3WUTA

Structure basis of inactivating cell abscission
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
53
structure length
53
Chain Sequence
b'SFNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Centrosomal protein of 55 kDa
publication title Structural and biochemical insights into the role of testis-expressed gene 14 (TEX14) in forming the stable intercellular bridges of germ cells
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 24
structure length 53
sequence length 53
chains with identical sequence B, D, E, G, H, J, K
ec nomenclature
pdb deposition date 2014-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12180 EABR TSG101 and ALIX binding domain of CEP55
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 3wutA00
3WUVA 2Q6QA 4BRYB 3E1RA 3WUTA 1UIIA 2ZXXA 3F5HA 4BRYA 3WUUA 2WVRA
chains in the Genus database with same CATH superfamily
5AVQB 3JC22 2YO3A 1GU5A 1BE3D 4AUWA 3HD7C 2OGUA 3H1HE 2WPQA 3T97A 1AVYA 1T2KD 2A06E 1IFPA 3IN6A 1BDDA 1AFOA 1NTKD 1AV1A 3IFMA 1QL1A 1PGQA 1JTHB 3L75G 3CCJP 1K73Q 3EFGA 2H8PD 3CX5I 2IYPA 4GT1A 3I56P 3Q5PA 1JNMA 4HKZH 1S5LH 2DW3A 2P1JA 3BCCD 1LT9C 4NPEA 4OGQB 2KI7B 4JQ0D 3R2PA 2C0XA 4L74A 1FBMA 2Y0DA 1N7SC 3LIEA 1L2PA 3NTNA 3NMDA 3RBZA 3M9QA 3GHGC 1YITP 3SSUA 4YTPC 4RKUJ 3VYIA 1S1CX 2IYOA 2JR8A 4A7PA 4D6TJ 5AW4B 1KFNA 4KT0J 1VQ6P 1ZMEC 3CX5E 2E42A 3HD7A 3AECC 1FZGA 4RESB 2N9YB 1BGYJ 4DT0A 2NPSC 1Q90D 5GTHH 3V2NA 2XNXA 1T3JA 4JYBA 2J5UA 1J1EC 3L73E 1LTSC 3U1AA 2XKMA 3I55P 1X79B 2ZFCA 1CZQA 3LIDA 3P32A 1KB9D 3MZWB 2WWWA 4DCKA 1IK7A 1R5SA 3HTKA 3H1IG 1SQPJ 2IFMA 1D7MA 2C9NY 3B5NB 1MUUA 1M1JC 1RE3C 1LT9A 4I1LA 3W68A 3GLMA 3A0BH 1BSHA 2ZJSE 3MGNA 1VQ9P 1GDTA 1NU1G 1S5LX 1DIPA 3VN0A 1EDKA 1GL2C 1KZUB 5APQA 3AE6C 4BWNA 1OIPA 5AVXB 4AYCA 5APYA 3C8VA 2ITAA 3KHUA 4OWFA 3WUVA 5GTIE 5K5GB 2LXBA 5AVSB 4GKGA 1U7JA 3L73G 5AVRB 3H1LJ 3P8MC 5APTA 1YQ3C 2QM8A 4EI2A 4PD4D 1KORA 2K88A 3JCUH 4YPCA 1Y47A 2XDJA 3G4SP 5CHXA 5CCGD 1VQ5P 2WSFJ 2R3CA 3AEGC 2UWJE 3CXHD 3FWLA 1MFZA 1RHZB 4K3AA 2BEQD 2N1TB 5APUA 3KQGA 3V2RA 2KIKA 1G2CA 5KTBA 5H2FE 3VTPC 3O6QB 4H0LC 3CCRP 2IDBA 1M1JA 1LTJC 1RE3A 3R4YA 3RL0C 2QRXA 4W80A 1S3JA 4NPDA 3H25A 3SWFA 1RE4C 1R5LA 3G71P 4D6TD 1RF1C 1E79H 1CI6A 1M1KQ 1GL2A 2QM7A 3OJAB 2KSEA 3WUTA 3KPEA 3RK2D 1SQPK 3H1JJ 5CJ4A 4L75A 4L73A 3KZIH 2B87B 1BGYD 4PJ0E 2OTJP 1OW6A 3H32B 3CCSP 2Y0EA 4EDFA 3CWBE 1LJ2A 3Q5RA 2FKWB 3U1CA 4L76A 2H88C 1HGZA 4GOFA 2M3BA 4WWIA 3FGAD 1NAYA 5BU5A 5KJ7C 3AE4C 1OW7A 4M3LA 3M0AA 3HE5B 1SQPD 3M91A 2G8YA 2OTKE 5CCGA 1EC5A 2C0WA 1LNQA 4Y28J 1EZVI 1SQBJ 4IL6H 1BCCJ 3A0HE 1LP1A 5KLVJ 4N78D 4WB4A 1GK4A 4OGQC 2OYHC 1T6AA 4H13D 2W6BA 1PGPA 2YNYA 1DEBA 4R4LA 2HR3A 1RF1A 1ZLLA 4JYCA 1FC2C 1ZR2A 2W27A 2J59M 2GUVA 1AQTA 2K9YA 