3WUTA

Structure basis of inactivating cell abscission
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
53
structure length
53
Chain Sequence
SFNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and biochemical insights into the role of testis-expressed gene 14 (TEX14) in forming the stable intercellular bridges of germ cells
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Centrosomal protein of 55 kDa
total genus 24
structure length 53
sequence length 53
chains with identical sequence B, D, E, G, H, J, K
ec nomenclature
pdb deposition date 2014-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12180 EABR TSG101 and ALIX binding domain of CEP55
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 3wutA00
4BRYA 2WVRA 3WUVA 3F5HA 3E1RA 2Q6QA 1UIIA 4BRYB 3WUUA 3WUTA 2ZXXA
chains in the Genus database with same CATH superfamily
1PFIA 2A45G 2K37A 3L71E 2KLUA 4A7PA 3CPWO 4RO0A 1NTMK 1SQXK 3AECC 3D70A 2I1KA 1QL2A 1HTLC 1KILC 3KZIE 4Z1MH 3S1KA 3H1JG 2ZJSE 1BSNA 3VMZA 3KDPB 1YHQP 3GHGC 1PPJG 3L70D 3FWLA 3QWOC 5AW3B 3T97A 1KQSO 1WMKA 4DT0A 3L73G 1SQPK 1IK7A 4H0LC 1OFCX 3Q2YA 2KZJA 5KAIH 2LXBA 3G71P 1GL2C 1K8AQ 1FZCB 3M9QA 3Q3DA 2E76D 3AE8C 1FE6A 2P67A 1EZVD 1YI2P 1FZAA 5KLVG 3EQ2A 1PL5A 5BU8B 3H1IG 3MD0A 4NPDA 1BE3J 2QJKB 4LC1A 1GD2E 1NTZG 1ZLLA 4I1LA 1GU4A 3CCLP 3BASA 3R2PA 1S9KD 2YO3A 4R4MA 1PP9E 3RK3E 4IFDK 4C46A 1KILA 5C39A 2RH0A 2WSFH 3WMM0 2WPQA 3SWYA 4D6TG 1M90Q 1LTBC 2O01N 2PP6A 5KJ7D 2SPZA 2YMKA 3E7KA 4PD4D 4XFJA 1S72P 2WSEH 3AEDC 2IYOA 1BCCE 3HD7C 1R5SA 2ZAEB 1UIIA 3HUSA 1N86A 2KS1B 1IJDB 2XNDH 3GW6A 4OGQB 2C0XA 1KQLA 2R5BA 3G3ZA 4N78D 3BRTB 3WUUA 2WITA 1Q90D 1QL1A 3P32A 1OXZA 1R5LA 2IBZI 4PV1B 1P84E 1NHLA 3O8ZA 3VMXA 2JDIH 2KYVA 1PP9J 3JC22 5KJ7C 2LXCB 5TJHA 3TNUA 4L75A 1MUUA 1OX3A 4C7RA 4H0LB 1FOSF 4KT0J 3L72E 1LT9A 1M7LA 3CD6P 3CXHE 3GHGB 1JM0A 1PGQA 3FXDA 2FFDA 1Y47A 3H1LG 2A45H 2C0WA 2KIKA 3OW2O 1BDCA 2ZXEB 1FDIA 1KB9H 2ZT9B 4GIFA 4RKUJ 3O6QB 4W7ZA 1EDJA 1H0TB 1L0NE 1HF9A 3L75E 1LTJA 5AVYB 2WSEJ 2IFMA 1JY3O 2YMYA 2L5GB 1ZV8A 1NU1E 3H1ID 5AW4B 1QGKB 1EZVG 1M1JC 2GA1A 4H13B 2AEJA 3WUVA 4M3LA 4CPGA 2XKMA 5CCGA 1Q86Q 3IAOA 4WBAA 2R44A 2M0BA 1L4AB 4GOFA 1KZUB 4U3FE 5B66E 5CCHC 1IFIA 1NVOA 3BCCG 1U7JA 3H6PA 1N7LA 3SWFA 1EQ7A 2B89A 2XDJA 2OTJP 2K3RA 1SFCD 5EFWB 5K5GB 1NTKK 5AVSB 3VP8A 3N4XA 3SSUA 3LW5H 2G8YA 2IBZE 1YJWP 2QJPB 3AE5C 2J58A 3K5BA 2P58A 3CX5D 2V7QH 4EDFA 3PJSK 1SQQK 1KFNA 3CC2P 1SS1A 2QJPC 1LJ2A 5KAIE 3TNUB 3PH0A 4IOIH 3RBXA 3MUDA 2W8ZA 1M1KQ 1GMJA 1LWUA 4YTPC 1G1JA 2BEQD 1LGHB 2HG5D 3L73D 5AVTB 1RF0C 1T8ZA 1S5LX 3VYIA 1R8EA 2MKVA 5H2FE 4I7ZC 3RGUA 1ZMEC 3RL0C 2NPSC 2RKLA 1JY3P 4H0LD 1EDIA 3GF3A 1SQVK 1KB9D 1QEXA 3MGNA 1U57A 2CK3H 2O3JA 3CWBE 1HJ0A 3L74J 3P7KA 