L A;  4MN4 C;  2WT7 A;  4D6T D;  2KP8 A;  4IFF A;  3SFD C;  3TGU D;  2BCC J;  1FZC A;  2ZYG A;  4H44 D;  1NAF A;  2P58 A;  2K1A A;  2FY8 A;  2ZVO B;  2K37 A;  3L72 G;  2JWD A;  2RKL A;  4JPZ B;  2YIU B;  2W83 C;  4TLF A;  1N73 A;  1VQL P;  1TU3 F;  1Y8A A;  1NGM B;  1X9V A;  1RF0 C;  2BEQ D;  2W27 A;  5H2F H;  2HOD A;  1VQP P;  1LTG C;  3EFF K;  1X0T A;  2IYP A;  3V2N A;  2KLU A;  2WTY A;  2A45 G;  4DZO A;  5APV A;  1HUC A;  1FZG A;  4IL6 X;  2KS1 A;  5AW5 B;  2OYI B;  1NJI Q;  1SQV G;  4ZMD A;  3H25 A;  3HRN A;  2W6A A;  3CWB D;  1FOS E;  1LT9 A;  5GTH E;  1SQX K;  2BCC E;  1SQQ E;  1N7S A;  2IPP A;  3W67 A;  4WY4 B;  3CXH E;  4WVZ A;  2V7Q H;  3PHL A;  3CC7 P;  2R32 A;  1M8O B;  2AXC A;  1DD4 A;  2Q5U A;  3U1A A;  3FWN A;  3BCC J;  3O6Q B;  2ITA A;  3Q1M A;  1EZV G;  1LTJ A;  1SQP G;  2QJK B;  4HJG H;  2J59 M;  1PIX A;  3KPE A;  2YKP A;  4EI2 A;  1KYO I;  4OH8 B;  1JNM A;  3G9R A;  3RK3 B;  1FS0 E;  1RF0 A;  1NTK G;  3AE2 C;  1DH3 A;  2W6B A;  2FBW C;  5CCH A;  3EFG A;  3L70 G;  1Q7Y Q;  2FYU J;  3GHG A;  2K9Y A;  1NWQ A;  4AQR D;  1RE3 A;  4I7Z C;  1HGZ A;  1R8E A;  1GZL A;  5TIS H;  5KAI H;  3S4R A;  2GA1 A;  1JUN A;  3CX5 D;  5DJU B;  4K35 A;  1GMJ A;  1RQU A;  1S72 P;  4H0L C;  4RJT A;  1MFT A;  2FXP A;  1G2C B;  3L36 A;  1DIP A;  4PV1 B;  3BCC E;  3MIW A;  4JBZ A;  1IFI A;  1QVG O;  3PJS K;  5AW8 B;  2O1J A;  1ZLL A;  5L8R J;  2B9B A;  2AEF A;  3HUS C;  1YIT P;  3M9Q A;  5B66 H;  2P2U A;  4Y99 C;  3SWF A;  5APS A;  1L0N D;  2H8P D;  2FYU E;  2OGU A;  2V4H A;  3EQ2 A;  3H1H G;  3H1J J;  4BXL A;  1M1J A;  3RL0 g;  3GMA A;  2OYO A;  1VF5 C;  2BAS A;  4Y28 J;  1JEK A;  1HJ0 A;  1NU1 D;  3AEB C;  1ZME C;  1OVV A;  3AE6 C;  1JB0 J;  1NTZ D;  3GG2 A;  4LLH A;  4W7Y A;  3PTZ A;  4OGQ C;  2WT7 B;  3B71 A;  2C0W A;  2HPC A;  3H1K J;  4M3L A;  1FZC B;  2PGD A;  4OVN F;  4UB6 E;  2WPR A;  1VQ6 P;  5CHX A;  2YIU C;  1KV4 A;  1QX8 A;  5KAF H;  4DOJ A;  5AW3 B;  1MUU A;  1IC2 A;  1QGK B;  3B5N A;  4R4M A;  1N73 B;  1KYO E;  1VQ9 P;  3H1J E;  3Q5R A;  4ASV A;  3CCM P;  2Y0D A;  1YJ9 P;  1S2E A;  5C39 A;  2R3S A;  2OYI C;  3C8V A;  1NVO A;  3L73 J;  2I1K A;  2KS1 B;  2BCC D;  1LT1 A;  2W8Z A;  3H1I G;  3H6P A;  4TT3 H;  3CC4 P;  3P8C E;  1LT9 B;  1U7J A;  1ZV8 A;  2JP3 A;  3CXH D;  2V7Q J;  3H1K E;  1R5L A;  2YO2 A;  1N7S B;  5KLV E;  2B87 A;  2YNY A;  4WY4 C;  1JMM A;  3HD7 D;  3BVH A;  2WWW A;  5H2F E;  3CC2 P;  2R5B A;  5AVW B;  2N1T A;  3CX5 I;  