1M56D 2AEFA 2Q3EA 3H1LD 2E76D 1NOHA 5AW3B 1EZVE 1K04A 2YKOA 1SQQE 1MKMA 3PRJA 1G2CB 1TU3F 1KB9H 1PGJA 5AW1B 1ZRTD 1L4AD 2Z5IA 1JTHA 3CI9A 3WMM0 3E7KA 4QMAA 4TLFA 2FBWC 3B5ND 2YXRB 1XTGB 3E1IA 2JJLA 4B86A 3AE3C 1S5LE 1UIIA 3Q3DA 2AXTH 2Q7CA 1G1IA 3ITKA 2ZT9D 3PJSK 1OVVA 3I5CA 4IL6X 2E74D 2IX7C 5AW9B 3V2PA 3QH9A 3H1JD 1PL5A 4D6TG 3CD6P 1QVGO 3L71E 2V7QJ 2O01J 1H8AA 2K3RA 1SQBK 2KP8A 5B5EH 1SQQG 1VQKP 4I7ZB 3TF5A 1BGYG 5KLVK 3OA7A 2HPCB 4PD4H 3P8CD 4PV1D 1Q7YQ 4GODA 1VQ7P 2CPSA 3L75E 4GOEA 2QE7H 4ASWA 1JY3P 2WPVB 1LT1A 3M06A 1LP1B 1J2JB 2L5GB 1FDOA 3CXHH 3M9BA 1YI2P 1W5CE 4RO0A 3CCVP 1AA0A 3RK3D 4U3FJ 1GK6A 1SQBD 1BCCD 1SQXJ 4I2LC 1SQPG 4ZNCA 4YXWH 3BRVB 4Z1MH 2YMKA 1FZCB 1SS1A 5KLVD 2HG5D 2Q5UA 1DD4A 3H1KJ 2ZAEB 3B5NA 1R8EA 1HWTC 3M0DA 2W90A 3PP5A 5AW5B 1PV3A 1U57A 3RK2B 3A0BE 3L71G 3GG2A 3C9IA 3CC2P 1OMIA 2NZ2A 2P10A 2R5BA 2QJYB 1KMIZ 1QEXA 1T2KC 3D6YA 2IBZD 1LTBC 3PLNA 1NTME 1IO4A 3VOPA 2RH0A 3MUDA 1NH4A 1HF9A 1N2DC 2I1JA 3H1LG 4NPFX 1JUNA 2HLOA 4ZKUA 2Q9IA 5AVYB 1LWUB 3L72D 4HJGH 3C1LA 1RH5B 2P58A 3JCUE 2E43A 3H1IE 2OYIB 1NYHA 2WSEJ 2FFDA 1GD2E 1L0LK 2V4HA 2K1AA 3AE2C 2BCCJ 1FOSE 2JO1A 1Q86Q 1QGKB 4KHXA 1ZXGA 1FJPA 4H13B 2KLVA 2N1TA 1KN7A 2RKLA 3F89A 1YBKA 3HUSB 1J1DB 2POHA 1A02F 1GW4A 1NU1E 3O6QA 3V5BA 2W83C 2YXQB 1EDJA 1NTZJ 4JBZA 1ZW0A 3L36A 1L0LD 1VQNP 1PP9E 1NTMG 2Q3IA 5KKZB 2E76B 5CCHD 1SQXK 5KAFH 2VRSA 3H1JG 1BE3E 4DOJA 1LGHB 2NRGA 1G1JA 2FYUJ 2QG4A 5L8RJ 3KZIE 1YTZT 1N7LA 2E5TA 4YXDC 2B87A 3CMEP 1L4AB 1NTKE 3H32A 1L0NJ 2ZYGA 2WSFH 4XE5B 1QX8A 3GW6A 3CLQA 2M0BA 2WVRA 3SWYA 2BASA 2JWDA 4U3FD 4N3YB 3L70J 1KD1Q 1SQXD 3L4FA 1EDLA 1SQBG 3L72E 3HE5A 3BCCE 3WU2H 1K9MQ 3H1KD 3V4QA 2ZT9B 3CCMP 4IL6E 3OW2O 3RBXA 2E74B 5KLVG 1KB9I 3D70A 3BVHA 3LW5J 3V4WA 2OQQA 4TT3H 1QL2A 1MZ9A 1PP9G 1NVOA 2MJZA 1BE3G 5AVUB 2RMZA 5AW8B 2M8RA 1FZEA 1VQLP 4C7RA 5DJTB 4WY4B 1M90Q 4PV1B 1WRGA 1NTKG 3CC7P 4N6JA 5KAIE 2WT7B 3TGUJ 2FFDB 2WPRA 1Q81Q 4I7ZC 1SFCD 5CCGC 4DZOA 3RK3B 1EXIA 3S1KA 1OVRA 1VF5D 2YMYA 4Y99B 5B66H 1NTZK 1JY3O 1KB9E 2HFED 1SQVJ 3SWKA 2WMMA 3L72G 3BCCG 3SFDC 2WSCJ 2BCCD 1NO4A 1P84D 3RL0g 2RN0A 1KYOD 5TISH 3A7OA 3L74J 1FE6A 1IJDB 2FYUK 4PD4I 3AEEC 2KK7A 4XFJA 1PFIA 1HJBA 3S4RA 3CCLP 3FXDA 2D2CB 1L0NK 3H1HJ 2H43A 1JCCA 3L37A 3CXHI 1NTZD 5E79H 2FY8A 3TDKA 2SPZA 2OARA 3RK2C 1KQGB 3B8EB 1JY2P 2P67A 2GA1A 1NHLA 1LTTC 1QVFO 1L0LG 2FYUD 5AW2B 1KTMA 3PTZA 2QJYC 1ZV8A 5B5EE 1JY3N 1L0ND 3BASA 1IFDA 1OX3A 2R32A 1GW3A 4PD4E 2M5AB 2HPCA 1VQ8P 1M57D 2OTLP 1SFCA 3L70D 4JPZB 2YO2A 1LWUC 3HE4B 2Y9YA 2PRRA 3CXHE 4U3FG 3EWKA 2QEXP 5APWA 1LTGC 2JP3A 1URQD 3H1KG 3AE5C 1LTIC 2WTYA 4H13C 1S9KD 1FZFA 2PP6A 1FZCA 3KXDA 3AEAC 3CCUP 2E75D 3IF4A 5AW0B 3RGUA 3HUSC 5GTIH 1M7LA 2O01N 2V7QH 2O01H 2NPSB 1FZBA 1SQVK 4D6TE 2KS1B 