4U3FG

Cytochrome bc1 complex from chicken with designed inhibitor bound
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
80
structure length
80
Chain Sequence
IHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Rational Design of Highly Potent and Slow-Binding Cytochrome bc1 Inhibitor as Fungicide by Computational Substitution Optimization
doi rcsb
total genus 16
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2014-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 4u3fG00
1SQBG 3H1LG 1NTKG 1L0LG 1SQVG 3CXHH 3H1IG 1SQQG 1PPJG 3L75G 3L73G 1SQXG 1NTMG 2FYUG 1SQPG 3H1KG 1L0NG 2IBZG 3BCCG 1KYOH 4U3FG 3H1JG 1KB9H 1P84H 4D6TG 1EZVG 3L70G 1BCCG 3CWBG 3L72G 3H1HG 1BE3G 2A06G 3L74G 2BCCG 3CX5H 1PP9G 1BGYG 1NTZG 1NU1G 4PD4H 3TGUG 3L71G 5KLVG
chains in the Genus database with same CATH superfamily
1JM0A 2P7JA 2QM8A 3EQ2A 1NTME 1JY2O 4AYCA 1HGZA 2AXTE 2E75B 3CCVP 1PZQA 3CXHI 3H1HE 3L70D 1FE6A 1RE4A 2R3CA 4I1LA 1S72P 3VMYA 1K73Q 5AVXB 2YO2A 3VYIA 2OYHB 3V4WA 2A45I 1CI6A 4Y28J 4KJMA 2IYPA 2B9BA 2K88A 3VMXA 4UB6H 3O6QB 4ZNCA 3CL3D 5APYA 2FXMA 2ZT9B 3BRTB 4GOEA 1P84D 1CSBA 2ZVOB 3I56P 2GA1A 3N7NA 1KYOH 3CX5D 3BCCE 1Y8AA 4K3AA 4AUWA 5B66H 1RH5B 3G6EP 3KQGA 4EOTA 5CCGA 1YTZT 2G3AA 2O1KA 4OGQC 1M90Q 2E76C 1OXZA 2QE7H 5AW2B 3CPWO 1J1DC 2BASA 2WITA 3AEBC 1AVOA 1EDKA 3KZIE 4U3FE 5AVYB 1EC5A 3RK3E 1U7JA 1USDA 3A3YB 2LXBA 4Y99C 2OGUA 1IZNB 3H6PA 1PGQA 2M8RA 2IFMA 3NXSA 3FWNA 2ZAEB 1VQ9P 2Q3IA 3GHGC 2V7QH 3H1IJ 5KLVE 1ZOYC 1OW6A 3AECC 2AEMA 2QJKC 3A0HH 2FYUE 2PRRA 3HTKB 1NGMB 5B5EH 1CZQA 4I6MC 1JY2P 1PP9J 1K8AQ 4GOFA 3SWFA 1AQ5A 4U7JA 3P8MC 3H1IG 3CC2P 1LT9B 4MN4C 1JCDA 3V2QA 3H1ID 1N73B 1KILE 3B5NA 2E75C 3G9RA 4ZKPA 1NU1J 3E7KA 1RE4C 2E74B 1PP9G 1LT1A 2ZYDA 4EYYQ 1FZCA 3H1LE 3NMDA 1DEEG 2OTLP 4HKZH 1NU1G 1AA0A 3CLQA 2Q1KA 3CCQP 1U57A 2ZT9C 3L71E 2OARA 3MD0A 1GL2A 3LW5H 3CWBJ 5CCGC 2E74D 5BU5A 1BGYJ 1J2JB 3CI9A 1E5WA 1N7SA 3RL0B 3AEEC 4PD4E 1S9KE 4C7RA 1RF1A 1KILB 3CWBG 1XTGB 4ZMDA 1BCCE 3M0DA 1BGYG 2A06E 3E1IA 3CMAP 3CWBD 1RQUA 1BGYD 1PGJA 4L76A 4H0LB 1RY3A 2PGDA 4HH2A 3CCUP 2PAJA 3BVHA 3KXDA 2IZ1A 1M1KQ 2WSEH 2WZ7A 2B87B 2ZJSE 2M5AA 1SQBJ 5KLIB 3RL0D 5CCHA 5B5EE 2K9JA 3KDPB 2K3RA 1NU1K 3O8ZA 1AJYA 2WPVB 3M06A 3H32B 2IX7C 1IK7A 3JC22 1OW7A 1SQBG 4H0LD 2OYIB 1L0LE 2Z5HA 3L75E 3L73E 1FDMA 1N73C 5KLVK 3CXHE 3H1JE 1EZVG 1Q81Q 3HE5B 3TK1A 3T97B 1K9MQ 3RK3C 1EZVD 2R3SA 1KYOD 1KB9D 1KC8Q 1T2KD 1M1JA 3FXDA 4WVZA 1KTMA 3MUDC 3C9IA 4DJGA 2K1AA 2JWAA 5L8RJ 2WWWA 3M0AA 1SQVJ 2Q9IA 4IL6X 1QL2A 2O1JA 1ZR2A 2KUBA 3Q5SA 3HD7B 2N1TB 3KYQA 3HE4A 1FDOA 1NTZJ 3V2NA 1H88A 4H13B 3TNUB 1YTZI 1LP1B 1DEBA 2HODA 3PJSK 1SQVG 1GD2E 3K5BA 2FFDA 1S4XA 1IFNA 1QL1A 1SQVD 3E1RA 1RF1C 1SQPE 3ITKA 1SLQA 4YXDC 1FZEA 4DZOA 3M0DC 1VL2A 3L72J 2FYZA 3A7OA 1KILC 2WSFJ 4DCKA 1NTZG 2JR8A 2HLOA 1Q90D 2BCCE 2OQQA 2O01N 1SQQJ 1XTCC 