4U3FG

Cytochrome bc1 complex from chicken with designed inhibitor bound
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
80
structure length
80
Chain Sequence
IHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational Design of Highly Potent and Slow-Binding Cytochrome bc1 Inhibitor as Fungicide by Computational Substitution Optimization
doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
total genus 16
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2014-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 4u3fG00
1NTMG 3CXHH 3L75G 1BGYG 3TGUG 3L72G 3H1LG 1BE3G 3H1JG 3L73G 1KYOH 1SQVG 3L74G 3H1HG 3H1KG 4D6TG 1KB9H 1NTZG 2FYUG 1EZVG 1NU1G 3CX5H 3H1IG 2A06G 3CWBG 1SQQG 1L0LG 5KLVG 2BCCG 1NTKG 3L71G 1SQXG 1SQBG 4U3FG 1PPJG 2IBZG 1L0NG 1SQPG 1BCCG 3BCCG 1P84H 3L70G 4PD4H 1PP9G
chains in the Genus database with same CATH superfamily
4KHXA 1AVYA 1BSNA 2FYUD 1SQPK 3L72G 1KILB 5AVVB 1OX3A 1KYOH 2UWJE 2W27A 4C7RA 1QL1A 1GL2C 1IFMA 2A06D 3P8CE 3F5HA 2AXTH 3LW5J 4OH8B 3Q3DA 1IFIA 2O1KA 2KUBA 3CWBG 1N7LA 1YQ3C 1N7SB 1PGJA 2WPQA 3AE8C 3KZIH 4PD4E 3CCJP 1S9KE 1DEBA 2HYNA 3G71P 3HE4B 4L75A 1K9MQ 1URQA 5AW9B 4DJGA 1NKNA 1W5CE 1N7SC 2ITAA 4GT1A 2D2CC 5DJUB 5CCGA 3B8EB 1L4AA 1URQC 2ZFCA 5TJHA 1FBMA 1FZBA 3K5BA 3RK3B 5C39A 4AUWA 3CX5I 1QVFO 1BGYE 3BASA 3AE2C 3RL0C 1YTZI 2IPPA 1H0TB 1PL5A 1H8AA 4NPFX 4H0LB 1FJKA 1KD1Q 5KAIE 2J59M 3H1JG 5CBOA 1NJIQ 1JTHA 1SS1A 5KLIB 1MUUA 2WSEH 2HLOA 1M1JB 1J1DB 2YO3A 1IFDA 2HFED 2QRXA 3GMAA 2Y0DA 3L73J 2QSIA 4A7PA 5CCHD 1S72P 1RF1A 3M0DA 1L0NJ 2A45I 3H1KD 3GHGA 3IFMA 2KLVA 3IF4A 2KLUA 1NU1E 2OGUA 2RH0A 4H0LC 1YYCA 2J58A 2K9JA 4U3FJ 1GU5A 1KYOI 1RE4A 5AW7B 4XA4A 3RK3C 3SWFA 1AA0A 1UIXA 1JMBA 1KORA 3L71J 4UB6H 1YITP 4EOTA 2CPSA 1RE4C 3W68A 2YKQA 4I7ZC 2QJYB 2PFXA 2R3CA 1Q90D 1ZP0C 3CWBJ 2A45H 1VQ7P 1PGPA 2M0BA 4TT3H 1BGYG 1ZXGA 2KZJA 2QE7H 3TGUG 2NZ2A 3EFGA 3U59A 2K1AA 1EDKA 1HVVA 4H13B 4I6MC 3S9OA 4B86A 2GUVA 4XFJA 4EYYQ 1BE3E 1USDA 3H1HG 2FXMA 2J5UA 5GTIH 2E42A 2IYOA 3BATA 1KB9H 1JY2O 2QIWA 2M3BA 2P7JA 4WY4A 4QMAA 5AW6B 3P32A 1IC2A 1RQVA 1VQPP 1EZVG 5APTA 2RN0A 1HJ0A 3CXHI 3H1IG 3BRVB 5AVUB 2YXRB 3OA7A 3L37A 5AVQB 3AE9C 2Z5IA 3L75J 4YTPC 3GW6A 2AXCA 3AE4C 1VQ5P 1USEA 1JY2N 1G1JA 2Q1KA 1SQQE 1N7SD 2BCCE 1SQXJ 2QM7A 3AEFC 1FZEA 1JB0J 1SQPJ 2Y9YA 1M57D 3HD7A 2E74B 1Q86Q 1NWQA 1GU4A 1LP1B 3RL0B 2SPZA 3BVHA 1S1CX 2B89A 1X79B 2DW3A 1KFMA 2YMYA 2FYUG 2ZYDA 5APVA 1T2KD 1EDJA 1W2BO 3CX5E 1LP1A 2W90A 2H43A 1U7MA 1PIXA 1VQNP 3Q5PA 5CJ0A 2WSCJ 4OGQD 5KAFE 1MV8A 1PPJE 1OW7A 3CCEP 2E5TA 1URQB 2P67A 1JY3N 4JYBA 3RK2C 2IX7C 3H1JE 1NU1D 1N86A 3H1KE 3M06A 4UB8E 4IL6H 1P84D 2MKVA 2OTKE 1JY3P 4L74A 1LNQA 3SSUA 2R3SA 1NTKE 4ASWA 4ZKUA 3D6YA 1G1IA 1OZHA 1GW4A 5KLVJ 4HJGH 5KLVG 5CCHA 4OGQB 2YO2A 3CCSP 2RKLA 4GDOA 4GIFA 1J1DC 4EIJA 2OTLP 1SQQK 2Q6QA 2W6JH 3VP9A 4RO0A 2P58A 