3ABVC 3L73J 3P7KA 5KLIB 5APVA 4UB8H 2WITA 3OAKA 2WSSH 4WVZA 5KKZC 3TGUD 2E76C 1BGYE 1HVVA 3CPWO 2I8DA 4IOIH 1VQPP 1NKZB 4IFMA 2K9JB 3PHLA 1L4AC 3GF7A 1BSNA 2AXCA 3V6IA 3K5BA 1FU1A 1KILD 1SQVD 2R3SA 1OXZA 1VDFA 1SVFA 2W6JH 3B5NC 1JMMA 1LWUA 1SQPE 5CJ0A 3M0DC 3L74D 1HUCA 2B88A 4C7NB 2BCCG 5AW6B 2OYIA 3TK1A 1HGVA 1M8OB 2LKMA 1JMBA 3H1HD 4DJGA 2ZT9C 2AEMA 2FXPA 4N78E 1YQ4C 2A06D 2E74C 5CMZA 1KC8Q 2QSIA 3HUSA 4HB1A 2L91A 1Y8AA 1NTZG 1A02J 3E1RA 3TSIA 1PPJD 1ZOYC 3MUDC 2PGDA 3VMXA 4WY4D 3QWOC 1JO5A 1HH0A 5GTHE 3FX0A 3BRTB 2W6AA 3AE7C 1SFCB 1FOSF 5KAFE 2K37A 2KUBA 1S4XA 2FYUG 1VF5B 2A45G 1USDA 5BVZA 1IFIA 1FDMA 3CCQP 3H1LE 3L35A 1Q82Q 1N8RQ 3MP7B 2FFDC 1LTAC 3JSVC 3TNUA 1L4AA 1W2BO 1OWAA 1H89A 2WSEH 4IFDK 1FJKA 1KQFB 1ZRTE 3CCEP 3RK3C 3A0HH 4H0LB 3GMAA 1VL2A 1KV4A 1OW8A 2N1TC 1LTJB 1KQSO 1P84H 2QIWA 1IFMA 1KYOH 2PAJA 3L70G 3BATA 1N73B 2IFNA 3RL0B 1YJ9P 4H44D 3SFEC 3A2AA 1JB0J 1ZR4A 2D2CD 3WU2E 3CX5D 4HH2A 4AQRD 1VQ4P 3HD7D 2FXOA 1X8YA 2AEJA 1Z56A 3CWBJ 2G3AA 2M3EA 2I1KA 2IZ1A 4R4MA 1H0TA 3L73D 4C46A 3H1JE 2A45H 1JY2O 4ZKPA 2KSJA 3CC4P 1YYCA 2IZ0A 2KNCB 5APXA 5AVZB 1T8ZA 1ZN5A 3TGUG 4WY4A 1PPJE 3S9OA 2P2UA 1DEEG 2WT7A 3P8CE 4UB6H 3KYQA 2HODB 1N86A 1JM0A 1X22A 4BRYB 2HYNA 3G9RA 1KFMA 5B66E 2E5YA 3AE1C 2IBZI 3VP9A 2XV5A 1SQVG 1URQB 1N7SD 3RK3E 1SQBE 1BCCE 2YIUB 2OYHB 3MHVA 1MV8A 3L74G 2E75B 1MFTA 1RF0A 5TISE 3LW5H 5KLVE 4WBAA 2FYNB 1SLQA 2Z5HA 1K05A 1X0TA 3H1HG 4CPGA 1JY2N 3NFQA 1QLED 2JWAA 2A06G 2NPSD 1RQVA 3NXSA 3VMYA 1T3UA 3IR9A 1SQQJ 5CCHC 1OVUA 5E79E 1NWQA 2CPBA 3U59A 1JCDA 3TNUB 1CW5A 2ZVNB 3FWNA 1PPJG 5KLIC 2QJKB 2IBZE 1AJYA 1HJ0A 3VMAA 1KILB 3D6ZA 1NGMB 3GF3A 2JEEA 3CMAP 1PZQA 2O1JA 2LR2A 5C39A 3PH0A 2WPSA 2OYOA 4GDOA 2Z4EA 1CSBA 3O8ZA 2Q6QA 2WSCH 1BCCG 2MKVA 1VQMP 2M5AA 1IFNA 3VP8A 4EYYQ 1NJIQ 2P7JA 3AEFC 1ZP0C 5AVWB 3HE4A 3T97B 1H0TB 1N7SA 1IK9A 1GL2D 3L71J 3EFFK 2H7HA 3GHGA 3UIAA 3CWBD 1YHQP 2PFXA 3AE9C 2KXPB 2KOGA 4EOTA 5BU8B 3L75J 1XTCC 2O1KA 5CCHA 2IBZG 2ZYAA 1L0LE 3A3YB 3Q2YA 2NPSA 1H88A 1DX7A 1DD3A 3AEBC 2KS1A 4OVNF 2N9BA 3FXEA 4UB8E 5TJHA 2QJPB 1GMJA 1SFCC 4HYTB 2ZVOB 2W8ZA 1VF5C 1EXJA 1FDIA 2J58A 3HRNA 2XU6A 3IAOA 5AW7B 1EQ7A 2GM4A 4H0LD 1NKNA 2K9JA 4H44B 1SQQK 3A5TA 4U3FE 4BXLA 4GIFA 1FZCC 1SQXE 3RL0D 2BEZF 1WMKA 4ZMDA 3HD7B 4MN4C 1N73C 3CX5H 2AXTE 3H1KE 4C7NA 4W7ZA 1RY3A 3H6PA 1NTMJ 4KJMA 3CL3D 1EZVD 1S72P 1P84I 2FXMA 1SQQD 2KZJA 1KYOI 3G6EP 2O3JA 2Q1KA 4K35A 2Y0CA 3VMZA 3MD0A 4LC1A 3HTKB 3Q5SA 1FS0E 3ZDMA 2CK3H 1GTWA 3D71A 1IC2A 5KJ7D 1RQUA 3H1IJ 2FYZA 5APSA 3AEDC 4JF7A 1LT9B 5AVVB 2JDIH 1JOCA 1E5WA 1PIXA 1Y9BA 3TYYA 1N7SB 1DH3A 1SQXG 2OYIC 1W2EA 3GHGB 4OH8B 5CBNA 2A45I 4EIJA 4LLHA 1NU1J 4OGQD 1UIXA 2BCCE 1OZHA 1P84E 1URQC 2H89C 1KYOE 1LTJA 3L71D 1U7MA 1AVOA 2YIUC 2ZXEB 1N73A 1J1DC 