3WUTA

Structure basis of inactivating cell abscission
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
53
structure length
53
Chain Sequence
SFNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Centrosomal protein of 55 kDa
publication title Structural and biochemical insights into the role of testis-expressed gene 14 (TEX14) in forming the stable intercellular bridges of germ cells
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 24
structure length 53
sequence length 53
chains with identical sequence B, D, E, G, H, J, K
ec nomenclature
pdb deposition date 2014-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12180 EABR TSG101 and ALIX binding domain of CEP55
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 3wutA00
4BRYA 1UIIA 3E1RA 3WUVA 2WVRA 3WUUA 2ZXXA 3WUTA 4BRYB 3F5HA 2Q6QA
chains in the Genus database with same CATH superfamily
1P84H 1LJ2A 3N7NA 1X8YA 2GM4A 4KT0J 1OFCX 5DJTB 2FBWC 3L71G 5KLIC 4LC1A 4U7JA 1JMBA 3RBXA 3JC22 1UIIA 1P84I 2MJZA 1PP9D 3MZWB 4R4MA 3C8VA 1T3JA 3CWBE 3E1IA 2WMMA 3T97B 3VP8A 3H1HG 3A0BE 5KLIB 1U7JA 3KXDA 1H88A 2OQQA 1NKZB 1VQMP 3H1KD 5B5EH 2XU6A 1N7LA 1N8RQ 3H1LJ 4H44D 2E42A 4HYTB 3L72G 2FYUK 1OX3A 3TGUD 2K1AA 1BGYD 2WT7A 3EFFK 3WU2E 1NTZE 2Y0CA 1FOSF 3FGAD 1NTMK 1YITP 3CLQA 1NO4A 2Y9ZA 4L74A 2YKQA 5BVZA 3M0AA 1R8EA 2E5TA 4LGDE 2R32A 3FX0A 1BCCD 4EOTA 1S1CX 2IFMA 4GKGA 1VQLP 2JKVA 1K04A 5TJHA 1J2JB 2WTYA 2HYNA 2O3JA 3L71E 3GMAA 1XTCC 1X9VA 3L4FA 3SSUA 1L0NG 1FZAA 5B66E 3Q1MA 3USSA 1VQ8P 1SQPJ 2HLOA 4NPEA 2Q3IA 2BASA 1Q81Q 3U1AA 3A0BH 1CI6A 3L75D 1S3JA 1FJKA 1OMIA 5APYA 3WUVA 3BATA 1L0LJ 3P32A 3H1HE 3H32A 2WSSH 2V7QH 5APQA 5KAIE 1D7MA 3SWYA 3V2RA 2GUSA 3WU2H 1FDIA 2YXQB 2AEJA 5AVVB 4GT1A 3ITKA 3TF5A 3EWKA 2WT7B 1RQUA 5CCHA 1LNQA 4W7ZA 2CK3H 2OYHC 1SQXD 3JSVC 1DH3A 2H8PD 1HJBA 3P8MC 1ZR4A 5CCHD 1FZEA 2E76C 1FDOA 2O1KA 3TSIA 3IF4A 4K35A 4OWFA 3D71A 2W6BA 4IFMA 1NTZK 1MUUA 1JY2N 3MP7B 1IFDA 1L4AA 2Q7CA 2BCCJ 2OYHB 1L0NE 1USEA 1P84D 1L4AD 2IPPA 1VQ4P 3CCUP 2NZ2A 2KLUA 4U3FD 1VDFA 2E76B 5GTHH 4UB6E 1M90Q 2FYZA 5CCHC 3PH0A 2FYUD 3L70G 3OAKA 2H88C 5CHXA 1DEEG 1AQTA 3H32B 1S9KD 3HRNA 1KYOE 4OGQD 2KS1A 3M0DA 1MV8A 3H1ID 2J58A 1NU1E 4A7PA 3E7KA 3WUTA 1NTMD 3A0HH 1GU5A 1YJNP 1T8ZA 1LTBC 4KJMA 1JNMA 3SFEC 1X79B 4GIFA 1PGQA 2M0BA 3G3ZA 2IZ1A 1RF0C 1M1JA 2Q5UA 2WITA 1L4AC 2YO3A 2RKLA 4C7NB 1Y9BA 3V4WA 3KPEA 2I8DA 2KSJA 1H0TB 1QL1A 3KYQA 2D2CC 5AVZB 3PHLA 3M9QA 4WVZA 1X22A 2WSCH 4JF7A 1PP9J 3M0DC 2E5YA 1L4AB 3GLMA 1PPJE 2N1TC 3D6ZA 4UB6H 5AVTB 4Y28J 1QLED 4D6TG 2AXCA 1QGKB 2OTKE 2B87B 2ZYAA 2D2CB 4IL6X 3Q3DA 1KYOH 2KP8A 1K05A 1WT6A 3AE4C 3CWBD 1RF1A 4WWIA 3H1KJ 3MUDC 3C1LA 1RE4A 1L0NK 1JY3N 2QJPC 3TGUJ 5E79E 2FXMA 2N1TB 1BGYJ 1KYOI 3L75E 5KLVE 5KAFE 