3C8VA 1NTZD 3SWKA 4H0LC 1OVRA 3EWKA 1EQ7A 3I55P 1KQSO 5CCHC 2RKLA 4H13D 3L72G 1YITP 1NTKJ 2NRGA 3V2RA 2J5UA 3TDKA 1MV8A 1SQQG 4ASVA 4ZKUA 1LTJA 2IFNA 3AEFC 5AVUB 1M56D 1SQQD 2W27A 2YKPA 4D6TJ 1JY3P 5CHXA 2HPCA 5APVA 2NPSB 2FXPA 4C46A 3I5CA 1HF9A 1L4AA 1WRGA 1NTKG 2G8YA 1E79H 3RBZA 2P67A 5KKZC 1NTKD 3P32A 1RHZB 1DD3A 4D6TG 4PD4I 1MKMA 2W83C 1KQLA 4D6TD 2WT7B 2AEJA 1P84E 4IOIH 1RE3C 3CX5E 3VMAA 2P2UA 1S5LX 5GTHE 5CMZA 4I7ZC 3TGUJ 3GHGB 2E76D 1FAVA 3A2AA 3H1KJ 1M7LA 2LKMA 3U1AA 5BU8B 3P7KA 3HD7C 2N1TC 2M3BA 4KT0J 4L74A 1VQLP 2RN0A 4LC1A 2JP3A 1X0TA 5H2FE 2JWDA 3TGUG 2VRSA 3AE4C 3G4SP 3CD6P 2KS1A 3TGUD 4R4MA 5K5GB 3H1KG 3IAOA 3M9BA 1GDTA 1Y9BA 3H1KD 3L70G 4GKGA 1L0NK 2KSJA 1YJ9P 4HJGH 1SQXJ 4W7ZA 2R44A 2HR3A 4ASWA 2K9YA 2XNXA 1CI6B 3WUTA 3AEGC 4AQRD 5EFWB 2QG4A 1JNMA 1EDLA 1SQPK 1LTJC 1OFCX 2E42A 1SQXG 3H1IE 3P8CE 1VF5B 4EIJA 1EXJA 3V4QA 1EXIA 1OVVA 4JPZB 1SQXD 1URQA 2D2CC 1T8ZA 1BDCA 2E75D 1FOSE 3QWOC 2NPSC 2OYOA 4N78D 3II6A 4GT1A 1BDDA 1PP9E 1N8RQ 1UIIA 3CC7P 1VQPP 3F5HA 4IFMA 2YKQA 2YXRB 1KQGB 2IBZD 2MKVA 3PH0A 3L35A 4PD4H 2ZT9D 3CC4P 1NU1E 1MUUA 2FKWB 3MHVA 4OWFA 2R5DA 2O01J 4W80A 2KIKA 3QH9A 1KQFB 5CCGD 2JKVA 1QVGO 2JEEA 3B8EB 2C9LY 2PP6A 2E5TA 2JJLA 2WVRA 1M8OB 4GIFA 4L73A 1EDJA 1MFTA 1NTMD 2RMZA 5TJHA 4JYCA 1HWTC 3CWBE 3USSA 1PL5A 2FBWC 2E5YA 1BGYE 2H43A 3M91A 2WSCJ 5DJTB 2QRXA 3B5NB 1JMMA 3JCUH 2WSSH 1ZRTD 1FZCB 2XU6A 3RK3B 1VQ7P 3U59A 1ZW0A 3S4RA 3CXHH 1P84I 1W2EA 1LTBC 5AW3B 1ZXGA 3CX5I 2W6BA 5GTIH 2XV5A 1G2CA 3B4SA 2A45H 1GTWA 1H89A 3W67A 1NH4A 1SQBE 1URQC 2P1JA 2WPQA 1VF5C 4CPGA 2QIWA 3AE3C 1IJDB 2KP8A 1EZVE 3RK3D 1NKNA 3L74E 2P10A 3IFMA 4Z1MH 2J58A 2R32A 3L37A 2KYVA 2KNCA 5APQA 1PPJE 1LTTC 3OAKA 4JF7A 1RF1B 2M0BA 4XA4A 3W68A 3MZWB 1MFZA 1YYCA 2LXCB 4XFJA 5KAIH 1IK9A 3RBXA 2OTKE 1WMKA 2KK7A 2KI7B 2ITAA 2FYUD 4BRYA 2M5AB 1AQTA 4RJTA 3HUSA 2W6AA 3GMAA 1JMBA 5APWA 2K9JB 1USEA 3PRJA 4XE5B 4RKUJ 1SQVE 3SSUA 2Y9ZA 2MJZA 1HJ0A 3CMEP 1BE3J 1KILD 5KTBA 1GW4A 3JCUE 2B89A 1NTZE 2Y9YA 1DIPA 5KKZB 1A02J 1Q7YQ 2GUSA 3B5NC 3KHUA 5CBOA 4KHXA 1QLED 1W5CE 2KLVA 1FOSF 5CCHD 4W7YA 3PP5A 1FZCC 1BE3G 1JTHA 3L72E 1Q2NA 1T3UA 5KAFH 1NKZB 1M1JB 1BE3D 1L2PA 3L71D 1PGPA 5GTIE 1J1EC 3C1LA 1GU5A 5DJUB 4PV1C 1H0TB 1KFMA 1P84H 2H7HA 1Z56A 3WUUA 3M9QA 3VTPC 4I7ZB 1AFOA 3CX5H 1GL2C 4JQ0D 5AVRB 3VP8A 1LWUA 1NTKE 4GODA 2V7QJ 5GTHH 3HE4B 4OH8B 1L0NE 1YIJP 2QM7A 4JBZA 1GU4A 4D6TE 1S9KD 1N7SC 2HODB 3VOPA 2FFDB 1BCCD 3CCMP 1JO5A 2WTYA 3CCEP 1JOCA 5BVZA 3RGUA 3CCSP 3RK2B 5KAIE 5H2FH 2HFED 1SQBK 4RESB 5AW5B 3Q1MA 2PFXA 2KSEA 3SFEC 1QVFO 2JO1A 2ZFCA 4NPEA 4BWNA 5M1BA 3H1JJ 4WB4A 3CCLP 3HD7D 2N1TD 3F89A 1VQ4P 3D71A 2KXPB 1IFJA 1LTJB 3TGUE 3R4YA 3HRNA 3KPEA 1OIPA 1L0LD 2HPCB 3L75D 5AW4B 3OW2O 3H1KE 3H1JG 2D2CB 1DD4A 3LW5J 3CXHD 3H1JD 1L4AB 3BASA 3L70E 4H44C 2L5GB 2Q6QA 1EZVI 4O9BA 2YKOA 2WPSA 1SFCA 1GK4A 1KB9I 3AE7C 