3WUTA

Structure basis of inactivating cell abscission
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
53
structure length
53
Chain Sequence
SFNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords Centrosomal protein of 55 kDa
publication title Structural and biochemical insights into the role of testis-expressed gene 14 (TEX14) in forming the stable intercellular bridges of germ cells
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 53
sequence length 53
chains with identical sequence B, D, E, G, H, J, K
ec nomenclature
pdb deposition date 2014-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12180 EABR TSG101 and ALIX binding domain of CEP55
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 3wutA00
3WUTA 3WUUA 3WUVA 4BRYB 2Q6QA 2WVRA 1UIIA 2ZXXA 4BRYA 3F5HA 3E1RA
chains in the Genus database with same CATH superfamily
3HD7C 2UWJE 1LTAC 3JCUE 1USDA 3CCQP 3HTKB 3PJSK 3B5ND 3A3YB 2IBZD 1X9VA 5AW1B 1Q82Q 5AW0B 5M1BA 2FYNC 4IFDK 4L75A 5KJ7A 1KILC 1RF0A 4K35A 1SQBK 3HD7A 3D70A 2FYUJ 3IN6A 1T3UA 2HODB 1DH3A 1GU5A 5KLVG 3A0BE 1LNQA 4D6TJ 1AA0A 2IFMA 4AYCA 2B9BA 2E76B 1KORA 3AE2C 3H1LD 1QVFO 1TU3F 1JTHA 2AXTH 2M8RA 1X22A 1OXZA 5AW3B 4HJGH 1L0LK 4N78D 2KXPB 1J2JB 5GTIE 3H1JG 4JYBA 3L73G 4GIFA 3T97A 5CCGD 2JKVA 3HTKA 1OW6A 3U59A 2YO3A 1AQ5A 1N7LA 2JWAA 1LTJB 2OYOA 1NTMJ 4WWIA 1BDDA 1W2BO 5APWA 3PP5A 2WSFH 1ZR2A 1R5SA 1Y8AA 1W2EA 2KZIA 1AVYA 1PZQA 5CMZA 1JY2O 4I6MC 2O01J 1JCCA 3LW5H 3SWFA 2FXOA 2BCCJ 3RBZA 2C0WA 1SQQK 1N8RQ 1PP9E 1SQVJ 3RK3B 2KNCB 3CXHI 2Y0EA 1OW8A 4NPDA 2P67A 1E5WA 2OYHB 3L72D 4H0LD 4IFFA 4D6TG 1LP1B 1SFCB 2YKQA 2P2UA 2YIUC 1L0NE 2YKOA 3CXHD 3CCJP 3EWKA 4IL6H 2E74C 2V7QJ 1EXIA 1QL2A 3H1IJ 4R4LA 5CBOA 1NO4A 4K3AA 1SQBD 3RK3E 2R3CA 2CPSA 2AEMA 3IAOA 1SQPD 1VDFA 2NRGA 1LJ2A 2ZYGA 1NTMG 2K9JB 1DEEG 2KNCA 3C1LA 3O6QA 1VQ5P 3KZIE 3A5TA 3CPWO 1H88A 1KD1Q 3BCCD 1NAFA 3CCEP 1NTZE 1U57A 1L4AC 2B87B 1UIXA 1JO5A 1L0LD 1WT6A 4U3FG 3Q3DA 1N7SC 4BWNA 3KXDA 1VF5C 1RQUA 1SQVG 4A7PA 3H1LJ 1KQGB 4OGQC 2A45H 1BGYE 1BE3D 1KYOH 2FYZA 3H1KE 3V4QA 1LT1A 4Y99B 1MFZA 1OVUA 4IFMA 3B5NB 1N86A 1JUNA 1PGPA 2LKMA 2ZXXA 1NHLA 1N7SA 5E79E 3F89A 3CD6P 5CCHC 2FBWC 1YTZT 2Q3EA 2JJLA 2C9NY 3H1IG 3V2RA 1SQQD 2PRRA 5AW2B 4Y99C 4CPGA 2B87A 3M9QA 5CCHA 3ITKA 1H0TB 3VMZA 2IBZG 4GODA 2H89C 2H7HA 4JQ0D 5APXA 1IO4A 2SPZA 2OGUA 3EFGA 2NPSB 3B8EB 1G2CB 1BCCG 2AXCA 3L72J 4EOTA 1BSHA 1L2PA 3CLQA 3L4FA 1RE4A 5KTBA 1T6AA 4YXDC 3M9BA 4BRYA 1NWQA 2QA4P 1ZR4A 1QVGO 1NYHA 1FBMA 1YQ4C 1HGVA 2E42A 1SQBJ 3A0HE 4RKUJ 5B5EE 1H0TA 2ZT9D 4ZKPA 2E5YA 3G6EP 1AV1A 2Q6QA 2NPSA 2OQQA 3BCCJ 3BASA 2WPSA 1JY3O 2KIKA 3BRTB 2L91A 4H44B 2E75C 3F5HA 1L0LJ 1YJ9P 3GG2A 3M0AA 1FU1A 1IFJA 1FZGA 2KS1A 2WSCH 5KKZB 1K05A 1GMJA 4AUWA 