1ZR4A 2O1JA 2FYUE 1Q2NA 2A45I 3KQGA 2IBZG 3AEBC 1EDLA 5AVRB 1NTZD 5CMZA 2FKWB 3G6EP 1H0TA 4OGQD 2E5YA 2R3CA 3GLMA 3E1IA 1Y8AA 3CWBJ 3L74E 1L0LJ 4O9BA 1KILE 4OVNF 3SWKA 3P8CE 3CCJP 3MIWA 1M1JA 5CBNA 3WUTA 1ZP0C 2NRGA 3H1JJ 1YJNP 4IL6H 3JCUE 1GU5A 1D7MA 2WTYA 1VQ7P 3A0HE 3TDKA 2KSEA 3HTKA 4BXLA 4YXDC 1QVGO 1FJPA 5KJ7A 2QRXA 2B9BA 2KI7B 2D2CD 3ITKA 1YIJP 1DEEG 1PP9D 2BCCD 3RK3D 5CCHD 1JTHB 1SQQG 2M8RA 3KYQA 1L0NG 3A3YB 4PJ0H 4MN4C 1HWTC 2N1TB 4Y99C 1AQTA 1FOSE 4H13C 1SQVE 3NTNA 1LTGC 4JPZB 5KLVJ 1G1IA 1CSBA 3CC7P 5APQA 1PIXA 5B5EH 4TLFA 5KLIC 3HD7B 2W6JH 4K3AA 2FYNB 1JY3N 2J5UA 1USEA 1Q81Q 1SQBJ 1JCCA 2JJLA 1W2BO 1EXIA 1VQ4P 3JSVC 2PAJA 1BGYD 1VDFA 3LW5J 3Q5SA 2VRSA 2POHA 3HE4B 3H1KE 1S4XA 4D6TD 5CJ4A 5TISE 4RESB 4W7YA 2GUSA 1SQQE 2GM4A 3H1HJ 3M06A 3M9HA 2IZ1A 4LGDE 5H2FH 1CW5A 1OVVA 3FX0A 4H13D 1XTGB 1NU1J 1X9VA 1RE4C 2A06D 2FBWC 3F5HA 1QVFO 2NZ2A 3CLQA 4UB8H 3UIAA 1FJKA 2Z4EA 3H32A 1BE3D 2NPSD 5AVWB 2MJZA 4JYCA 3CXHD 4NPFX 3TGUG 5KLVD 4BRYB 5KAFH 3H1HE 4IL6E 2WVRA 1NTMD 4OH8B 3H1KJ 4Y28J 3FGAD 3HE4A 2QVAA 2AEFA 5GTIE 2N1TA 5BVZA 1FZCC 3CMEP 1SQBE 3L75D 3L71J 1LP1A 1S1CX 3V2RA 1GDTA 5AVZB 3L72J 2FFDB 3B8EB 3HD7A 2K9JB 2AXCA 1LT9B 1SFCC 3H1LJ 5APUA 2OYIC 4JQ0D 2M3EA 3PP5A 1LWUC 3RK2B 3V6IA 1LTIC 1HGZA 1SQXE 2Y0CA 1A02F 1PGJA 3AEAC 4L76A 3LIEA 5E79E 4L73A 2NPSA 5AW0B 2DW3A 3TGUE 3MP7B 3IR9A 3I5CA 4PD4E 1H8AA 3HTKB 3ABVC 1JOCA 1QLED 2RMZA 3H32B 4W80A 1GK4A 4OWFA 1J1EC 4R4LA 1PPJE 3EFFK 3KXDA 1S5LH 3D71A 3M9BA 1UIXA 2K1AA 2ZYGA 5AVXB 5AW8B 4NPEA 1AA0A 1E5WA 1JTHA 3H1JE 5AW9B 1S3JA 4PD4H 5GTIH 1FZCA 2QE7H 2B88A 1M57D 3PHLA 4WWIA 1GL2B 4HH2A 3BCCJ 3CCMP 3BATA 1RF1C 5L8RJ 2YKOA 1FZFA 4AQRD 1NTKD 3G9RA 2KNCB 2WMMA 1FU1A 2FYUJ 2D2CC 4WY4A 3B5NC 1EC5A 1WRGA 3EWKA 3L4FA 3N7NA 3U1CA 2Y0EA 3RK3C 1JY2N 2QJYB 5CCGC 3S4RA 2W6BA 1URQD 2E76B 3VP9A 1NTMJ 1RQUA 2HFED 1KQGB 1M56D 2Y0DA 2ZXXA 1VQOP 1NKZB 2HLOA 1BSHA 4H44D 1VL2A 3AEEC 1ZW0A 1BCCD 3GF7A 3QH9A 5KKZC 2IPPA 1KYOD 2XU6A 1LTSC 1S2EA 2ZYDA 2QEXP 3S9OA 3CCQP 1NU1D 3KHUA 4AUWA 2WPVB 2XV5A 1DIPA 1HGVA 1SQPJ 1OMIA 1VQPP 1FDMA 2V7QJ 1KILD 3L74G 2CPBA 3P8CD 5DJTB 5AVUB 3RK2D 1EZVI 1FBMA 2OYHA 3AE6C 3OA7A 1RE3A 3PTZA 4WY4D 2K9JA 3CCUP 3Q1MA 2WZ7A 3L72D 3CC4P 1ZRTE 1JMMA 1KORA 1OWAA 1NAYA 1URQA 1VF5C 4WVZA 4U3FJ 1RE4A 2M3BA 3CWBG 1L0LG 1PGPA 2JWDA 2KLVA 1L4AA 3V4WA 2H89C 2P1JA 2QJYC 2IFNA 1LT1A 1JY2O 1N7SA 2ZT9C 1YQ3C 2HPCA 1PV3A 3L36A 4EIJA 3B5NB 3LIDA 2W90A 1IC2A 1PGOA 4TT3H 1NGMB 2OYIB 3M0DC 2ZVOB 1HUCA 3V2QA 3V5BA 1KYOI 1KYOH 3HE5B 3IF4A 3KZIH 2JO1A 2HODA 3NMDA 1H88A 2WWWA 2OTLP 1SQQJ 1KMIZ 1SQXG 1L0NJ 1NWQA 3H1KD 2PFXA 5KAFE 1M1JB 1GK6A 1E79H 1OZHA 1BDDA 2I8DA 1G2CB 2Q5UA 2FYUD 1AVOA 1OVRA 2Q7CA 1J1EB 4ZNCA 3M0AA 3IN6A 3D6YA 1ZN5A 4ASWA 1NTZE 1K05A 3MTUE 