2KZJA 1G2CA 1Q7YQ 3CC2P 5BU5A 3O8ZA 1DEBA 3L37A 3MTUE 1YJ9P 1N73C 1NTZD 1LTGC 3AE9C 2B88A 2LXCB 1BCCJ 1R5LA 1NU1K 2PP6A 2QJPB 2AEMA 4XFJA 1BE3G 5KJ7A 2QJKC 3JCUE 3M9HA 1GK4A 2LXBA 3VMZA 2E75D 2H7HA 5KJ7D 4XA4A 2QG4A 2E43A 2O01N 3H1JE 3SWFA 3AEGC 4WY4C 3L71D 4BRYB 1N73B 3IFMA 3L75J 3B5NC 1KB9E 2P2UA 2IBZG 3CCLP 3BCCE 1M1KQ 3R2PA 4ZKUA 2QJKB 5E79H 3VMXA 2Q1KA 5AVXB 3H1HD 3ABVC 1FZCA 4ZNCA 5KAFH 2O01J 1ZMEC 4WY4B 2E75C 3V6IA 3CI9A 4I7ZC 1SFCC 1AFOA 3B5NB 1SQXJ 3RK2D 4C7RA 1HF9A 2XZRA 1KFMA 1LT9C 4R4LA 3H1IE 2P7JA 3HE5A 1N2DC 2XNXA 4PV1D 2O01H 2IZ0A 1OZHA 3AE6C 2C9LY 3JCUH 1BDCA 1PZQA 2E75B 4DOJA 4I7ZB 1SFCB 5KLVK 3D70A 1SQBG 1BE3E 1KTMA 3AEFC 1K73Q 1KB9H 1LT9B 2QVAA 1OVVA 3P8CE 3CX5E 1EDKA 3RK2C 4U3FJ 1FZCC 4W80A 3AEEC 3VP9A 2XKMA 2FYUJ 2A45G 1L0ND 1GZLA 1K9MQ 3NMDA 3L73E 4PV1C 2PFXA 1KB9I 4QMAA 1SQXK 1AA0A 3H1IJ 4GOEA 1OW7A 1NTMJ 3A2AA 2QM7A 1FC2C 2KIKA 3HUSC 4AYCA 1SQQE 3CCMP 5CCGC 3RK2B 1FZCB 3II6A 1KYOD 1LTJC 4I2LC 1ZRTE 1NU1D 3CC4P 4UB8H 5AW7B 3FXEA 4PV1B 4IFDK 2L5GB 3C9IA 2C0WA 2Z4EA 3HE5B 1G1JA 1LTAC 1LWUC 1VF5C 1SQVE 3AE3C 2IFNA 1NTKE 3GW6A 3HUSB 5AVWB 3GF3A 2KI7B 3W67A 1LTJB 3NFQA 3CX5H 3U59A 2BCCG 3RL0C 3TK1A 1SQBE 1BSNA 1IFPA 4JYBA 3B4SA 2FFDA 1M57D 1LWUB 1VF5B 1KQLA 3CX5I 1PPJD 1GK6A 4HKZH 3CCEP 1MFTA 3CWBJ 1GL2C 2JR8A 2MKVA 3RL0B 2OYHA 3L70D 2AXTE 2V7QJ 2M3BA 3V2QA 3CPWO 3VYIA 1GL2B 1SS1A 1NTZJ 1AJYA 5KLVD 2E76D 5CMZA 2KXPB 3AEBC 3VTPC 1JY2P 2FFDC 1YHQP 1QX8A 3SWKA 1SQQK 4Z1MH 5APWA 3MIWA 2B9BA 1YI2P 2P58A 3L72E 4RESB 3L71J 2ZVNB 4EYYQ 1KQGB 3EQ2A 1VL2A 4C7NA 3NXSA 1PIXA 2LKMA 2WPSA 1Y47A 5AW1B 2A45H 2FFDB 1SQVK 3PTZA 1IZNB 1H0TA 1NTKK 1KMIZ 4NPDA 3H1JD 2Q6QA 2A06G 2RMZA 5BU8B 1VPCA 1DD3A 1KB9D 2ZYGA 5B66H 2P67A 1KC8Q 1KQFB 3H1HJ 2A45I 2WPVB 1RF0A 3BCCD 2AXTH 1S2EA 3M9BA 1L2PA 3U1CA 3GHGC 1BSHA 2B87A 1FU1A 3O6QB 4N78E 1T6AA 1T2KD 3GG2A 2OGUA 5CJ0A 1HBWA 1NYHA 2W8ZA 1DIPA 1BCCG 2D2CD 5KAIH 1W2EA 1OXZA 2N1TA 1GD2E 1NAYA 1JTHB 5GTIE 2M8RA 3GHGB 4ZKPA 1KILE 2R5DA 2WSFH 2KYVA 2E74D 2N1TD 4MN4C 3HE4B 4AUWA 3BRVB 5APVA 4C46A 4IOIH 1BE3D 1VQ7P 1L0NJ 3L74G 4L73A 1T2KC 1YYCA 2WSCJ 1JY3P 3MUDA 2SPZA 5L8RJ 3P8CD 3CX5D 4PJ0E 1NWQA 3AE5C 1WMKA 1ZN5A 3LW5H 2A06E 1Q2NA 3FXDA 2Q3EA 3L73D 5APUA 3AE7C 2AEFA 2ZYDA 1OIPA 3HTKB 2KB7P 3AE2C 2O1JA 1BDDA 2WZ7A 1NU1J 4RJTA 2E74C 2BEZF 4BRYA 1N73A 1A02J 2XNDH 2QE7H 1SQQD 1VQOP 1LT1A 3SFDC 2WSEH 4EI2A 3KHUA 1T3UA 2W6AA 1GW4A 1ZRTD 5AW2B 4YTPC 3A3YB 3OJAB 1E5WA 2M3EA 3L70E 2JEEA 5AVSB 2DW3A 3IAOA 2C0XA 2K3RA 2ZAEB 2BEQD 5M1BA 1YIJP 2YNYA 2E74B 1GMJA 1SQVD 5C39A 4WY4A 5AVQB 1HUCA 1NTKD 3B5NA 5EFWB 1HTLC 5TISE 4WY4D 4U3FG 2KZIA 1NOHA 3B5ND 4PJ0H 1MZ9A 1SQBD 3L74E 1URQC 1Q90D 3KZIE 4HH2A 1N86A 2QSIA 1JO5A 2GA1A 1SFCA 4O9BA 3F89A 1YQ4C 1XTGB 1YJWP 2J5UA 3L70J 2H43A 