3L72G 3A2AA 3HE5A 3P8MC 3KQGA 4TLFA 1HTLC 1NTZK 1OX3A 4H44C 3JC22 4XE5B 1S4XA 1DD3A 1PPJE 4GKGA 1LTIC 1Y47A 1M1JC 2QVAA 2H88C 1RF1C 1SQQJ 4H13C 3I5CA 4ASVA 1ZRTE 3FXEA 3MP7B 1ZOYC 1NTKG 1YBKA 2IYPA 2A06E 3RL0C 1RF1A 3BCCG 2K9YA 4PD4E 2E76D 2R32A 4MN4C 3PRJA 1D7MA 3MUDC 1MV8A 1SQXG 2XNXA 4RO0A 2MKVA 3PHLA 3FX0A 1M8OB 2FFDC 1PIXA 1URQC 2ZFCA 1VQPP 3MUDA 3TNUB 4N6JA 1RHZB 3AE7C 4DZOA 1IZNB 2D2CB 3CL3D 1QEXA 1AJYA 2KP8A 5EFWB 5KAFE 3CXHH 1HJ0A 1GDTA 3K5BA 1HF9A 2ITAA 3RK2C 2WPQA 2WSFJ 2Z4EA 4BXLA 3OAKA 1SQQG 4JYCA 3RK3D 1QX8A 3S4RA 3V2QA 3V2NA 3O8ZA 3TGUG 3SFDC 2HR3A 1JY2P 4GT1A 2KLVA 1SFCD 1NOHA 1J1DB 4EIJA 1X0TA 3TNUA 1NJIQ 3A7OA 1NTZD 2I8DA 1S3JA 2WQYC 2WPRA 2ZYAA 3OJAB 3CWBE 4WY4B 1CSBA 4UB6E 3L70E 4Y28J 1MKMA 4HYTB 1YQ3C 1BGYD 2GUSA 3H1KD 3CX5E 1GZLA 1LTTC 3HD7B 4OWFA 2HPCA 3BVHA 1HJBA 4C46A 3PH0A 1J1DC 4XFJA 2FKWB 1NU1K 5AVUB 3AEBC 2Y0CA 2CK3H 2BASA 1LT9B 1IFIA 1KILB 3VMYA 4IL6X 1Q2NA 2NZ2A 5KLIC 1M1KQ 1KMIZ 2K3RA 2W6AA 3H1HE 3LIEA 2C9LY 1GD2E 2HLOA 3T97B 4WY4A 5AW9B 3GHGC 2K1AA 3P8CE 1LT9C 2QG4A 1HUCA 3SWYA 1FZCB 1SQPK 1DEBA 5TISE 4C7NB 5GTHH 1KILE 3L71D 3GHGA 1NH4A 3M91A 1S5LH 1LT9A 4L73A 1KILA 2Q1KA 2IFNA 1KN7A 3VMAA 3L75J 2KYVA 1Q81Q 5APQA 1OIPA 3AEFC 5KLVE 5BVZA 2PP6A 1FZCC 5APVA 5K5GB 2NPSD 2M0BA 3TDKA 2QM8A 2WZ7A 1FZCA 4C7NA 3JCUH 3L73E 4JF7A 1FJKA 4ZMDA 1NTZJ 2YIUB 2OTKE 3RBXA 1IK9A 2W6BA 2E43A 1JMBA 4I2LC 2E74B 1NVOA 3OA7A 2V4HA 1DIPA 2FXMA 4UB8E 1NU1D 1BGYJ 3O6QB 3H1KJ 2FYUG 4PV1C 3A0BH 2A45G 4ZKUA 3R2PA 3Q5PA 5AW8B 2FXPA 4JPZB 3U1CA 5APUA 1IFPA 3L74D 3L75G 1VQNP 2WTYA 2G8YA 1GW4A 4PJ0E 4H44D 5KAIE 3P32A 5GTIH 3CC7P 2AEJA 4PD4I 1L4AB 5AW5B 1N7SB 1AVOA 1VF5B 1M57D 2XV5A 1JY3P 4OGQB 1FZFA 1ZRTD 3II6A 2A06D 1RE3C 3L35A 4AQRD 1SS1A 3VTPC 3L71J 2WSCJ 1T2KD 1G1JA 3VOPA 2BCCG 1NTME 1X79B 4YPCA 1RE3A 1VL2A 1BGYG 1EDKA 2Q9IA 3TSIA 1L4AA 1JNMA 1VQ6P 1RH5B 3H25A 3W68A 2HG5D 2FY8A 4KHXA 4U3FE 2Z5IA 3NXSA 1IK7A 2DW3A 4BRYB 1SQVE 2IPPA 3D71A 3TK1A 4HKZH 2OTLP 2Q7CA 5CHXA 1DX7A 3G9RA 2B89A 3RK2D 1YIJP 1HH0A 1IC2A 2POHA 2JP3A 1WRGA 3KZIH 3H1IE 1FC2C 3CX5I 2D2CD 1NU1J 1YYCA 3WMM0 3QH9A 3L71G 4KJMA 2JR8A 2RMZA 3VYIA 2P1JA 3CWBD 5BU8B 2BEQD 1M56D 3AE8C 2L5GB 3L70D 3GF3A 2M5AA 1S2EA 1OZHA 3L74J 3H1LG 1DD4A 2RH0A 1LWUC 2KS1B 1BCCE 5E79H 1N73C 2KSJA 2KUBA 3Q1MA 4EYYQ 2Y9ZA 2E75B 1H89A 2YXRB 1X8YA 1FDIA 1YJNP 1QLED 3TF5A 1SQPJ 3H32A 5AVSB 3HE5B 1OMIA 1LWUA 2ZYDA 2QEXP 4KT0J 1Q90D 3RL0g 4WY4D 1H8AA 4M3LA 5CCGC 1T3JA 1L0NK 1GW3A 5KJ7D 3L37A 3HD7D 4B86A 3D6ZA 3HUSC 3D6YA 3P8CD 1FE6A 4L74A 1XTGB 1NU1G 1M1JB 4YTPC 1BE3J 1KILD 3E7KA 1RF1B 4H13B 3AE6C 1EDJA 3HUSA 1WMKA 1PGQA 1Y9BA 1Q7YQ 1J1EC 2PFXA 3L74G 3RL0B 2W6JH 4H0LC 5CJ4A 2B88A 1P84E 1M90Q 3A0HH 1KB9E 4W7YA 5B5EH 1SQBG 2FFDB 1SQPG 1URQB 2WITA 1HBWA 3NFQA 