5CJ0 A;  3Q5P A;  3CCE P;  2M8R A;  2WMM A;  2IZ0 A;  2QJK C;  5GTH H;  4AUW A;  1L0N K;  1LTJ B;  1R5S A;  1DD3 A;  4L74 A;  2RMZ A;  3RK3 C;  2J58 A;  4HH2 A;  2Y9Z A;  3R2P A;  1NTZ K;  1YQ4 C;  1OW6 A;  3E1I A;  5BU8 B;  3L73 E;  1VQK P;  1BSH A;  1IJD B;  4RKU J;  2QSI A;  2YMY A;  2Z4E A;  2W90 A;  4H13 C;  1L4A A;  1M90 Q;  2I1J A;  1MKM A;  1GU5 A;  3R4Y A;  3BCC D;  3WUT A;  1KFM A;  3JCU E;  1L0L J;  1GL2 C;  1VQ5 P;  4PV1 C;  2KZI A;  2E74 D;  4IOI H;  3SWY A;  1VQ7 P;  4U3F J;  3A0B E;  3L70 J;  1IFJ A;  4DJG A;  1KMI Z;  2C0X A;  3JC2 2;  2FYU D;  4IL6 H;  2MKV A;  5KAI E;  5TIS E;  2XZR A;  1PGO A;  1FDO A;  1RHZ B;  1M1J B;  1DEE G;  1BGY J;  1PGQ A;  4AYC A;  2UWJ E;  1EZV E;  3U59 A;  1MV8 A;  1ZXG A;  5B5E H;  4JYB A;  3AED C;  5KLI B;  3L71 J;  5APY A;  1VDF A;  1JTH A;  1Y9B A;  2A06 E;  1L0L E;  3WMM 0;  4I7Z B;  1NTK E;  1T3J A;  1FJP A;  2YKO A;  2H89 C;  3O8Z A;  1OXZ A;  2WSC H;  3AE3 C;  1A02 F;  1S5L X;  3TSI A;  3L70 E;  1FZC C;  2HPC B;  4IFD K;  5B66 E;  4L73 A;  3CXH I;  3M06 A;  2VRS A;  1GTW A;  4H0L B;  2K3R A;  3CPW O;  1KYO D;  1SQX G;  2C9N Y;  2QIW A;  3H1J D;  2G3A A;  3D70 A;  4XA4 A;  3NXS A;  3B5N B;  3RBX A;  3SFE C;  3V2Q A;  2O01 H;  1PPJ G;  1BGY E;  2IDB A;  1BCC G;  3HTK B;  5CCG A;  4Y99 B;  1EXI A;  1BE3 J;  4JYC A;  2IBZ G;  1N7S D;  3RK2 B;  1KQG B;  2FFD A;  2ZXX A;  2CPB A;  3L71 E;  1YJN P;  2HLO A;  1IFM A;  2R5D A;  1WMK A;  3H1K D;  1LT9 C;  3L75 G;  2P7J A;  2XV5 A;  1N7S C;  2QE7 H;  5KAF E;  1KC8 Q;  3H32 A;  5KJ7 A;  3MP7 B;  3GF7 A;  2B87 B;  1LP1 A;  4W80 A;  3FWL A;  1SQQ J;  3A3Y B;  4C7R A;  2N1T B;  3AEC C;  1BDC A;  3TGU G;  2GM4 A;  2SPZ A;  1LTJ C;  3A7O A;  1HVV A;  3AEG C;  2W6J H;  2OYH A;  3V4W A;  1JY2 O;  3P32 A;  3L73 D;  2Y0E A;  2MJZ A;  1BE3 E;  3NFQ A;  3AE4 C;  1QEX A;  1QVF O;  5AVZ B;  1Q86 Q;  1H89 A;  2WSE H;  5CCH C;  1FU1 A;  2HYN A;  4GDO A;  3GHG C;  1H0T B;  5AW4 B;  1OFC X;  1JY2 P;  1BDD A;  3L74 J;  1RE3 C;  1L4A B;  2KIK A;  1PV3 A;  5AVT B;  1KIL A;  1RF1 A;  3G6E P;  3KZI H;  1ZW0 A;  1SS1 A;  2Z5H A;  1YHQ P;  1VQ4 P;  3CWB G;  2AEJ A;  2JR8 A;  4BRY B;  3CCV P;  3TDK A;  1KB9 E;  1CI6 A;  2QG4 A;  1P84 H;  5AVS B;  1Q82 Q;  4C7N B;  5AVV B;  2ZAE B;  2M0B A;  5AW2 B;  1URQ A;  1NKN A;  3JCU H;  2A45 H;  4OWF A;  3RK3 E;  4UB8 H;  1FZE A;  1JCD A;  1J2J B;  1PP9 J;  4ZNC A;  1M1J C;  3A0B H;  3CD6 P;  4YPC A;  3MD0 A;  3L74 E;  5E79 E;  4LGD