1ZV8A 1X8YA 5KJ7A 5AVSB 5KAFE 1LTIC 1SQVK 2IYOA 2ZVNB 3PLNA 2SPZA 2YNYA 3S9OA 1D7MA 1VQNP 1KORA 4N3YB 2HG5D 3NFQA 4GDOA 1Y47A 1M1JC 1M57D 4WY4A 3WMM0 2Z4EA 1SQXE 2YIUC 4IL6E 1JY2N 1NTZK 1S5LH 2D2CD 1H8AA 2BCCJ 2NPSD 4N78E 1VQ8P 1LWUC 2WSEJ 2KLUA 3LIDA 4EI2A 1X79B 3OA7A 3L36A 1QEXA 1DX7A 2BEQD 2ZYAA 1NJIQ 1VDFA 5AVZB 1FZFA 3D70A 2N9BA 3M9HA 1SQQK 1T3JA 3AE2C 5APUA 1SVFA 2GUVA 1IO4A 2KS1B 1QX8A 4C7NA 2FFDC 1LNQA 2BCCD 5AW8B 2R5BA 3RK2C 1RF0A 3CCJP 2KOGA 1YQ4C 3B71A 1WT6A 5E79E 3A0BE 2FYNB 3IN6A 1NTKK 4R4LA 3SFDC 5TISE 3WU2H 1OVUA 1PGOA 3VMZA 2QEXP 2H89C 5CJ4A 1K04A 3MGNA 3V2PA 1S3JA 2L91A 3R2PA 2RH0A 4I2LC 2QJPC 2XNDH 3D6ZA 3VN0A 3MIWA 5C39A 3Q2YA 3H25A 1NAYA 1URQB 1ZRTE 1ZP0C 2M3EA 1IFMA 2IPPA 3WUVA 1NYHA 1NO4A 1IFDA 2WQYC 3IR9A 1LTGC 2OYHA 4JYBA 1L4AC 1SFCC 5APXA 2NZ2A 3PHLA 2ZYGA 3O6QA 1KN7A 5KJ7C 5CBNA 3AE1C 3A5TA 1YJWP 1TU3F 4LLHA 2QVAA 1ZN5A 2IBZG 1FDIA 3TYYA 1KB9H 2Y0CA 2JDIH 1U7MA 4QMAA 2QSIA 3RL0g 3TF5A 1VQ5P 4WY4C 1JUNA 1LJ2A 1S5LE 4RO0A 2Q3EA 1URQD 4YXWH 1NTMJ 1JB0J 3AE5C 1VF5D 1JCCA 4YPCA 1NAFA 1OZHA 4IFDK 3D6YA 2CK3H 2Q5UA 3H1HJ 3AE8C 3V6IA 1IFPA 2QJYB 1KD1Q 2DW3A 4TLFA 3OJAB 1NTMG 3BATA 1VQKP 4A7PA 1GK6A 1G1JA 3N4XA 1DH3A 4WBAA 1SQXK 4NPFX 3H1HG 2YO3A 2W8ZA 1RF0C 2C0WA 3H1HD 2O3JA 3BCCJ 3WU2E 2XZRA 2I1KA 4M3LA 2FYNC 2YXQB 1SS1A 1KV4A 3HTKA 2AEFA 2KB7P 3TSIA 1CW5A 3UIAA 1LTAC 1FU1A 1J1EB 4U3FJ 3P8CD 1OMIA 4PV1B 3BCCG 5AW0B 1LT9A 1G2CB 2WSFH 1K05A 3BRVB 1X9VA 1AV1A 3BCCD 1N73A 1HTLC 1GL2B 1PP9D 1VQOP 4UB6E 3B5ND 2AXCA 2OYHC 1PFIA 1FZAA 4U3FG 5CJ0A 3ZDMA 2IBZI 1NTMK 4U3FD 2YMKA 2ZXEB 1N7SB 3MUDA 5KLVJ 2E43A 1BE3E 1KYOE 4L75A 2KNCB 2Z5IA 1KB9E 1KZUB 1NVOA 1NU1D 2FYUJ 5B66E 2XKMA 4PJ0H 4PV1D 5AVVB 3LIEA 2OTJP 1W2BO 1GL2D 4N6JA 5KLVG 1PV3A 3GF3A 2V4HA 1JY3N 4BRYB 2FYUG 2C0XA 2FY8A 5KLVD 3HUSB 1N7SD 2QJYC 1YQ3C 1G1IA 3H1LJ 3U1CA 1KILA 1KFNA 3Q3DA 3AE9C 1GW3A 5AW9B 5AW6B 2XDJA 1LTSC 2HYNA 3A0HE 3L71J 4H44B 1N86A 2B87A 1S1CX 1YI2P 4UB8H 3FX0A 1FJPA 4LGDE 3H1LG 2N9YB 3H1LD 4OVNF 3L4FA 3SWYA 1OW8A 1JTHB 4DT0A 3L74J 2Y0EA 3H32A 1RQVA 1R5SA 3L71G 3AEAC 1ZMEC 1JY3O 3Q5PA 1LT9C 1HBWA 1SQBD 2GM4A 1SQQE 2YIUB 3JSVC 2OYIA 1YJNP 2IZ0A 1AVYA 1R5LA 1GMJA 1BCCJ 2J59M 4EDFA 2FYUK 4H44D 1BSHA 2YMYA 1LWUB 2E74C 3L74G 4IL6H 5APTA 3HE5A 3T97A 1HGVA 2Q7CA 3L74D 5AVQB 3PTZA 1PPJG 3V5BA 2KZIA 3S1KA 3CCRP 2UWJE 2WMMA 1NHLA 1PPJD 1QGKB 1NOHA 1RE3A 3GW6A 4PD4D 1FZGA 2P58A 3MTUE 1H0TA 4PJ0E 5AW7B 1BCCG 2C9NY 2A06G 1SP4A 1YHQP 5AVTB 1S2EA 3VP9A 2A06D 1IC2A 3HD7A 2N1TA 3EFGA 5E79H 1L0LJ 5AW1B 1VPCA 3A0BH 3FWLA 3L75J 3ABVC 3L73J 3RL0C 1KMIZ 3TNUA 1LP1A 4DOJA 5TISH 1UIXA 2WPRA 2I8DA 3HUSC 4K35A 1N2DC 1GZLA 2QJPB 3NTNA 2H8PD 4YTPC 4BXLA 1OX3A 3G71P 1FJKA 2AXTH 1L0LG 1ZR4A 3RK2D 2O01H 3IF4A 3L75G 3L73G 1Q82Q 2CPBA 1YBKA 3L73D 4UB8E 4IFFA 1T6AA 1HUCA 2QA4P 2POHA 1SFCB 1LGHB 5KLIC 1ZLLA 2BEZF 5AVWB 3L72D 4NPDA 