1PP9J 2GUSA 2E75C 1BE3J 3MTUE 1RE4A 5M1BA 3EQ2A 5DJUB 2KYVA 2FYNC 2LXCB 1NAFA 5AVTB 3G3ZA 3CWBG 1J1EB 1NTZE 5KAIH 1GZLA 3L75D 4ASVA 1NTKJ 1S2EA 1K8AQ 3B4SA 1USEA 1WT6A 3Q1MA 2KLUA 3II6A 4W7YA 3USSA 1HTLC 3M9HA 2FYUE 4U7JA 2QJKC 3V2QA 2KZIA 5H2FH 1M1JB 1L0NE 2KNCA 5KJ7A 1EDIA 3MIWA 3L72J 3BCCJ 1YIJP 1KILC 1NTMK 1HBWA 2R5DA 4UB6E 1SP4A 4RJTA 2HODA 3L70E 4O9BA 1CI6B 4BRYA 1GL2B 2ZXXA 1VQOP 1FAVA 2Y9ZA 1URQA 1BDCA 1OFCX 4PJ0H 2YKPA 2R44A 1JEKA 2OYHA 4LGDE 3KDPB 1IFJA 3N7NA 1NTMD 1S9KE 1AQ5A 3AE8C 1YTZI 1L0LJ 2IPPA 3F5HA 1EZVG 4WY4C 2C9LY 1NU1K 4PV1C 2QA4P 1YJNP 1YJWP 3B71A 3H1ID 4I6MC 1L0NG 3TGUE 2B9BA 1KQLA 2WZ7A 3W67A 4IFFA 1IZNB 3N4XA 4XA4A 2WQYC 4Y99C 2QJPC 1FZAA 2B89A 3WUUA 1Q2NA 2ZYDA 1KILA 2XNDH 2YKQA 2QVAA 2KB7P 1PGOA 2N1TD 1NTKK 1KILE 1RF0C 1SQVE 1NU1D 5EFWB 1GU4A 2XZRA 1RF1B 4H44C 2JKVA 1VPCA 3L74E 2D2CC 1PP9D 1X9VA 5CBOA
chains in the Genus database with same CATH topology
3WUVA 2Q6QA 4BRYB 3E1RA 3WUTA 1UIIA 2ZXXA 3F5HA 4BRYA 3WUUA 2WVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WUV A;  2Q6Q A;  4BRY B;  3E1R A;  3WUT A;  1UII A;  2ZXX A;  3F5H A;  4BRY A;  3WUU A;  2WVR A; 
#chains in the Genus database with same CATH topology
 5AVQ B;  3JC2 2;  2YO3 A;  1GU5 A;  1BE3 D;  4AUW A;  3HD7 C;  2OGU A;  3H1H E;  2WPQ A;  3T97 A;  1AVY A;  1T2K D;  2A06 E;  1IFP A;  3IN6 A;  1BDD A;  1AFO A;  1NTK D;  1AV1 A;  3IFM A;  1QL1 A;  1PGQ A;  1JTH B;  3L75 G;  3CCJ P;  1K73 Q;  3EFG A;  2H8P D;  3CX5 I;  2IYP A;  4GT1 A;  3I56 P;  3Q5P A;  1JNM A;  4HKZ H;  1S5L H;  2DW3 A;  2P1J A;  3BCC D;  1LT9 C;  4NPE A;  4OGQ B;  2KI7 B;  4JQ0 D;  3R2P A;  2C0X A;  4L74 A;  1FBM A;  2Y0D A;  1N7S C;  3LIE A;  1L2P A;  3NTN A;  3NMD A;  3RBZ A;  3M9Q A;  3GHG C;  1YIT P;  3SSU A;  4YTP C;  4RKU J;  3VYI A;  1S1C X;  2IYO A;  2JR8 A;  4A7P A;  4D6T J;  5AW4 B;  1KFN A;  4KT0 J;  1VQ6 P;  1ZME C;  3CX5 E;  2E42 A;  3HD7 A;  3AEC C;  1FZG A;  4RES B;  2N9Y B;  1BGY J;  4DT0 A;  2NPS C;  1Q90 D;  5GTH H;  3V2N A;  2XNX A;  1T3J A;  4JYB A;  2J5U A;  1J1E C;  3L73 E;  1LTS C;  3U1A A;  2XKM A;  3I55 P;  1X79 B;  2ZFC A;  1CZQ A;  3LID A;  3P32 A;  1KB9 D;  3MZW B;  2WWW A;  4DCK A;  1IK7 A;  1R5S A;  3HTK A;  3H1I G;  1SQP J;  2IFM A;  1D7M A;  2C9N Y;  3B5N B;  1MUU A;  1M1J C;  1RE3 C;  1LT9 A;  4I1L A;  3W68 A;  3GLM A;  3A0B H;  1BSH A;  2ZJS E;  3MGN A;  1VQ9 P;  1GDT A;  1NU1 G;  1S5L X;  1DIP A;  3VN0 A;  1EDK A;  1GL2 C;  1KZU B;  5APQ A;  3AE6 C;  4BWN A;  1OIP A;  5AVX B;  4AYC A;  5APY A;  3C8V A;  2ITA A;  3KHU A;  4OWF A;  3WUV A;  5GTI E;  5K5G B;  2LXB A;  5AVS B;  4GKG A;  1U7J A;  3L73 G;  5AVR B;  3H1L J;  3P8M C;  5APT A;  1YQ3 C;  2QM8 A;  4EI2 A;  4PD4 D;  1KOR A;  2K88 A;  3JCU