E;  1S9K E;  4RO0 A;  2A06 D;  2L5G B;  1FC2 C;  1L0L D;  2KSJ A;  4W7Z A;  5KLI C;  2WSC J;  2Z5I A;  3AEE C;  4H13 B;  1DEB A;  1OIP A;  2D2C B;  3AE1 C;  4U3F D;  1JTH B;  3L70 D;  4H0L D;  1EC5 A;  2OTK E;  1FJK A;  1IZN B;  2PRR A;  3C1L A;  3V4Q A;  2M3E A;  3FGA D;  1GL2 B;  4IL6 E;  3BRT B;  4JF7 A;  2IFN A;  2ZT9 C;  1IK7 A;  2O01 J;  3CCL P;  1T6A A;  1HTL C;  1NTM J;  4KJM A;  1EDI A;  3B5N C;  1BGY D;  1CSB A;  2P67 A;  2ZXE B;  5B5E E;  1PP9 E;  3KYQ A;  4GKG A;  1VF5 D;  2KLV A;  2Y0C A;  2XU6 A;  1W2E A;  3H1L J;  2B89 A;  3L71 D;  3Q3D A;  1T3U A;  4LC1 A;  5APT A;  1ZR2 A;  1K9M Q;  1LJ2 A;  3RK2 C;  4GIF A;  4HYT B;  1L0N G;  1SQB J;  3EWK A;  2FFD B;  2ZVN B;  4OGQ D;  4N6J A;  5CJ4 A;  1OMI A;  1K73 Q;  1NKZ B;  4BWN A;  1GK4 A;  1HH0 A;  2N1T D;  1NTZ G;  4L75 A;  3II6 A;  2GUS A;  1RE4 A;  4EOT A;  1USE A;  4HB1 A;  3RBZ A;  1LTS C;  2IYO A;  1D7M A;  4YXW H;  1E79 H;  5AW9 B;  1KN7 A;  1KQL A;  2N1T C;  3VMY A;  3IF4 A;  5KLV J;  1NTM E;  3C9I A;  2WZ7 A;  1XTC C;  2B88 A;  1LTA C;  4WWI A;  1BE3 D;  1J1D C;  1GW3 A;  2LXC B;  4ZKP A;  3ZDM A;  1RQV A;  2E75 C;  2WSE J;  2OYH B;  3H1L E;  5K5G B;  3AEA C;  2I8D A;  2XND H;  1L0L K;  2HOD B;  3MZW B;  4PD4 H;  3I55 P;  1SQB E;  3WU2 H;  1J1E B;  4DT0 A;  2QEX P;  5KKZ C;  4HKZ H;  1OZH A;  3TYY A;  1FZA A;  1KIL E;  1L4A C;  3GF3 A;  1EZV I;  1SQQ D;  3L72 J;  4WY4 D;  1QLE D; 
#chains in the Genus database with same CATH homology
 3PH0 A;  2P58 A;  2LR2 A;  2B89 A;  4NPF X;  5CBO A;  1OVU A;  2JWD A;  2WMM A;  2RKL A;  1H0T A;  2ZAE B;  1DEE G;  1Q2N A;  2M0B A;  1JMB A;  2B87 B;  2R44 A;  1EDK A;  4GOF A;  1LP1 A;  2UWJ E;  5EFW B;  2KI7 B;  4K3A A;  3RGU A;  1EDL A;  1ZXG A;  1JM0 A;  2Q1K A;  4CPG A;  1OVR A;  1BDC A;  4ZNC A;  1X0T A;  2SPZ A;  3MHV A;  2KZJ A;  2QVA A;  3S1K A;  5DJU B;  4K35 A;  2KUB A;  4HB1 A;  1FC2 C;  4GOD A;  1U7M A;  2QRX A;  1MFT A;  4ZMD A;  3QWO C;  2HR3 A;  2K3R A;  5DJT B;  2M5A A;  3FXD A;  4ASV A;  2B88 A;  4JBZ A;  4WWI A;  1EC5 A;  2LXC B;  5C39 A;  2LXB A;  1H0T B;  2OTK E;  3ZDM A;  1LP1 B;  1NVO A;  1BDD A;  4EYY Q;  5K5G B;  2KS1 B;  4GOE A;  2I8D A;  3FXE A;  2KIK A;  4NPD A;  1LT1 A;  2KZI A;  4IOI H;  2M5A B;  1S3J A;  1ZW0 A;  3MZW B;  1U7J A;  1SS1 A;  4HKZ H;  5CBN A;  4ASW A;  4BXL A;  4KJM A;  1EDI A;  4MN4 C;  2B87 A;  1Y47 A;  4NPE A;  1OVV A;  1EDJ A;  4HJG H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...