1KYOI 1L0NJ 2A45G 3GLMA 1FS0E 1T2KC 1VQMP 3FGAD 1FC2C 4HYTB 4WY4B 1Q86Q 2WSCH 4OGQB 2NPSA 2OYIC 2E76B 2KZJA 2W90A 1SQPJ 1J1DB 2ZXXA 1A02F 1L0NG 4WWIA 2IDBA 3GG2A 4HB1A 1X22A 1L0ND 1L4AD 1SFCD 3MP7B 2LR2A 2K37A 1VQ6P 1R8EA 1JEKA 5KJ7D 3FXEA 4Y99B 3KZIH 2WT7A 1SQPG 1HJBA 1HVVA 3AE6C 1OWAA 2IBZE 1NWQA 1L0LK 1SQPD 2Y0DA 4WY4D 4C7NB 3Q5RA 1IFIA 1FBMA 3EFFK 2BCCG 4OGQD 2FXOA 1MZ9A 1EDIA 2H88C 3GHGA 1BSNA 2QJKB 2W6JH 1PIXA 4B86A 1HH0A 1N7LA 3L70J 3GF7A 2B88A 1FZBA 3G3ZA 5APSA 2I1JA 4H13C 3AEDC 2CPSA 4TT3H
chains in the Genus database with same CATH topology
1SQBG 3H1LG 1NTKG 1L0LG 1SQVG 3CXHH 3H1IG 1SQQG 1PPJG 3L75G 3L73G 1SQXG 1NTMG 2FYUG 1SQPG 3H1KG 1L0NG 2IBZG 3BCCG 1KYOH 4U3FG 3H1JG 1KB9H 1P84H 4D6TG 1EZVG 3L70G 1BCCG 3CWBG 3L72G 3H1HG 1BE3G 2A06G 3L74G 2BCCG 3CX5H 1PP9G 1BGYG 1NTZG 1NU1G 4PD4H 3TGUG 3L71G 5KLVG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQB G;  3H1L G;  1NTK G;  1L0L G;  1SQV G;  3CXH H;  3H1I G;  1SQQ G;  1PPJ G;  3L75 G;  3L73 G;  1SQX G;  1NTM G;  2FYU G;  1SQP G;  3H1K G;  1L0N G;  2IBZ G;  3BCC G;  1KYO H;  4U3F G;  3H1J G;  1KB9 H;  1P84 H;  4D6T G;  1EZV G;  3L70 G;  1BCC G;  3CWB G;  3L72 G;  3H1H G;  1BE3 G;  2A06 G;  3L74 G;  2BCC G;  3CX5 H;  1PP9 G;  1BGY G;  1NTZ G;  1NU1 G;  4PD4 H;  3TGU G;  3L71 G;  5KLV G; 
#chains in the Genus database with same CATH topology
 1JM0 A;  2P7J A;  2QM8 A;  3EQ2 A;  1NTM E;  1JY2 O;  4AYC A;  1HGZ A;  2AXT E;  2E75 B;  3CCV P;  1PZQ A;  3CXH I;  3H1H E;  3L70 D;  1FE6 A;  1RE4 A;  2R3C A;  4I1L A;  1S72 P;  3VMY A;  1K73 Q;  5AVX B;  2YO2 A;  3VYI A;  2OYH B;  3V4W A;  2A45 I;  1CI6 A;  4Y28 J;  4KJM A;  2IYP A;  2B9B A;  2K88 A;  3VMX A;  4UB6 H;  3O6Q B;  4ZNC A;  3CL3 D;  5APY A;  2FXM A;  2ZT9 B;  3BRT B;  4GOE A;  1P84 D;  1CSB A;  2ZVO B;  3I56 P;  2GA1 A;  3N7N A;  1KYO H;  3CX5 D;  3BCC E;  1Y8A A;  4K3A A;  4AUW A;  5B66 H;  1RH5 B;  3G6E P;  3KQG A;  4EOT A;  5CCG A;  1YTZ T;  2G3A A;  2O1K A;  4OGQ C;  1M90 Q;  2E76 C;  1OXZ A;  2QE7 H;  5AW2 B;  3CPW O;  1J1D C;  2BAS A;  2WIT A;  3AEB C;  1AVO A;  1EDK A;  3KZI E;  4U3F E;  5AVY B;  1EC5 A;  3RK3 E;  1U7J A;  1USD A;  3A3Y B;  2LXB A;  4Y99 C;  2OGU A;  1IZN B;  3H6P A;  1PGQ A;  2M8R A;  2IFM A;  3NXS A;  3FWN A;  2ZAE B;  1VQ9 P;  2Q3I A;  3GHG C;  2V7Q H;  3H1I J;  5KLV E;  1ZOY C;  1OW6 A;  3AEC C;  2AEM A;  2QJK C;  3A0H H;  2FYU E;  2PRR A;  3HTK B;  1NGM B;  5B5E H;  1CZQ A;  4I6M C;  1JY2 P;  1PP9 J;  1K8A Q;  4GOF A;  3SWF A;  1AQ5 A;  4U7J A;  3P8M C;  3H1I G;  3CC2 P;  1LT9 B;  4MN4 C;  1JCD A;  3V2Q A;  3H1I D;  1N73 B;  1KIL E;  3B5N A;  2E75 C;  3G9R A;  4ZKP A;  1NU1 J;  3E7K A;  1RE4 C;  2E74 B;  1PP9 G;  1LT1 A;  2ZYD A;  4EYY Q;  1FZC A;  3H1L E;  3NMD A;  1DEE G;  2OTL P;  4HKZ H;  1NU1 G;  1AA0 A;  3CLQ A;  2Q1K A;  3CCQ P;  