4GOFA

Crystal structure of the sgta homodimerization domain with covalent modifications to both c38
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
52
Chain Sequence
MKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGVTVEDSDLAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small glutamine-rich tetratricopeptide repeat-containing pro
publication title Structures of the Sgt2/SGTA Dimerization Domain with the Get5/UBL4A UBL Domain Reveal an Interaction that Forms a Conserved Dynamic Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 18
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4gofA00
4ZNCA 1H0TA 2KS1B 3RGUA 2OTKE 4GOFA 5CBNA 4EYYQ 3ZDMA 4GODA 2B88A 4NPDA 4ASVA 1EDJA 1LT1A 2B89A 2QRXA 4GOEA 1OVRA 5DJUB 1Q2NA 1ZXGA 2LXCB 2B87A 4ASWA 2RKLA 5C39A 2LXBA 2KI7B 2I8DA 1JM0A 4NPEA 1NVOA 1DEEG 4IOIH 4CPGA 2P58A 3MHVA 2UWJE 1U7JA 2B87B 1BDDA 4K35A 2M5AA 1FC2C 2Q1KA 1OVVA 1X0TA 2ZAEB 5EFWB 2K3RA 1Y47A 1SS1A 5DJTB 2LR2A 3FXDA 4MN4C 1BDCA 2M5AB 1EDLA 2JWDA 3PH0A 4BXLA 3S1KA 4KJMA 4HJGH 2M0BA 1LP1A 1EDIA 2SPZA 4NPFX 3QWOC 1MFTA 4HKZH 1JMBA 2QVAA 2WMMA 1EC5A 1S3JA 4K3AA 5CBOA 2KZJA 1ZW0A 2KUBA 4ZMDA 4HB1A 2KZIA 2R44A 1U7MA 2HR3A 5K5GB 1LP1B 1H0TB 2KIKA 3MZWB 3FXEA 1OVUA 4WWIA 1EDKA 4JBZA
chains in the Genus database with same CATH superfamily
1J1DC 1HUCA 2OTKE 2JKVA 3U1CA 3KXDA 2Q7CA 3PTZA 1SQVD 2XKMA 1SQPK 1JY2N 1EZVE 1Q7YQ 2B88A 1JY2O 1W2BO 1BGYJ 1NTZE 3AE2C 3L37A 5DJUB 2FYNB 3MUDA 2LXCB 4EIJA 1WMKA 2XZRA 1VF5C 3AEAC 3AE8C 4QMAA 1KQLA 3FX0A 1ZRTD 2Z5IA 2OTJP 3HE4A 4B86A 1MFZA 3Q1MA 1Y8AA 1SP4A 4RO0A 5KLVE 1VQ9P 3H1KE 1BDDA 3G9RA 1GL2B 3VP8A 1K05A 2Q3EA 2P67A 3RL0C 4MN4C 1GW4A 2IYOA 1KILE 1L0LK 3OJAB 1L4AA 1CI6B 4IFDK 2FXOA 3M0DA 3CCQP 3PH0A 2QIWA 1KILC 1SQPJ 1IC2A 1HGVA 1ZV8A 2JWAA 3OA7A 2GA1A 2HYNA 3B5ND 2MKVA 2FBWC 3HD7C 1M57D 2FKWB 4AUWA 3CWBG 1ZW0A 5AVQB 3AE9C 1J1DB 2IDBA 1S5LH 1W2EA 1URQB 4WWIA 5CMZA 2C9NY 3AE1C 3VP9A 3IN6A 5AW2B 1SQPD 5AVWB 1J1EC 2A06D 5CBNA 1NGMB 2E76D 1NH4A 3GF3A 2O1KA 1GU5A 1PPJG 2B89A 4W80A 5H2FH 1L0LJ 3L70E 1GL2A 1GZLA 3RK2D 2KI7B 2AEJA 1NTMD 1EZVG 1R5LA 1NTKG 3JCUE 1FDIA 3KHUA 2Q1KA 2QM7A 1CI6A 2R3SA 5EFWB 3H1LJ 3L35A 2YMYA 2ZVNB 3V5BA 1HF9A 3H1KG 1BCCE 3A7OA 2ZXXA 3D71A 1OZHA 1NAFA 1L0NK 1OFCX 1NJIQ 1NKNA 1URQA 1PFIA 1MFTA 2KK7A 1JMBA 2H88C 1FZCB 5KLIB 4K3AA 2A45G 2K9YA 2KP8A 4HB1A 2KZIA 3U1AA 1NU1D 2KSJA 2QJPB 1M8OB 5KTBA 2AEMA 4YXWH 1LTBC 1LT9B 3TYYA 3NMDA 2JEEA 4D6TJ 2H8PD 3AEBC 3V2PA 3TSIA 4WY4B 1BE3E 3C9IA 3L73J 3Q2YA 4N3YB 1CSBA 3U59A 1GW3A 3CCRP 5GTHH 4H44C 2KXPB 3SSUA 4DT0A 1L0NJ 4AQRD 2QA4P 1U7JA 1KILA 5AVUB 1DD4A 2BCCG 2XU6A 3L70G 2QEXP 1Q86Q 4D6TD 2ZYAA 1FDOA 3Q3DA 5KLVK 3TNUB 3L73D 3MP7B 2FY8A 1SQVE 1S5LE 2YO3A 1SQBG 3MGNA 3V4WA 2ZT9D 5CCHD 1ZRTE 1JCDA 2WSFJ 4KHXA 4N78D 5CHXA 1BCCG 2YKOA 3BCCE 4A7PA 4GDOA 4HKZH 1K73Q 1LWUB 1LGHB 3CLQA 5H2FE 3L71E 2JJLA 2W83C 3WMM0 2O01H 2N1TD 3Q5RA 4WY4A 4DJGA 2OYHC 5AW0B 5KLVJ 4U3FE 1FBMA 2QRXA 3BRVB 1NYHA 2OGUA 3VMZA 3D70A 1JY3O 1IFDA 1PGPA 2CK3H 5APQA 2YIUC 3CL3D 4NPEA 4IOIH 4W7ZA 2ZFCA 3WU2H 2AXTH 3TNUA 3L74D 