3MD0A 1MFZA 1N7SA 2B87A 4I2LC 4GOFA 3W67A 4LGDE 2OYIC 3PHLA 1NOHA 1NTMG 4MN4C 4AYCA 1YIJP 3AEAC 1FU1A 1RE3A 2YIUC 3I56P 3ABVC 2KYVA 1SLQA 2PP6A 3JCUH 3L4FA 4GODA 4XE5B 2XKMA 3RK3E 5TISH 3MTUE 5M1BA 3TGUE 1G2CB 1VDFA 4ZKPA 1S5LX 1X0TA 2HODA 1T3UA 1H0TA 1OMIA 1YBKA 3GHGB 1L2PA 2A06G 5E79E 1KV4A 1BE3J 2H88C 2K88A 3CXHE 1KB9E 2O3JA 2VRSA 1FZGA 1GW3A 4WY4B 2GUSA 1EZVE 3USSA 1NTKG 4HKZH 1VQ6P 2JEEA 3LIDA 3P8CD 1DH3A 1N73A 3B5ND 1KN7A 1K04A 3L72E 1X9VA 1HBWA 2M3EA 5GTHH 3D70A 2KB7P 3V5BA 2H89C 3T97A 3H25A 2FBWC 1LGHB 1AFOA 5AW0B 1MZ9A 1N2DC 4PD4D 1KILE 1YTZT 4C46A 1SQBD 2BCCJ 3G9RA 2JWDA 1VL2A 3H1JD 3RL0g 1D7MA 1QL2A 3I5CA 2QVAA 1TU3F 1SQVG 3LW5H 3PRJA 3QWOC 1Q81Q 2V4HA 1CSBA 2QA4P 4D6TG 4LLHA 1FZFA 3CD6P 1OIPA 5KLIC 1ZW0A 4HH2A 1FZCB 3AE3C 1NU1G 3MZWB 1WT6A 2C0XA 1CI6A 2Y9ZA 1RF1B 4H44C 2OTJP 1Y47A 3H32A 3TSIA 3SWKA 1VQ8P 2OQQA 2KI7B 1FS0E 2JP3A 4KJMA 1BSHA 2N1TB 2QG4A 3G6EP 3HTKA 1FZAA 3CLQA 3LIEA 4JF7A 4YXWH 5GTHE 1BCCE 2R32A 4WWIA 3Q5SA 1EXJA 1DD4A 1PFIA 1S3JA 2KP8A 1PGOA 1VPCA 3H32B 4O9BA 1SQXK 3CXHH 4Y99B 2KIKA 3H1LD 3MUDC 4PV1C 2FYNC 5APUA 5CCGD 2HPCA 2GM4A 4N6JA 2C0WA 5AVXB 3ZDMA 2W8ZA 3HUSB 2LXBA 3L72J 3B5NA 1LTIC 2WT7B 1SP4A 1L4AB 3KYQA 2NPSB 2OYOA 3TNUB 3WU2H 1YI2P 3CCLP 2E76D 3CCMP 1NTMD 4RKUJ 1ZOYC 1LTJA 4HYTB 2H8PD 1EZVD 2NPSC 3MP7B 1KB9D 1VF5D 4BRYA 5BVZA 4PD4I 3RBXA 1SQQG 1L0LG 4IL6E 3TGUJ 3M9BA 4DCKA 1UIIA 1E5WA 1JY3O 1QGKB 1T8ZA 3AEEC 4PV1B 5AW8B 5KJ7A 2OYHC 1IFPA 2E43A 1KYOE 3HUSC 2L91A 5TISE 3L75D 2FYNB 1DEEG 2E76B 2OYHA 1NTZJ 1MFTA 1K05A 3JSVC 1U57A 1PGQA 1SQBE 1JNMA 1GL2A 1SQPD 3H1IJ 2ZYAA 3L70J 1PP9G 1HGZA 1NTZE 1NVOA 3NTNA 5KLVE 1N8RQ 1BDCA 1GZLA 1HGVA 4DT0A 2Q9IA 1M1JA 1G2CA 3H1KJ 4K3AA 2QJPC 1QX8A 1ZMEC 4H0LD 1M8OB 2N9YB 1LTAC 4IFFA 4LC1A 3II6A 3BCCJ 3PTZA 3AEGC 1PP9D 2E74C 2ZT9B 1GMJA 3IN6A 4JYCA 1NAFA 2WMMA 2YNYA 1WMKA 1HTLC 1M1KQ 2E75C 2WWWA 2IBZI 2KSJA 3BCCE 3CX5H 2KNCB 1EDIA 3G3ZA 3HRNA 4I1LA 3KPEA 4UB8H 3NXSA 4OGQC 2K3RA 2WSFH 3A0BE 2Y0CA 5APWA 2IYPA 4EI2A 1FOSF 5AVSB 1JY2P 3L74J 1LWUA 2IBZG 4GKGA 1J1EC 3WMM0 1K73Q 1N73C 1VQLP 2ZVOB 3M9HA 3VMXA 3RK2B 4PV1D 5CCGC 1NTKD 3S4RA 4WY4C 1SQBK 4BRYB 4GOEA 5AW2B 3CL3D 1OW8A 3AE6C 3H1HD 1KC8Q 1BE3G 1NTME 2FFDC 5EFWB 2FXPA 3WU2E 1SQVJ 1KQSO 3FXDA 1EXIA 3A7OA 3NMDA 4IFDK 1DIPA 1ZR4A 1L0NK 1NKZB 3KQGA 1KILA 1QEXA 3B5NB 3C1LA 5GTIE 2NPSD 1OVUA 3CCRP 1FZCA 4I7ZB 1JM0A 1IJDB 1KQLA 1PZQA 1T3JA 1U7JA 2ZJSE 2YIUB 3CMAP 2E5YA 1KILC 1H89A 1GL2B 5APXA 3CMEP 1AVOA 2YMKA 2OYIB 3AECC 3FWNA 3O6QB 4L73A 4R4LA 1VQMP 3H1HE 2WPRA 2V7QJ 3AE7C 2XV5A 4NPEA 1SVFA 1R8EA 3OW2O 1CZQA 2I1KA 3M0AA 5KLVK 3ITKA 1M56D 3HE5A 2WITA 3N4XA 5AW4B 1BGYD 1NU1J 2I8DA 3V6IA 2WTYA 1SFCD 2IDBA 4Y28J 4ZNCA 1LTJB 1RHZB 3TYYA 2QJYC 3L73G 1PP9E 5KKZC 2O01N 5AVZB 1HUCA 3M91A 3L35A 2R5BA 3H1JJ 4H44B 1ZRTE 1VQOP 5KAIH 3GF7A 2E75D 5H2FE 4DZOA 3GLMA 3VTPC 3FXEA 2D2CB 2C9NY 