H;  4YPC A;  1Y47 A;  2XDJ A;  3G4S P;  5CHX A;  5CCG D;  1VQ5 P;  2WSF J;  2R3C A;  3AEG C;  2UWJ E;  3CXH D;  3FWL A;  1MFZ A;  1RHZ B;  4K3A A;  2BEQ D;  2N1T B;  5APU A;  3KQG A;  3V2R A;  2KIK A;  1G2C A;  5KTB A;  5H2F E;  3VTP C;  3O6Q B;  4H0L C;  3CCR P;  2IDB A;  1M1J A;  1LTJ C;  1RE3 A;  3R4Y A;  3RL0 C;  2QRX A;  4W80 A;  1S3J A;  4NPD A;  3H25 A;  3SWF A;  1RE4 C;  1R5L A;  3G71 P;  4D6T D;  1RF1 C;  1E79 H;  1CI6 A;  1M1K Q;  1GL2 A;  2QM7 A;  3OJA B;  2KSE A;  3WUT A;  3KPE A;  3RK2 D;  1SQP K;  3H1J J;  5CJ4 A;  4L75 A;  4L73 A;  3KZI H;  2B87 B;  1BGY D;  4PJ0 E;  2OTJ P;  1OW6 A;  3H32 B;  3CCS P;  2Y0E A;  4EDF A;  3CWB E;  1LJ2 A;  3Q5R A;  2FKW B;  3U1C A;  4L76 A;  2H88 C;  1HGZ A;  4GOF A;  2M3B A;  4WWI A;  3FGA D;  1NAY A;  5BU5 A;  5KJ7 C;  3AE4 C;  1OW7 A;  4M3L A;  3M0A A;  3HE5 B;  1SQP D;  3M91 A;  2G8Y A;  2OTK E;  5CCG A;  1EC5 A;  2C0W A;  1LNQ A;  4Y28 J;  1EZV I;  1SQB J;  4IL6 H;  1BCC J;  3A0H E;  1LP1 A;  5KLV J;  4N78 D;  4WB4 A;  1GK4 A;  4OGQ C;  2OYH C;  1T6A A;  4H13 D;  2W6B A;  1PGP A;  2YNY A;  1DEB A;  4R4L A;  2HR3 A;  1RF1 A;  1ZLL A;  4JYC A;  1FC2 C;  1ZR2 A;  2W27 A;  2J59 M;  2GUV A;  1AQT A;  2K9Y A;  1M56 D;  2AEF A;  2Q3E A;  3H1L D;  2E76 D;  1NOH A;  5AW3 B;  1EZV E;  1K04 A;  2YKO A;  1SQQ E;  1MKM A;  3PRJ A;  1G2C B;  1TU3 F;  1KB9 H;  1PGJ A;  5AW1 B;  1ZRT D;  1L4A D;  2Z5I A;  1JTH A;  3CI9 A;  3WMM 0;  3E7K A;  4QMA A;  4TLF A;  2FBW C;  3B5N D;  2YXR B;  1XTG B;  3E1I A;  2JJL A;  4B86 A;  3AE3 C;  1S5L E;  1UII A;  3Q3D A;  2AXT H;  2Q7C A;  1G1I A;  3ITK A;  2ZT9 D;  3PJS K;  1OVV A;  3I5C A;  4IL6 X;  2E74 D;  2IX7 C;  5AW9 B;  3V2P A;  3QH9 A;  3H1J D;  1PL5 A;  4D6T G;  3CD6 P;  1QVG O;  3L71 E;  2V7Q J;  2O01 J;  1H8A A;  2K3R A;  1SQB K;  2KP8 A;  5B5E H;  1SQQ G;  1VQK P;  4I7Z B;  3TF5 A;  1BGY G;  5KLV K;  3OA7 A;  2HPC B;  4PD4 H;  3P8C D;  4PV1 D;  1Q7Y Q;  4GOD A;  1VQ7 P;  2CPS A;  3L75 E;  4GOE A;  2QE7 H;  4ASW A;  1JY3 P;  2WPV B;  1LT1 A;  3M06 A;  1LP1 B;  1J2J B;  2L5G B;  1FDO A;  3CXH H;  3M9B A;  1YI2 P;  1W5C E;  4RO0 A;  3CCV P;  1AA0 A;  3RK3 D;  4U3F J;  1GK6 A;  1SQB D;  1BCC D;  1SQX J;  4I2L C;  1SQP G;  4ZNC A;  4YXW H;  3BRV B;  4Z1M H;  2YMK A;  1FZC B;  1SS1 A;  5KLV D;  2HG5 D;  2Q5U A;  1DD4 A;  3H1K J;  2ZAE B;  3B5N A;  1R8E A;  1HWT C;  3M0D A;  2W90 A;  3PP5 A;  5AW5 B;  1PV3 A;  1U57 A;  3RK2 B;  3A0B E;  3L71 G;  3GG2 A;  3C9I A;  3CC2 P;  1OMI A;  2NZ2 A;  2P10 A;  2R5B A;  2QJY B;  1KMI Z;  1QEX A;  1T2K C;  3D6Y A;  2IBZ D;  1LTB C;  3PLN A;  1NTM E;  1IO4 A;  3VOP A;  2RH0 A;  3MUD A;  1NH4 A;  1HF9 A;  1N2D C;  2I1J A;  3H1L G;  4NPF X;  1JUN A;  2HLO A;  4ZKU A;  2Q9I A;  5AVY