2YXRB 1LT9A 1SFCD 1KQSO 3OA7A 1RQVA 1RH5B 3KDPB 1URQB 2CPBA 4WB4A 1S5LE 4D6TE 5KLVJ 3CCJP 1A02F 4YXDC 3CXHI 1IFJA 1HGZA 2HR3A 4PD4I 1W5CE 3H1LG 1QL2A 3Q5SA 5AVYB 2I1JA 5TISH 1IFNA 2JWAA 3A7OA 1N7SC 2K9JA 1KZUB 1GTWA 1FOSE 5AW0B 2FXPA 1JEKA 3V4QA 3I5CA 4JBZA 1SP4A 3KZIH 3L72D 3CMAP 2VRSA 3H1JJ 3FWNA 2POHA 5KTBA 4GDOA 5AW5B 4I6MC 3CWBG 3AEDC 1ZR2A 2YKOA 2KOGA 3HUSA 1VQNP 1G1IA 3B71A 1AVYA 5CCGA 1YBKA 1ZLLA 3CCVP 1LTJA 3CCRP 5AW9B 3BCCJ 1OW8A 1PGPA 2NRGA 2YIUC 1IFIA 1N7SB 5CCGD 4BXLA 1MFZA 1PV3A 1OWAA 1SQPG 1KFNA 2JWDA 4N3YB 1S5LH 2H89C 4K3AA 1LWUA 1YTZT 2JJLA 2KNCB 2ZJSE 3F5HA 5B5EE 1MKMA 1VQ5P 1NTZG 2IX7C 1HH0A 3BVHA 2KUBA 1L0LG 1VF5D 2IBZE 2QIWA 3LIEA 1J1DC 2WPRA 3G4SP 2YIUB 4N78D 3HD7C 2QM8A 1EDLA 1QVGO 3TNUA 3H1LE 1QEXA 3RBZA 3V5BA 5CBOA 1OVUA 3RL0D 3H25A 1KILA 2OYIC 2GUVA 1ZOYC 2K9JB 3TYYA 3Q5RA 1BE3J 1GL2A 2UWJE 1KILD 2ZT9C 3PP5A 1J1DB 4L75A 1JM0A 1GL2D 4BWNA 2R3SA 4L76A 3L36A 1EZVG 3HD7B 1GU4A 4AQRD 1Y8AA 3RGUA 3L73J 4ASWA 3G6EP 2ZXXA 2Z5IA 5AVUB 2RH0A 2J59M 2OYIB 2ZXEB 3AE1C 2WPQA 3V2PA 2IYOA 2K88A 2A06D 2M5AB 2ZT9B 1SQQJ 1FJPA 3A5TA 1SQPE 3D6YA 1KILC 1NH4A 2W90A 3CXHD 1CSBA 2FYNC 1ZV8A 1L0LE 4TLFA 1SLQA 1NGMB 4PD4D 2IBZI 5APXA 2ZFCA 1SQVJ 3M91A 4H0LD 1S5LX 1JOCA 1NTKJ 3TNUB 1IJDB 4YPCA 1KILB 3VN0A 5AW3B 4H44C 3O6QA 4DZOA 3RK3E 3PRJA 4IL6E 1SQBJ 1FDMA 4KHXA 2FYNB 3WMM0 3AE8C 3KQGA 1Q86Q 1SVFA 1RY3A 2YKPA 1EC5A 5H2FE 2HFED 1AVOA 2RN0A 1AV1A 1EZVE 1M56D 4JPZB 4W7YA 1HWTC 1JTHA 3CCQP 3L74D 3GHGA 1LTTC 4H0LC 3G9RA 1PP9G 3GF7A 2QRXA 5GTHE 2XV5A 4H44B 5CBNA 3OW2O 1NU1G 1HVVA 3HE4A 2BCCE 2I1KA 1FBMA 5APTA 5AW8B 3IN6A 1CZQA 1LTSC 1U7MA 3A0HE 2PAJA 3H1KG 1JCDA 4OH8B 2HODA 2KLVA 3PLNA 4H0LB 1NJIQ 3LIDA 1NKNA 4D6TD 1IK7A 2R3CA 4Y99C 2Y0EA 3P7KA 3S1KA 1SQBK 3TGUG 3HTKA 1DX7A 1BGYG 1HJ0A 1SQPK 1S4XA 3CCSP 3I55P 1FAVA 4IL6H 4IFFA 1IK9A 4LLHA 3ZDMA 5APSA 2FY8A 3L72J 4HJGH 1RE3A 1KORA 2K37A 1PPJG 4GOFA 5H2FH 1L0LK 2WSFJ 2QJYC 2W6JH 4Y99B 3VMAA 2R44A 2YMKA 2W27A 1CI6B 1USDA 5DJUB 3MD0A 1OW6A 2B89A 1LP1A 1PGOA 1EZVI 2JO1A 1DD4A 2ITAA 1PP9E 2LR2A 1S72P 1FS0E 2P10A 3LW5J 3AEAC 2JDIH 3L75G 2FXOA 3Q5PA 1ZW0A 2OYOA 2OARA 1M7LA 2QJYB 3PJSK 1K8AQ 5KLVG 3MGNA 3WUUA 4EIJA 2C9NY 1EQ7A 2FKWB 2L91A 2PGDA 1RE3C 5CJ4A 3H6PA 1H8AA 1YTZI 2Z5HA 2CPSA 3CC7P 4GODA 2HODB 3H1KE 4H13D 4JQ0D 2WSEJ 2IBZD 4I1LA 4OVNF 3N4XA 3TGUE 2OTLP 1BGYE 1IFMA 4OGQC 1SQXG 3VOPA 2Y9YA 3CXHE 1URQA 3H1LD 1WRGA 1HGVA 1Q82Q 1PFIA 2P1JA 1VQPP 2WQYC 4DJGA 4PD4E 1JUNA 3H1JG 1GW3A 1URQD 1KD1Q 1JY2O 2Q9IA 2KSEA 4M3LA 1EDJA 5GTIH 1BCCE 1FZBA 2IYPA 2JP3A 1KN7A 4H13C 4JYCA 3BCCG 2NPSA 3V2NA 1M1JC 5AW6B 3CL3D 1E79H 4OGQB 2G3AA 1LP1B 1ZXGA 1YQ3C 2NPSD 4RO0A 1JCCA 4XE5B 2KS1B 1J1EC 3Q2YA 2QA4P 4NPFX 2XDJA 2FYUG 3MHVA 2YO2A 2IDBA 1R5SA 2W83C 1SQPD 4H13B 