1H88A 2FXOA 5B5EH 4NPDA 2JJLA 3U1AA 3NFQA 1LTTC 3C8VA 4K35A 1EZVI 3PP5A 1X22A 3VOPA 1AQTA 1KB9I 1LTBC 4PJ0E 3FWLA 3CX5D 4H44D 3HE5B 4WY4D 3CCVP 1LJ2A 2Z5HA 1VQKP 2KS1A 3L74E 1LT9C 2LKMA 1Y8AA 2R44A 5E79H 2HR3A 3L75G 3AEDC 3B71A 2GA1A 3OJAB 4IOIH 2XU6A 1SQQJ 5CHXA 3Q1MA 2A45G 2AXTE 1BE3D 1FDOA 2POHA 2Y0EA 5CMZA 1BCCD 3V2PA 3V4WA 1VF5B 3L72D 1HWTC 3OAKA 2N1TA 3PH0A 3V4QA 1M7LA 2KXPB 3JCUE 1M90Q 3VN0A 1NTKK 3MHVA 1NTMJ 4H13C 2FYUJ 2KS1B 1KFNA 1P84I 2WVRA 2W83C 2IBZD 3L36A 1EQ7A 1SQVK 1JO5A 4M3LA 2ZAEB 4D6TD 3CWBE 3FGAD 2WSEJ 3PLNA 1S2EA 4HB1A 5APQA 2Q3IA 1GTWA 2FFDB 4EDFA 1SQBJ 1R5SA 2BCCD 2LR2A 1S4XA 4JPZB 1XTCC 1NU1K 1YJ9P 3L70E 1YJNP 3CI9A 1OWAA 5B66H 2LXCB 4C7NB 1VF5C 3HE4A 2N9BA 3BCCG 1VQ4P 1FZCC 3UIAA 3P7KA 2H7HA 1JUNA 2IFNA 2AEFA 3P8MC 1SFCC 3SFEC 1S5LE 5BU5A 3M0DC 4ASVA 3CCQP 3HD7D 3L75E 1E79H 1LWUB 2D2CD 2WSCH 1JCCA 3A3YB 2YXQB 1RF0C 1DD3A 1RH5B 2K9JB 2IFMA 3RK2D 2E75B 3TNUA 5AVRB 1EDLA 5KAFH 3L73E 2BASA 3GF3A 1Z56A 3WUUA 1OVVA 2XZRA 3CXHD 1RF0A 1RQUA 2KNCA 1PP9J 2ZT9C 2HG5D 1Q7YQ 1T6AA 4KT0J 1R5LA 2ZYGA 2QJPB 1FAVA 2Z4EA 3MUDA 2BCCG 3H1LJ 3CC2P 1SQVE 3RL0D 4CPGA 3G4SP 4ZMDA 3HD7B 1SQXG 1FJPA 1L0LD 2V7QH 2WPSA 4BXLA 1S5LH 5L8RJ 1Q2NA 4OVNF 2PRRA 2XDJA 2AEJA 1FE6A 3L71E 3GHGC 3H1IE 3L74D 3VP8A 2K37A 5CBNA 4OWFA 2PGDA 1LTJC 5AW5B 4U3FD 3MIWA 2P10A 1VQ9P 2WQYC 5B66E 1KTMA 3VMZA 1LTGC 1NTKJ 4N78D 1J2JB 3EFFK 2OYHB 3V2NA 3EQ2A 3TGUD 2O01H 1N73B 1IO4A 5AVTB 4R4MA 1Q82Q 3L70G 4Z1MH 2KOGA 3CWBD 1SQVD 1FOSE 3AEBC 1IK9A 1MKMA 4H13D 3RBZA 1WRGA 4WVZA 2OARA 4BWNA 3I55P 3A5TA 3A0HE 2N1TD 1NTZD 2W6AA 2AEMA 2ZVNB 3C9IA 2W6BA 1P84E 1QVGO 2HODB 2Q3EA 3H1ID 3H6PA 5BU8B 1L4AC 3L70D 1LT9A 2L5GB 3L71G 1CW5A 3O6QA 4WB4A 5AW3B 1OFCX 3B5NC 4UB6E 3B4SA 1ZR2A 4U3FG 1BDDA 3V2RA 2JR8A 1RY3A 1SQXE 1FC2C 3AE5C 3D6ZA 1BCCG 3U1CA 1IZNB 1KILD 3BCCD 1JMMA 3BRTB 1L0NG 4PJ0H 3SWYA 3Q5RA 2HPCB 5K5GB 1HF9A 1LT1A 1YHQP 3H1LG 1NTZK 1OVRA 3L73D 3VMAA 3WUTA 2QM8A 2WSSH 4JQ0D 1JTHB 2C9LY 3N7NA 1RF1C 5KJ7C 2ZXEB 1L0ND 2PAJA 5B5EE 5AVWB 1NYHA 3VMYA 5AVYB 1NO4A 2ZT9D 5KKZB 2XNDH 4U7JA 1JEKA 2NRGA 2Q5UA 5H2FH 2KSEA 1M1JC 2B87B 3M9QA 2IZ0A 2RMZA 4W80A 4C7NA 3L71D 1L0LE 1ZRTD 1SFCA 1XTGB 4RESB 3CC7P 2XNXA 3GG2A 1K8AQ 3MGNA 1PPJD 2MJZA 1X8YA 3E1RA 3H1HJ 3JC22 3SFDC 2IZ1A 2JKVA 3HUSA 1SQPG 1NH4A 1AV1A 2ZXXA 4N78E 4U3FE 3H1LE 5KTBA 5KLVD 1P84H 1ZLLA 5DJTB 4PD4H 3KZIE 4RJTA 1YJWP 2QEXP 2M5AB 3A0HH 2CPBA 3R4YA 2O01J 3A2AA 2O1JA 2P1JA 2WPVB 1JOCA 4IL6X 4Y99C 2YKOA 3VYIA 3WUVA 1OW6A 3TF5A 3CCUP 3KDPB 2KZIA 2K9YA 1NTMK 1FDMA 2FYUK 1SQQD 2E76C 3PJSK 3RGUA 1NGMB 1GL2D 2WT7A 3Q2YA 2OYIA 2BEQD 1GDTA 4WBAA 4L76A 3TK1A 1AQ5A 1JCDA 2N1TC 1IK7A 1RE3C 1W2EA 2M8RA 1T2KC 3EWKA 1NAYA 1AJYA 2A06E 1SQXD 1L4AD 3TDKA 2JDIH 3CPWO 1A02J 1BGYJ 2R5DA 4D6TJ 1KZUB 1J1EB 2JWAA 1NHLA 1KQGB 2CK3H 1L0LK 3O8ZA 4IFMA 4W7YA 1LT9B 4AQRD 4YXDC 3CC4P 1HJBA 1GK4A 1QLED 