1ZW0A 1M1JA 4JBZA 3AEGC 3L73D 2PGDA 1NKZB 2KK7A 2O1KA 2JEEA 2Q3IA 3V2PA 1JY2N 1L0LG 1EZVE 3L70J 1JB0J 1NTKE 1PP9D 3E1RA 3RK2B 2N1TB 3CCUP 3WUVA 3BCCE 3GF7A 3AE9C 2YNYA 3WU2E 1BE3G 4LC1A 1FZBA 1XTCC 3E1IA 3CCSP 1SQXE 3GMAA 3MGNA 2G3AA 1S5LX 1YITP 2FFDA 2ZXEB 3CMEP 2M3EA 1L0ND 1URQA 2ZJSE 1VQOP 2XDJA 1G1IA 1KB9H 5APYA 1K04A 2E74D 2LR2A 2N1TC 2HPCB 2P58A 2YO2A 3H6PA 1FJPA 4R4MA 2O01N 3MTUE 1VQMP 2W8ZA 2QRXA 1S1CX 2N1TA 4PD4H 1RY3A 5DJUB 5AVVB 1SQQE 3M06A 1FAVA 3BRVB 3MHVA 4IOIH 3TGUE 1L4AD 5KLIB 1N7SD 4O9BA 1A02F 3Q5RA 1VF5D 2LXCB 2WSEJ 2IYOA 4OGQD 3PLNA 2RKLA 3QWOC 3Q5SA 3FWNA 3C8VA 3VN0A 4U3FD 2YKPA 5KAFH 3GHGB 4GDOA 1SQVD 1T8ZA 1HWTC 3LIDA 4ASWA 2Y0DA 1OWAA 5CCHD 1RQVA 3NMDA 2XNDH 2QJPC 4XA4A 2J59M 3WUTA 3L73J 1PV3A 2ZT9C 2MJZA 2J58A 1GTWA 2O3JA 3H1ID 2GA1A 1PP9J 4EDFA 3EFFK 1RF0C 2IZ0A 1FOSF 4GOEA 2WT7B 2C0XA 2R5BA 1KQFB 4UB6H 5AVRB 1ZXGA 2XU6A 1EC5A 3CX5H 1L0NJ 2QIWA 5L8RJ 5AW4B 3S1KA 1IFNA 3R4YA 3N7NA 3BATA 1OFCX 3S9OA 1BCCD 1VQLP 5AVYB 4W80A 1FS0E 2E5TA 1NTKK 3AE3C 1SLQA 1R8EA 2KOGA 3UIAA 1VQ8P 3IF4A 2HYNA 3WUUA 1QL1A 1SQXK 1PGOA 2CPBA 4PV1B 1GL2B 4WVZA 4IL6E 5AVWB 1YTZI 2WMMA 1S9KE 2WT7A 1LGHB 3H1JE 2YXQB 3USSA 3P7KA 1VQKP 1JY3N 3JSVC 2ZVOB 2JO1A 2E76C 1W5CE 2WPVB 2E75D 4LLHA 1PP9G 3V5BA 5TISH 2WSSH 2HODA 3HE4B 1P84I 3VP9A 3IFMA 1FDOA 1GL2C 2QJYB 2LXBA 3TYYA 1FZEA 1KB9I 1Z56A 1PFIA 1K73Q 3CI9A 4U3FJ 3Q2YA 5AW7B 1L0NG 1LTJC 2ZAEB 2WSEH 1GL2A 1FOSE 5AW6B 3N4XA 1P84D 2FYUE 3G3ZA 2Y9YA 1KYOE 1PPJD 3G71P 1KB9D 4D6TE 5B66E 3AEEC 1VPCA 1LTJA 3CCRP 2QJYC 2RN0A 1M7LA 1CW5A 3L75E 4H13D 3FWLA 1EZVI 2QSIA 3HE4A 3CCLP 3RK3C 5AVXB 1HGZA 4PD4D 5TJHA 1AFOA 1MUUA 4RJTA 2W27A 2OYHC 3RL0D 1NTZG 3AEAC 3G4SP 4UB8H 2P7JA 1SFCC 2Z5HA 2R5DA 1PL5A 1EZVD 4DJGA 1ZN5A 1NTKD 1KFNA 2BEZF 2R44A 1S72P 3AECC 4ZNCA 2OYHA 3H1KG 1OW7A 1PGJA 5APTA 1URQD 1BCCJ 3GLMA 4OVNF 1LP1A 1SQXD 1SFCA 1FDMA 1OVVA 3AE1C 3AE5C 2BCCE 3L36A 3V6IA 1EDIA 2KB7P 4PJ0H 2M5AB 5KAIH 1ZV8A 3ZDMA 3I56P 3AEDC 5B66H 2JDIH 1JOCA 1CZQA 3CC4P 2N1TD 5AVQB 3ABVC 3HRNA 3CMAP 2K9JA 4GOFA 5KLVK 1IFMA 3H32B 3CC2P 2VRSA 4RESB 2N9BA 1LWUB 2KLUA 2XZRA 1K8AQ 1N73B 1R5LA 2KSEA 3B5NC 1SVFA 3TGUD 2QE7H 2ZVNB 2W83C 1RE4C 1U7MA 2IBZE 2I1KA 5C39A 1SP4A 3CX5D 3M0DC 3KYQA 1MFTA 3B5NA 2O01H 2IX7C 1LTBC 3L71E 4Z1MH 4I7ZB 2IZ1A 3HUSB 3M0DA 3V4WA 1JM0A 1NKNA 1JCDA 3B4SA 3H1LE 2K88A 1KFMA 3U1AA 3IR9A 1KQLA 1KC8Q 4WBAA 3PTZA 1N73A 1QGKB 3H1HD 2OYIB 3NTNA 4N78E 2NPSC 1VQ4P 1EQ7A 2I1JA 2FYUK 1KZUB 2V7QH 2P10A 1J1EB 4I7ZC 3KPEA 4H0LB 2H8PD 5APSA 2OTJP 4LGDE 1ZMEC 1NTKJ 5CCGA 1MZ9A 2K37A 3SSUA 1EDLA 1G2CA 4HB1A 2OYIC 1HVVA 1SQXJ 1FZAA 3VP8A 4DOJA 1USEA 1U7JA 1KQSO 4L76A 1NU1E 1LTSC 1E79H 2OYIA 5KLVD 1NTMK 2HFED 1PPJG 4OH8B 4DT0A 3L72E 3GW6A 1BDCA 4QMAA 2YMKA 5DJTB 2WWWA 1GU4A 