3HE5A 2QSIA 1RH5B 3SFEC 1SQBG 1DD4A 3BCCE 5CCGD 5KLVE 3II6A 3MHVA 3U1AA 1N7SC 3CX5H 2OTKE 1JEKA 1P84D 1Y9BA 1P84I 2BCCJ 3L74D 1N7SB 3C1LA 1SP4A 2OGUA 1EZVE 3H1HG 5APYA 2CPSA 3G4SP 1KD1Q 1BGYJ 4H44C 2OYHB 1VQ9P 1NU1K 1NU1G 2HYNA 3PRJA 4DOJA 5GTHH 2IZ0A 4RJTA 2KP8A 3Q5PA 1BCCJ 1VQMP 2R5DA 1JCDA 1SFCA 3A2AA 3TGUJ 1PZQA 4GDOA 3L75G 2Q1KA 3AEGC 4WY4B 4Y99B 1XTCC 2AXTH 2WSCJ 2XNXA 2YO2A 3H1KG 1A02J 3FWNA 2H7HA 2YIUC 3CWBD 4WY4C 1AV1A 1JB0J 1K04A 3B5NA 3L71G 2E43A 3H1LE 5KTBA 4IL6X 1SQVD 5APVA 4DZOA 1GZLA 1KQFB 5AW7B 3Q5RA 3L72G 3AEFC 1W5CE 5BU5A 1MZ9A 1YJ9P 3A0BE 3AE9C 3IFMA 3C8VA 1SQVG 3W67A 1AFOA 3EFGA 1KILB 5CJ0A 3WU2E 1CI6A 3V2NA 1EDKA 1NYHA 2AXTE 5AVVB 4BWNA 1K73Q 2P2UA 2Y9YA 4YXWH 1IFJA 1N2DC 2QG4A 4U3FD 1KC8Q 1H89A 1VQNP 2FXMA 1JUNA 1VF5B 1MFTA 3I56P 2YNYA 3L37A 3CXHI 3CXHH 2HR3A 1RF1A 3HUSB 2KNCA 3R4YA 4GODA 3BVHA 2WPSA 2YXRB 4BRYA 3AE7C 1FZEA 1FC2C 2O01J 2K9YA 1RE3C 1GW3A 2E74B 4L74A 3NFQA 4C7NA 1JY2P 1WT6A 2YKPA 1L0ND 2J59M 1SQPD 4PJ0E 5APWA 1N8RQ 3F89A 1VQLP 4N3YB 1LP1B 3C9IA 1USDA 1NH4A 1SQBD 1QX8A 2YKQA 2BEZF 3WU2H 3AE2C 2E75B 5KKZB 2B87B 4XA4A 4ASVA 2QA4P 3H1IE 3L70J 1T3UA 1ZOYC 3A7OA 2FYUG 1OVUA 4UB6H 2E76C 1LTJC 2BASA 3AE4C 1LTJB 1L0LD 1MFZA 3B71A 1NTMG 4DCKA 1FZGA 3CCVP 1IFMA 3H25A 1HBWA 1GL2A 1NTKJ 1RQVA 2XZRA 3AE3C 4JBZA 3FXEA 3CL3D 3TGUD 3L35A 3ZDMA 5APXA 2HODB 4QMAA 1NOHA 1YYCA 1J2JB 2W6AA 1J1DB 2N9BA 5CBOA 3RL0g 5APSA 1KTMA 1VPCA 1SQPG 2QIWA 1L4AC 2OQQA 1NTME 5E79H 2PRRA 2IYPA 4GOEA 3TF5A 2WSCH 4EOTA 1J1DC 3RL0B 3U59A 1N73C 2Q3IA 2H8PD 3GHGA 2ZVNB 2P7JA 2I1JA 2W27A 2JEEA 3B5ND 3CMAP 2OYOA 1LNQA 4AYCA 4U3FG 3RL0D 1YBKA 2OARA 5B66H 1NAFA 4ZKPA 1IO4A 1SQXD 2PGDA 2YXQB 3E1RA 2ZFCA 1SVFA 2WT7B 1N7SD 2KSJA 4HKZH 1DX7A 2V4HA 2Y9ZA 3A5TA 4HB1A 1X22A 3CCSP 2JWAA 2KZIA 2FXPA 3JCUH 3VTPC 4ZMDA 1YQ4C 1U7MA 2E75C 3CI9A 2A06G 4N78E 2WPRA 3L73J 2O1KA 3L71D 1SLQA 1VQ5P 4GKGA 2RN0A 1BGYE 1P84H 2WSFJ 1SQBK 2O01H 2M5AB 1AVYA 3BCCD 3CX5I 4C7NB 1SQXJ 4EYYQ 3TYYA 3V4QA 3O6QA 1T2KC 3HRNA 2C9NY 4PV1C 2LR2A 2E74C 3RK3B 2FYZA 1NKNA 2HPCB 3H1IJ 3L70E 1X79B 1HH0A 5GTHE 3M0DA 1BE3G 3HUSC 5AW6B 1Q82Q 1NTZJ 5B5EE 4HJGH 1BE3E 2E75D 1L0LK 2E5TA 4U7JA 2ZYAA 1FAVA 1ZRTD 1URQB 5DJUB 3T97B 3H1HD 2OYHC 3SFDC 1YTZT 1EXJA 1CI6B 3CX5E 1RHZB 4K35A 4D6TJ 1HVVA 2M5AA 2BCCG 2R3SA 2KB7P 1GTWA 4JYBA 4PD4I 4KJMA 1LWUB 1BGYG 3RK2C 1URQC 2E74D 4ZKUA 2C9LY 1IZNB 1NTZK 3GG2A 1X8YA 1LT9C 1SFCB 2FYNC 2Z5HA 1BCCG 2KS1A 4GT1A 2P10A 2QJKC 3TSIA 5KLIB 1KFMA 1LTAC 3VOPA 3A0BH 1S9KE 2FFDC 3VMYA 1GL2D 1OW6A 3BRVB 2R32A 3V2PA 1VF5D 3L75J 1FDOA 5AW5B 1KV4A 2YIUB 2E42A 4D6TE 2WT7A 1HJBA 4XE5B 1CZQA 3AE1C 3NXSA 4KHXA 1AJYA 1PP9G 4B86A 2W83C 1IFNA 2FY8A 4I2LC 2AEMA 4OGQC 5AW2B 2Q6QA 5AVQB 3VN0A 4WB4A 2IBZD 1SQVJ 3MUDC 4H44B 1ZR2A 3D6ZA 