2K88A

Association of subunit d (vma6p) and e (vma4p) with g (vma10p) and the nmr solution structure of subunit g (g1-59) of the saccharomyces cerevisiae v1vo atpase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
60
structure length
60
Chain Sequence
MVSQKNGIATLLQAEKEAHEIVSKARKYRQDKLKQAKTDAAKEIDSYKIQKDKELKEFEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Vacuolar proton pump subunit G
publication title Assembly of subunit d (Vma6p) and G (Vma10p) and the NMR solution structure of subunit G (G(1-59)) of the Saccharomyces cerevisiae V(1)V(O) ATPase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 22
structure length 60
sequence length 60
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2008-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.620 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces F1F0 ATP synthase subunit B, membrane domain 2k88A00
2KK7A 2K88A 1L2PA 3V6IA 4DT0A 3K5BA
chains in the Genus database with same CATH superfamily
1OVUA 2GUVA 2QJYB 1VQ5P 2Y0DA 1X0TA 3HTKB 1IFIA 1HJ0A 3AEGC 1YJWP 3L75J 3S4RA 4KT0J 4WB4A 2G3AA 4YXWH 5AVVB 1T8ZA 3SFEC 4U3FE 5CCHD 4DCKA 1OWAA 1FZFA 3HE5A 1RF1A 2I1JA 2KLUA 5CCHC 1NVOA 1AFOA 1PPJG 5AW3B 2YIUB 4BRYA 3CX5I 2WSFH 4I7ZC 3USSA 2KXPB 1KYOD 2Y0EA 2N9BA 4U3FD 3EFFK 1KTMA 2KYVA 2YMKA 2H88C 3CCJP 2O1JA 3FX0A 2JP3A 2BCCE 3L36A 4HB1A 3Q5SA 4YXDC 2YKPA 1FZEA 1U57A 2P58A 3CCQP 3A0BH 2Q3EA 1IK7A 1R5LA 3CL3D 5KKZB 4IOIH 1JM0A 1HWTC 1L0LJ 3JC22 3AE2C 1D7MA 3G9RA 2IFMA 2KLVA 3AE8C 4W7YA 2XU6A 1NGMB 2B87A 1SQBJ 2ZFCA 1PIXA 3HD7B 1OW7A 1SQXE 3M9BA 1JMBA 4JQ0D 4PJ0H 4IL6X 1IC2A 3H25A 3MP7B 3L73G 3U1AA 1J1DB 3P8CE 1E5WA 2V7QH 1U7MA 1MFTA 2FXMA 4DZOA 5APQA 1MUUA 4D6TG 5E79H 2WPVB 1PZQA 3CXHI 1T3UA 3Q3DA 2M8RA 2BEZF 2KIKA 3P8CD 4GDOA 5APTA 5AVWB 1XTCC 2NPSD 1GTWA 2R44A 3G4SP 3NXSA 2K37A 1G2CA 2NPSC 3PP5A 1SVFA 1VQ4P 1PP9E 5CBNA 