3CX5D 1T2KD 4IFFA 1RF1C 1FZFA 2YO2A 1BE3G 4H0LB 3TGUJ 2A45I 4RKUJ 1SQXD 2ZYDA 1OVVA 3CC7P 3H6PA 3PHLA 5AVTB 3G6EP 3AEGC 1HGZA 4UB8E 4I1LA 3L4FA 3FGAD 5APXA 3P32A 3W68A 2FYUK 1LWUA 1GK4A 1VQ8P 2G8YA 2R5BA 3KPEA 5CJ4A 4HJGH 1SQVG 1MV8A 3C8VA 3MUDC 5APTA 3HRNA 2NPSD 1RQUA 3OAKA 2QJKC 4OGQD 3B71A 4GKGA 1G2CA 2KUBA 3LW5H 2O01N 3L75D 3GHGB 1RF0A 2YXQB 5GTHE 1H89A 2OYHB 2MJZA 3BCCG 1KMIZ 1S2EA 2POHA 3OW2O 1OXZA 1M1JB 5TISH 1H0TA 4EOTA 2Q5UA 1IO4A 4GOFA 1QL2A 2OTLP 4LC1A 2ITAA 2K1AA 4ASVA 1SFCD 1KB9D 3HUSB 3M0DC 3B5NB 1A02J 1RF1B 2I8DA 3L72D 2ZYGA 2N9BA 2FYUJ 3RBXA 3CCSP 3G71P 4JPZB 2A45H 4U3FG 1BSHA 4DOJA 3MHVA 2UWJE 1OW8A 1OW7A 1PGOA 1JNMA 4N6JA 1YTZT 5AVVB 1FC2C 3Q5PA 4JYCA 1LTIC 2Q9IA 3B8EB 5TJHA 2E76B 1FOSE 1FS0E 1JOCA 3CD6P 1YQ3C 2FYUD 2FYNC 3PJSK 3RK2B 2E43A 1OIPA 3P8CE 1ZP0C 2R32A 2C0XA 3H1JJ 3G4SP 1Q90D 2I1JA 2OYHA 2OQQA 4WVZA 1HH0A 2WTYA 1K04A 4EI2A 1M1JA 2WMMA 1S3JA 1RHZB 1IFPA 5K5GB 1LP1B 1NTMG 4RESB 3CWBE 2AXTE 3HUSA 1MUUA 2KS1B 3H1JD 3B5NA 1YYCA 2IZ1A 1RF1A 3KZIH 3IAOA 3M9HA 1GD2E 1AVOA 1FAVA 2XV5A 2Z5HA 4N78E 5AW1B 2W90A 2CPSA 1YJNP 1A02F 3RK3D 3SFEC 1JMMA 5AVZB 1FU1A 2D2CD 1URQC 2JO1A 1S9KD 1ZMEC 1NTKE 2WQYC 1N7SC 4PD4D 4R4LA 1AVYA 2JDIH 1NU1G 3KDPB 4C7RA 2WSEJ 3L71J 2QJYB 2P2UA 5TISE 5CCGA 1IK7A 1KYOD 3CXHD 1BGYD 1LP1A 4NPFX 4XE5B 1BSNA 2HODB 3G3ZA 1OWAA 3AE7C 1ZR2A 3O6QB 2KS1A 1YHQP 1SQXE 1TU3F 2V7QH 1HTLC 1HJBA 2OYOA 2WPRA 4HYTB 5E79H 3GW6A 1T6AA 5KJ7C 4L74A 1PP9E 2ZVOB 1VPCA 4GODA 4PV1B 4NPDA 3L73G 1CW5A 1LT1A 3AEDC 1LTJC 5AVXB 1FZCC 5KLIC 4ASWA 5AW8B 2M3EA 1RE3A 4BWNA 3H1IJ 1N7SB 2QJPC 3L75E 3H1HE 1VQ4P 1AQ5A 1NWQA 2P58A 3CPWO 2N1TB 4K35A 3TF5A 1ZN5A 5APSA 1JO5A 1LT9C 1YI2P 2BCCE 4AYCA 4H13C 2FFDB 1SQQE 3VMYA 4WY4C 1K8AQ 4PJ0H 1AFOA 5KAFH 2HODA 2BEQD 3W67A 5AW9B 1SQBE 3VMXA 1GMJA 2H89C 1OW6A 2H7HA 3IR9A 3O6QA 4LGDE 3L72E 3KZIE 1EDIA 1GK6A 2WPVB 1L0LD 2PGDA 3PRJA 2QVAA 3T97B 3R4YA 3II6A 1USEA 5CCHA 2WZ7A 3V6IA 3L74G 3VOPA 1LTGC 3VYIA 3S4RA 1FZBA 3FWLA 4BRYB 4W7YA 2KOGA 1JY2P 2PRRA 3H1LD 2GUVA 2OYIB 1SQXG 1LTJB 1L4AD 2E75C 2HLOA 1N7SA 4UB8H 1LWUC 2N1TA 5APVA 3IFMA 1PP9G 1SLQA 2O01J 1M7LA 4H13B 2Y0EA 2B87B 1KTMA 3NFQA 2E74D 1PL5A 3PLNA 1RF0C 1USDA 1IFJA 5DJTB 3L75G 3H1HG 1NTZK 1W5CE 2M5AB 5B5EE 2E42A 3K5BA 1ZLLA 5E79E 3T97A 2K9JB 3CCJP 5AW6B 3RK3E 1UIIA 1SQQG 1GL2D 5KJ7A 4H0LC 1Z56A 3QWOC 3AE4C 4BRYA 2YKPA 4IL6X 2KZJA 1N73B 1L0ND 2R44A 3L72G 2W6AA 1LTJA 3M0AA 1FZCA 3I55P 1OVUA 5BU8B 4JBZA 3A0BH 3PP5A 3NXSA 2GUSA 2E75B 1FJPA 3N4XA 1WRGA 1Y9BA 4M3LA 3H32B 4WB4A 4EYYQ 1GTWA 4Y99C 1LT9A 1NTZJ 2WSCJ 4PJ0E 2B87A 4I7ZB 2RKLA 5KAFE 1FE6A 2BEZF 3GHGC 2J58A 1VQLP 4Y28J 3SWYA 5KKZB 1YJWP 1J2JB 3H1KJ 1M1JC 2DW3A 3M91A 1EZVD 5AW3B 2M5AA 4YTPC 1VF5D 3V2NA 1NTZD 1JY3N 2K3RA 1OMIA 3CX5I 4Z1MH 5APUA 2K9JA 1SS1A 2K37A 3HUSC 1S72P 4OH8B 3B5NC 1KN7A 4TLFA 1N8RQ 2HPCB 5KLVD 3RK3B 1QVFO 1N73A 1EXJA 2GM4A 1SQPE 1M90Q 3RL0D 2A06E 1VQMP 5AW7B 2BASA 4UB6H 2E76C 1KILD 4ZMDA 1M1KQ 3D6ZA 4XA4A 3H32A 3TK1A 4WBAA 2P7JA 3A2AA 3TGUD 3SWKA 3FXEA 1K9MQ 1NTME 4Y99B 3HD7D 3RK2C 1P84D 2WSFH 1FZAA 3E1IA 5BU5A 3CCEP 3A0HE 2QSIA 