1DD3A 3PLNA 2ITAA 2KUBA 1DH3A 3P8MC 1MKMA 1NO4A 5CCHA 1OIPA 1AQ5A 1MV8A 1SQPE 2JKVA 1GW4A 3L73E 1VQKP 3I55P 1LTTC 2KK7A 2Q3EA 2QM7A 3VMAA 3B4SA 1ZXGA 3M91A 4I6MC 3KPEA 1K9MQ 1N73A 1JO5A 1IK9A 1KB9E 1T3JA 2L91A 2BCCE 2N1TC 2FYUK 1W2EA 2IDBA 2N9YB 3OJAB 1FZBA 2KOGA 2UWJE 2Z5IA 4JF7A 1L0NK 1L4AD 3GMAA 4LLHA 4PV1D 1JNMA 3CCRP 1L0LE 2H88C 2NPSB 4UB6E 5CHXA 2H43A 4HYTB 4I7ZB 3H1LD 2OYIA 2WSSH 1YTZI 3MZWB 3HD7D 4UB8E 4EI2A 1IFDA 1PPJD 3L70G 1KYOE 1KN7A 3RBZA 3W68A 3H1JD 2WQYC 2Q9IA 3TK1A 5AW1B 1OW8A 1NJIQ 2N1TD 5TISH 1Q7YQ 3USSA 1SQQD 1RY3A 4DJGA 4N6JA 2D2CB 5KLVK 1OW7A 1NTKG 2A06E 2G3AA 1M8OB 2KXPB 3A0HH 4YPCA 1YITP 1RF1B 2JP3A 3CCEP 1NTKE 1DEBA 1Z56A 1FS0E 1N73B 1VQ6P 1T2KD 4IFMA 1X0TA 2K88A 1VQ8P 1KB9I 2ZT9D 1T6AA 2FXOA 1S5LE 1IFPA 3OAKA 5APTA 1G2CA 1TU3F 5M1BA 1JMBA 1RF0A 2B87A 2QM8A 1L2PA 4IFFA 2GUVA 2IX7C 2JR8A 2LKMA
chains in the Genus database with same CATH topology
4BRYA 2WVRA 3WUVA 3F5HA 3E1RA 2Q6QA 1UIIA 4BRYB 3WUUA 3WUTA 2ZXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BRY A;  2WVR A;  3WUV A;  3F5H A;  3E1R A;  2Q6Q A;  1UII A;  4BRY B;  3WUU A;  3WUT A;  2ZXX A; 
#chains in the Genus database with same CATH topology
 1PFI A;  2A45 G;  2K37 A;  3L71 E;  2KLU A;  4A7P A;  3CPW O;  4RO0 A;  1NTM K;  1SQX K;  3AEC C;  3D70 A;  2I1K A;  1QL2 A;  1HTL C;  1KIL C;  3KZI E;  4Z1M H;  3S1K A;  3H1J G;  2ZJS E;  1BSN A;  3VMZ A;  3KDP B;  1YHQ P;  3GHG C;  1PPJ G;  3L70 D;  3FWL A;  3QWO C;  5AW3 B;  3T97 A;  1KQS O;  1WMK A;  4DT0 A;  3L73 G;  1SQP K;  1IK7 A;  4H0L C;  1OFC X;  3Q2Y A;  2KZJ A;  5KAI H;  2LXB A;  3G71 P;  1GL2 C;  1K8A Q;  1FZC B;  3M9Q A;  3Q3D A;  2E76 D;  3AE8 C;  1FE6 A;  2P67 A;  1EZV D;  1YI2 P;  1FZA A;  5KLV G;  3EQ2 A;  1PL5 A;  5BU8 B;  3H1I G;  3MD0 A;  4NPD A;  1BE3 J;  2QJK B;  4LC1 A;  1GD2 E;  1NTZ G;  1ZLL A;  4I1L A;  1GU4 A;  3CCL P;  3BAS A;  3R2P A;  1S9K D;  2YO3 A;  4R4M A;  1PP9 E;  3RK3 E;  4IFD K;  4C46 A;  1KIL A;  5C39 A;  2RH0 A;  2WSF H;  3WMM 0;  2WPQ A;  3SWY A;  4D6T G;  1M90 Q;  1LTB C;  2O01 N;  2PP6 A;  5KJ7 D;  2SPZ A;  2YMK A;  3E7K A;  4PD4 D;  4XFJ A;  1S72 P;  2WSE H;  3AED C;  2IYO A;  1BCC E;  3HD7 C;  1R5S A;  2ZAE B;  1UII A;  3HUS A;  1N86 A;  2KS1 B;  1IJD B;  2XND H;  3GW6 A;  4OGQ B;  2C0X A;  1KQL A;  2R5B A;  3G3Z A;  4N78 D;  3BRT B;  3WUU A;  2WIT A;  1Q90 D;  1QL1 A;  3P32 A;  1OXZ A;  1R5L A;  2IBZ I;  4PV1 B;  1P84 E;  1NHL A;  3O8Z A;  3VMX A;  2JDI H;  2KYV A;  1PP9 J;  3JC2 2;  5KJ7 C;  2LXC B;  5TJH A;  3TNU A;  4L75 A;  1MUU A;  1OX3 A;  4C7R A;  4H0L B;  1FOS F;  4KT0 J;  3L72 E;  1LT9 A;  1M7L A;  3CD6 P;  3CXH E;  3GHG B;  1JM0 A;  1PGQ A;  3FXD A;  2FFD A;  1Y47 A;  3H1L G;  2A45 H;  2C0W A;  2KIK A;  