2HPCA 3H1IG 1M1JB 4RKUJ 3EFGA 1EXIA 1FE6A 1NTMG 3AECC 1N7SA 4DCKA 1FZGA 5AVRB 1L0LD 3CXHH 1J1EB 1N7SD 2YMYA 4DT0A 2NPSC 1VQ6P 2R5BA 3IR9A 4PD4H 2KNCA 1RF1C 1SQXE 1JB0J 3FWLA 1VQ9P 1VQKP 3CD6P 3I56P 3BASA 3CMEP 1PGJA 3S4RA 4EDFA 4WBAA 3QWOC 1RE4C 2N9YB 2Y0DA 2PRRA 1W2BO 3RK3D 1M8OB 1QVFO 1UIXA 2KK7A 3L73G 3L74J 3W68A 1IC2A 3BRTB 4YXWH 3QH9A 1EDIA 1EXJA 1LTIC 2NPSB 4N6JA 1JMMA 1OVRA 2N9BA 4ZMDA 1PL5A 1RF1B 1EZVD 2HG5D 1P84E 3NTNA 1SQQG 1U57A 5KKZC 3G71P 3S9OA 2OTJP 4U3FE 1FZFA 1LGHB 1JY3O 3E1RA 1ZP0C 4CPGA 5KJ7C 3VMYA 2FYUE 3HD7A 2BCCD 4B86A 3UIAA 3B8EB 3K5BA 2WWWA 1S9KE 2HPCB 4D6TJ 3T97A 1G2CB 3RK3C 4ASVA 1H89A 3HD7D 2K9YA 3TDKA 2ZVOB 5K5GB 4UB8E 1SQVG 2OYIA 1GDTA 1NTME 1NTKG 1IO4A 2V4HA 5KKZB 1Z56A 2M5AA 4HB1A 2G8YA 1X0TA 1RHZB 1AQ5A 3R4YA 1NHLA 2ZT9D 1NAFA 2WVRA 1KV4A 2QEXP 1NVOA 3RK3B 5AW4B 3L35A 1CW5A 1TU3F 4TT3H 3M06A 3RL0g
chains in the Genus database with same CATH topology
4BRYA 1UIIA 3E1RA 3WUVA 2WVRA 3WUUA 2ZXXA 3WUTA 4BRYB 3F5HA 2Q6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BRY A;  1UII A;  3E1R A;  3WUV A;  2WVR A;  3WUU A;  2ZXX A;  3WUT A;  4BRY B;  3F5H A;  2Q6Q A; 
#chains in the Genus database with same CATH topology
 1P84 H;  1LJ2 A;  3N7N A;  1X8Y A;  2GM4 A;  4KT0 J;  1OFC X;  5DJT B;  2FBW C;  3L71 G;  5KLI C;  4LC1 A;  4U7J A;  1JMB A;  3RBX A;  3JC2 2;  1UII A;  1P84 I;  2MJZ A;  1PP9 D;  3MZW B;  4R4M A;  3C8V A;  1T3J A;  3CWB E;  3E1I A;  2WMM A;  3T97 B;  3VP8 A;  3H1H G;  3A0B E;  5KLI B;  1U7J A;  3KXD A;  1H88 A;  2OQQ A;  1NKZ B;  1VQM P;  3H1K D;  5B5E H;  2XU6 A;  1N7L A;  1N8R Q;  3H1L J;  4H44 D;  2E42 A;  4HYT B;  3L72 G;  2FYU K;  1OX3 A;  3TGU D;  2K1A A;  1BGY D;  2WT7 A;  3EFF K;  3WU2 E;  1NTZ E;  2Y0C A;  1FOS F;  3FGA D;  1NTM K;  1YIT P;  3CLQ A;  1NO4 A;  2Y9Z A;  4L74 A;  2YKQ A;  5BVZ A;  3M0A A;  1R8E A;  2E5T A;  4LGD E;  2R32 A;  3FX0 A;  1BCC D;  4EOT A;  1S1C X;  2IFM A;  4GKG A;  1VQL P;  2JKV A;  1K04 A;  5TJH A;  1J2J B;  2WTY A;  2HYN A;  2O3J A;  3L71 E;  3GMA A;  1XTC C;  1X9V A;  3L4F A;  3SSU A;  1L0N G;  1FZA A;  5B66 E;  3Q1M A;  3USS A;  1VQ8 P;  1SQP J;  2HLO A;  4NPE A;  2Q3I A;  2BAS A;  1Q81 Q;  3U1A A;  3A0B H;  1CI6 A;  3L75 D;  1S3J A;  1FJK A;  1OMI A;  5APY A;  3WUV A;  3BAT A;  1L0L J;  3P32 A;  3H1H E;  3H32 A;  2WSS H;  2V7Q H;  5APQ A;  5KAI E;  1D7M A;  3SWY A;  3V2R A;  2GUS A;  3WU2 H;  1FDI A;  2YXQ B;  2AEJ A;  5AVV B;  4GT1 A;  3ITK A;  3TF5 A;  3EWK A;  2WT7 B;  1RQU A;  5CCH A;  1LNQ A;  4W7Z A;  2CK3 H;  2OYH C;  1SQX D;  3JSV C;  1DH3 A;  2H8P D;  1HJB A;  3P8M C;  1ZR4 A;  5CCH D;  1FZE A;  2E76 C;  1FDO A;  2O1K A;  3TSI A;  3IF4 A;  4K35 A;  4OWF A;  3D71 A;  2W6B A;  4IFM A;  1NTZ K;  1MUU A;  