2AXTH 1OFCX 2ZT9C 3RK3D 2Y9ZA 2GM4A 3WUUA 3RK3C 1NTKE 3OAKA 1HTLC 3H1IE 4H44B 3RL0B 3Q5RA 3CCVP 3G71P 4JYCA 1PP9D 2WSEJ 1JOCA 1OVVA 1LJ2A 3SWYA 4O9BA 1TU3F 2V4HA 3B5NB 2K9YA 2WT7A 5TISH 3IN6A 1BCCE 3V2QA 3VP9A 4ASWA 3H1ID 1HUCA 3HRNA 4M3LA 2WTYA 5AVSB 2PGDA 3VTPC 3MGNA 4PD4I 3L71J 4GODA 4IL6E 2OTLP 1BCCD 3L70J 1NTME 2JEEA 4C7NA 3VN0A 2YO2A 1YJ9P 2Q7CA 2A45G 3OA7A 3H1LE 3AEFC 3BRVB 1VF5B 2JO1A 4UB8E 5GTIH 1LTJC 1L4AC 4C46A 4W7ZA 4HYTB 3TYYA 2HODB 5AVRB 2D2CB 3H1LD 1EXJA 3IAOA 3L73J 1Q81Q 5B66H 4XE5B 3RK2B 1OXZA 2OQQA 2HPCA 1N86A 3SFDC 3LW5J 5APXA 2HLOA 2E5TA 5TJHA 3KDPB 4D6TJ 1PGPA 1LTJA 1L4AA 1ZLLA 1X22A 1LWUC 4GIFA 4XFJA 2QSIA 5CBOA 2WQYC 1JY2P 2FYZA 1NWQA 3L75E 1JEKA 3L37A 1SQVK 2FFDB 3PHLA 1HF9A 3N4XA 4HKZH 4U7JA 1RQVA 1YHQP 3CX5E 3P8MC 5AW6B 3SWKA 1URQD 4H13D 3PTZA 1URQC 1KD1Q 1AQ5A 1LWUA 1T2KC 1AJYA 2N1TD 1LTIC 3I55P 3CX5D 1GW4A 1EZVD 2C0XA 3A0HE 1PFIA 3BVHA 1NYHA 2OYIC 1GMJA 1N7LA 3H32A 1EXIA 1GL2D 2IX7C 3E1IA 3FGAD 4HH2A 1BSHA 1SFCD 5AVQB 3AE1C 2QJKC 1YYCA 2L91A 1GU4A 1BSNA 3GHGB 1NU1G 3CWBJ 3QWOC 1M1JC 1IFDA 3B4SA 2O01N 1L0LE 2WWWA 4AQRD 2W83C 2NRGA 1A02J 1K05A 1NHLA 2E75B 5AW2B 1FZCB 1KQFB 2PP6A 1W5CE 2AEMA 2K9JB 2WMMA 2A45I 4WY4C 2OYIA 2WSSH 2KZIA 1VQ9P 3BATA 2J5UA 1SQBE 1UIIA 5AVYB 1L0LD 1KMIZ 2KNCB 1N73B 2QJPC 1M1JA 1FZBA 3KZIE 1FDIA 4RJTA 1KZUB 1S4XA 2IDBA 1SQQG 2M5AB 1SQBD 3CXHE 1N73A 1T6AA 4WY4A 4GOEA 1OIPA 1PGOA 1EDLA 2J59M 4YTPC 3CMAP 4BXLA 5CJ0A 3R4YA 4R4LA 3L74G 3TGUG 3CXHD 1LT9C 2IPPA 1G1IA 3QH9A 2YXRB 1CSBA 4Z1MH 1KQSO 1FE6A 1SLQA 4GOFA 2FYUK 4H0LD 4PV1C 1ZMEC 3I5CA 4GT1A 4H0LC 1PPJE 1N7SA 2IZ1A 1NU1K 1KILE 1OW6A 2E74D 5AVZB 4B86A 1A02F 1L0NJ 2E74B 3K5BA 1LT9A 4PD4E 5AW8B 1PPJD 3RBXA 5KLVK 4L73A 1GD2E 1RY3A 1QL1A 1KILD 1VQMP 3OW2O 3A2AA 3H1JD 1YTZT 3L71E 2H7HA 4L76A 4IL6H 1DH3A 2YKOA 4PD4D 3AE7C 4Y99B 4RESB 1NU1J 1DEBA 3L70E 4LC1A 4I6MC 2WSFJ 1OZHA 2LR2A 1VQ8P 