1U57 A;  2ZT9 C;  3L71 E;  2OAR A;  3MD0 A;  1GL2 A;  3LW5 H;  3CWB J;  5CCG C;  2E74 D;  5BU5 A;  1BGY J;  1J2J B;  3CI9 A;  1E5W A;  1N7S A;  3RL0 B;  3AEE C;  4PD4 E;  1S9K E;  4C7R A;  1RF1 A;  1KIL B;  3CWB G;  1XTG B;  4ZMD A;  1BCC E;  3M0D A;  1BGY G;  2A06 E;  3E1I A;  3CMA P;  3CWB D;  1RQU A;  1BGY D;  1PGJ A;  4L76 A;  4H0L B;  1RY3 A;  2PGD A;  4HH2 A;  3CCU P;  2PAJ A;  3BVH A;  3KXD A;  2IZ1 A;  1M1K Q;  2WSE H;  2WZ7 A;  2B87 B;  2ZJS E;  2M5A A;  1SQB J;  5KLI B;  3RL0 D;  5CCH A;  5B5E E;  2K9J A;  3KDP B;  2K3R A;  1NU1 K;  3O8Z A;  1AJY A;  2WPV B;  3M06 A;  3H32 B;  2IX7 C;  1IK7 A;  3JC2 2;  1OW7 A;  1SQB G;  4H0L D;  2OYI B;  1L0L E;  2Z5H A;  3L75 E;  3L73 E;  1FDM A;  1N73 C;  5KLV K;  3CXH E;  3H1J E;  1EZV G;  1Q81 Q;  3HE5 B;  3TK1 A;  3T97 B;  1K9M Q;  3RK3 C;  1EZV D;  2R3S A;  1KYO D;  1KB9 D;  1KC8 Q;  1T2K D;  1M1J A;  3FXD A;  4WVZ A;  1KTM A;  3MUD C;  3C9I A;  4DJG A;  2K1A A;  2JWA A;  5L8R J;  2WWW A;  3M0A A;  1SQV J;  2Q9I A;  4IL6 X;  1QL2 A;  2O1J A;  1ZR2 A;  2KUB A;  3Q5S A;  3HD7 B;  2N1T B;  3KYQ A;  3HE4 A;  1FDO A;  1NTZ J;  3V2N A;  1H88 A;  4H13 B;  3TNU B;  1YTZ I;  1LP1 B;  1DEB A;  2HOD A;  3PJS K;  1SQV G;  1GD2 E;  3K5B A;  2FFD A;  1S4X A;  1IFN A;  1QL1 A;  1SQV D;  3E1R A;  1RF1 C;  1SQP E;  3ITK A;  1SLQ A;  4YXD C;  1FZE A;  4DZO A;  3M0D C;  1VL2 A;  3L72 J;  2FYZ A;  3A7O A;  1KIL C;  2WSF J;  4DCK A;  1NTZ G;  2JR8 A;  2HLO A;  1Q90 D;  2BCC E;  2OQQ A;  2O01 N;  1SQQ J;  1XTC C;  3C8V A;  1NTZ D;  3SWK A;  4H0L C;  1OVR A;  3EWK A;  1EQ7 A;  3I55 P;  1KQS O;  5CCH C;  2RKL A;  4H13 D;  3L72 G;  1YIT P;  1NTK J;  2NRG A;  3V2R A;  2J5U A;  3TDK A;  1MV8 A;  1SQQ G;  4ASV A;  4ZKU A;  1LTJ A;  2IFN A;  3AEF C;  5AVU B;  1M56 D;  1SQQ D;  2W27 A;  2YKP A;  4D6T J;  1JY3 P;  5CHX A;  2HPC A;  5APV A;  2NPS B;  2FXP A;  4C46 A;  3I5C A;  1HF9 A;  1L4A A;  1WRG A;  1NTK G;  2G8Y A;  1E79 H;  3RBZ A;  2P67 A;  5KKZ C;  1NTK D;  3P32 A;  1RHZ B;  1DD3 A;  4D6T G;  4PD4 I;  1MKM A;  2W83 C;  1KQL A;  4D6T D;  2WT7 B;  2AEJ A;  1P84 E;  4IOI H;  1RE3 C;  3CX5 E;  3VMA A;  2P2U A;  1S5L X;  5GTH E;  5CMZ A;  4I7Z C;  3TGU J;  3GHG B;  2E76 D;  1FAV A;  3A2A A;  3H1K J;  1M7L A;  2LKM A;  3U1A A;  5BU8 B;  3P7K A;  3HD7 C;  2N1T C;  2M3B A;  4KT0 J;  4L74 A;  1VQL P;  2RN0 A;  4LC1 A;  2JP3 A;  1X0T A;  5H2F E;  2JWD A;  3TGU G;  2VRS A;  3AE4 C;  3G4S P;  3CD6 P;  2KS1 A;  3TGU D;  4R4M A;  5K5G B;  3H1K G;  3IAO A;  3M9B A;  1GDT A;  1Y9B A;  3H1K D;  3L70 G;  4GKG A;  1L0N K;  2KSJ A;  1YJ9 P;  4HJG H;  1SQX J;  4W7Z A;  2R44 A;  2HR3 A;  4ASW A;  2K9Y A;  2XNX A;  1CI6 B;  3WUT A;  3AEG C;  4AQR D;  5EFW B;  2QG4 A;  1JNM A;  1EDL A;  1SQP K;  1LTJ C;  1OFC X;  2E42 A;  1SQX G;  3H1I E;  3P8C E;  1VF5 B;  4EIJ A;  1EXJ A;  3V4Q