3OW2 O;  1BDC A;  2ZXE B;  1FDI A;  1KB9 H;  2ZT9 B;  4GIF A;  4RKU J;  3O6Q B;  4W7Z A;  1EDJ A;  1H0T B;  1L0N E;  1HF9 A;  3L75 E;  1LTJ A;  5AVY B;  2WSE J;  2IFM A;  1JY3 O;  2YMY A;  2L5G B;  1ZV8 A;  1NU1 E;  3H1I D;  5AW4 B;  1QGK B;  1EZV G;  1M1J C;  2GA1 A;  4H13 B;  2AEJ A;  3WUV A;  4M3L A;  4CPG A;  2XKM A;  5CCG A;  1Q86 Q;  3IAO A;  4WBA A;  2R44 A;  2M0B A;  1L4A B;  4GOF A;  1KZU B;  4U3F E;  5B66 E;  5CCH C;  1IFI A;  1NVO A;  3BCC G;  1U7J A;  3H6P A;  1N7L A;  3SWF A;  1EQ7 A;  2B89 A;  2XDJ A;  2OTJ P;  2K3R A;  1SFC D;  5EFW B;  5K5G B;  1NTK K;  5AVS B;  3VP8 A;  3N4X A;  3SSU A;  3LW5 H;  2G8Y A;  2IBZ E;  1YJW P;  2QJP B;  3AE5 C;  2J58 A;  3K5B A;  2P58 A;  3CX5 D;  2V7Q H;  4EDF A;  3PJS K;  1SQQ K;  1KFN A;  3CC2 P;  1SS1 A;  2QJP C;  1LJ2 A;  5KAI E;  3TNU B;  3PH0 A;  4IOI H;  3RBX A;  3MUD A;  2W8Z A;  1M1K Q;  1GMJ A;  1LWU A;  4YTP C;  1G1J A;  2BEQ D;  1LGH B;  2HG5 D;  3L73 D;  5AVT B;  1RF0 C;  1T8Z A;  1S5L X;  3VYI A;  1R8E A;  2MKV A;  5H2F E;  4I7Z C;  3RGU A;  1ZME C;  3RL0 C;  2NPS C;  2RKL A;  1JY3 P;  4H0L D;  1EDI A;  3GF3 A;  1SQV K;  1KB9 D;  1QEX A;  3MGN A;  1U57 A;  2CK3 H;  2O3J A;  3CWB E;  1HJ0 A;  3L74 J;  3P7K A;  1ZR4 A;  2O1J A;  2FYU E;  1Q2N A;  2A45 I;  3KQG A;  2IBZ G;  3AEB C;  1EDL A;  5AVR B;  1NTZ D;  5CMZ A;  2FKW B;  3G6E P;  1H0T A;  4OGQ D;  2E5Y A;  2R3C A;  3GLM A;  3E1I A;  1Y8A A;  3CWB J;  3L74 E;  1L0L J;  4O9B A;  1KIL E;  4OVN F;  3SWK A;  3P8C E;  3CCJ P;  3MIW A;  1M1J A;  5CBN A;  3WUT A;  1ZP0 C;  2NRG A;  3H1J J;  1YJN P;  4IL6 H;  3JCU E;  1GU5 A;  1D7M A;  2WTY A;  1VQ7 P;  3A0H E;  3TDK A;  2KSE A;  3HTK A;  4BXL A;  4YXD C;  1QVG O;  1FJP A;  5KJ7 A;  2QRX A;  2B9B A;  2KI7 B;  2D2C D;  3ITK A;  1YIJ P;  1DEE G;  1PP9 D;  2BCC D;  3RK3 D;  5CCH D;  1JTH B;  1SQQ G;  2M8R A;  3KYQ A;  1L0N G;  3A3Y B;  4PJ0 H;  4MN4 C;  1HWT C;  2N1T B;  4Y99 C;  1AQT A;  1FOS E;  4H13 C;  1SQV E;  3NTN A;  1LTG C;  4JPZ B;  5KLV J;  1G1I A;  1CSB A;  3CC7 P;  5APQ A;  1PIX A;  5B5E H;  4TLF A;  5KLI C;  3HD7 B;  2W6J H;  4K3A A;  2FYN B;  1JY3 N;  2J5U A;  1USE A;  1Q81 Q;  1SQB J;  1JCC A;  2JJL A;  1W2B O;  1EXI A;  1VQ4 P;  3JSV C;  2PAJ A;  1BGY D;  1VDF A;  3LW5 J;  3Q5S A;  2VRS A;  2POH A;  3HE4 B;  3H1K E;  1S4X A;  4D6T D;  5CJ4 A;  5TIS E;  4RES B;  4W7Y A;  2GUS A;  1SQQ E;  2GM4 A;  3H1H J;  3M06 A;  3M9H A;  2IZ1 A;  4LGD E;  5H2F H;  1CW5 A;  1OVV A;  3FX0 A;  4H13 D;  1XTG B;  1NU1 J;  1X9V A;  1RE4 C;  2A06 D;  2FBW C;  3F5H A;  1QVF O;  2NZ2 A;  3CLQ A;  4UB8 H;  3UIA A;  1FJK A;  2Z4E A;  3H32 A;  1BE3 D;  2NPS D;  5AVW B;  2MJZ A;  4JYC A;  3CXH D;  4NPF X;  3TGU G;  5KLV D;  4BRY B;  5KAF H;  3H1H