1JY2 N;  3MP7 B;  1IFD A;  1L4A A;  2Q7C A;  2BCC J;  2OYH B;  1L0N E;  1USE A;  1P84 D;  1L4A D;  2IPP A;  1VQ4 P;  3CCU P;  2NZ2 A;  2KLU A;  4U3F D;  1VDF A;  2E76 B;  5GTH H;  4UB6 E;  1M90 Q;  2FYZ A;  5CCH C;  3PH0 A;  2FYU D;  3L70 G;  3OAK A;  2H88 C;  5CHX A;  1DEE G;  1AQT A;  3H32 B;  1S9K D;  3HRN A;  1KYO E;  4OGQ D;  2KS1 A;  3M0D A;  1MV8 A;  3H1I D;  2J58 A;  1NU1 E;  4A7P A;  3E7K A;  3WUT A;  1NTM D;  3A0H H;  1GU5 A;  1YJN P;  1T8Z A;  1LTB C;  4KJM A;  1JNM A;  3SFE C;  1X79 B;  4GIF A;  1PGQ A;  2M0B A;  3G3Z A;  2IZ1 A;  1RF0 C;  1M1J A;  2Q5U A;  2WIT A;  1L4A C;  2YO3 A;  2RKL A;  4C7N B;  1Y9B A;  3V4W A;  3KPE A;  2I8D A;  2KSJ A;  1H0T B;  1QL1 A;  3KYQ A;  2D2C C;  5AVZ B;  3PHL A;  3M9Q A;  4WVZ A;  1X22 A;  2WSC H;  4JF7 A;  1PP9 J;  3M0D C;  2E5Y A;  1L4A B;  3GLM A;  1PPJ E;  2N1T C;  3D6Z A;  4UB6 H;  5AVT B;  4Y28 J;  1QLE D;  4D6T G;  2AXC A;  1QGK B;  2OTK E;  2B87 B;  2ZYA A;  2D2C B;  4IL6 X;  3Q3D A;  1KYO H;  2KP8 A;  1K05 A;  1WT6 A;  3AE4 C;  3CWB D;  1RF1 A;  4WWI A;  3H1K J;  3MUD C;  3C1L A;  1RE4 A;  1L0N K;  1JY3 N;  2QJP C;  3TGU J;  5E79 E;  2FXM A;  2N1T B;  1BGY J;  1KYO I;  3L75 E;  5KLV E;  5KAF E;  2KZJ A;  1G2C A;  1Q7Y Q;  3CC2 P;  5BU5 A;  3O8Z A;  1DEB A;  3L37 A;  3MTU E;  1YJ9 P;  1N73 C;  1NTZ D;  1LTG C;  3AE9 C;  2B88 A;  2LXC B;  1BCC J;  1R5L A;  1NU1 K;  2PP6 A;  2QJP B;  2AEM A;  4XFJ A;  1BE3 G;  5KJ7 A;  2QJK C;  3JCU E;  3M9H A;  1GK4 A;  2LXB A;  3VMZ A;  2E75 D;  2H7H A;  5KJ7 D;  4XA4 A;  2QG4 A;  2E43 A;  2O01 N;  3H1J E;  3SWF A;  3AEG C;  4WY4 C;  3L71 D;  4BRY B;  1N73 B;  3IFM A;  3L75 J;  3B5N C;  1KB9 E;  2P2U A;  2IBZ G;  3CCL P;  3BCC E;  1M1K Q;  3R2P A;  4ZKU A;  2QJK B;  5E79 H;  3VMX A;  2Q1K A;  5AVX B;  3H1H D;  3ABV C;  1FZC A;  4ZNC A;  5KAF H;  2O01 J;  1ZME C;  4WY4 B;  2E75 C;  3V6I A;  3CI9 A;  4I7Z C;  1SFC C;  1AFO A;  3B5N B;  1SQX J;  3RK2 D;  4C7R A;  1HF9 A;  2XZR A;  1KFM A;  1LT9 C;  4R4L A;  3H1I E;  2P7J A;  3HE5 A;  1N2D C;  2XNX A;  4PV1 D;  2O01 H;  2IZ0 A;  1OZH A;  3AE6 C;  2C9L Y;  3JCU H;  1BDC A;  1PZQ A;  2E75 B;  4DOJ A;  4I7Z B;  1SFC B;  5KLV K;  3D70 A;  1SQB G;  1BE3 E;  1KTM A;  3AEF C;  1K73 Q;  1KB9 H;  1LT9 B;  2QVA A;  1OVV A;  3P8C E;  3CX5 E;  1EDK A;  3RK2 C;  4U3F J;  1FZC C;  4W80 A;  3AEE C;  3VP9 A;  2XKM A;  2FYU J;  2A45 G;  1L0N D;  1GZL A;  1K9M Q;  3NMD A;  3L73 E;  4PV1 C;  2PFX A;  1KB9 I;  4QMA A;  1SQX K;  1AA0 A;  3H1I J;  4GOE A;  1OW7 A;  1NTM J;  3A2A A;  2QM7 A;  1FC2 C;  2KIK A;  3HUS C;  4AYC A;  1SQQ E;  3CCM P;  5CCG C;  3RK2 B;  1FZC B;  3II6 A;  1KYO D;  1LTJ C;  4I2L C;  1ZRT E;  1NU1 D;  3CC4 P;  4UB8 H;  5AW7 B;  3FXE A;  4PV1 B;  4IFD K;  