1BSNA 1K9MQ 3L74E 4W7ZA 1EXJA 3CXHE 1VQ9P 3EQ2A 3RGUA 1YJWP 5BU5A 2A06G 2GUVA 1S9KD 1CI6B 3H1JD 3SWKA 1SQVK 4NPFX 3FGAD 5KKZC 1N2DC 1SQBE 2OARA 1SQPE 3TGUJ 2YMYA 1Q86Q 2PAJA 1YHQP 3KHUA 3CWBJ 1ZLLA 1EZVG 3KDPB 2WVRA 4YXWH 2GM4A 2W90A 2XKMA 2A45I 1AQTA 1KYOI 1T2KC 1ZP0C 3FXDA 4PV1D 1GL2D 5H2FE 1L0LE 1KTMA 2M3BA 1P84H 4N3YB 2FYUD 1JEKA 1BE3E 2KZJA 3B71A 1KYOD 4EI2A 5CBNA 1CI6A 3H1HJ 4D6TD 2AEFA 3I55P 2N9YB 1KV4A 3L75D 5AVZB 3MIWA 2QJKB 3AE4C 2H43A 1GK6A 2QM7A 3SFEC 1JMMA 4NPEA 2O1JA 3W67A 4DCKA 1NTMD 2D2CC 3CWBG 3LW5J 4I1LA 2IDBA 3L70G 3WU2H 2QJPB 1LTGC 5CJ0A 2QJKC 1IFDA 2ZT9B 5H2FH 5KLVJ 1IJDB 5GTHE 2BCCD 2R3SA 5AVTB 3MD0A 1NAYA 1S5LE 3CCMP 3OW2O 1A02J 3CCVP 1UIIA 3VMXA 4WB4A 2KI7B 3MZWB 2AXTE 4HH2A 4TT3H 2JWDA 3H1HG 1OVRA 2Q5UA 3H1JJ 1NGMB 2J5UA 1GK4A 2FYNB 4U7JA 2IBZI 1VQ7P 4WY4C 1JTHB 3C9IA 1YI2P 4C7RA 3M9HA 5KJ7C
chains in the Genus database with same CATH topology
3WUTA 3WUUA 3WUVA 4BRYB 2Q6QA 2WVRA 1UIIA 2ZXXA 4BRYA 3F5HA 3E1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WUT A;  3WUU A;  3WUV A;  4BRY B;  2Q6Q A;  2WVR A;  1UII A;  2ZXX A;  4BRY A;  3F5H A;  3E1R A; 
#chains in the Genus database with same CATH topology
 3HD7 C;  2UWJ E;  1LTA C;  3JCU E;  1USD A;  3CCQ P;  3HTK B;  3PJS K;  3B5N D;  3A3Y B;  2IBZ D;  1X9V A;  5AW1 B;  1Q82 Q;  5AW0 B;  5M1B A;  2FYN C;  4IFD K;  4L75 A;  5KJ7 A;  1KIL C;  1RF0 A;  4K35 A;  1SQB K;  3HD7 A;  3D70 A;  2FYU J;  3IN6 A;  1T3U A;  2HOD B;  1DH3 A;  1GU5 A;  5KLV G;  3A0B E;  1LNQ A;  4D6T J;  1AA0 A;  2IFM A;  4AYC A;  2B9B A;  2E76 B;  1KOR A;  3AE2 C;  3H1L D;  1QVF O;  1TU3 F;  1JTH A;  2AXT H;  2M8R A;  1X22 A;  1OXZ A;  5AW3 B;  4HJG H;  1L0L K;  4N78 D;  2KXP B;  1J2J B;  5GTI E;  3H1J G;  4JYB A;  3L73 G;  4GIF A;  3T97 A;  5CCG D;  2JKV A;  3HTK A;  1OW6 A;  3U59 A;  2YO3 A;  1AQ5 A;  1N7L A;  2JWA A;  1LTJ B;  2OYO A;  1NTM J;  4WWI A;  1BDD A;  1W2B O;  5APW A;  3PP5 A;  2WSF H;  1ZR2 A;  1R5S A;  1Y8A A;  1W2E A;  2KZI A;  1AVY A;  1PZQ A;  5CMZ A;  1JY2 O;  4I6M C;  2O01 J;  1JCC A;  3LW5 H;  3SWF A;  2FXO A;  2BCC J;  3RBZ A;  2C0W A;  1SQQ K;  1N8R Q;  1PP9 E;  1SQV J;  3RK3 B;  2KNC B;  3CXH I;  2Y0E A;  1OW8 A;  4NPD A;  2P67 A;  1E5W A;  2OYH B;  3L72 D;  4H0L D;  4IFF A;  4D6T G;  1LP1 B;  1SFC B;  2YKQ A;  2P2U A;  2YIU C;  1L0N E;  2YKO A;  3CXH D;  3CCJ P;  3EWK A;  4IL6 H;  2E74 C;  2V7Q J;  1EXI A;  1QL2 A;  3H1I J;  4R4L A;  5CBO A;  1NO4 A;  4K3A A;  1SQB D;  3RK3 E;  2R3C A;  2CPS A;  2AEM A;  3IAO A;  1SQP D;  1VDF A;  2NRG A;  1LJ2 A;  2ZYG A;  1NTM G;  2K9J B;  1DEE G;  2KNC A;  3C1L A;  3O6Q A;  1VQ5 P;  3KZI E;  3A5T A;  3CPW O;  1H88 A;  1KD1 Q;  3BCC D;  1NAF A;  3CCE P;  1NTZ E;  1U57 A;  1L4A