E;  4IL6 E;  2WVR A;  1NTM D;  4OH8 B;  3H1K J;  4Y28 J;  3FGA D;  3HE4 A;  2QVA A;  2AEF A;  5GTI E;  2N1T A;  5BVZ A;  1FZC C;  3CME P;  1SQB E;  3L75 D;  3L71 J;  1LP1 A;  1S1C X;  3V2R A;  1GDT A;  5AVZ B;  3L72 J;  2FFD B;  3B8E B;  3HD7 A;  2K9J B;  2AXC A;  1LT9 B;  1SFC C;  3H1L J;  5APU A;  2OYI C;  4JQ0 D;  2M3E A;  3PP5 A;  1LWU C;  3RK2 B;  3V6I A;  1LTI C;  1HGZ A;  1SQX E;  2Y0C A;  1A02 F;  1PGJ A;  3AEA C;  4L76 A;  3LIE A;  5E79 E;  4L73 A;  2NPS A;  5AW0 B;  2DW3 A;  3TGU E;  3MP7 B;  3IR9 A;  3I5C A;  4PD4 E;  1H8A A;  3HTK B;  3ABV C;  1JOC A;  1QLE D;  2RMZ A;  3H32 B;  4W80 A;  1GK4 A;  4OWF A;  1J1E C;  4R4L A;  1PPJ E;  3EFF K;  3KXD A;  1S5L H;  3D71 A;  3M9B A;  1UIX A;  2K1A A;  2ZYG A;  5AVX B;  5AW8 B;  4NPE A;  1AA0 A;  1E5W A;  1JTH A;  3H1J E;  5AW9 B;  1S3J A;  4PD4 H;  5GTI H;  1FZC A;  2QE7 H;  2B88 A;  1M57 D;  3PHL A;  4WWI A;  1GL2 B;  4HH2 A;  3BCC J;  3CCM P;  3BAT A;  1RF1 C;  5L8R J;  2YKO A;  1FZF A;  4AQR D;  1NTK D;  3G9R A;  2KNC B;  2WMM A;  1FU1 A;  2FYU J;  2D2C C;  4WY4 A;  3B5N C;  1EC5 A;  1WRG A;  3EWK A;  3L4F A;  3N7N A;  3U1C A;  2Y0E A;  3RK3 C;  1JY2 N;  2QJY B;  5CCG C;  3S4R A;  2W6B A;  1URQ D;  2E76 B;  3VP9 A;  1NTM J;  1RQU A;  2HFE D;  1KQG B;  1M56 D;  2Y0D A;  2ZXX A;  1VQO P;  1NKZ B;  2HLO A;  1BSH A;  4H44 D;  1VL2 A;  3AEE C;  1ZW0 A;  1BCC D;  3GF7 A;  3QH9 A;  5KKZ C;  2IPP A;  1KYO D;  2XU6 A;  1LTS C;  1S2E A;  2ZYD A;  2QEX P;  3S9O A;  3CCQ P;  1NU1 D;  3KHU A;  4AUW A;  2WPV B;  2XV5 A;  1DIP A;  1HGV A;  1SQP J;  1OMI A;  1VQP P;  1FDM A;  2V7Q J;  1KIL D;  3L74 G;  2CPB A;  3P8C D;  5DJT B;  5AVU B;  3RK2 D;  1EZV I;  1FBM A;  2OYH A;  3AE6 C;  3OA7 A;  1RE3 A;  3PTZ A;  4WY4 D;  2K9J A;  3CCU P;  3Q1M A;  2WZ7 A;  3L72 D;  3CC4 P;  1ZRT E;  1JMM A;  1KOR A;  1OWA A;  1NAY A;  1URQ A;  1VF5 C;  4WVZ A;  4U3F J;  1RE4 A;  2M3B A;  3CWB G;  1L0L G;  1PGP A;  2JWD A;  2KLV A;  1L4A A;  3V4W A;  2H89 C;  2P1J A;  2QJY C;  2IFN A;  1LT1 A;  1JY2 O;  1N7S A;  2ZT9 C;  1YQ3 C;  2HPC A;  1PV3 A;  3L36 A;  4EIJ A;  3B5N B;  3LID A;  2W90 A;  1IC2 A;  1PGO A;  4TT3 H;  1NGM B;  2OYI B;  3M0D C;  2ZVO B;  1HUC A;  3V2Q A;  3V5B A;  1KYO I;  1KYO H;  3HE5 B;  3IF4 A;  3KZI H;  2JO1 A;  2HOD A;  3NMD A;  1H88 A;  2WWW A;  2OTL P;  1SQQ J;  1KMI Z;  1SQX G;  1L0N J;  1NWQ A;  3H1K D;  2PFX A;  5KAF E;  1M1J B;  1GK6 A;  1E79 H;  1OZH A;  1BDD A;  2I8D A;  1G2C B;  2Q5U A;  2FYU D;  1AVO A;  1OVR A;  2Q7C A;  1J1E B;  4ZNC A;  3M0A A;  3IN6 A;  3D6Y A;  1ZN5 A;  4ASW A;  1NTZ E;  1K05 A;  3MTU E;  3HE5 A;  2QSI A;  1RH5 B;  3SFE C;  1SQB G;  1DD4 A;  3BCC E;  5CCG D;  5KLV E;  3II6 A;  3MHV A;  3U1A A;  1N7S C;  3CX5 H;  