1URQD 4D6TE 3KHUA 2M5AA 2IBZE 2BEZF 1LWUC 1KMIZ 1CI6B 1SQPE 1LTSC 2KK7A 3S1KA 4W7ZA 3D71A 1S9KD 2JO1A 2I1JA 1ZV8A 3T97B 5APYA 1L0NE 3L74G 1IFNA 4DOJA 2FKWB 5KJ7D 2B88A 3E1IA 1OXZA 1SFCB 3H1KG 2QJKB 1FDIA 3A0BH 3IAOA 4TLFA 2G8YA 2Q7CA 2FFDA 1NTZG 2E74D 4YPCA 1IFJA 2FYUE 3FX0A 3QH9A 3R2PA 4N3YB 2FYZA 5CCHC 2QJKC 2WSFJ 1KQFB 3F89A 3HD7C 3V2QA 1HH0A 1DX7A 3AE1C 1PV3A 1GK6A 2WZ7A 2YKPA 3HTKB 5APSA 3RK3D 1YQ4C 2NPSA 1SQBG 4JBZA 1PPJG 1KYOD 2B9BA 5CJ4A 1EC5A 1A02F 2FY8A 3IR9A 3KXDA 1BCCJ 1GD2E 3E7KA 1ZN5A 2P2UA 1L0LJ 1Y9BA 2G3AA 5AW1B
chains in the Genus database with same CATH topology
1NTMG 3CXHH 3L75G 1BGYG 3TGUG 3L72G 3H1LG 1BE3G 3H1JG 3L73G 1KYOH 1SQVG 3L74G 3H1HG 3H1KG 4D6TG 1KB9H 1NTZG 2FYUG 1EZVG 1NU1G 3CX5H 3H1IG 2A06G 3CWBG 1SQQG 1L0LG 5KLVG 2BCCG 1NTKG 3L71G 1SQXG 1SQBG 4U3FG 1PPJG 2IBZG 1L0NG 1SQPG 1BCCG 3BCCG 1P84H 3L70G 4PD4H 1PP9G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTM G;  3CXH H;  3L75 G;  1BGY G;  3TGU G;  3L72 G;  3H1L G;  1BE3 G;  3H1J G;  3L73 G;  1KYO H;  1SQV G;  3L74 G;  3H1H G;  3H1K G;  4D6T G;  1KB9 H;  1NTZ G;  2FYU G;  1EZV G;  1NU1 G;  3CX5 H;  3H1I G;  2A06 G;  3CWB G;  1SQQ G;  1L0L G;  5KLV G;  2BCC G;  1NTK G;  3L71 G;  1SQX G;  1SQB G;  4U3F G;  1PPJ G;  2IBZ G;  1L0N G;  1SQP G;  1BCC G;  3BCC G;  1P84 H;  3L70 G;  4PD4 H;  1PP9 G; 
#chains in the Genus database with same CATH topology
 4KHX A;  1AVY A;  1BSN A;  2FYU D;  1SQP K;  3L72 G;  1KIL B;  5AVV B;  1OX3 A;  1KYO H;  2UWJ E;  2W27 A;  4C7R A;  1QL1 A;  1GL2 C;  1IFM A;  2A06 D;  3P8C E;  3F5H A;  2AXT H;  3LW5 J;  4OH8 B;  3Q3D A;  1IFI A;  2O1K A;  2KUB A;  3CWB G;  1N7L A;  1YQ3 C;  1N7S B;  1PGJ A;  2WPQ A;  3AE8 C;  3KZI H;  4PD4 E;  3CCJ P;  1S9K E;  1DEB A;  2HYN A;  3G71 P;  3HE4 B;  4L75 A;  1K9M Q;  1URQ A;  5AW9 B;  4DJG A;  1NKN A;  1W5C E;  1N7S C;  2ITA A;  4GT1 A;  2D2C C;  5DJU B;  5CCG A;  3B8E B;  1L4A A;  1URQ C;  2ZFC A;  5TJH A;  1FBM A;  1FZB A;  3K5B A;  3RK3 B;  5C39 A;  4AUW A;  3CX5 I;  1QVF O;  1BGY E;  3BAS A;  3AE2 C;  3RL0 C;  1YTZ I;  2IPP A;  1H0T B;  1PL5 A;  1H8A A;  4NPF X;  4H0L B;  1FJK A;  1KD1 Q;  5KAI E;  2J59 M;  3H1J G;  5CBO A;  1NJI Q;  1JTH A;  1SS1 A;  5KLI B;  1MUU A;  2WSE H;  2HLO A;  1M1J B;  1J1D B;  2YO3 A;  1IFD A;  2HFE D;  2QRX A;  3GMA A;  2Y0D A;  3L73 J;  2QSI A;  4A7P A;  5CCH D;  1S72 P;  1RF1 A;  3M0D A;  1L0N J;  2A45 I;  3H1K D;  3GHG A;  3IFM A;  2KLV A;  3IF4 A;  2KLU A;  1NU1 E;  2OGU A;  2RH0 A;  4H0L C;  1YYC A;  2J58 A;  2K9J A;  4U3F J;  1GU5 A;  1KYO I;  1RE4 A;  5AW7 B;  4XA4 A;  3RK3 C;  3SWF A;  1AA0 A;  1UIX A;  1JMB A;  1KOR A;  3L71 J;  4UB6 H;  1YIT P;  4EOT A;  2CPS A;  1RE4 C;  3W68 A;  2YKQ A;  4I7Z C;  2QJY B;  2PFX A;  2R3C A;  1Q90 D;  1ZP0 C;  3CWB J;  2A45 H;  1VQ7 P;  1PGP A;  2M0B A;  4TT3 H;  1BGY