2Q5UA 2QJYC 1YI2P 1SQQK 2B89A 3F5HA 3AE4C 3L71D 3HE5B 1RF1B 2NZ2A 5KAIE 3L70D 4EYYQ 4BRYB 3BCCJ 3W67A 1S9KE 2R3SA 2L5GB 1PV3A 2QEXP 4A7PA 2ZVOB 2XDJA 2R5DA 2QM7A 4WBAA 2YO3A 1JMMA 1SQQJ 1S9KD 3D70A 2C0WA 5KTBA 1H0TA 1SQPE 4I7ZB 1S72P 2W8ZA 1K73Q 3AE9C 5AW1B 2P67A 1Y8AA 3MIWA 2IBZG 3TGUJ 5CCHA 5AW0B 1S2EA 4OH8B 4QMAA 3KYQA 1QL2A 1KN7A 4N3YB 1YBKA 3IFMA 3M06A 1SQPD 2BCCD 2DW3A 1FS0E 1JO5A 5KKZC 3CC2P 1VQKP 1JCDA 2C9LY 3H1HG 3CX5H 2B87B 2V7QJ 2FBWC 2ZVNB 3AEBC 4NPFX 2G8YA 4JF7A 3HUSC 2JKVA 1AA0A 3ABVC 1BE3J 3AE6C 3HD7D 2WPSA 2PAJA 1BGYG 2O01J 1X8YA 1IK9A 4LLHA 5H2FE 1G1JA 3CCMP 3A0HH 3MUDC 5CCGD 1HVVA 1NOHA 1J1DC 3O6QA 2E76B 3TNUA 3S9OA 1ZXGA 3CC4P 1SQXD 2KZJA 2K88A 1G2CB 3HUSA 1GW3A 3CWBE 3C9IA 4EI2A 2FXPA 1H88A 3NFQA 4I1LA 2Q1KA 5GTHE 2JDIH 2KSJA 1UIXA 3MUDA 2OYHC 3D6YA 2WVRA 2BEQD 3CWBD 1HGZA 1J1EB 2KK7A 3VP8A 5AW9B 4H44D 3L35A 3RL0D 3JSVC 1OVRA 2WT7B 2XV5A 5KJ7D 3PLNA 4H44C 2M3EA 3KZIH 2KS1A 2K3RA 3C1LA 3L4FA 1J2JB 1NKZB 5KJ7C 2ZT9B 5B5EE 3GLMA 3B5ND 1LTSC 2W6AA 2LXBA 3CXHH 2OYHA 2PRRA 2NPSA 4OVNF 1VQNP 1NTKD 2QG4A 2OGUA 2E43A 2KI7B 2KP8A 1SQVG 1YIJP 4C7NB 2H89C 1JTHA 1HGVA 1AVYA 3H1HJ 3ZDMA 1DEEG 1MKMA 4YPCA 1QVGO 4ZNCA 1WMKA 3L72G 1JUNA 4ZKPA 1MZ9A 3PRJA 1GU5A 3CC7P 1VF5D 1NTMD 2I1KA 2JR8A 3M0AA 2WSEH 1RE4C 2RH0A 1L0NE 1BGYJ 2HPCB 1NTZE 3VMYA 2D2CD 4PD4H 4NPEA 3TK1A 1VQPP 1S3JA 1PGQA 1EDIA 2M0BA 2H43A 1LTJB 1L4AB 3RK2D 1PP9G 1M8OB 3HE4A 1L0ND 1RH5B 4I2LC 2FXOA 1NTZD 1ZOYC 1KV4A 3RL0g 2CPBA 1KYOI 1LNQA 1RE4A 1DIPA 4OGQB 1LP1A 3FXDA 2FYNC 5AVXB 2YMYA 1FJKA 1QEXA 1PGJA 3W68A 3KHUA 1M1KQ 1JB0J 1QLED 1FBMA 3P32A 4TLFA 3CCSP 2I8DA 3V5BA 2IYOA 1USDA 1BCCG 3H1KG 3CCRP 1LWUB 3BCCE 1KORA 2AEFA 2RN0A 4C7RA 1JY2N 1SQXK 2Q3IA 3L75D 3CLQA 4H13C 1YQ4C 3KXDA 1NH4A 1U7JA 3BCCD 4Y28J 4XA4A 2N1TC 4ASVA 1VPCA 3H32B 5K5GB 3H6PA 3Q1MA 4DT0A 3LW5H 2E42A 1SQVJ 1X79B 3H1LG 5APUA 2QM8A 2ZXXA 4RKUJ 1S1CX 