C;  2B87 B;  1UIX A;  1JO5 A;  1L0L D;  1WT6 A;  4U3F G;  3Q3D A;  1N7S C;  4BWN A;  3KXD A;  1VF5 C;  1RQU A;  1SQV G;  4A7P A;  3H1L J;  1KQG B;  4OGQ C;  2A45 H;  1BGY E;  1BE3 D;  1KYO H;  2FYZ A;  3H1K E;  3V4Q A;  1LT1 A;  4Y99 B;  1MFZ A;  1OVU A;  4IFM A;  3B5N B;  1N86 A;  1JUN A;  1PGP A;  2LKM A;  2ZXX A;  1NHL A;  1N7S A;  5E79 E;  3F89 A;  3CD6 P;  5CCH C;  2FBW C;  1YTZ T;  2Q3E A;  2JJL A;  2C9N Y;  3H1I G;  3V2R A;  1SQQ D;  2PRR A;  5AW2 B;  4Y99 C;  4CPG A;  2B87 A;  3M9Q A;  5CCH A;  3ITK A;  1H0T B;  3VMZ A;  2IBZ G;  4GOD A;  2H89 C;  2H7H A;  4JQ0 D;  5APX A;  1IO4 A;  2SPZ A;  2OGU A;  3EFG A;  2NPS B;  3B8E B;  1G2C B;  1BCC G;  2AXC A;  3L72 J;  4EOT A;  1BSH A;  1L2P A;  3CLQ A;  3L4F A;  1RE4 A;  5KTB A;  1T6A A;  4YXD C;  3M9B A;  4BRY A;  1NWQ A;  2QA4 P;  1ZR4 A;  1QVG O;  1NYH A;  1FBM A;  1YQ4 C;  1HGV A;  2E42 A;  1SQB J;  3A0H E;  4RKU J;  5B5E E;  1H0T A;  2ZT9 D;  4ZKP A;  2E5Y A;  3G6E P;  1AV1 A;  2Q6Q A;  2NPS A;  2OQQ A;  3BCC J;  3BAS A;  2WPS A;  1JY3 O;  2KIK A;  3BRT B;  2L91 A;  4H44 B;  2E75 C;  3F5H A;  1L0L J;  1YJ9 P;  3GG2 A;  3M0A A;  1FU1 A;  1IFJ A;  1FZG A;  2KS1 A;  2WSC H;  5KKZ B;  1K05 A;  1GMJ A;  4AUW A;  3L72 G;  3A2A A;  3HE5 A;  3P8M C;  3KQG A;  4TLF A;  1HTL C;  1NTZ K;  1OX3 A;  4H44 C;  3JC2 2;  4XE5 B;  1S4X A;  1DD3 A;  1PPJ E;  4GKG A;  1LTI C;  1Y47 A;  1M1J C;  2QVA A;  2H88 C;  1RF1 C;  1SQQ J;  4H13 C;  3I5C A;  4ASV A;  1ZRT E;  3FXE A;  3MP7 B;  1ZOY C;  1NTK G;  1YBK A;  2IYP A;  2A06 E;  3RL0 C;  1RF1 A;  3BCC G;  2K9Y A;  4PD4 E;  2E76 D;  2R32 A;  4MN4 C;  3PRJ A;  1D7M A;  3MUD C;  1MV8 A;  1SQX G;  2XNX A;  4RO0 A;  2MKV A;  3PHL A;  3FX0 A;  1M8O B;  2FFD C;  1PIX A;  1URQ C;  2ZFC A;  1VQP P;  3MUD A;  3TNU B;  4N6J A;  1RHZ B;  3AE7 C;  4DZO A;  1IZN B;  2D2C B;  3CL3 D;  1QEX A;  1AJY A;  2KP8 A;  5EFW B;  5KAF E;  3CXH H;  1HJ0 A;  1GDT A;  3K5B A;  1HF9 A;  2ITA A;  3RK2 C;  2WPQ A;  2WSF J;  2Z4E A;  4BXL A;  3OAK A;  1SQQ G;  4JYC A;  3RK3 D;  1QX8 A;  3S4R A;  3V2Q A;  3V2N A;  3O8Z A;  3TGU G;  3SFD C;  2HR3 A;  1JY2 P;  4GT1 A;  2KLV A;  1SFC D;  1NOH A;  1J1D B;  4EIJ A;  1X0T A;  3TNU A;  1NJI Q;  3A7O A;  1NTZ D;  2I8D A;  1S3J A;  2WQY C;  2WPR A;  2ZYA A;  3OJA B;  3CWB E;  4WY4 B;  1CSB A;  4UB6 E;  3L70 E;  4Y28 J;  1MKM A;  4HYT B;  1YQ3 C;  1BGY D;  2GUS A;  3H1K D;  3CX5 E;  1GZL A;  1LTT C;  3HD7 B;  4OWF A;  2HPC A;  3BVH A;  1HJB A;  4C46 A;  3PH0 A;  1J1D C;  4XFJ A;  2FKW B;  1NU1 K;  5AVU B;  3AEB C;  2Y0C A;  2CK3 H;  2BAS A;  1LT9 B;  1IFI A;  1KIL B;  3VMY A;  4IL6 X;  1Q2N A;  2NZ2 A;  5KLI C;  1M1K Q;  1KMI Z;  2K3R A;  2W6A A;  3H1H E;  3LIE A;  2C9L Y;  1GD2 E;  2HLO A;  3T97 