G;  1ZXG A;  2KZJ A;  2QE7 H;  3TGU G;  2NZ2 A;  3EFG A;  3U59 A;  2K1A A;  1EDK A;  1HVV A;  4H13 B;  4I6M C;  3S9O A;  4B86 A;  2GUV A;  4XFJ A;  4EYY Q;  1BE3 E;  1USD A;  3H1H G;  2FXM A;  2J5U A;  5GTI H;  2E42 A;  2IYO A;  3BAT A;  1KB9 H;  1JY2 O;  2QIW A;  2M3B A;  2P7J A;  4WY4 A;  4QMA A;  5AW6 B;  3P32 A;  1IC2 A;  1RQV A;  1VQP P;  1EZV G;  5APT A;  2RN0 A;  1HJ0 A;  3CXH I;  3H1I G;  3BRV B;  5AVU B;  2YXR B;  3OA7 A;  3L37 A;  5AVQ B;  3AE9 C;  2Z5I A;  3L75 J;  4YTP C;  3GW6 A;  2AXC A;  3AE4 C;  1VQ5 P;  1USE A;  1JY2 N;  1G1J A;  2Q1K A;  1SQQ E;  1N7S D;  2BCC E;  1SQX J;  2QM7 A;  3AEF C;  1FZE A;  1JB0 J;  1SQP J;  2Y9Y A;  1M57 D;  3HD7 A;  2E74 B;  1Q86 Q;  1NWQ A;  1GU4 A;  1LP1 B;  3RL0 B;  2SPZ A;  3BVH A;  1S1C X;  2B89 A;  1X79 B;  2DW3 A;  1KFM A;  2YMY A;  2FYU G;  2ZYD A;  5APV A;  1T2K D;  1EDJ A;  1W2B O;  3CX5 E;  1LP1 A;  2W90 A;  2H43 A;  1U7M A;  1PIX A;  1VQN P;  3Q5P A;  5CJ0 A;  2WSC J;  4OGQ D;  5KAF E;  1MV8 A;  1PPJ E;  1OW7 A;  3CCE P;  2E5T A;  1URQ B;  2P67 A;  1JY3 N;  4JYB A;  3RK2 C;  2IX7 C;  3H1J E;  1NU1 D;  1N86 A;  3H1K E;  3M06 A;  4UB8 E;  4IL6 H;  1P84 D;  2MKV A;  2OTK E;  1JY3 P;  4L74 A;  1LNQ A;  3SSU A;  2R3S A;  1NTK E;  4ASW A;  4ZKU A;  3D6Y A;  1G1I A;  1OZH A;  1GW4 A;  5KLV J;  4HJG H;  5KLV G;  5CCH A;  4OGQ B;  2YO2 A;  3CCS P;  2RKL A;  4GDO A;  4GIF A;  1J1D C;  4EIJ A;  2OTL P;  1SQQ K;  2Q6Q A;  2W6J H;  3VP9 A;  4RO0 A;  2P58 A;  3MD0 A;  1MFZ A;  1N7S A;  2B87 A;  4I2L C;  4GOF A;  3W67 A;  4LGD E;  2OYI C;  3PHL A;  1NOH A;  1NTM G;  4MN4 C;  4AYC A;  1YIJ P;  3AEA C;  1FU1 A;  1RE3 A;  2YIU C;  3I56 P;  3ABV C;  2KYV A;  1SLQ A;  2PP6 A;  3JCU H;  3L4F A;  4GOD A;  4XE5 B;  2XKM A;  3RK3 E;  5TIS H;  3MTU E;  5M1B A;  3TGU E;  1G2C B;  1VDF A;  4ZKP A;  1S5L X;  1X0T A;  2HOD A;  1T3U A;  1H0T A;  1OMI A;  1YBK A;  3GHG B;  1L2P A;  2A06 G;  5E79 E;  1KV4 A;  1BE3 J;  2H88 C;  2K88 A;  3CXH E;  1KB9 E;  2O3J A;  2VRS A;  1FZG A;  1GW3 A;  4WY4 B;  2GUS A;  1EZV E;  3USS A;  1NTK G;  4HKZ H;  1VQ6 P;  2JEE A;  3LID A;  3P8C D;  1DH3 A;  1N73 A;  3B5N D;  1KN7 A;  1K04 A;  3L72 E;  1X9V A;  1HBW A;  2M3E A;  5GTH H;  3D70 A;  2KB7 P;  3V5B A;  2H89 C;  3T97 A;  3H25 A;  2FBW C;  1LGH B;  1AFO A;  5AW0 B;  1MZ9 A;  1N2D C;  4PD4 D;  1KIL E;  1YTZ T;  4C46 A;  1SQB D;  2BCC J;  3G9R A;  2JWD A;  1VL2 A;  3H1J D;  3RL0 g;  1D7M A;  1QL2 A;  3I5C A;  2QVA A;  1TU3 F;  1SQV G;  3LW5 H;  3PRJ A;  3QWO C;  1Q81 Q;  2V4H A;  1CSB A;  2QA4 P;  4D6T G;  4LLH A;  1FZF A;  3CD6 P;  1OIP A;  5KLI C;  1ZW0 A;  4HH2 A;  1FZC B;  3AE3 C;  1NU1 G;  3MZW B;  1WT6 A;  2C0X A;  1CI6 A;  2Y9Z A;  1RF1 B;  4H44 C;  2OTJ P;  1Y47 A;  3H32 A;  3TSI A;  3SWK A;  1VQ8 P;  2OQQ A;  2KI7 B;  1FS0 E;  2JP3 A;  4KJM A;  1BSH A;  2N1T B;  2QG4 