1ZXGA 1L0LE 3MTUE 2BCCJ 3L70J 5CCGC 1KQFB 1IK9A 1IZNB 3CI9A 3CCLP 1KB9I 1BGYG 2NZ2A 3B4SA 4EDFA 3CX5H 2FYZA 1VL2A 3CCUP 1QLED 1KV4A 1T3JA 3WUVA 2HPCA 3H1LE 1VQNP 4WY4D 3L70D 4DCKA 2J5UA 1GU4A 1X9VA 1BCCJ 3A0BE 3LIDA 3H25A 1NU1E 2W6JH 3D6YA 3WUUA 1MKMA 2IPPA 4I6MC 2IYPA 1YBKA 2C0WA 2SPZA 1VQKP 1HBWA 3VMAA 1RE3C 2W8ZA 1HWTC 1P84H 5AW4B 1BCCD 1SQVK 1SQPG 1X22A 4GIFA 4C7NB 2A06G 3GHGA 2QJYC 3MD0A 1XTCC 1JY3P 4D6TE 3EQ2A 4ZKUA 3EFFK 2YKQA 2IBZI 1BE3J 4L76A 3L73E 1E5WA 1KB9H 3M9QA 2L5GB 2V7QJ 1JM0A 2IBZD 1DIPA 3E7KA 2KLUA 1JB0J 3I56P 3R2PA 5CJ0A 1QVGO 1L0LG 1G1JA 4I2LC 4O9BA 3BASA 4YPCA 1R8EA 3M06A 2ZT9C 1BE3D 5CCHC 1Y47A 4PV1C 4OWFA 4UB6E 4H44D 1AV1A 1NHLA 1SQVJ 4ZKPA 1DD3A 2QG4A 3I5CA 2PP6A 1EQ7A 4PD4I 1EDLA 3BRTB 3O8ZA 2OARA 2JP3A 2WVRA 3H1LG 3MIWA 3LIEA 1D7MA 2M0BA 3Q5SA 2N1TC 4C7NA 3TDKA 3BCCJ 2E74B 2P10A 1AA0A 1EC5A 2RN0A 1T3UA 1KYOI 2FFDC 3IF4A 3CXHI 1FDMA 2WITA 3AEEC 1JEKA 1AQTA 4GT1A 5BVZA 4U7JA 2Q3IA 3L74E 3CX5E 4HH2A 1G1IA 2M8RA 1PGQA 3BCCD 1NTMK 1KD1Q 4U3FJ 1T2KC 2G3AA 3L71D 1LTSC 1CZQA 2VRSA 2B9BA 1RH5B 5B5EH 1NO4A 2R5DA 3JC22 4D6TG 2KB7P 4CPGA 3JSVC 2ZT9B 3TGUE 1Q81Q 3N7NA 4U3FD 2OYIC 2P1JA 1XTGB 2Y0DA 1DEBA 1P84E 1UIXA 4PD4H 1L0NG 2W6BA 2NPSC 1HJ0A 1KC8Q 2HG5D 4OGQC 4KJMA 1NTMJ 2XDJA 2AEFA 3AEFC 1NU1K 1KYOH 3V4QA 3CXHH 2E5TA 5KAIE 1H8AA 5AVSB 2IZ0A 1KQGB 2YNYA 1LNQA 3H1ID 1KB9E 2WSSH 1VF5B 4L73A 5M1BA 3CMAP 5B66H 3CMEP 4JF7A 1SFCC 2V4HA 1EDKA 2WSEH 2Y9YA 4TT3H 3C1LA 1N7LA 5APWA 2KSEA 1NTZG 3GF7A 2WT7B 2XNXA 4IL6H 3RL0B 3EFGA 1SVFA 3GMAA 4GOEA 1ZOYC 5CCGD 1Q82Q 1E79H 1WT6A 2WWWA 3EWKA 1N73C 4OVNF 2FYUE 5KLVG 3ITKA 1DEEG 1KILB 4IFMA 1PV3A 1NU1J 2CPBA 3P7KA 1LJ2A 2XNDH 3SFDC 4R4MA 2NPSB 3HD7B 1FZEA 5AW5B 3SWFA 1L2PA 1YITP 1JTHB 1KZUB 1S4XA 1QEXA 4OGQB 5L8RJ 2Q6QA 3S9OA 1BDCA 3TGUG 2FFDA 1S5LX 2Z4EA 4I7ZC 5GTIH 2N9YB 1H88A 2R3CA 1KFNA 1QX8A 1J1EB 5KKZC 2IBZE 3H1JE 2IFNA 1NTKK 3A0HH 3A5TA 1OX3A 1SFCB 4RJTA 1RY3A 3GG2A 2KIKA 3CWBJ 3MZWB 1VQPP 2WT7A 3P8CD 1PIXA 1KORA 1YTZI 3RK3C 1S9KE 1IJDB 2FXMA 4DZOA 3HE5B 1FJKA 1FZGA 1VQ6P 2D2CC 2OYIA 1EDJA 4PD4E 1GDTA 3CC2P 2YMKA 3CC4P 2C9LY 3CWBD 2PAJA 1SQXK 2NPSA 4C46A 3HD7A 2ZXEB 3KYQA 1ZR4A 1JTHA 1NKZB 2O1JA 1NTKJ 1KYOE 3CXHE 1BGYE 3NTNA 4PV1D 2FYUG 4KT0J 1RE4C 1PPJD 3V2QA 3BVHA 3LW5J 3HTKB 5B66E 1URQD 1FOSF 1MZ9A 4JYBA 1EZVI 1YIJP 2Y0CA 3VN0A 2JWDA 2W27A 1N7SD 5AVRB 1SFCA 4BXLA 2K88A 3S1KA 1NTKD 2RH0A 1IFNA 2QE7H 1LTTC 3L74J 1G2CB 1KFMA 1HVVA 4IL6E 2KYVA 4JQ0D 2L91A 1N86A 1JCCA 1SQXJ 1SQQK 1R5SA 2IBZG 3H1JG 1H0TB 4H44B 3HE5A 3H1KD 3RBZA 1SQBK 4ZNCA 2D2CB 1PZQA 3RGUA 2H43A 3KQGA 1PP9J 3ZDMA 1VQ7P 3USSA 1NOHA 3RL0g 1QL1A 1OVRA 1Q2NA 1P84I 1M56D 5C39A 5KJ7D 3AE3C 5GTIE 3H1IE 1NVOA 3L36A 3M9BA 3L75J 3H1HJ 3HTKA 2AXCA 1PP9D 1LTAC 2PFXA 1X0TA 3VTPC 1QGKB 2WPQA 3E1RA 1SQQJ 2WSCH 2KNCB 1N2DC 1DX7A 2M3BA 1SQBJ 1VDFA 2WPSA 2ZJSE 3H1HD 1IFIA 4XFJA 4H13D 3L72J 2E5YA 1YJ9P 2BCCD 3L71G 4L75A 1SQQD 3P8MC 2YIUB 5APYA 2YXRB 5AVYB 3QH9A 1L4AC 2IX7C 3V2RA 1SQBD 2RMZA 3FWNA 2KLVA 3ABVC 1S1CX 3UIAA 3AE5C 3CCVP 1PGJA 3GLMA 3F5HA 2E74C 2JR8A 1RE4A 3F89A 2HFED 1IFMA 2LXBA 1X79B 3WUTA 2Y9ZA 1JUNA 2NRGA 2E75D 1EXIA 1T8ZA 1U57A 1VQ5P 3AECC 2KNCA 2LKMA 1VQOP 3A3YB 1NAYA 2QJKB 5KAIH 2ZAEB 3HE4B 1AJYA 3H1IG 2LR2A 3AE6C 1GL2C 2J59M 3FXDA 1DH3A 1L0NE 2IFMA 1KQSO 2O3JA 2FXPA 4LLHA 3WU2E 3JCUH 1RQVA 1YQ4C 1L4AB 2I1KA 3BATA 1X8YA 5CBOA 1U7MA 2HR3A 3CCMP 4YXDC 1PPJE 2QM8A 4H0LD