B;  4WY4 A;  5AW9 B;  3GHG C;  2K1A A;  3P8C E;  1LT9 C;  2QG4 A;  1HUC A;  3SWY A;  1FZC B;  1SQP K;  1DEB A;  5TIS E;  4C7N B;  5GTH H;  1KIL E;  3L71 D;  3GHG A;  1NH4 A;  3M91 A;  1S5L H;  1LT9 A;  4L73 A;  1KIL A;  2Q1K A;  2IFN A;  1KN7 A;  3VMA A;  3L75 J;  2KYV A;  1Q81 Q;  5APQ A;  1OIP A;  3AEF C;  5KLV E;  5BVZ A;  2PP6 A;  1FZC C;  5APV A;  5K5G B;  2NPS D;  2M0B A;  3TDK A;  2QM8 A;  2WZ7 A;  1FZC A;  4C7N A;  3JCU H;  3L73 E;  4JF7 A;  1FJK A;  4ZMD A;  1NTZ J;  2YIU B;  2OTK E;  3RBX A;  1IK9 A;  2W6B A;  2E43 A;  1JMB A;  4I2L C;  2E74 B;  1NVO A;  3OA7 A;  2V4H A;  1DIP A;  2FXM A;  4UB8 E;  1NU1 D;  1BGY J;  3O6Q B;  3H1K J;  2FYU G;  4PV1 C;  3A0B H;  2A45 G;  4ZKU A;  3R2P A;  3Q5P A;  5AW8 B;  2FXP A;  4JPZ B;  3U1C A;  5APU A;  1IFP A;  3L74 D;  3L75 G;  1VQN P;  2WTY A;  2G8Y A;  1GW4 A;  4PJ0 E;  4H44 D;  5KAI E;  3P32 A;  5GTI H;  3CC7 P;  2AEJ A;  4PD4 I;  1L4A B;  5AW5 B;  1N7S B;  1AVO A;  1VF5 B;  1M57 D;  2XV5 A;  1JY3 P;  4OGQ B;  1FZF A;  1ZRT D;  3II6 A;  2A06 D;  1RE3 C;  3L35 A;  4AQR D;  1SS1 A;  3VTP C;  3L71 J;  2WSC J;  1T2K D;  1G1J A;  3VOP A;  2BCC G;  1NTM E;  1X79 B;  4YPC A;  1RE3 A;  1VL2 A;  1BGY G;  1EDK A;  2Q9I A;  3TSI A;  1L4A A;  1JNM A;  1VQ6 P;  1RH5 B;  3H25 A;  3W68 A;  2HG5 D;  2FY8 A;  4KHX A;  4U3F E;  2Z5I A;  3NXS A;  1IK7 A;  2DW3 A;  4BRY B;  1SQV E;  2IPP A;  3D71 A;  3TK1 A;  4HKZ H;  2OTL P;  2Q7C A;  5CHX A;  1DX7 A;  3G9R A;  2B89 A;  3RK2 D;  1YIJ P;  1HH0 A;  1IC2 A;  2POH A;  2JP3 A;  1WRG A;  3KZI H;  3H1I E;  1FC2 C;  3CX5 I;  2D2C D;  1NU1 J;  1YYC A;  3WMM 0;  3QH9 A;  3L71 G;  4KJM A;  2JR8 A;  2RMZ A;  3VYI A;  2P1J A;  3CWB D;  5BU8 B;  2BEQ D;  1M56 D;  3AE8 C;  2L5G B;  3L70 D;  3GF3 A;  2M5A A;  1S2E A;  1OZH A;  3L74 J;  3H1L G;  1DD4 A;  2RH0 A;  1LWU C;  2KS1 B;  1BCC E;  5E79 H;  1N73 C;  2KSJ A;  2KUB A;  3Q1M A;  4EYY Q;  2Y9Z A;  2E75 B;  1H89 A;  2YXR B;  1X8Y A;  1FDI A;  1YJN P;  1QLE D;  3TF5 A;  1SQP J;  3H32 A;  5AVS B;  3HE5 B;  1OMI A;  1LWU A;  2ZYD A;  2QEX P;  4KT0 J;  1Q90 D;  3RL0 g;  4WY4 D;  1H8A A;  4M3L A;  5CCG C;  1T3J A;  1L0N K;  1GW3 A;  5KJ7 D;  3L37 A;  3HD7 D;  4B86 A;  3D6Z A;  3HUS C;  3D6Y A;  3P8C D;  1FE6 A;  4L74 A;  1XTG B;  1NU1 G;  1M1J B;  4YTP C;  1BE3 J;  1KIL D;  3E7K A;  1RF1 B;  4H13 B;  3AE6 C;  1EDJ A;  3HUS A;  1WMK A;  1PGQ A;  1Y9B A;  1Q7Y Q;  1J1E C;  2PFX A;  3L74 G;  3RL0 B;  2W6J H;  4H0L C;  5CJ4 A;  2B88 A;  1P84 E;  1M90 Q;  3A0H H;  1KB9 E;  4W7Y A;  5B5E H;  1SQB G;  2FFD B;  1SQP G;  1URQ B;  2WIT A;  1HBW A;  3NFQ A;  1ZW0 A;  1M1J A;  4JBZ A;  3AEG C;  3L73 D;  2PGD A;  1NKZ B;  2KK7 A;  2O1K A;  2JEE A;  2Q3I A;  3V2P A;  1JY2 N;  1L0L G;  