B;  1LWU B;  3L72 D;  4HJG H;  3C1L A;  1RH5 B;  2P58 A;  3JCU E;  2E43 A;  3H1I E;  2OYI B;  1NYH A;  2WSE J;  2FFD A;  1GD2 E;  1L0L K;  2V4H A;  2K1A A;  3AE2 C;  2BCC J;  1FOS E;  2JO1 A;  1Q86 Q;  1QGK B;  4KHX A;  1ZXG A;  1FJP A;  4H13 B;  2KLV A;  2N1T A;  1KN7 A;  2RKL A;  3F89 A;  1YBK A;  3HUS B;  1J1D B;  2POH A;  1A02 F;  1GW4 A;  1NU1 E;  3O6Q A;  3V5B A;  2W83 C;  2YXQ B;  1EDJ A;  1NTZ J;  4JBZ A;  1ZW0 A;  3L36 A;  1L0L D;  1VQN P;  1PP9 E;  1NTM G;  2Q3I A;  5KKZ B;  2E76 B;  5CCH D;  1SQX K;  5KAF H;  2VRS A;  3H1J G;  1BE3 E;  4DOJ A;  1LGH B;  2NRG A;  1G1J A;  2FYU J;  2QG4 A;  5L8R J;  3KZI E;  1YTZ T;  1N7L A;  2E5T A;  4YXD C;  2B87 A;  3CME P;  1L4A B;  1NTK E;  3H32 A;  1L0N J;  2ZYG A;  2WSF H;  4XE5 B;  1QX8 A;  3GW6 A;  3CLQ A;  2M0B A;  2WVR A;  3SWY A;  2BAS A;  2JWD A;  4U3F D;  4N3Y B;  3L70 J;  1KD1 Q;  1SQX D;  3L4F A;  1EDL A;  1SQB G;  3L72 E;  3HE5 A;  3BCC E;  3WU2 H;  1K9M Q;  3H1K D;  3V4Q A;  2ZT9 B;  3CCM P;  4IL6 E;  3OW2 O;  3RBX A;  2E74 B;  5KLV G;  1KB9 I;  3D70 A;  3BVH A;  3LW5 J;  3V4W A;  2OQQ A;  4TT3 H;  1QL2 A;  1MZ9 A;  1PP9 G;  1NVO A;  2MJZ A;  1BE3 G;  5AVU B;  2RMZ A;  5AW8 B;  2M8R A;  1FZE A;  1VQL P;  4C7R A;  5DJT B;  4WY4 B;  1M90 Q;  4PV1 B;  1WRG A;  1NTK G;  3CC7 P;  4N6J A;  5KAI E;  2WT7 B;  3TGU J;  2FFD B;  2WPR A;  1Q81 Q;  4I7Z C;  1SFC D;  5CCG C;  4DZO A;  3RK3 B;  1EXI A;  3S1K A;  1OVR A;  1VF5 D;  2YMY A;  4Y99 B;  5B66 H;  1NTZ K;  1JY3 O;  1KB9 E;  2HFE D;  1SQV J;  3SWK A;  2WMM A;  3L72 G;  3BCC G;  3SFD C;  2WSC J;  2BCC D;  1NO4 A;  1P84 D;  3RL0 g;  2RN0 A;  1KYO D;  5TIS H;  3A7O A;  3L74 J;  1FE6 A;  1IJD B;  2FYU K;  4PD4 I;  3AEE C;  2KK7 A;  4XFJ A;  1PFI A;  1HJB A;  3S4R A;  3CCL P;  3FXD A;  2D2C B;  1L0N K;  3H1H J;  2H43 A;  1JCC A;  3L37 A;  3CXH I;  1NTZ D;  5E79 H;  2FY8 A;  3TDK A;  2SPZ A;  2OAR A;  3RK2 C;  1KQG B;  3B8E B;  1JY2 P;  2P67 A;  2GA1 A;  1NHL A;  1LTT C;  1QVF O;  1L0L G;  2FYU D;  5AW2 B;  1KTM A;  3PTZ A;  2QJY C;  1ZV8 A;  5B5E E;  1JY3 N;  1L0N D;  3BAS A;  1IFD A;  1OX3 A;  2R32 A;  1GW3 A;  4PD4 E;  2M5A B;  2HPC A;  1VQ8 P;  1M57 D;  2OTL P;  1SFC A;  3L70 D;  4JPZ B;  2YO2 A;  1LWU C;  3HE4 B;  2Y9Y A;  2PRR A;  3CXH E;  4U3F G;  3EWK A;  2QEX P;  5APW A;  1LTG C;  2JP3 A;  1URQ D;  3H1K G;  3AE5 C;  1LTI C;  2WTY A;  4H13 C;  1S9K D;  1FZF A;  2PP6 A;  1FZC A;  3KXD A;  3AEA C;  3CCU P;  2E75 D;  3IF4 A;  5AW0 B;  3RGU A;  3HUS C;  5GTI H;  1M7L A;  2O01 N;  2V7Q H;  2O01 H;  2NPS B;  1FZB A;  1SQV K;  4D6T E;  2KS1 B;  3ABV C;  3L73 J;  3P7K A;  5KLI B;  5APV A;  4UB8 H;  2WIT A;  3OAK A;  2WSS H;  4WVZ A;  5KKZ C;  3TGU D;  2E76 C;  1BGY E;  1HVV A;  3CPW O;  2I8D