chains in the Genus database with same CATH topology
4ZNCA 1H0TA 2KS1B 3RGUA 2OTKE 4GOFA 5CBNA 4EYYQ 3ZDMA 4GODA 2B88A 4NPDA 4ASVA 1EDJA 1LT1A 2B89A 2QRXA 4GOEA 1OVRA 5DJUB 1Q2NA 1ZXGA 2LXCB 2B87A 4ASWA 2RKLA 5C39A 2LXBA 2KI7B 2I8DA 1JM0A 4NPEA 1NVOA 1DEEG 4IOIH 4CPGA 2P58A 3MHVA 2UWJE 1U7JA 2B87B 1BDDA 4K35A 2M5AA 1FC2C 2Q1KA 1OVVA 1X0TA 2ZAEB 5EFWB 2K3RA 1Y47A 1SS1A 5DJTB 2LR2A 3FXDA 4MN4C 1BDCA 2M5AB 1EDLA 2JWDA 3PH0A 4BXLA 3S1KA 4KJMA 4HJGH 2M0BA 1LP1A 1EDIA 2SPZA 4NPFX 3QWOC 1MFTA 4HKZH 1JMBA 2QVAA 2WMMA 1EC5A 1S3JA 4K3AA 5CBOA 2KZJA 1ZW0A 2KUBA 4ZMDA 4HB1A 2KZIA 2R44A 1U7MA 2HR3A 5K5GB 1LP1B 1H0TB 2KIKA 3MZWB 3FXEA 1OVUA 4WWIA 1EDKA 4JBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZNC A;  1H0T A;  2KS1 B;  3RGU A;  2OTK E;  4GOF A;  5CBN A;  4EYY Q;  3ZDM A;  4GOD A;  2B88 A;  4NPD A;  4ASV A;  1EDJ A;  1LT1 A;  2B89 A;  2QRX A;  4GOE A;  1OVR A;  5DJU B;  1Q2N A;  1ZXG A;  2LXC B;  2B87 A;  4ASW A;  2RKL A;  5C39 A;  2LXB A;  2KI7 B;  2I8D A;  1JM0 A;  4NPE A;  1NVO A;  1DEE G;  4IOI H;  4CPG A;  2P58 A;  3MHV A;  2UWJ E;  1U7J A;  2B87 B;  1BDD A;  4K35 A;  2M5A A;  1FC2 C;  2Q1K A;  1OVV A;  1X0T A;  2ZAE B;  5EFW B;  2K3R A;  1Y47 A;  1SS1 A;  5DJT B;  2LR2 A;  3FXD A;  4MN4 C;  1BDC A;  2M5A B;  1EDL A;  2JWD A;  3PH0 A;  4BXL A;  3S1K A;  4KJM A;  4HJG H;  2M0B A;  1LP1 A;  1EDI A;  2SPZ A;  4NPF X;  3QWO C;  1MFT A;  4HKZ H;  1JMB A;  2QVA A;  2WMM A;  1EC5 A;  1S3J A;  4K3A A;  5CBO A;  2KZJ A;  1ZW0 A;  2KUB A;  4ZMD A;  4HB1 A;  2KZI A;  2R44 A;  1U7M A;  2HR3 A;  5K5G B;  1LP1 B;  1H0T B;  2KIK A;  3MZW B;  3FXE A;  1OVU A;  4WWI A;  1EDK A;  4JBZ A; 
#chains in the Genus database with same CATH topology
 1J1D C;  1HUC A;  2OTK E;  2JKV A;  3U1C A;  3KXD A;  2Q7C A;  3PTZ A;  1SQV D;  2XKM A;  1SQP K;  1JY2 N;  1EZV E;  1Q7Y Q;  2B88 A;  1JY2 O;  1W2B O;  1BGY J;  1NTZ E;  3AE2 C;  3L37 A;  5DJU B;  2FYN B;  3MUD A;  2LXC B;  4EIJ A;  1WMK A;  2XZR A;  1VF5 C;  3AEA C;  3AE8 C;  4QMA A;  1KQL A;  3FX0 A;  1ZRT D;  2Z5I A;  2OTJ P;  3HE4 A;  4B86 A;  1MFZ A;  3Q1M A;  1Y8A A;  1SP4 A;  4RO0 A;  5KLV E;  1VQ9 P;  3H1K E;  1BDD A;  3G9R A;  1GL2 B;  3VP8 A;  1K05 A;  2Q3E A;  2P67 A;  3RL0 C;  4MN4 C;  1GW4 A;  2IYO A;  1KIL E;  1L0L K;  3OJA B;  1L4A A;  1CI6 B;  4IFD K;  2FXO A;  3M0D A;  3CCQ P;  3PH0 A;  2QIW A;  1KIL C;  1SQP J;  1IC2 A;  1HGV A;  1ZV8 A;  2JWA A;  3OA7 A;  2GA1 A;  2HYN A;  3B5N D;  2MKV A;  2FBW C;  3HD7 C;  1M57 D;  2FKW B;  4AUW A;  3CWB G;  1ZW0 A;  5AVQ B;  3AE9 C;  1J1D B;  2IDB A;  1S5L H;  1W2E A;  1URQ B;  4WWI A;  5CMZ A;  2C9N Y;  3AE1 C;  3VP9 A;  3IN6 A;  5AW2 B;  1SQP D;  5AVW B;  1J1E C;  2A06 D;  5CBN A;  1NGM B;  2E76 D;  1NH4 A;  3GF3 A;  2O1K A;  1GU5 