A;  1EXI A;  1OVV A;  4JPZ B;  1SQX D;  1URQ A;  2D2C C;  1T8Z A;  1BDC A;  2E75 D;  1FOS E;  3QWO C;  2NPS C;  2OYO A;  4N78 D;  3II6 A;  4GT1 A;  1BDD A;  1PP9 E;  1N8R Q;  1UII A;  3CC7 P;  1VQP P;  3F5H A;  4IFM A;  2YKQ A;  2YXR B;  1KQG B;  2IBZ D;  2MKV A;  3PH0 A;  3L35 A;  4PD4 H;  2ZT9 D;  3CC4 P;  1NU1 E;  1MUU A;  2FKW B;  3MHV A;  4OWF A;  2R5D A;  2O01 J;  4W80 A;  2KIK A;  3QH9 A;  1KQF B;  5CCG D;  2JKV A;  1QVG O;  2JEE A;  3B8E B;  2C9L Y;  2PP6 A;  2E5T A;  2JJL A;  2WVR A;  1M8O B;  4GIF A;  4L73 A;  1EDJ A;  1MFT A;  1NTM D;  2RMZ A;  5TJH A;  4JYC A;  1HWT C;  3CWB E;  3USS A;  1PL5 A;  2FBW C;  2E5Y A;  1BGY E;  2H43 A;  3M91 A;  2WSC J;  5DJT B;  2QRX A;  3B5N B;  1JMM A;  3JCU H;  2WSS H;  1ZRT D;  1FZC B;  2XU6 A;  3RK3 B;  1VQ7 P;  3U59 A;  1ZW0 A;  3S4R A;  3CXH H;  1P84 I;  1W2E A;  1LTB C;  5AW3 B;  1ZXG A;  3CX5 I;  2W6B A;  5GTI H;  2XV5 A;  1G2C A;  3B4S A;  2A45 H;  1GTW A;  1H89 A;  3W67 A;  1NH4 A;  1SQB E;  1URQ C;  2P1J A;  2WPQ A;  1VF5 C;  4CPG A;  2QIW A;  3AE3 C;  1IJD B;  2KP8 A;  1EZV E;  3RK3 D;  1NKN A;  3L74 E;  2P10 A;  3IFM A;  4Z1M H;  2J58 A;  2R32 A;  3L37 A;  2KYV A;  2KNC A;  5APQ A;  1PPJ E;  1LTT C;  3OAK A;  4JF7 A;  1RF1 B;  2M0B A;  4XA4 A;  3W68 A;  3MZW B;  1MFZ A;  1YYC A;  2LXC B;  4XFJ A;  5KAI H;  1IK9 A;  3RBX A;  2OTK E;  1WMK A;  2KK7 A;  2KI7 B;  2ITA A;  2FYU D;  4BRY A;  2M5A B;  1AQT A;  4RJT A;  3HUS A;  2W6A A;  3GMA A;  1JMB A;  5APW A;  2K9J B;  1USE A;  3PRJ A;  4XE5 B;  4RKU J;  1SQV E;  3SSU A;  2Y9Z A;  2MJZ A;  1HJ0 A;  3CME P;  1BE3 J;  1KIL D;  5KTB A;  1GW4 A;  3JCU E;  2B89 A;  1NTZ E;  2Y9Y A;  1DIP A;  5KKZ B;  1A02 J;  1Q7Y Q;  2GUS A;  3B5N C;  3KHU A;  5CBO A;  4KHX A;  1QLE D;  1W5C E;  2KLV A;  1FOS F;  5CCH D;  4W7Y A;  3PP5 A;  1FZC C;  1BE3 G;  1JTH A;  3L72 E;  1Q2N A;  1T3U A;  5KAF H;  1NKZ B;  1M1J B;  1BE3 D;  1L2P A;  3L71 D;  1PGP A;  5GTI E;  1J1E C;  3C1L A;  1GU5 A;  5DJU B;  4PV1 C;  1H0T B;  1KFM A;  1P84 H;  2H7H A;  1Z56 A;  3WUU A;  3M9Q A;  3VTP C;  4I7Z B;  1AFO A;  3CX5 H;  1GL2 C;  4JQ0 D;  5AVR B;  3VP8 A;  1LWU A;  1NTK E;  4GOD A;  2V7Q J;  5GTH H;  3HE4 B;  4OH8 B;  1L0N E;  1YIJ P;  2QM7 A;  4JBZ A;  1GU4 A;  4D6T E;  1S9K D;  1N7S C;  2HOD B;  3VOP A;  2FFD B;  1BCC D;  3CCM P;  1JO5 A;  2WTY A;  3CCE P;  1JOC A;  5BVZ A;  3RGU A;  3CCS P;  3RK2 B;  5KAI E;  5H2F H;  2HFE D;  1SQB K;  4RES B;  5AW5 B;  3Q1M A;  2PFX A;  2KSE A;  3SFE C;  1QVF O;  2JO1 A;  2ZFC A;  4NPE A;  4BWN A;  5M1B A;  3H1J J;  4WB4 A;  3CCL P;  3HD7 D;  2N1T D;  3F89 A;  1VQ4 P;  3D71 A;  2KXP B;  1IFJ A;  1LTJ B;  3TGU E;  3R4Y A;  3HRN A;  3KPE A;  1OIP A;  1L0L D;  2HPC B;  3L75 D;  5AW4 B;  3OW2 O;  3H1K E;  3H1J G;  2D2C B;  1DD4 A;  3LW5 J;  3CXH D;  3H1J D;  1L4A B;  3BAS A;  3L70 