2OTK E;  1JEK A;  1P84 D;  1Y9B A;  1P84 I;  2BCC J;  3L74 D;  1N7S B;  3C1L A;  1SP4 A;  2OGU A;  1EZV E;  3H1H G;  5APY A;  2CPS A;  3G4S P;  1KD1 Q;  1BGY J;  4H44 C;  2OYH B;  1VQ9 P;  1NU1 K;  1NU1 G;  2HYN A;  3PRJ A;  4DOJ A;  5GTH H;  2IZ0 A;  4RJT A;  2KP8 A;  3Q5P A;  1BCC J;  1VQM P;  2R5D A;  1JCD A;  1SFC A;  3A2A A;  3TGU J;  1PZQ A;  4GDO A;  3L75 G;  2Q1K A;  3AEG C;  4WY4 B;  4Y99 B;  1XTC C;  2AXT H;  2WSC J;  2XNX A;  2YO2 A;  3H1K G;  1A02 J;  3FWN A;  2H7H A;  2YIU C;  3CWB D;  4WY4 C;  1AV1 A;  1JB0 J;  1K04 A;  3B5N A;  3L71 G;  2E43 A;  3H1L E;  5KTB A;  4IL6 X;  1SQV D;  5APV A;  4DZO A;  1GZL A;  1KQF B;  5AW7 B;  3Q5R A;  3L72 G;  3AEF C;  1W5C E;  5BU5 A;  1MZ9 A;  1YJ9 P;  3A0B E;  3AE9 C;  3IFM A;  3C8V A;  1SQV G;  3W67 A;  1AFO A;  3EFG A;  1KIL B;  5CJ0 A;  3WU2 E;  1CI6 A;  3V2N A;  1EDK A;  1NYH A;  2AXT E;  5AVV B;  4BWN A;  1K73 Q;  2P2U A;  2Y9Y A;  4YXW H;  1IFJ A;  1N2D C;  2QG4 A;  4U3F D;  1KC8 Q;  1H89 A;  1VQN P;  2FXM A;  1JUN A;  1VF5 B;  1MFT A;  3I56 P;  2YNY A;  3L37 A;  3CXH I;  3CXH H;  2HR3 A;  1RF1 A;  3HUS B;  2KNC A;  3R4Y A;  4GOD A;  3BVH A;  2WPS A;  2YXR B;  4BRY A;  3AE7 C;  1FZE A;  1FC2 C;  2O01 J;  2K9Y A;  1RE3 C;  1GW3 A;  2E74 B;  4L74 A;  3NFQ A;  4C7N A;  1JY2 P;  1WT6 A;  2YKP A;  1L0N D;  2J59 M;  1SQP D;  4PJ0 E;  5APW A;  1N8R Q;  3F89 A;  1VQL P;  4N3Y B;  1LP1 B;  3C9I A;  1USD A;  1NH4 A;  1SQB D;  1QX8 A;  2YKQ A;  2BEZ F;  3WU2 H;  3AE2 C;  2E75 B;  5KKZ B;  2B87 B;  4XA4 A;  4ASV A;  2QA4 P;  3H1I E;  3L70 J;  1T3U A;  1ZOY C;  3A7O A;  2FYU G;  1OVU A;  4UB6 H;  2E76 C;  1LTJ C;  2BAS A;  3AE4 C;  1LTJ B;  1L0L D;  1MFZ A;  3B71 A;  1NTM G;  4DCK A;  1FZG A;  3CCV P;  1IFM A;  3H25 A;  1HBW A;  1GL2 A;  1NTK J;  1RQV A;  2XZR A;  3AE3 C;  4JBZ A;  3FXE A;  3CL3 D;  3TGU D;  3L35 A;  3ZDM A;  5APX A;  2HOD B;  4QMA A;  1NOH A;  1YYC A;  1J2J B;  2W6A A;  1J1D B;  2N9B A;  5CBO A;  3RL0 g;  5APS A;  1KTM A;  1VPC A;  1SQP G;  2QIW A;  1L4A C;  2OQQ A;  1NTM E;  5E79 H;  2PRR A;  2IYP A;  4GOE A;  3TF5 A;  2WSC H;  4EOT A;  1J1D C;  3RL0 B;  3U59 A;  1N73 C;  2Q3I A;  2H8P D;  3GHG A;  2ZVN B;  2P7J A;  2I1J A;  2W27 A;  2JEE A;  3B5N D;  3CMA P;  2OYO A;  1LNQ A;  4AYC A;  4U3F G;  3RL0 D;  1YBK A;  2OAR A;  5B66 H;  1NAF A;  4ZKP A;  1IO4 A;  1SQX D;  2PGD A;  2YXQ B;  3E1R A;  2ZFC A;  1SVF A;  2WT7 B;  1N7S D;  2KSJ A;  4HKZ H;  1DX7 A;  2V4H A;  2Y9Z A;  3A5T A;  4HB1 A;  1X22 A;  3CCS P;  2JWA A;  2KZI A;  2FXP A;  3JCU H;  3VTP C;  4ZMD A;  1YQ4 C;  1U7M A;  2E75 C;  3CI9 A;  2A06 G;  4N78 E;  2WPR A;  3L73 J;  2O1K A;  3L71 D;  1SLQ A;  1VQ5 P;  4GKG A;  2RN0 A;  1BGY E;  1P84 H;  2WSF J;  1SQB K;  2O01 H;  