A;  1PPJ G;  2B89 A;  4W80 A;  5H2F H;  1L0L J;  3L70 E;  1GL2 A;  1GZL A;  3RK2 D;  2KI7 B;  2AEJ A;  1NTM D;  1EZV G;  1R5L A;  1NTK G;  3JCU E;  1FDI A;  3KHU A;  2Q1K A;  2QM7 A;  1CI6 A;  2R3S A;  5EFW B;  3H1L J;  3L35 A;  2YMY A;  2ZVN B;  3V5B A;  1HF9 A;  3H1K G;  1BCC E;  3A7O A;  2ZXX A;  3D71 A;  1OZH A;  1NAF A;  1L0N K;  1OFC X;  1NJI Q;  1NKN A;  1URQ A;  1PFI A;  1MFT A;  2KK7 A;  1JMB A;  2H88 C;  1FZC B;  5KLI B;  4K3A A;  2A45 G;  2K9Y A;  2KP8 A;  4HB1 A;  2KZI A;  3U1A A;  1NU1 D;  2KSJ A;  2QJP B;  1M8O B;  5KTB A;  2AEM A;  4YXW H;  1LTB C;  1LT9 B;  3TYY A;  3NMD A;  2JEE A;  4D6T J;  2H8P D;  3AEB C;  3V2P A;  3TSI A;  4WY4 B;  1BE3 E;  3C9I A;  3L73 J;  3Q2Y A;  4N3Y B;  1CSB A;  3U59 A;  1GW3 A;  3CCR P;  5GTH H;  4H44 C;  2KXP B;  3SSU A;  4DT0 A;  1L0N J;  4AQR D;  2QA4 P;  1U7J A;  1KIL A;  5AVU B;  1DD4 A;  2BCC G;  2XU6 A;  3L70 G;  2QEX P;  1Q86 Q;  4D6T D;  2ZYA A;  1FDO A;  3Q3D A;  5KLV K;  3TNU B;  3L73 D;  3MP7 B;  2FY8 A;  1SQV E;  1S5L E;  2YO3 A;  1SQB G;  3MGN A;  3V4W A;  2ZT9 D;  5CCH D;  1ZRT E;  1JCD A;  2WSF J;  4KHX A;  4N78 D;  5CHX A;  1BCC G;  2YKO A;  3BCC E;  4A7P A;  4GDO A;  4HKZ H;  1K73 Q;  1LWU B;  1LGH B;  3CLQ A;  5H2F E;  3L71 E;  2JJL A;  2W83 C;  3WMM 0;  2O01 H;  2N1T D;  3Q5R A;  4WY4 A;  4DJG A;  2OYH C;  5AW0 B;  5KLV J;  4U3F E;  1FBM A;  2QRX A;  3BRV B;  1NYH A;  2OGU A;  3VMZ A;  3D70 A;  1JY3 O;  1IFD A;  1PGP A;  2CK3 H;  5APQ A;  2YIU C;  3CL3 D;  4NPE A;  4IOI H;  4W7Z A;  2ZFC A;  3WU2 H;  2AXT H;  3TNU A;  3L74 D;  3CX5 D;  1T2K D;  4IFF A;  1RF1 C;  1FZF A;  2YO2 A;  1BE3 G;  4H0L B;  3TGU J;  2A45 I;  4RKU J;  1SQX D;  2ZYD A;  1OVV A;  3CC7 P;  3H6P A;  3PHL A;  5AVT B;  3G6E P;  3AEG C;  1HGZ A;  4UB8 E;  4I1L A;  3L4F A;  3FGA D;  5APX A;  3P32 A;  3W68 A;  2FYU K;  1LWU A;  1GK4 A;  1VQ8 P;  2G8Y A;  2R5B A;  3KPE A;  5CJ4 A;  4HJG H;  1SQV G;  1MV8 A;  3C8V A;  3MUD C;  5APT A;  3HRN A;  2NPS D;  1RQU A;  3OAK A;  2QJK C;  4OGQ D;  3B71 A;  4GKG A;  1G2C A;  2KUB A;  3LW5 H;  2O01 N;  3L75 D;  3GHG B;  1RF0 A;  2YXQ B;  5GTH E;  1H89 A;  2OYH B;  2MJZ A;  3BCC G;  1KMI Z;  1S2E A;  2POH A;  3OW2 O;  1OXZ A;  1M1J B;  5TIS H;  1H0T A;  4EOT A;  2Q5U A;  1IO4 A;  4GOF A;  1QL2 A;  2OTL P;  4LC1 A;  2ITA A;  2K1A A;  4ASV A;  1SFC D;  1KB9 D;  3HUS B;  3M0D C;  3B5N B;  1A02 J;  1RF1 B;  2I8D A;  3L72 D;  2ZYG A;  2N9B A;  2FYU J;  3RBX A;  3CCS P;  3G71 P;  4JPZ B;  2A45 H;  4U3F G;  1BSH A;  4DOJ A;  3MHV A;  2UWJ E;  1OW8 A;  1OW7 A;  1PGO A;  1JNM A;  4N6J A;  1YTZ T;  5AVV B;  1FC2 C;  3Q5P A;  4JYC A;  1LTI C;  2Q9I A;  3B8E B;  5TJH A;  2E76 B;  1FOS E;  1FS0 E;  1JOC A;  3CD6 P;  1YQ3 C;  2FYU D;  2FYN C;  3PJS K;  3RK2 B;  2E43 A;  1OIP A;  3P8C E;  1ZP0 C;  2R32 A;  2C0X A;  3H1J J;  3G4S P;  1Q90 D;  2I1J A;  2OYH A;  2OQQ A;  4WVZ A;  1HH0 A;  2WTY A;  1K04 A;  4EI2 A;  1M1J A;  2WMM A;  1S3J A;  1RHZ B;  1IFP A;  5K5G B;  1LP1 B;  1NTM G;  4RES B;  3CWB E;  2AXT E;  3HUS A;  1MUU A;  2KS1 B;  3H1J D;  3B5N A;  