1EZV E;  3L70 J;  1JB0 J;  1NTK E;  1PP9 D;  3E1R A;  3RK2 B;  2N1T B;  3CCU P;  3WUV A;  3BCC E;  3GF7 A;  3AE9 C;  2YNY A;  3WU2 E;  1BE3 G;  4LC1 A;  1FZB A;  1XTC C;  3E1I A;  3CCS P;  1SQX E;  3GMA A;  3MGN A;  2G3A A;  1S5L X;  1YIT P;  2FFD A;  2ZXE B;  3CME P;  2M3E A;  1L0N D;  1URQ A;  2ZJS E;  1VQO P;  2XDJ A;  1G1I A;  1KB9 H;  5APY A;  1K04 A;  2E74 D;  2LR2 A;  2N1T C;  2HPC B;  2P58 A;  2YO2 A;  3H6P A;  1FJP A;  4R4M A;  2O01 N;  3MTU E;  1VQM P;  2W8Z A;  2QRX A;  1S1C X;  2N1T A;  4PD4 H;  1RY3 A;  5DJU B;  5AVV B;  1SQQ E;  3M06 A;  1FAV A;  3BRV B;  3MHV A;  4IOI H;  3TGU E;  1L4A D;  5KLI B;  1N7S D;  4O9B A;  1A02 F;  3Q5R A;  1VF5 D;  2LXC B;  2WSE J;  2IYO A;  4OGQ D;  3PLN A;  2RKL A;  3QWO C;  3Q5S A;  3FWN A;  3C8V A;  3VN0 A;  4U3F D;  2YKP A;  5KAF H;  3GHG B;  4GDO A;  1SQV D;  1T8Z A;  1HWT C;  3LID A;  4ASW A;  2Y0D A;  1OWA A;  5CCH D;  1RQV A;  3NMD A;  2XND H;  2QJP C;  4XA4 A;  2J59 M;  3WUT A;  3L73 J;  1PV3 A;  2ZT9 C;  2MJZ A;  2J58 A;  1GTW A;  2O3J A;  3H1I D;  2GA1 A;  1PP9 J;  4EDF A;  3EFF K;  1RF0 C;  2IZ0 A;  1FOS F;  4GOE A;  2WT7 B;  2C0X A;  2R5B A;  1KQF B;  4UB6 H;  5AVR B;  1ZXG A;  2XU6 A;  1EC5 A;  3CX5 H;  1L0N J;  2QIW A;  5L8R J;  5AW4 B;  3S1K A;  1IFN A;  3R4Y A;  3N7N A;  3BAT A;  1OFC X;  3S9O A;  1BCC D;  1VQL P;  5AVY B;  4W80 A;  1FS0 E;  2E5T A;  1NTK K;  3AE3 C;  1SLQ A;  1R8E A;  2KOG A;  3UIA A;  1VQ8 P;  3IF4 A;  2HYN A;  3WUU A;  1QL1 A;  1SQX K;  1PGO A;  2CPB A;  4PV1 B;  1GL2 B;  4WVZ A;  4IL6 E;  5AVW B;  1YTZ I;  2WMM A;  1S9K E;  2WT7 A;  1LGH B;  3H1J E;  2YXQ B;  3USS A;  3P7K A;  1VQK P;  1JY3 N;  3JSV C;  2ZVO B;  2JO1 A;  2E76 C;  1W5C E;  2WPV B;  2E75 D;  4LLH A;  1PP9 G;  3V5B A;  5TIS H;  2WSS H;  2HOD A;  3HE4 B;  1P84 I;  3VP9 A;  3IFM A;  1FDO A;  1GL2 C;  2QJY B;  2LXB A;  3TYY A;  1FZE A;  1KB9 I;  1Z56 A;  1PFI A;  1K73 Q;  3CI9 A;  4U3F J;  3Q2Y A;  5AW7 B;  1L0N G;  1LTJ C;  2ZAE B;  2WSE H;  1GL2 A;  1FOS E;  5AW6 B;  3N4X A;  1P84 D;  2FYU E;  3G3Z A;  2Y9Y A;  1KYO E;  1PPJ D;  3G71 P;  1KB9 D;  4D6T E;  5B66 E;  3AEE C;  1VPC A;  1LTJ A;  3CCR P;  2QJY C;  2RN0 A;  1M7L A;  1CW5 A;  3L75 E;  4H13 D;  3FWL A;  1EZV I;  2QSI A;  3HE4 A;  3CCL P;  3RK3 C;  5AVX B;  1HGZ A;  4PD4 D;  5TJH A;  1AFO A;  1MUU A;  4RJT A;  2W27 A;  2OYH C;  3RL0 D;  1NTZ G;  3AEA C;  3G4S P;  4UB8 H;  2P7J A;  1SFC C;  2Z5H A;  2R5D A;  1PL5 A;  1EZV D;  4DJG A;  1ZN5 A;  1NTK D;  1KFN A;  2BEZ F;  2R44 A;  1S72 P;  3AEC C;  4ZNC A;  2OYH A;  3H1K G;  1OW7 A;  1PGJ A;  5APT A;  1URQ D;  1BCC J;  3GLM A;  4OVN F;  1LP1 A;  1SQX D;  1SFC A;  1FDM A;  1OVV A;  3AE1 C;  3AE5 C;  2BCC E;  3L36 A;  3V6I A;  1EDI A;  2KB7 P;  