A;  4IOI H;  1VQP P;  1NKZ B;  4IFM A;  2K9J B;  3PHL A;  1L4A C;  3GF7 A;  1BSN A;  2AXC A;  3V6I A;  3K5B A;  1FU1 A;  1KIL D;  1SQV D;  2R3S A;  1OXZ A;  1VDF A;  1SVF A;  2W6J H;  3B5N C;  1JMM A;  1LWU A;  1SQP E;  5CJ0 A;  3M0D C;  3L74 D;  1HUC A;  2B88 A;  4C7N B;  2BCC G;  5AW6 B;  2OYI A;  3TK1 A;  1HGV A;  1M8O B;  2LKM A;  1JMB A;  3H1H D;  4DJG A;  2ZT9 C;  2AEM A;  2FXP A;  4N78 E;  1YQ4 C;  2A06 D;  2E74 C;  5CMZ A;  1KC8 Q;  2QSI A;  3HUS A;  4HB1 A;  2L91 A;  1Y8A A;  1NTZ G;  1A02 J;  3E1R A;  3TSI A;  1PPJ D;  1ZOY C;  3MUD C;  2PGD A;  3VMX A;  4WY4 D;  3QWO C;  1JO5 A;  1HH0 A;  5GTH E;  3FX0 A;  3BRT B;  2W6A A;  3AE7 C;  1SFC B;  1FOS F;  5KAF E;  2K37 A;  2KUB A;  1S4X A;  2FYU G;  1VF5 B;  2A45 G;  1USD A;  5BVZ A;  1IFI A;  1FDM A;  3CCQ P;  3H1L E;  3L35 A;  1Q82 Q;  1N8R Q;  3MP7 B;  2FFD C;  1LTA C;  3JSV C;  3TNU A;  1L4A A;  1W2B O;  1OWA A;  1H89 A;  2WSE H;  4IFD K;  1FJK A;  1KQF B;  1ZRT E;  3CCE P;  3RK3 C;  3A0H H;  4H0L B;  3GMA A;  1VL2 A;  1KV4 A;  1OW8 A;  2N1T C;  1LTJ B;  1KQS O;  1P84 H;  2QIW A;  1IFM A;  1KYO H;  2PAJ A;  3L70 G;  3BAT A;  1N73 B;  2IFN A;  3RL0 B;  1YJ9 P;  4H44 D;  3SFE C;  3A2A A;  1JB0 J;  1ZR4 A;  2D2C D;  3WU2 E;  3CX5 D;  4HH2 A;  4AQR D;  1VQ4 P;  3HD7 D;  2FXO A;  1X8Y A;  2AEJ A;  1Z56 A;  3CWB J;  2G3A A;  2M3E A;  2I1K A;  2IZ1 A;  4R4M A;  1H0T A;  3L73 D;  4C46 A;  3H1J E;  2A45 H;  1JY2 O;  4ZKP A;  2KSJ A;  3CC4 P;  1YYC A;  2IZ0 A;  2KNC B;  5APX A;  5AVZ B;  1T8Z A;  1ZN5 A;  3TGU G;  4WY4 A;  1PPJ E;  3S9O A;  2P2U A;  1DEE G;  2WT7 A;  3P8C E;  4UB6 H;  3KYQ A;  2HOD B;  1N86 A;  1JM0 A;  1X22 A;  4BRY B;  2HYN A;  3G9R A;  1KFM A;  5B66 E;  2E5Y A;  3AE1 C;  2IBZ I;  3VP9 A;  2XV5 A;  1SQV G;  1URQ B;  1N7S D;  3RK3 E;  1SQB E;  1BCC E;  2YIU B;  2OYH B;  3MHV A;  1MV8 A;  3L74 G;  2E75 B;  1MFT A;  1RF0 A;  5TIS E;  3LW5 H;  5KLV E;  4WBA A;  2FYN B;  1SLQ A;  2Z5H A;  1K05 A;  1X0T A;  3H1H G;  4CPG A;  1JY2 N;  3NFQ A;  1QLE D;  2JWA A;  2A06 G;  2NPS D;  1RQV A;  3NXS A;  3VMY A;  1T3U A;  3IR9 A;  1SQQ J;  5CCH C;  1OVU A;  5E79 E;  1NWQ A;  2CPB A;  3U59 A;  1JCD A;  3TNU B;  1CW5 A;  2ZVN B;  3FWN A;  1PPJ G;  5KLI C;  2QJK B;  2IBZ E;  1AJY A;  1HJ0 A;  3VMA A;  1KIL B;  3D6Z A;  1NGM B;  3GF3 A;  2JEE A;  3CMA P;  1PZQ A;  2O1J A;  2LR2 A;  5C39 A;  3PH0 A;  2WPS A;  2OYO A;  4GDO A;  2Z4E A;  1CSB A;  3O8Z A;  2Q6Q A;  2WSC H;  1BCC G;  2MKV A;  1VQM P;  2M5A A;  1IFN A;  3VP8 A;  4EYY Q;  1NJI Q;  2P7J A;  3AEF C;  1ZP0 C;  5AVW B;  3HE4 A;  3T97 B;  1H0T B;  1N7S A;  1IK9 A;  1GL2 D;  3L71 J;  3EFF K;  2H7H A;  3GHG A;  3UIA A;  3CWB D;  1YHQ P;  2PFX A;  3AE9 C;  2KXP B;  2KOG A;  4EOT A;  5BU8 