1YYC A;  2IZ1 A;  1RF1 A;  3KZI H;  3IAO A;  3M9H A;  1GD2 E;  1AVO A;  1FAV A;  2XV5 A;  2Z5H A;  4N78 E;  5AW1 B;  2W90 A;  2CPS A;  1YJN P;  1A02 F;  3RK3 D;  3SFE C;  1JMM A;  5AVZ B;  1FU1 A;  2D2C D;  1URQ C;  2JO1 A;  1S9K D;  1ZME C;  1NTK E;  2WQY C;  1N7S C;  4PD4 D;  4R4L A;  1AVY A;  2JDI H;  1NU1 G;  3KDP B;  4C7R A;  2WSE J;  3L71 J;  2QJY B;  2P2U A;  5TIS E;  5CCG A;  1IK7 A;  1KYO D;  3CXH D;  1BGY D;  1LP1 A;  4NPF X;  4XE5 B;  1BSN A;  2HOD B;  3G3Z A;  1OWA A;  3AE7 C;  1ZR2 A;  3O6Q B;  2KS1 A;  1YHQ P;  1SQX E;  1TU3 F;  2V7Q H;  1HTL C;  1HJB A;  2OYO A;  2WPR A;  4HYT B;  5E79 H;  3GW6 A;  1T6A A;  5KJ7 C;  4L74 A;  1PP9 E;  2ZVO B;  1VPC A;  4GOD A;  4PV1 B;  4NPD A;  3L73 G;  1CW5 A;  1LT1 A;  3AED C;  1LTJ C;  5AVX B;  1FZC C;  5KLI C;  4ASW A;  5AW8 B;  2M3E A;  1RE3 A;  4BWN A;  3H1I J;  1N7S B;  2QJP C;  3L75 E;  3H1H E;  1VQ4 P;  1AQ5 A;  1NWQ A;  2P58 A;  3CPW O;  2N1T B;  4K35 A;  3TF5 A;  1ZN5 A;  5APS A;  1JO5 A;  1LT9 C;  1YI2 P;  2BCC E;  4AYC A;  4H13 C;  2FFD B;  1SQQ E;  3VMY A;  4WY4 C;  1K8A Q;  4PJ0 H;  1AFO A;  5KAF H;  2HOD A;  2BEQ D;  3W67 A;  5AW9 B;  1SQB E;  3VMX A;  1GMJ A;  2H89 C;  1OW6 A;  2H7H A;  3IR9 A;  3O6Q A;  4LGD E;  3L72 E;  3KZI E;  1EDI A;  1GK6 A;  2WPV B;  1L0L D;  2PGD A;  3PRJ A;  2QVA A;  3T97 B;  3R4Y A;  3II6 A;  1USE A;  5CCH A;  2WZ7 A;  3V6I A;  3L74 G;  3VOP A;  1LTG C;  3VYI A;  3S4R A;  1FZB A;  3FWL A;  4BRY B;  4W7Y A;  2KOG A;  1JY2 P;  2PRR A;  3H1L D;  2GUV A;  2OYI B;  1SQX G;  1LTJ B;  1L4A D;  2E75 C;  2HLO A;  1N7S A;  4UB8 H;  1LWU C;  2N1T A;  5APV A;  3IFM A;  1PP9 G;  1SLQ A;  2O01 J;  1M7L A;  4H13 B;  2Y0E A;  2B87 B;  1KTM A;  3NFQ A;  2E74 D;  1PL5 A;  3PLN A;  1RF0 C;  1USD A;  1IFJ A;  5DJT B;  3L75 G;  3H1H G;  1NTZ K;  1W5C E;  2M5A B;  5B5E E;  2E42 A;  3K5B A;  1ZLL A;  5E79 E;  3T97 A;  2K9J B;  3CCJ P;  5AW6 B;  3RK3 E;  1UII A;  1SQQ G;  1GL2 D;  5KJ7 A;  4H0L C;  1Z56 A;  3QWO C;  3AE4 C;  4BRY A;  2YKP A;  4IL6 X;  2KZJ A;  1N73 B;  1L0N D;  2R44 A;  3L72 G;  2W6A A;  1LTJ A;  3M0A A;  1FZC A;  3I55 P;  1OVU A;  5BU8 B;  4JBZ A;  3A0B H;  3PP5 A;  3NXS A;  2GUS A;  2E75 B;  1FJP A;  3N4X A;  1WRG A;  1Y9B A;  4M3L A;  3H32 B;  4WB4 A;  4EYY Q;  1GTW A;  4Y99 C;  1LT9 A;  1NTZ J;  2WSC J;  4PJ0 E;  2B87 A;  4I7Z B;  2RKL A;  5KAF E;  1FE6 A;  2BEZ F;  3GHG C;  2J58 A;  1VQL P;  4Y28 J;  3SWY A;  5KKZ B;  1YJW P;  1J2J B;  3H1K J;  1M1J C;  2DW3 A;  3M91 A;  1EZV D;  5AW3 B;  2M5A A;  4YTP C;  1VF5 D;  3V2N A;  1NTZ D;  1JY3 N;  2K3R A;  1OMI A;  3CX5 I;  4Z1M H;  5APU A;  2K9J A;  1SS1 A;  2K37 A;  3HUS C;  1S72 P;  4OH8 B;  3B5N C;  1KN7 A;  4TLF A;  1N8R Q;  2HPC B;  5KLV D;  3RK3 B;  1QVF O;  1N73 A;  1EXJ A;  2GM4 A;  1SQP E;  1M90 Q;  3RL0 D;  2A06 E;  1VQM P;  5AW7 B;  2BAS A;  4UB6 H;  2E76 C;  1KIL D;  4ZMD A;  1M1K Q;  3D6Z A;  4XA4 A;  3H32 A;  3TK1 A;  4WBA A;  2P7J A;  3A2A A;  3TGU D;  3SWK A;  3FXE A;  1K9M Q;  1NTM E;  4Y99 B;  3HD7 D;  3RK2 C;  1P84 D;  2WSF H;  1FZA A;  3E1I A;  