2L5G B;  3C9I A;  2C0W A;  2Z4E A;  3HE5 B;  1G1J A;  1LTA C;  1LWU C;  1VF5 C;  1SQV E;  3AE3 C;  2IFN A;  1NTK E;  3GW6 A;  3HUS B;  5AVW B;  3GF3 A;  2KI7 B;  3W67 A;  1LTJ B;  3NFQ A;  3CX5 H;  3U59 A;  2BCC G;  3RL0 C;  3TK1 A;  1SQB E;  1BSN A;  1IFP A;  4JYB A;  3B4S A;  2FFD A;  1M57 D;  1LWU B;  1VF5 B;  1KQL A;  3CX5 I;  1PPJ D;  1GK6 A;  4HKZ H;  3CCE P;  1MFT A;  3CWB J;  1GL2 C;  2JR8 A;  2MKV A;  3RL0 B;  2OYH A;  3L70 D;  2AXT E;  2V7Q J;  2M3B A;  3V2Q A;  3CPW O;  3VYI A;  1GL2 B;  1SS1 A;  1NTZ J;  1AJY A;  5KLV D;  2E76 D;  5CMZ A;  2KXP B;  3AEB C;  3VTP C;  1JY2 P;  2FFD C;  1YHQ P;  1QX8 A;  3SWK A;  1SQQ K;  4Z1M H;  5APW A;  3MIW A;  2B9B A;  1YI2 P;  2P58 A;  3L72 E;  4RES B;  3L71 J;  2ZVN B;  4EYY Q;  1KQG B;  3EQ2 A;  1VL2 A;  4C7N A;  3NXS A;  1PIX A;  2LKM A;  2WPS A;  1Y47 A;  5AW1 B;  2A45 H;  2FFD B;  1SQV K;  3PTZ A;  1IZN B;  1H0T A;  1NTK K;  1KMI Z;  4NPD A;  3H1J D;  2Q6Q A;  2A06 G;  2RMZ A;  5BU8 B;  1VPC A;  1DD3 A;  1KB9 D;  2ZYG A;  5B66 H;  2P67 A;  1KC8 Q;  1KQF B;  3H1H J;  2A45 I;  2WPV B;  1RF0 A;  3BCC D;  2AXT H;  1S2E A;  3M9B A;  1L2P A;  3U1C A;  3GHG C;  1BSH A;  2B87 A;  1FU1 A;  3O6Q B;  4N78 E;  1T6A A;  1T2K D;  3GG2 A;  2OGU A;  5CJ0 A;  1HBW A;  1NYH A;  2W8Z A;  1DIP A;  1BCC G;  2D2C D;  5KAI H;  1W2E A;  1OXZ A;  2N1T A;  1GD2 E;  1NAY A;  1JTH B;  5GTI E;  2M8R A;  3GHG B;  4ZKP A;  1KIL E;  2R5D A;  2WSF H;  2KYV A;  2E74 D;  2N1T D;  4MN4 C;  3HE4 B;  4AUW A;  3BRV B;  5APV A;  4C46 A;  4IOI H;  1BE3 D;  1VQ7 P;  1L0N J;  3L74 G;  4L73 A;  1T2K C;  1YYC A;  2WSC J;  1JY3 P;  3MUD A;  2SPZ A;  5L8R J;  3P8C D;  3CX5 D;  4PJ0 E;  1NWQ A;  3AE5 C;  1WMK A;  1ZN5 A;  3LW5 H;  2A06 E;  1Q2N A;  3FXD A;  2Q3E A;  3L73 D;  5APU A;  3AE7 C;  2AEF A;  2ZYD A;  1OIP A;  3HTK B;  2KB7 P;  3AE2 C;  2O1J A;  1BDD A;  2WZ7 A;  1NU1 J;  4RJT A;  2E74 C;  2BEZ F;  4BRY A;  1N73 A;  1A02 J;  2XND H;  2QE7 H;  1SQQ D;  1VQO P;  1LT1 A;  3SFD C;  2WSE H;  4EI2 A;  3KHU A;  1T3U A;  2W6A A;  1GW4 A;  1ZRT D;  5AW2 B;  4YTP C;  3A3Y B;  3OJA B;  1E5W A;  2M3E A;  3L70 E;  2JEE A;  5AVS B;  2DW3 A;  3IAO A;  2C0X A;  2K3R A;  2ZAE B;  2BEQ D;  5M1B A;  1YIJ P;  2YNY A;  2E74 B;  1GMJ A;  1SQV D;  5C39 A;  4WY4 A;  5AVQ B;  1HUC A;  1NTK D;  3B5N A;  5EFW B;  1HTL C;  5TIS E;  4WY4 D;  4U3F G;  2KZI A;  1NOH A;  3B5N D;  4PJ0 H;  1MZ9 A;  1SQB D;  3L74 E;  1URQ C;  1Q90 D;  3KZI E;  4HH2 A;  1N86 A;  2QSI A;  1JO5 A;  2GA1 A;  1SFC A;  4O9B A;  3F89 A;  1YQ4 C;  1XTG B;  1YJW P;  2J5U A;  3L70 J;  2H43 A;  2YXR B;  1LT9 A;  1SFC D;  1KQS O;  3OA7 A;  1RQV A;  1RH5 B;  3KDP B;  1URQ B;  2CPB A;  4WB4 A;  1S5L E;  4D6T E;  5KLV J;  3CCJ P;  1A02 