E;  4H44 C;  2L5G B;  2Q6Q A;  1EZV I;  4O9B A;  2YKO A;  2WPS A;  1SFC A;  1GK4 A;  1KB9 I;  3AE7 C;  1ZV8 A;  1X8Y A;  5KJ7 A;  5AVS B;  5KAF E;  1LTI C;  1SQV K;  2IYO A;  2ZVN B;  3PLN A;  2SPZ A;  2YNY A;  3S9O A;  1D7M A;  1VQN P;  1KOR A;  4N3Y B;  2HG5 D;  3NFQ A;  4GDO A;  1Y47 A;  1M1J C;  1M57 D;  4WY4 A;  3WMM 0;  2Z4E A;  1SQX E;  2YIU C;  4IL6 E;  1JY2 N;  1NTZ K;  1S5L H;  2D2C D;  1H8A A;  2BCC J;  2NPS D;  4N78 E;  1VQ8 P;  1LWU C;  2WSE J;  2KLU A;  3LID A;  4EI2 A;  1X79 B;  3OA7 A;  3L36 A;  1QEX A;  1DX7 A;  2BEQ D;  2ZYA A;  1NJI Q;  1VDF A;  5AVZ B;  1FZF A;  3D70 A;  2N9B A;  3M9H A;  1SQQ K;  1T3J A;  3AE2 C;  5APU A;  1SVF A;  2GUV A;  1IO4 A;  2KS1 B;  1QX8 A;  4C7N A;  2FFD C;  1LNQ A;  2BCC D;  5AW8 B;  2R5B A;  3RK2 C;  1RF0 A;  3CCJ P;  2KOG A;  1YQ4 C;  3B71 A;  1WT6 A;  5E79 E;  3A0B E;  2FYN B;  3IN6 A;  1NTK K;  4R4L A;  3SFD C;  5TIS E;  3WU2 H;  1OVU A;  1PGO A;  3VMZ A;  2QEX P;  2H89 C;  5CJ4 A;  1K04 A;  3MGN A;  3V2P A;  1S3J A;  2L91 A;  3R2P A;  2RH0 A;  4I2L C;  2QJP C;  2XND H;  3D6Z A;  3VN0 A;  3MIW A;  5C39 A;  3Q2Y A;  3H25 A;  1NAY A;  1URQ B;  1ZRT E;  1ZP0 C;  2M3E A;  1IFM A;  2IPP A;  3WUV A;  1NYH A;  1NO4 A;  1IFD A;  2WQY C;  3IR9 A;  1LTG C;  2OYH A;  4JYB A;  1L4A C;  1SFC C;  5APX A;  2NZ2 A;  3PHL A;  2ZYG A;  3O6Q A;  1KN7 A;  5KJ7 C;  5CBN A;  3AE1 C;  3A5T A;  1YJW P;  1TU3 F;  4LLH A;  2QVA A;  1ZN5 A;  2IBZ G;  1FDI A;  3TYY A;  1KB9 H;  2Y0C A;  2JDI H;  1U7M A;  4QMA A;  2QSI A;  3RL0 g;  3TF5 A;  1VQ5 P;  4WY4 C;  1JUN A;  1LJ2 A;  1S5L E;  4RO0 A;  2Q3E A;  1URQ D;  4YXW H;  1NTM J;  1JB0 J;  3AE5 C;  1VF5 D;  1JCC A;  4YPC A;  1NAF A;  1OZH A;  4IFD K;  3D6Y A;  2CK3 H;  2Q5U A;  3H1H J;  3AE8 C;  3V6I A;  1IFP A;  2QJY B;  1KD1 Q;  2DW3 A;  4TLF A;  3OJA B;  1NTM G;  3BAT A;  1VQK P;  4A7P A;  1GK6 A;  1G1J A;  3N4X A;  1DH3 A;  4WBA A;  1SQX K;  4NPF X;  3H1H G;  2YO3 A;  2W8Z A;  1RF0 C;  2C0W A;  3H1H D;  2O3J A;  3BCC J;  3WU2 E;  2XZR A;  2I1K A;  4M3L A;  2FYN C;  2YXQ B;  1SS1 A;  1KV4 A;  3HTK A;  2AEF A;  2KB7 P;  3TSI A;  1CW5 A;  3UIA A;  1LTA C;  1FU1 A;  1J1E B;  4U3F J;  3P8C D;  1OMI A;  4PV1 B;  3BCC G;  5AW0 B;  1LT9 A;  1G2C B;  2WSF H;  1K05 A;  3BRV B;  1X9V A;  1AV1 A;  3BCC D;  1N73 A;  1HTL C;  1GL2 B;  1PP9 D;  1VQO P;  4UB6 E;  3B5N D;  2AXC A;  2OYH C;  1PFI A;  1FZA A;  4U3F G;  5CJ0 A;  3ZDM A;  2IBZ I;  1NTM K;  4U3F D;  2YMK A;  2ZXE B;  1N7S B;  3MUD A;  5KLV J;  2E43 A;  1BE3 E;  1KYO E;  4L75 A;  2KNC B;  2Z5I A;  1KB9 E;  1KZU B;  1NVO A;  1NU1 D;  2FYU J;  5B66 E;  2XKM A;  4PJ0 H;  4PV1 D;  5AVV B;  3LIE A;  2OTJ P;  1W2B O;  1GL2 D;  4N6J A;  5KLV G;  1PV3 A;  3GF3 A;  2V4H A;  1JY3 N;  4BRY B;  2FYU G;  2C0X A;  2FY8 A;  5KLV D;  3HUS B;  1N7S D;  2QJY C;  1YQ3 C;  1G1I