5BU5 A;  3CCE P;  3A0H E;  2QSI A;  1ZXG A;  1L0L E;  3MTU E;  2BCC J;  3L70 J;  5CCG C;  1KQF B;  1IK9 A;  1IZN B;  3CI9 A;  3CCL P;  1KB9 I;  1BGY G;  2NZ2 A;  3B4S A;  4EDF A;  3CX5 H;  2FYZ A;  1VL2 A;  3CCU P;  1QLE D;  1KV4 A;  1T3J A;  3WUV A;  2HPC A;  3H1L E;  1VQN P;  4WY4 D;  3L70 D;  4DCK A;  2J5U A;  1GU4 A;  1X9V A;  1BCC J;  3A0B E;  3LID A;  3H25 A;  1NU1 E;  2W6J H;  3D6Y A;  3WUU A;  1MKM A;  2IPP A;  4I6M C;  2IYP A;  1YBK A;  2C0W A;  2SPZ A;  1VQK P;  1HBW A;  3VMA A;  1RE3 C;  2W8Z A;  1HWT C;  1P84 H;  5AW4 B;  1BCC D;  1SQV K;  1SQP G;  1X22 A;  4GIF A;  4C7N B;  2A06 G;  3GHG A;  2QJY C;  3MD0 A;  1XTC C;  1JY3 P;  4D6T E;  3EQ2 A;  4ZKU A;  3EFF K;  2YKQ A;  2IBZ I;  1BE3 J;  4L76 A;  3L73 E;  1E5W A;  1KB9 H;  3M9Q A;  2L5G B;  2V7Q J;  1JM0 A;  2IBZ D;  1DIP A;  3E7K A;  2KLU A;  1JB0 J;  3I56 P;  3R2P A;  5CJ0 A;  1QVG O;  1L0L G;  1G1J A;  4I2L C;  4O9B A;  3BAS A;  4YPC A;  1R8E A;  3M06 A;  2ZT9 C;  1BE3 D;  5CCH C;  1Y47 A;  4PV1 C;  4OWF A;  4UB6 E;  4H44 D;  1AV1 A;  1NHL A;  1SQV J;  4ZKP A;  1DD3 A;  2QG4 A;  3I5C A;  2PP6 A;  1EQ7 A;  4PD4 I;  1EDL A;  3BRT B;  3O8Z A;  2OAR A;  2JP3 A;  2WVR A;  3H1L G;  3MIW A;  3LIE A;  1D7M A;  2M0B A;  3Q5S A;  2N1T C;  4C7N A;  3TDK A;  3BCC J;  2E74 B;  2P10 A;  1AA0 A;  1EC5 A;  2RN0 A;  1T3U A;  1KYO I;  2FFD C;  3IF4 A;  3CXH I;  1FDM A;  2WIT A;  3AEE C;  1JEK A;  1AQT A;  4GT1 A;  5BVZ A;  4U7J A;  2Q3I A;  3L74 E;  3CX5 E;  4HH2 A;  1G1I A;  2M8R A;  1PGQ A;  3BCC D;  1NTM K;  1KD1 Q;  4U3F J;  1T2K C;  2G3A A;  3L71 D;  1LTS C;  1CZQ A;  2VRS A;  2B9B A;  1RH5 B;  5B5E H;  1NO4 A;  2R5D A;  3JC2 2;  4D6T G;  2KB7 P;  4CPG A;  3JSV C;  2ZT9 B;  3TGU E;  1Q81 Q;  3N7N A;  4U3F D;  2OYI C;  2P1J A;  1XTG B;  2Y0D A;  1DEB A;  1P84 E;  1UIX A;  4PD4 H;  1L0N G;  2W6B A;  2NPS C;  1HJ0 A;  1KC8 Q;  2HG5 D;  4OGQ C;  4KJM A;  1NTM J;  2XDJ A;  2AEF A;  3AEF C;  1NU1 K;  1KYO H;  3V4Q A;  3CXH H;  2E5T A;  5KAI E;  1H8A A;  5AVS B;  2IZ0 A;  1KQG B;  2YNY A;  1LNQ A;  3H1I D;  1KB9 E;  2WSS H;  1VF5 B;  4L73 A;  5M1B A;  3CMA P;  5B66 H;  3CME P;  4JF7 A;  1SFC C;  2V4H A;  1EDK A;  2WSE H;  2Y9Y A;  4TT3 H;  3C1L A;  1N7L A;  5APW A;  2KSE A;  1NTZ G;  3GF7 A;  2WT7 B;  2XNX A;  4IL6 H;  3RL0 B;  3EFG A;  1SVF A;  3GMA A;  4GOE A;  1ZOY C;  5CCG D;  1Q82 Q;  1E79 H;  1WT6 A;  2WWW A;  3EWK A;  1N73 C;  4OVN F;  2FYU E;  5KLV G;  3ITK A;  1DEE G;  1KIL B;  4IFM A;  1PV3 A;  1NU1 J;  2CPB A;  3P7K A;  1LJ2 A;  2XND H;  3SFD C;  4R4M A;  2NPS B;  3HD7 B;  1FZE A;  5AW5 B;  3SWF A;  1L2P A;  1YIT P;  1JTH B;  1KZU B;  1S4X A;  1QEX A;  4OGQ B;  5L8R J;  2Q6Q A;  3S9O A;  1BDC A;  3TGU G;  2FFD A;  1S5L X;  2Z4E A;  4I7Z C;  5GTI H;  2N9Y B;  1H88 A;  2R3C A;  1KFN A;  1QX8 A;  1J1E B;  5KKZ C;  2IBZ E;  3H1J E;  2IFN A;  1NTK K;  3A0H H;  3A5T A;  1OX3 A;  1SFC B;  4RJT A;  1RY3 A;  3GG2 A;  2KIK A;  3CWB J;  3MZW B;  1VQP P;  2WT7 A;  3P8C D;  1PIX A;  1KOR A;  1YTZ I;  3RK3 C;  1S9K E;  1IJD B;  2FXM A;  4DZO A;  3HE5 B;  1FJK