A;  3G6E P;  3HTK A;  1FZA A;  3CLQ A;  3LIE A;  4JF7 A;  4YXW H;  5GTH E;  1BCC E;  2R32 A;  4WWI A;  3Q5S A;  1EXJ A;  1DD4 A;  1PFI A;  1S3J A;  2KP8 A;  1PGO A;  1VPC A;  3H32 B;  4O9B A;  1SQX K;  3CXH H;  4Y99 B;  2KIK A;  3H1L D;  3MUD C;  4PV1 C;  2FYN C;  5APU A;  5CCG D;  2HPC A;  2GM4 A;  4N6J A;  2C0W A;  5AVX B;  3ZDM A;  2W8Z A;  3HUS B;  2LXB A;  3L72 J;  3B5N A;  1LTI C;  2WT7 B;  1SP4 A;  1L4A B;  3KYQ A;  2NPS B;  2OYO A;  3TNU B;  3WU2 H;  1YI2 P;  3CCL P;  2E76 D;  3CCM P;  1NTM D;  4RKU J;  1ZOY C;  1LTJ A;  4HYT B;  2H8P D;  1EZV D;  2NPS C;  3MP7 B;  1KB9 D;  1VF5 D;  4BRY A;  5BVZ A;  4PD4 I;  3RBX A;  1SQQ G;  1L0L G;  4IL6 E;  3TGU J;  3M9B A;  4DCK A;  1UII A;  1E5W A;  1JY3 O;  1QGK B;  1T8Z A;  3AEE C;  4PV1 B;  5AW8 B;  5KJ7 A;  2OYH C;  1IFP A;  2E43 A;  1KYO E;  3HUS C;  2L91 A;  5TIS E;  3L75 D;  2FYN B;  1DEE G;  2E76 B;  2OYH A;  1NTZ J;  1MFT A;  1K05 A;  3JSV C;  1U57 A;  1PGQ A;  1SQB E;  1JNM A;  1GL2 A;  1SQP D;  3H1I J;  2ZYA A;  3L70 J;  1PP9 G;  1HGZ A;  1NTZ E;  1NVO A;  3NTN A;  5KLV E;  1N8R Q;  1BDC A;  1GZL A;  1HGV A;  4DT0 A;  2Q9I A;  1M1J A;  1G2C A;  3H1K J;  4K3A A;  2QJP C;  1QX8 A;  1ZME C;  4H0L D;  1M8O B;  2N9Y B;  1LTA C;  4IFF A;  4LC1 A;  3II6 A;  3BCC J;  3PTZ A;  3AEG C;  1PP9 D;  2E74 C;  2ZT9 B;  1GMJ A;  3IN6 A;  4JYC A;  1NAF A;  2WMM A;  2YNY A;  1WMK A;  1HTL C;  1M1K Q;  2E75 C;  2WWW A;  2IBZ I;  2KSJ A;  3BCC E;  3CX5 H;  2KNC B;  1EDI A;  3G3Z A;  3HRN A;  4I1L A;  3KPE A;  4UB8 H;  3NXS A;  4OGQ C;  2K3R A;  2WSF H;  3A0B E;  2Y0C A;  5APW A;  2IYP A;  4EI2 A;  1FOS F;  5AVS B;  1JY2 P;  3L74 J;  1LWU A;  2IBZ G;  4GKG A;  1J1E C;  3WMM 0;  1K73 Q;  1N73 C;  1VQL P;  2ZVO B;  3M9H A;  3VMX A;  3RK2 B;  4PV1 D;  5CCG C;  1NTK D;  3S4R A;  4WY4 C;  1SQB K;  4BRY B;  4GOE A;  5AW2 B;  3CL3 D;  1OW8 A;  3AE6 C;  3H1H D;  1KC8 Q;  1BE3 G;  1NTM E;  2FFD C;  5EFW B;  2FXP A;  3WU2 E;  1SQV J;  1KQS O;  3FXD A;  1EXI A;  3A7O A;  3NMD A;  4IFD K;  1DIP A;  1ZR4 A;  1L0N K;  1NKZ B;  3KQG A;  1KIL A;  1QEX A;  3B5N B;  3C1L A;  5GTI E;  2NPS D;  1OVU A;  3CCR P;  1FZC A;  4I7Z B;  1JM0 A;  1IJD B;  1KQL A;  1PZQ A;  1T3J A;  1U7J A;  2ZJS E;  2YIU B;  3CMA P;  2E5Y A;  1KIL C;  1H89 A;  1GL2 B;  5APX A;  3CME P;  1AVO A;  2YMK A;  2OYI B;  3AEC C;  3FWN A;  3O6Q B;  4L73 A;  4R4L A;  1VQM P;  3H1H E;  2WPR A;  2V7Q J;  3AE7 C;  2XV5 A;  4NPE A;  1SVF A;  1R8E A;  3OW2 O;  1CZQ A;  2I1K A;  3M0A A;  5KLV K;  3ITK A;  1M56 D;  3HE5 A;  2WIT A;  3N4X A;  5AW4 B;  1BGY D;  1NU1 J;  2I8D A;  3V6I A;  2WTY A;  1SFC D;  2IDB A;  4Y28 J;  4ZNC A;  1LTJ B;  1RHZ B;  3TYY A;  2QJY C;  3L73 G;  1PP9 E;  5KKZ C;  2O01 N;  5AVZ B;  1HUC A;  3M91 A;  3L35 A;  2R5B A;  3H1J J;  4H44 B;  1ZRT E;  1VQO P;  5KAI H;  3GF7 A;  2E75 D;  