2M5A B;  1AVY A;  3BCC D;  3CX5 I;  4C7N B;  1SQX J;  4EYY Q;  3TYY A;  3V4Q A;  3O6Q A;  1T2K C;  3HRN A;  2C9N Y;  4PV1 C;  2LR2 A;  2E74 C;  3RK3 B;  2FYZ A;  1NKN A;  2HPC B;  3H1I J;  3L70 E;  1X79 B;  1HH0 A;  5GTH E;  3M0D A;  1BE3 G;  3HUS C;  5AW6 B;  1Q82 Q;  1NTZ J;  5B5E E;  4HJG H;  1BE3 E;  2E75 D;  1L0L K;  2E5T A;  4U7J A;  2ZYA A;  1FAV A;  1ZRT D;  1URQ B;  5DJU B;  3T97 B;  3H1H D;  2OYH C;  3SFD C;  1YTZ T;  1EXJ A;  1CI6 B;  3CX5 E;  1RHZ B;  4K35 A;  4D6T J;  1HVV A;  2M5A A;  2BCC G;  2R3S A;  2KB7 P;  1GTW A;  4JYB A;  4PD4 I;  4KJM A;  1LWU B;  1BGY G;  3RK2 C;  1URQ C;  2E74 D;  4ZKU A;  2C9L Y;  1IZN B;  1NTZ K;  3GG2 A;  1X8Y A;  1LT9 C;  1SFC B;  2FYN C;  2Z5H A;  1BCC G;  2KS1 A;  4GT1 A;  2P10 A;  2QJK C;  3TSI A;  5KLI B;  1KFM A;  1LTA C;  3VOP A;  3A0B H;  1S9K E;  2FFD C;  3VMY A;  1GL2 D;  1OW6 A;  3BRV B;  2R32 A;  3V2P A;  1VF5 D;  3L75 J;  1FDO A;  5AW5 B;  1KV4 A;  2YIU B;  2E42 A;  4D6T E;  2WT7 A;  1HJB A;  4XE5 B;  1CZQ A;  3AE1 C;  3NXS A;  4KHX A;  1AJY A;  1PP9 G;  4B86 A;  2W83 C;  1IFN A;  2FY8 A;  4I2L C;  2AEM A;  4OGQ C;  5AW2 B;  2Q6Q A;  5AVQ B;  3VN0 A;  4WB4 A;  2IBZ D;  1SQV J;  3MUD C;  4H44 B;  1ZR2 A;  3D6Z A;  1DD3 A;  3PLN A;  2ITA A;  2KUB A;  1DH3 A;  3P8M C;  1MKM A;  1NO4 A;  5CCH A;  1OIP A;  1AQ5 A;  1MV8 A;  1SQP E;  2JKV A;  1GW4 A;  3L73 E;  1VQK P;  3I55 P;  1LTT C;  2KK7 A;  2Q3E A;  2QM7 A;  3VMA A;  3B4S A;  1ZXG A;  3M91 A;  4I6M C;  3KPE A;  1K9M Q;  1N73 A;  1JO5 A;  1IK9 A;  1KB9 E;  1T3J A;  2L91 A;  2BCC E;  2N1T C;  2FYU K;  1W2E A;  2IDB A;  2N9Y B;  3OJA B;  1FZB A;  2KOG A;  2UWJ E;  2Z5I A;  4JF7 A;  1L0N K;  1L4A D;  3GMA A;  4LLH A;  4PV1 D;  1JNM A;  3CCR P;  1L0L E;  2H88 C;  2NPS B;  4UB6 E;  5CHX A;  2H43 A;  4HYT B;  4I7Z B;  3H1L D;  2OYI A;  2WSS H;  1YTZ I;  3MZW B;  3HD7 D;  4UB8 E;  4EI2 A;  1IFD A;  1PPJ D;  3L70 G;  1KYO E;  1KN7 A;  3RBZ A;  3W68 A;  3H1J D;  2WQY C;  2Q9I A;  3TK1 A;  5AW1 B;  1OW8 A;  1NJI Q;  2N1T D;  5TIS H;  1Q7Y Q;  3USS A;  1SQQ D;  1RY3 A;  4DJG A;  4N6J A;  2D2C B;  5KLV K;  1OW7 A;  1NTK G;  2A06 E;  2G3A A;  1M8O B;  2KXP B;  3A0H H;  4YPC A;  1YIT P;  1RF1 B;  2JP3 A;  3CCE P;  1NTK E;  1DEB A;  1Z56 A;  1FS0 E;  1N73 B;  1VQ6 P;  1T2K D;  4IFM A;  1X0T A;  2K88 A;  1VQ8 P;  1KB9 I;  2ZT9 D;  1T6A A;  2FXO A;  1S5L E;  1IFP A;  3OAK A;  5APT A;  1G2C A;  1TU3 F;  5M1B A;  1JMB A;  1RF0 A;  2B87 A;  2QM8 A;  1L2P A;  4IFF A;  2GUV A;  2IX7 C;  2JR8 A;  2LKM A; 
#chains in the Genus database with same CATH homology
 4BRY A;  2WVR A;  3WUV A;  3F5H A;  3E1R A;  2Q6Q A;  1UII A;  4BRY B;  3WUU A;  3WUT A;  2ZXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...