A;  3H1L J;  3U1C A;  1KIL A;  1KFN A;  3Q3D A;  3AE9 C;  1GW3 A;  5AW9 B;  5AW6 B;  2XDJ A;  1LTS C;  2HYN A;  3A0H E;  3L71 J;  4H44 B;  1N86 A;  2B87 A;  1S1C X;  1YI2 P;  4UB8 H;  3FX0 A;  1FJP A;  4LGD E;  3H1L G;  2N9Y B;  3H1L D;  4OVN F;  3L4F A;  3SWY A;  1OW8 A;  1JTH B;  4DT0 A;  3L74 J;  2Y0E A;  3H32 A;  1RQV A;  1R5S A;  3L71 G;  3AEA C;  1ZME C;  1JY3 O;  3Q5P A;  1LT9 C;  1HBW A;  1SQB D;  2GM4 A;  1SQQ E;  2YIU B;  3JSV C;  2OYI A;  1YJN P;  2IZ0 A;  1AVY A;  1R5L A;  1GMJ A;  1BCC J;  2J59 M;  4EDF A;  2FYU K;  4H44 D;  1BSH A;  2YMY A;  1LWU B;  2E74 C;  3L74 G;  4IL6 H;  5APT A;  3HE5 A;  3T97 A;  1HGV A;  2Q7C A;  3L74 D;  5AVQ B;  3PTZ A;  1PPJ G;  3V5B A;  2KZI A;  3S1K A;  3CCR P;  2UWJ E;  2WMM A;  1NHL A;  1PPJ D;  1QGK B;  1NOH A;  1RE3 A;  3GW6 A;  4PD4 D;  1FZG A;  2P58 A;  3MTU E;  1H0T A;  4PJ0 E;  5AW7 B;  1BCC G;  2C9N Y;  2A06 G;  1SP4 A;  1YHQ P;  5AVT B;  1S2E A;  3VP9 A;  2A06 D;  1IC2 A;  3HD7 A;  2N1T A;  3EFG A;  5E79 H;  1L0L J;  5AW1 B;  1VPC A;  3A0B H;  3FWL A;  3L75 J;  3ABV C;  3L73 J;  3RL0 C;  1KMI Z;  3TNU A;  1LP1 A;  4DOJ A;  5TIS H;  1UIX A;  2WPR A;  2I8D A;  3HUS C;  4K35 A;  1N2D C;  1GZL A;  2QJP B;  3NTN A;  2H8P D;  4YTP C;  4BXL A;  1OX3 A;  3G71 P;  1FJK A;  2AXT H;  1L0L G;  1ZR4 A;  3RK2 D;  2O01 H;  3IF4 A;  3L75 G;  3L73 G;  1Q82 Q;  2CPB A;  1YBK A;  3L73 D;  4UB8 E;  4IFF A;  1T6A A;  1HUC A;  2QA4 P;  2POH A;  1SFC B;  1LGH B;  5KLI C;  1ZLL A;  2BEZ F;  5AVW B;  3L72 D;  4NPD A;  1KYO I;  1L0N J;  2A45 G;  3GLM A;  1FS0 E;  1T2K C;  1VQM P;  3FGA D;  1FC2 C;  4HYT B;  4WY4 B;  1Q86 Q;  2WSC H;  4OGQ B;  2NPS A;  2OYI C;  2E76 B;  2KZJ A;  2W90 A;  1SQP J;  1J1D B;  2ZXX A;  1A02 F;  1L0N G;  4WWI A;  2IDB A;  3GG2 A;  4HB1 A;  1X22 A;  1L0N D;  1L4A D;  1SFC D;  3MP7 B;  2LR2 A;  2K37 A;  1VQ6 P;  1R8E A;  1JEK A;  5KJ7 D;  3FXE A;  4Y99 B;  3KZI H;  2WT7 A;  1SQP G;  1HJB A;  1HVV A;  3AE6 C;  1OWA A;  2IBZ E;  1NWQ A;  1L0L K;  1SQP D;  2Y0D A;  4WY4 D;  4C7N B;  3Q5R A;  1IFI A;  1FBM A;  3EFF K;  2BCC G;  4OGQ D;  2FXO A;  1MZ9 A;  1EDI A;  2H88 C;  3GHG A;  1BSN A;  2QJK B;  2W6J H;  1PIX A;  4B86 A;  1HH0 A;  1N7L A;  3L70 J;  3GF7 A;  2B88 A;  1FZB A;  3G3Z A;  5APS A;  2I1J A;  4H13 C;  3AED C;  2CPS A;  4TT3 H; 
#chains in the Genus database with same CATH homology
 1SQB G;  3H1L G;  1NTK G;  1L0L G;  1SQV G;  3CXH H;  3H1I G;  1SQQ G;  1PPJ G;  3L75 G;  3L73 G;  1SQX G;  1NTM G;  2FYU G;  1SQP G;  3H1K G;  1L0N G;  2IBZ G;  3BCC G;  1KYO H;  4U3F G;  3H1J G;  1KB9 H;  1P84 H;  4D6T G;  1EZV G;  3L70 G;  1BCC G;  3CWB G;  3L72 G;  3H1H G;  1BE3 G;  2A06 G;  3L74 G;  2BCC G;  3CX5 H;  1PP9 G;  1BGY G;  1NTZ G;  1NU1 G;  4PD4 H;  3TGU G;  3L71 G;  5KLV G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...