F;  4YXD C;  3CXH I;  1IFJ A;  1HGZ A;  2HR3 A;  4PD4 I;  1W5C E;  3H1L G;  1QL2 A;  3Q5S A;  5AVY B;  2I1J A;  5TIS H;  1IFN A;  2JWA A;  3A7O A;  1N7S C;  2K9J A;  1KZU B;  1GTW A;  1FOS E;  5AW0 B;  2FXP A;  1JEK A;  3V4Q A;  3I5C A;  4JBZ A;  1SP4 A;  3KZI H;  3L72 D;  3CMA P;  2VRS A;  3H1J J;  3FWN A;  2POH A;  5KTB A;  4GDO A;  5AW5 B;  4I6M C;  3CWB G;  3AED C;  1ZR2 A;  2YKO A;  2KOG A;  3HUS A;  1VQN P;  1G1I A;  3B71 A;  1AVY A;  5CCG A;  1YBK A;  1ZLL A;  3CCV P;  1LTJ A;  3CCR P;  5AW9 B;  3BCC J;  1OW8 A;  1PGP A;  2NRG A;  2YIU C;  1IFI A;  1N7S B;  5CCG D;  4BXL A;  1MFZ A;  1PV3 A;  1OWA A;  1SQP G;  1KFN A;  2JWD A;  4N3Y B;  1S5L H;  2H89 C;  4K3A A;  1LWU A;  1YTZ T;  2JJL A;  2KNC B;  2ZJS E;  3F5H A;  5B5E E;  1MKM A;  1VQ5 P;  1NTZ G;  2IX7 C;  1HH0 A;  3BVH A;  2KUB A;  1L0L G;  1VF5 D;  2IBZ E;  2QIW A;  3LIE A;  1J1D C;  2WPR A;  3G4S P;  2YIU B;  4N78 D;  3HD7 C;  2QM8 A;  1EDL A;  1QVG O;  3TNU A;  3H1L E;  1QEX A;  3RBZ A;  3V5B A;  5CBO A;  1OVU A;  3RL0 D;  3H25 A;  1KIL A;  2OYI C;  2GUV A;  1ZOY C;  2K9J B;  3TYY A;  3Q5R A;  1BE3 J;  1GL2 A;  2UWJ E;  1KIL D;  2ZT9 C;  3PP5 A;  1J1D B;  4L75 A;  1JM0 A;  1GL2 D;  4BWN A;  2R3S A;  4L76 A;  3L36 A;  1EZV G;  3HD7 B;  1GU4 A;  4AQR D;  1Y8A A;  3RGU A;  3L73 J;  4ASW A;  3G6E P;  2ZXX A;  2Z5I A;  5AVU B;  2RH0 A;  2J59 M;  2OYI B;  2ZXE B;  3AE1 C;  2WPQ A;  3V2P A;  2IYO A;  2K88 A;  2A06 D;  2M5A B;  2ZT9 B;  1SQQ J;  1FJP A;  3A5T A;  1SQP E;  3D6Y A;  1KIL C;  1NH4 A;  2W90 A;  3CXH D;  1CSB A;  2FYN C;  1ZV8 A;  1L0L E;  4TLF A;  1SLQ A;  1NGM B;  4PD4 D;  2IBZ I;  5APX A;  2ZFC A;  1SQV J;  3M91 A;  4H0L D;  1S5L X;  1JOC A;  1NTK J;  3TNU B;  1IJD B;  4YPC A;  1KIL B;  3VN0 A;  5AW3 B;  4H44 C;  3O6Q A;  4DZO A;  3RK3 E;  3PRJ A;  4IL6 E;  1SQB J;  1FDM A;  4KHX A;  2FYN B;  3WMM 0;  3AE8 C;  3KQG A;  1Q86 Q;  1SVF A;  1RY3 A;  2YKP A;  1EC5 A;  5H2F E;  2HFE D;  1AVO A;  2RN0 A;  1AV1 A;  1EZV E;  1M56 D;  4JPZ B;  4W7Y A;  1HWT C;  1JTH A;  3CCQ P;  3L74 D;  3GHG A;  1LTT C;  4H0L C;  3G9R A;  1PP9 G;  3GF7 A;  2QRX A;  5GTH E;  2XV5 A;  4H44 B;  5CBN A;  3OW2 O;  1NU1 G;  1HVV A;  3HE4 A;  2BCC E;  2I1K A;  1FBM A;  5APT A;  5AW8 B;  3IN6 A;  1CZQ A;  1LTS C;  1U7M A;  3A0H E;  2PAJ A;  3H1K G;  1JCD A;  4OH8 B;  2HOD A;  2KLV A;  3PLN A;  4H0L B;  1NJI Q;  3LID A;  1NKN A;  4D6T D;  1IK7 A;  2R3C A;  4Y99 C;  2Y0E A;  3P7K A;  3S1K A;  1SQB K;  3TGU G;  3HTK A;  1DX7 A;  1BGY G;  1HJ0 A;  1SQP K;  1S4X A;  3CCS P;  3I55 P;  1FAV A;  4IL6 H;  4IFF A;  1IK9 A;  4LLH A;  3ZDM A;  5APS A;  2FY8 A;  3L72 J;  4HJG H;  1RE3 A;  1KOR A;  2K37 A;  1PPJ G;  4GOF A;  5H2F H;  1L0L K;  2WSF J;  2QJY C;  2W6J