A;  1FZG A;  1VQ6 P;  2D2C C;  2OYI A;  1EDJ A;  4PD4 E;  1GDT A;  3CC2 P;  2YMK A;  3CC4 P;  2C9L Y;  3CWB D;  2PAJ A;  1SQX K;  2NPS A;  4C46 A;  3HD7 A;  2ZXE B;  3KYQ A;  1ZR4 A;  1JTH A;  1NKZ B;  2O1J A;  1NTK J;  1KYO E;  3CXH E;  1BGY E;  3NTN A;  4PV1 D;  2FYU G;  4KT0 J;  1RE4 C;  1PPJ D;  3V2Q A;  3BVH A;  3LW5 J;  3HTK B;  5B66 E;  1URQ D;  1FOS F;  1MZ9 A;  4JYB A;  1EZV I;  1YIJ P;  2Y0C A;  3VN0 A;  2JWD A;  2W27 A;  1N7S D;  5AVR B;  1SFC A;  4BXL A;  2K88 A;  3S1K A;  1NTK D;  2RH0 A;  1IFN A;  2QE7 H;  1LTT C;  3L74 J;  1G2C B;  1KFM A;  1HVV A;  4IL6 E;  2KYV A;  4JQ0 D;  2L91 A;  1N86 A;  1JCC A;  1SQX J;  1SQQ K;  1R5S A;  2IBZ G;  3H1J G;  1H0T B;  4H44 B;  3HE5 A;  3H1K D;  3RBZ A;  1SQB K;  4ZNC A;  2D2C B;  1PZQ A;  3RGU A;  2H43 A;  3KQG A;  1PP9 J;  3ZDM A;  1VQ7 P;  3USS A;  1NOH A;  3RL0 g;  1QL1 A;  1OVR A;  1Q2N A;  1P84 I;  1M56 D;  5C39 A;  5KJ7 D;  3AE3 C;  5GTI E;  3H1I E;  1NVO A;  3L36 A;  3M9B A;  3L75 J;  3H1H J;  3HTK A;  2AXC A;  1PP9 D;  1LTA C;  2PFX A;  1X0T A;  3VTP C;  1QGK B;  2WPQ A;  3E1R A;  1SQQ J;  2WSC H;  2KNC B;  1N2D C;  1DX7 A;  2M3B A;  1SQB J;  1VDF A;  2WPS A;  2ZJS E;  3H1H D;  1IFI A;  4XFJ A;  4H13 D;  3L72 J;  2E5Y A;  1YJ9 P;  2BCC D;  3L71 G;  4L75 A;  1SQQ D;  3P8M C;  2YIU B;  5APY A;  2YXR B;  5AVY B;  3QH9 A;  1L4A C;  2IX7 C;  3V2R A;  1SQB D;  2RMZ A;  3FWN A;  2KLV A;  3ABV C;  1S1C X;  3UIA A;  3AE5 C;  3CCV P;  1PGJ A;  3GLM A;  3F5H A;  2E74 C;  2JR8 A;  1RE4 A;  3F89 A;  2HFE D;  1IFM A;  2LXB A;  1X79 B;  3WUT A;  2Y9Z A;  1JUN A;  2NRG A;  2E75 D;  1EXI A;  1T8Z A;  1U57 A;  1VQ5 P;  3AEC C;  2KNC A;  2LKM A;  1VQO P;  3A3Y B;  1NAY A;  2QJK B;  5KAI H;  2ZAE B;  3HE4 B;  1AJY A;  3H1I G;  2LR2 A;  3AE6 C;  1GL2 C;  2J59 M;  3FXD A;  1DH3 A;  1L0N E;  2IFM A;  1KQS O;  2O3J A;  2FXP A;  4LLH A;  3WU2 E;  3JCU H;  1RQV A;  1YQ4 C;  1L4A B;  2I1K A;  3BAT A;  1X8Y A;  5CBO A;  1U7M A;  2HR3 A;  3CCM P;  4YXD C;  1PPJ E;  2QM8 A;  4H0L D; 
#chains in the Genus database with same CATH homology
 4ZNC A;  1H0T A;  2KS1 B;  3RGU A;  2OTK E;  4GOF A;  5CBN A;  4EYY Q;  3ZDM A;  4GOD A;  2B88 A;  4NPD A;  4ASV A;  1EDJ A;  1LT1 A;  2B89 A;  2QRX A;  4GOE A;  1OVR A;  5DJU B;  1Q2N A;  1ZXG A;  2LXC B;  2B87 A;  4ASW A;  2RKL A;  5C39 A;  2LXB A;  2KI7 B;  2I8D A;  1JM0 A;  4NPE A;  1NVO A;  1DEE G;  4IOI H;  4CPG A;  2P58 A;  3MHV A;  2UWJ E;  1U7J A;  2B87 B;  1BDD A;  4K35 A;  2M5A A;  1FC2 C;  2Q1K A;  1OVV A;  1X0T A;  2ZAE B;  5EFW B;  2K3R A;  1Y47 A;  1SS1 A;  5DJT B;  2LR2 A;  3FXD A;  4MN4 C;  1BDC A;  2M5A B;  1EDL A;  2JWD A;  3PH0 A;  4BXL A;  3S1K A;  4KJM A;  4HJG H;  2M0B A;  1LP1 A;  1EDI A;  2SPZ A;  4NPF X;  3QWO C;  1MFT A;  4HKZ H;  1JMB A;  2QVA A;  2WMM A;  1EC5 A;  1S3J A;  4K3A A;  5CBO A;  2KZJ A;  1ZW0 A;  2KUB A;  4ZMD A;  4HB1 A;  2KZI A;  2R44 A;  1U7M A;  2HR3 A;  5K5G B;  1LP1 B;  1H0T B;  2KIK A;  3MZW B;  3FXE A;  1OVU A;  4WWI A;  1EDK A;  4JBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...