B;  3L75 J;  1XTC C;  2O1K A;  5CCH A;  2IBZ G;  2ZYA A;  1L0L E;  3A3Y B;  3Q2Y A;  2NPS A;  1H88 A;  1DX7 A;  1DD3 A;  3AEB C;  2KS1 A;  4OVN F;  2N9B A;  3FXE A;  4UB8 E;  5TJH A;  2QJP B;  1GMJ A;  1SFC C;  4HYT B;  2ZVO B;  2W8Z A;  1VF5 C;  1EXJ A;  1FDI A;  2J58 A;  3HRN A;  2XU6 A;  3IAO A;  5AW7 B;  1EQ7 A;  2GM4 A;  4H0L D;  1NKN A;  2K9J A;  4H44 B;  1SQQ K;  3A5T A;  4U3F E;  4BXL A;  4GIF A;  1FZC C;  1SQX E;  3RL0 D;  2BEZ F;  1WMK A;  4ZMD A;  3HD7 B;  4MN4 C;  1N73 C;  3CX5 H;  2AXT E;  3H1K E;  4C7N A;  4W7Z A;  1RY3 A;  3H6P A;  1NTM J;  4KJM A;  3CL3 D;  1EZV D;  1S72 P;  1P84 I;  2FXM A;  1SQQ D;  2KZJ A;  1KYO I;  3G6E P;  2O3J A;  2Q1K A;  4K35 A;  2Y0C A;  3VMZ A;  3MD0 A;  4LC1 A;  3HTK B;  3Q5S A;  1FS0 E;  3ZDM A;  2CK3 H;  1GTW A;  3D71 A;  1IC2 A;  5KJ7 D;  1RQU A;  3H1I J;  2FYZ A;  5APS A;  3AED C;  4JF7 A;  1LT9 B;  5AVV B;  2JDI H;  1JOC A;  1E5W A;  1PIX A;  1Y9B A;  3TYY A;  1N7S B;  1DH3 A;  1SQX G;  2OYI C;  1W2E A;  3GHG B;  4OH8 B;  5CBN A;  2A45 I;  4EIJ A;  4LLH A;  1NU1 J;  4OGQ D;  1UIX A;  2BCC E;  1OZH A;  1P84 E;  1URQ C;  2H89 C;  1KYO E;  1LTJ A;  3L71 D;  1U7M A;  1AVO A;  2YIU C;  2ZXE B;  1N73 A;  1J1D C;  1PP9 J;  2GUS A;  2E75 C;  1BE3 J;  3MTU E;  1RE4 A;  5M1B A;  3EQ2 A;  5DJU B;  2KYV A;  2FYN C;  2LXC B;  1NAF A;  5AVT B;  3G3Z A;  3CWB G;  1J1E B;  1NTZ E;  5KAI H;  1GZL A;  3L75 D;  4ASV A;  1NTK J;  1S2E A;  1K8A Q;  3B4S A;  1USE A;  1WT6 A;  3Q1M A;  2KLU A;  3II6 A;  4W7Y A;  3USS A;  1HTL C;  3M9H A;  2FYU E;  4U7J A;  2QJK C;  3V2Q A;  2KZI A;  5H2F H;  1M1J B;  1L0N E;  2KNC A;  5KJ7 A;  1EDI A;  3MIW A;  3L72 J;  3BCC J;  1YIJ P;  1KIL C;  1NTM K;  1HBW A;  2R5D A;  4UB6 E;  1SP4 A;  4RJT A;  2HOD A;  3L70 E;  4O9B A;  1CI6 B;  4BRY A;  1GL2 B;  2ZXX A;  1VQO P;  1FAV A;  2Y9Z A;  1URQ A;  1BDC A;  1OFC X;  4PJ0 H;  2YKP A;  2R44 A;  1JEK A;  2OYH A;  4LGD E;  3KDP B;  1IFJ A;  3N7N A;  1NTM D;  1S9K E;  1AQ5 A;  3AE8 C;  1YTZ I;  1L0L J;  2IPP A;  3F5H A;  1EZV G;  4WY4 C;  2C9L Y;  1NU1 K;  4PV1 C;  2QA4 P;  1YJN P;  1YJW P;  3B71 A;  3H1I D;  4I6M C;  1L0N G;  3TGU E;  2B9B A;  1KQL A;  2WZ7 A;  3W67 A;  4IFF A;  1IZN B;  3N4X A;  4XA4 A;  2WQY C;  4Y99 C;  2QJP C;  1FZA A;  2B89 A;  3WUU A;  1Q2N A;  2ZYD A;  1KIL A;  2XND H;  2YKQ A;  2QVA A;  2KB7 P;  1PGO A;  2N1T D;  1NTK K;  1KIL E;  1RF0 C;  1SQV E;  1NU1 D;  5EFW B;  1GU4 A;  2XZR A;  1RF1 B;  4H44 C;  2JKV A;  1VPC A;  3L74 E;  2D2C C;  1PP9 D;  1X9V A;  5CBO A; 
#chains in the Genus database with same CATH homology
 3WUV A;  2Q6Q A;  4BRY B;  3E1R A;  3WUT A;  1UII A;  2ZXX A;  3F5H A;  4BRY A;  3WUU A;  2WVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...