5H2F E;  4DZO A;  3GLM A;  3VTP C;  3FXE A;  2D2C B;  2C9N Y;  1H88 A;  2FXO A;  5B5E H;  4NPD A;  2JJL A;  3U1A A;  3NFQ A;  1LTT C;  3C8V A;  4K35 A;  1EZV I;  3PP5 A;  1X22 A;  3VOP A;  1AQT A;  1KB9 I;  1LTB C;  4PJ0 E;  3FWL A;  3CX5 D;  4H44 D;  3HE5 B;  4WY4 D;  3CCV P;  1LJ2 A;  2Z5H A;  1VQK P;  2KS1 A;  3L74 E;  1LT9 C;  2LKM A;  1Y8A A;  2R44 A;  5E79 H;  2HR3 A;  3L75 G;  3AED C;  3B71 A;  2GA1 A;  3OJA B;  4IOI H;  2XU6 A;  1SQQ J;  5CHX A;  3Q1M A;  2A45 G;  2AXT E;  1BE3 D;  1FDO A;  2POH A;  2Y0E A;  5CMZ A;  1BCC D;  3V2P A;  3V4W A;  1VF5 B;  3L72 D;  1HWT C;  3OAK A;  2N1T A;  3PH0 A;  3V4Q A;  1M7L A;  2KXP B;  3JCU E;  1M90 Q;  3VN0 A;  1NTK K;  3MHV A;  1NTM J;  4H13 C;  2FYU J;  2KS1 B;  1KFN A;  1P84 I;  2WVR A;  2W83 C;  2IBZ D;  3L36 A;  1EQ7 A;  1SQV K;  1JO5 A;  4M3L A;  2ZAE B;  4D6T D;  3CWB E;  3FGA D;  2WSE J;  3PLN A;  1S2E A;  4HB1 A;  5APQ A;  2Q3I A;  1GTW A;  2FFD B;  4EDF A;  1SQB J;  1R5S A;  2BCC D;  2LR2 A;  1S4X A;  4JPZ B;  1XTC C;  1NU1 K;  1YJ9 P;  3L70 E;  1YJN P;  3CI9 A;  1OWA A;  5B66 H;  2LXC B;  4C7N B;  1VF5 C;  3HE4 A;  2N9B A;  3BCC G;  1VQ4 P;  1FZC C;  3UIA A;  3P7K A;  2H7H A;  1JUN A;  2IFN A;  2AEF A;  3P8M C;  1SFC C;  3SFE C;  1S5L E;  5BU5 A;  3M0D C;  4ASV A;  3CCQ P;  3HD7 D;  3L75 E;  1E79 H;  1LWU B;  2D2C D;  2WSC H;  1JCC A;  3A3Y B;  2YXQ B;  1RF0 C;  1DD3 A;  1RH5 B;  2K9J B;  2IFM A;  3RK2 D;  2E75 B;  3TNU A;  5AVR B;  1EDL A;  5KAF H;  3L73 E;  2BAS A;  3GF3 A;  1Z56 A;  3WUU A;  1OVV A;  2XZR A;  3CXH D;  1RF0 A;  1RQU A;  2KNC A;  1PP9 J;  2ZT9 C;  2HG5 D;  1Q7Y Q;  1T6A A;  4KT0 J;  1R5L A;  2ZYG A;  2QJP B;  1FAV A;  2Z4E A;  3MUD A;  2BCC G;  3H1L J;  3CC2 P;  1SQV E;  3RL0 D;  4CPG A;  3G4S P;  4ZMD A;  3HD7 B;  1SQX G;  1FJP A;  1L0L D;  2V7Q H;  2WPS A;  4BXL A;  1S5L H;  5L8R J;  1Q2N A;  4OVN F;  2PRR A;  2XDJ A;  2AEJ A;  1FE6 A;  3L71 E;  3GHG C;  3H1I E;  3L74 D;  3VP8 A;  2K37 A;  5CBN A;  4OWF A;  2PGD A;  1LTJ C;  5AW5 B;  4U3F D;  3MIW A;  2P10 A;  1VQ9 P;  2WQY C;  5B66 E;  1KTM A;  3VMZ A;  1LTG C;  1NTK J;  4N78 D;  1J2J B;  3EFF K;  2OYH B;  3V2N A;  3EQ2 A;  3TGU D;  2O01 H;  1N73 B;  1IO4 A;  5AVT B;  4R4M A;  1Q82 Q;  3L70 G;  4Z1M H;  2KOG A;  3CWB D;  1SQV D;  1FOS E;  3AEB C;  1IK9 A;  1MKM A;  4H13 D;  3RBZ A;  1WRG A;  4WVZ A;  2OAR A;  4BWN A;  3I55 P;  3A5T A;  3A0H E;  2N1T D;  1NTZ D;  2W6A A;  2AEM A;  2ZVN B;  3C9I A;  2W6B A;  1P84 E;  1QVG O;  2HOD B;  2Q3E A;  3H1I D;  3H6P A;  5BU8 B;  1L4A C;  3L70 D;  1LT9 A;  2L5G B;  3L71 G;  1CW5 A;  3O6Q A;  4WB4 A;  5AW3 B;  1OFC X;  3B5N C;  4UB6 E;  3B4S A;  1ZR2 A;  4U3F G;  1BDD A;  3V2R A;  2JR8 A;  1RY3 A;  1SQX E;  1FC2 C;  3AE5 C;  3D6Z A;  1BCC G;  3U1C A;  1IZN B;  1KIL D;  3BCC D;  1JMM A;  3BRT B;  1L0N G;  4PJ0 H;  3SWY A;  