H;  4Y99 B;  3VMA A;  2R44 A;  2YMK A;  2W27 A;  1CI6 B;  1USD A;  5DJU B;  3MD0 A;  1OW6 A;  2B89 A;  1LP1 A;  1PGO A;  1EZV I;  2JO1 A;  1DD4 A;  2ITA A;  1PP9 E;  2LR2 A;  1S72 P;  1FS0 E;  2P10 A;  3LW5 J;  3AEA C;  2JDI H;  3L75 G;  2FXO A;  3Q5P A;  1ZW0 A;  2OYO A;  2OAR A;  1M7L A;  2QJY B;  3PJS K;  1K8A Q;  5KLV G;  3MGN A;  3WUU A;  4EIJ A;  2C9N Y;  1EQ7 A;  2FKW B;  2L91 A;  2PGD A;  1RE3 C;  5CJ4 A;  3H6P A;  1H8A A;  1YTZ I;  2Z5H A;  2CPS A;  3CC7 P;  4GOD A;  2HOD B;  3H1K E;  4H13 D;  4JQ0 D;  2WSE J;  2IBZ D;  4I1L A;  4OVN F;  3N4X A;  3TGU E;  2OTL P;  1BGY E;  1IFM A;  4OGQ C;  1SQX G;  3VOP A;  2Y9Y A;  3CXH E;  1URQ A;  3H1L D;  1WRG A;  1HGV A;  1Q82 Q;  1PFI A;  2P1J A;  1VQP P;  2WQY C;  4DJG A;  4PD4 E;  1JUN A;  3H1J G;  1GW3 A;  1URQ D;  1KD1 Q;  1JY2 O;  2Q9I A;  2KSE A;  4M3L A;  1EDJ A;  5GTI H;  1BCC E;  1FZB A;  2IYP A;  2JP3 A;  1KN7 A;  4H13 C;  4JYC A;  3BCC G;  2NPS A;  3V2N A;  1M1J C;  5AW6 B;  3CL3 D;  1E79 H;  4OGQ B;  2G3A A;  1LP1 B;  1ZXG A;  1YQ3 C;  2NPS D;  4RO0 A;  1JCC A;  4XE5 B;  2KS1 B;  1J1E C;  3Q2Y A;  2QA4 P;  4NPF X;  2XDJ A;  2FYU G;  3MHV A;  2YO2 A;  2IDB A;  1R5S A;  2W83 C;  1SQP D;  4H13 B;  2HPC A;  3H1I G;  1M1J B;  4RKU J;  3EFG A;  1EXI A;  1FE6 A;  1NTM G;  3AEC C;  1N7S A;  4DCK A;  1FZG A;  5AVR B;  1L0L D;  3CXH H;  1J1E B;  1N7S D;  2YMY A;  4DT0 A;  2NPS C;  1VQ6 P;  2R5B A;  3IR9 A;  4PD4 H;  2KNC A;  1RF1 C;  1SQX E;  1JB0 J;  3FWL A;  1VQ9 P;  1VQK P;  3CD6 P;  3I56 P;  3BAS A;  3CME P;  1PGJ A;  3S4R A;  4EDF A;  4WBA A;  3QWO C;  1RE4 C;  2N9Y B;  2Y0D A;  2PRR A;  1W2B O;  3RK3 D;  1M8O B;  1QVF O;  1UIX A;  2KK7 A;  3L73 G;  3L74 J;  3W68 A;  1IC2 A;  3BRT B;  4YXW H;  3QH9 A;  1EDI A;  1EXJ A;  1LTI C;  2NPS B;  4N6J A;  1JMM A;  1OVR A;  2N9B A;  4ZMD A;  1PL5 A;  1RF1 B;  1EZV D;  2HG5 D;  1P84 E;  3NTN A;  1SQQ G;  1U57 A;  5KKZ C;  3G71 P;  3S9O A;  2OTJ P;  4U3F E;  1FZF A;  1LGH B;  1JY3 O;  3E1R A;  1ZP0 C;  4CPG A;  5KJ7 C;  3VMY A;  2FYU E;  3HD7 A;  2BCC D;  4B86 A;  3UIA A;  3B8E B;  3K5B A;  2WWW A;  1S9K E;  2HPC B;  4D6T J;  3T97 A;  1G2C B;  3RK3 C;  4ASV A;  1H89 A;  3HD7 D;  2K9Y A;  3TDK A;  2ZVO B;  5K5G B;  4UB8 E;  1SQV G;  2OYI A;  1GDT A;  1NTM E;  1NTK G;  1IO4 A;  2V4H A;  5KKZ B;  1Z56 A;  2M5A A;  4HB1 A;  2G8Y A;  1X0T A;  1RHZ B;  1AQ5 A;  3R4Y A;  1NHL A;  2ZT9 D;  1NAF A;  2WVR A;  1KV4 A;  2QEX P;  1NVO A;  3RK3 B;  5AW4 B;  3L35 A;  1CW5 A;  1TU3 F;  4TT3 H;  3M06 A;  3RL0 g; 
#chains in the Genus database with same CATH homology
 4BRY A;  1UII A;  3E1R A;  3WUV A;  2WVR A;  3WUU A;  2ZXX A;  3WUT A;  4BRY B;  3F5H A;  2Q6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...