4PJ0 H;  2M5A B;  5KAI H;  1ZV8 A;  3ZDM A;  3I56 P;  3AED C;  5B66 H;  2JDI H;  1JOC A;  1CZQ A;  3CC4 P;  2N1T D;  5AVQ B;  3ABV C;  3HRN A;  3CMA P;  2K9J A;  4GOF A;  5KLV K;  1IFM A;  3H32 B;  3CC2 P;  2VRS A;  4RES B;  2N9B A;  1LWU B;  2KLU A;  2XZR A;  1K8A Q;  1N73 B;  1R5L A;  2KSE A;  3B5N C;  1SVF A;  3TGU D;  2QE7 H;  2ZVN B;  2W83 C;  1RE4 C;  1U7M A;  2IBZ E;  2I1K A;  5C39 A;  1SP4 A;  3CX5 D;  3M0D C;  3KYQ A;  1MFT A;  3B5N A;  2O01 H;  2IX7 C;  1LTB C;  3L71 E;  4Z1M H;  4I7Z B;  2IZ1 A;  3HUS B;  3M0D A;  3V4W A;  1JM0 A;  1NKN A;  1JCD A;  3B4S A;  3H1L E;  2K88 A;  1KFM A;  3U1A A;  3IR9 A;  1KQL A;  1KC8 Q;  4WBA A;  3PTZ A;  1N73 A;  1QGK B;  3H1H D;  2OYI B;  3NTN A;  4N78 E;  2NPS C;  1VQ4 P;  1EQ7 A;  2I1J A;  2FYU K;  1KZU B;  2V7Q H;  2P10 A;  1J1E B;  4I7Z C;  3KPE A;  4H0L B;  2H8P D;  5APS A;  2OTJ P;  4LGD E;  1ZME C;  1NTK J;  5CCG A;  1MZ9 A;  2K37 A;  3SSU A;  1EDL A;  1G2C A;  4HB1 A;  2OYI C;  1HVV A;  1SQX J;  1FZA A;  3VP8 A;  4DOJ A;  1USE A;  1U7J A;  1KQS O;  4L76 A;  1NU1 E;  1LTS C;  1E79 H;  2OYI A;  5KLV D;  1NTM K;  2HFE D;  1PPJ G;  4OH8 B;  4DT0 A;  3L72 E;  3GW6 A;  1BDC A;  4QMA A;  2YMK A;  5DJT B;  2WWW A;  1GU4 A;  1BSN A;  1K9M Q;  3L74 E;  4W7Z A;  1EXJ A;  3CXH E;  1VQ9 P;  3EQ2 A;  3RGU A;  1YJW P;  5BU5 A;  2A06 G;  2GUV A;  1S9K D;  1CI6 B;  3H1J D;  3SWK A;  1SQV K;  4NPF X;  3FGA D;  5KKZ C;  1N2D C;  1SQB E;  2OAR A;  1SQP E;  3TGU J;  2YMY A;  1Q86 Q;  2PAJ A;  1YHQ P;  3KHU A;  3CWB J;  1ZLL A;  1EZV G;  3KDP B;  2WVR A;  4YXW H;  2GM4 A;  2W90 A;  2XKM A;  2A45 I;  1AQT A;  1KYO I;  1T2K C;  1ZP0 C;  3FXD A;  4PV1 D;  1GL2 D;  5H2F E;  1L0L E;  1KTM A;  2M3B A;  1P84 H;  4N3Y B;  2FYU D;  1JEK A;  1BE3 E;  2KZJ A;  3B71 A;  1KYO D;  4EI2 A;  5CBN A;  1CI6 A;  3H1H J;  4D6T D;  2AEF A;  3I55 P;  2N9Y B;  1KV4 A;  3L75 D;  5AVZ B;  3MIW A;  2QJK B;  3AE4 C;  2H43 A;  1GK6 A;  2QM7 A;  3SFE C;  1JMM A;  4NPE A;  2O1J A;  3W67 A;  4DCK A;  1NTM D;  2D2C C;  3CWB G;  3LW5 J;  4I1L A;  2IDB A;  3L70 G;  3WU2 H;  2QJP B;  1LTG C;  5CJ0 A;  2QJK C;  1IFD A;  2ZT9 B;  5H2F H;  5KLV J;  1IJD B;  5GTH E;  2BCC D;  2R3S A;  5AVT B;  3MD0 A;  1NAY A;  1S5L E;  3CCM P;  3OW2 O;  1A02 J;  3CCV P;  1UII A;  3VMX A;  4WB4 A;  2KI7 B;  3MZW B;  2AXT E;  4HH2 A;  4TT3 H;  2JWD A;  3H1H G;  1OVR A;  2Q5U A;  3H1J J;  1NGM B;  2J5U A;  1GK4 A;  2FYN B;  4U7J A;  2IBZ I;  1VQ7 P;  4WY4 C;  1JTH B;  3C9I A;  1YI2 P;  4C7R A;  3M9H A;  5KJ7 C; 
#chains in the Genus database with same CATH homology
 3WUT A;  3WUU A;  3WUV A;  4BRY B;  2Q6Q A;  2WVR A;  1UII A;  2ZXX A;  4BRY A;  3F5H A;  3E1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...