3Q5R A;  2HPC B;  5K5G B;  1HF9 A;  1LT1 A;  1YHQ P;  3H1L G;  1NTZ K;  1OVR A;  3L73 D;  3VMA A;  3WUT A;  2QM8 A;  2WSS H;  4JQ0 D;  1JTH B;  2C9L Y;  3N7N A;  1RF1 C;  5KJ7 C;  2ZXE B;  1L0N D;  2PAJ A;  5B5E E;  5AVW B;  1NYH A;  3VMY A;  5AVY B;  1NO4 A;  2ZT9 D;  5KKZ B;  2XND H;  4U7J A;  1JEK A;  2NRG A;  2Q5U A;  5H2F H;  2KSE A;  1M1J C;  2B87 B;  3M9Q A;  2IZ0 A;  2RMZ A;  4W80 A;  4C7N A;  3L71 D;  1L0L E;  1ZRT D;  1SFC A;  1XTG B;  4RES B;  3CC7 P;  2XNX A;  3GG2 A;  1K8A Q;  3MGN A;  1PPJ D;  2MJZ A;  1X8Y A;  3E1R A;  3H1H J;  3JC2 2;  3SFD C;  2IZ1 A;  2JKV A;  3HUS A;  1SQP G;  1NH4 A;  1AV1 A;  2ZXX A;  4N78 E;  4U3F E;  3H1L E;  5KTB A;  5KLV D;  1P84 H;  1ZLL A;  5DJT B;  4PD4 H;  3KZI E;  4RJT A;  1YJW P;  2QEX P;  2M5A B;  3A0H H;  2CPB A;  3R4Y A;  2O01 J;  3A2A A;  2O1J A;  2P1J A;  2WPV B;  1JOC A;  4IL6 X;  4Y99 C;  2YKO A;  3VYI A;  3WUV A;  1OW6 A;  3TF5 A;  3CCU P;  3KDP B;  2KZI A;  2K9Y A;  1NTM K;  1FDM A;  2FYU K;  1SQQ D;  2E76 C;  3PJS K;  3RGU A;  1NGM B;  1GL2 D;  2WT7 A;  3Q2Y A;  2OYI A;  2BEQ D;  1GDT A;  4WBA A;  4L76 A;  3TK1 A;  1AQ5 A;  1JCD A;  2N1T C;  1IK7 A;  1RE3 C;  1W2E A;  2M8R A;  1T2K C;  3EWK A;  1NAY A;  1AJY A;  2A06 E;  1SQX D;  1L4A D;  3TDK A;  2JDI H;  3CPW O;  1A02 J;  1BGY J;  2R5D A;  4D6T J;  1KZU B;  1J1E B;  2JWA A;  1NHL A;  1KQG B;  2CK3 H;  1L0L K;  3O8Z A;  4IFM A;  4W7Y A;  1LT9 B;  4AQR D;  4YXD C;  3CC4 P;  1HJB A;  1GK4 A;  1QLE D;  1URQ D;  4D6T E;  3KHU A;  2M5A A;  2IBZ E;  2BEZ F;  1LWU C;  1KMI Z;  1CI6 B;  1SQP E;  1LTS C;  2KK7 A;  3S1K A;  4W7Z A;  3D71 A;  1S9K D;  2JO1 A;  2I1J A;  1ZV8 A;  3T97 B;  5APY A;  1L0N E;  3L74 G;  1IFN A;  4DOJ A;  2FKW B;  5KJ7 D;  2B88 A;  3E1I A;  1OXZ A;  1SFC B;  3H1K G;  2QJK B;  1FDI A;  3A0B H;  3IAO A;  4TLF A;  2G8Y A;  2Q7C A;  2FFD A;  1NTZ G;  2E74 D;  4YPC A;  1IFJ A;  2FYU E;  3FX0 A;  3QH9 A;  3R2P A;  4N3Y B;  2FYZ A;  5CCH C;  2QJK C;  2WSF J;  1KQF B;  3F89 A;  3HD7 C;  3V2Q A;  1HH0 A;  1DX7 A;  3AE1 C;  1PV3 A;  1GK6 A;  2WZ7 A;  2YKP A;  3HTK B;  5APS A;  3RK3 D;  1YQ4 C;  2NPS A;  1SQB G;  4JBZ A;  1PPJ G;  1KYO D;  2B9B A;  5CJ4 A;  1EC5 A;  1A02 F;  2FY8 A;  3IR9 A;  3KXD A;  1BCC J;  1GD2 E;  3E7K A;  1ZN5 A;  2P2U A;  1L0L J;  1Y9B A;  2G3A A;  5AW1 B; 
#chains in the Genus database with same CATH homology
 1NTM G;  3CXH H;  3L75 G;  1BGY G;  3TGU G;  3L72 G;  3H1L G;  1BE3 G;  3H1J G;  3L73 G;  1KYO H;  1SQV G;  3L74 G;  3H1H G;  3H1K G;  4D6T G;  1KB9 H;  1NTZ G;  2FYU G;  1EZV G;  1NU1 G;  3CX5 H;  3H1I G;  2A06 G;  3CWB G;  1SQQ G;  1L0L G;  5KLV G;  2BCC G;  1NTK G;  3L71 G;  1SQX G;  1SQB G;  4U3F G;  1PPJ G;  2IBZ G;  1L0N G;  1SQP G;  1BCC G;  3BCC G;  1P84 H;  3L70 G;  4PD4 H;  1PP9 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...