1XTGB 2JWAA 1SP4A 3AEAC 2FYUG 3TGUE 1CI6A 1URQA 3AECC 1LTGC 1GL2C 5AW4B 3CPWO 1SFCC 4PJ0E 1YQ3C 2HYNA 2ZYGA 3V2PA 2OYIB 2N1TA 3L72J 1EQ7A 2A06E 3V4WA 3TGUD 2E75D 1GZLA 1M90Q 2QJKB 1NTKK 3AE3C 1RQUA 2E75C 5KLVG 5CMZA 1M1JB 2O1KA 1T3JA 5E79E 3G3ZA 3M91A 1FZGA 2ZYDA 1BE3E 1DD4A 1GL2A 1JY3O 1NO4A 2A06D 1M56D 1JY3N 1SFCA 1IFPA 4WY4B 1Q7YQ 5KLIC 3TF5A 1GDTA 1Q82Q 1BE3D 3GF3A 5CHXA 2LXCB 2QJPB 3V4QA 3SSUA 1P84I 1EZVG 4NPDA 1FC2C 1X9VA 5DJTB 4N78E 3WU2E 2A45H 2OTKE 1L2PA 2WSCH 3H1KJ 1N7SB 1H8AA 2ZJSE 3P7KA 3AEDC 1KB9I 2E5YA 3WMM0 2R5BA 2YNYA 1QVFO 1FU1A 2VRSA 1FOSF 1LT9B 5DJUB 1RHZB 3JCUE 3B8EB 1VQ7P 5APVA 4KJMA 4PV1B 2W27A 2WPQA 2E74C 3IF4A 1L0LG 1SS1A 4W80A 3H1LJ 2ZYAA 2W6BA 1EDJA 1IFNA 1S5LE 1M57D 2M3BA 2FYUJ 2P2UA 2R3CA 4IFMA 1GK4A 1KILC 1NAFA 1ZP0C 4KHXA 3T97A 4Y99C 5CJ4A 1K9MQ 3E1RA 3H1HE 2ZAEB 2KB7P 1LGHB 1Q2NA 1WRGA 4AYCA 5KLVJ 3UIAA 1RF1C 3VOPA 3EWKA 4BWNA 2C9NY 4UB8H 1KILA 2QRXA 3H1HD 5BU5A 1R8EA 1BGYE 1EC5A 1KFNA 1H0TB 3NTNA 3L73E 4EOTA 2YIUC 1KYOE 4K3AA 4UB6E 1VQOP 3CD6P 1AV1A 3HTKA 1BGYD 1MV8A 3BRTB 2B9BA 4IFFA 4R4MA 4D6TE 4EDFA 1R5SA 2HR3A 3L73D 3I56P 4WWIA 1NAYA 3L74J 2OTJP 1EZVI 3H1JG 3CMEP 1LT1A 2WPRA 1L0LK 1IJDB 4D6TD 3V2RA 2RKLA 3PH0A 3SWFA 1JCCA 3VMZA 1SQBK 3O8ZA 3L71G 2QVAA 3FXEA 4HJGH 1BDDA 1YITP 3TDKA 3L70G 3AEEC 1AQTA 2YKQA 1OX3A 3O6QB 3TNUB 2WITA 3HD7C 1SQVE 2UWJE 3HUSB 2AXCA 5AVTB 2E76D 1QX8A 1ZRTE 4U3FG 5CCGC 3CCUP 1K04A 1N8RQ 1E79H 2E76C 3V6IA 1IFMA 5AW5B 2MJZA 1SQVD 1FOSE 5AW7B 3IR9A 5L8RJ 3L72E 1ZR4A 1HJBA 3V2NA 1LTAC 2XNDH 5EFWB 5BVZA 1BDCA 1ZRTD 1DD3A 3HD7A 3EFGA 2K1AA 4RO0A 1ZV8A 3S1KA 2IFNA 2GA1A 2H8PD 2KS1B 3TSIA 1SQPG 2BCCG 1OW8A 3RK3E 5CCGA 2CPSA 3L72D 2RMZA 4DOJA 1J1EC 3GF7A 2O01H 2OYHB 1Y47A 2QIWA 1IO4A 2NPSB 4CPGA 2Z4EA 3RL0C 2ZT9D 1Y9BA 2J58A 1P84E 4N6JA 1WT6A 2MKVA 3B71A 3RK3B 2LKMA 3NMDA 2N9YB 3AE5C 5KAFE 3B5NC 2FY8A 3GW6A 3WUVA 1JTHB 2Z5HA 3WU2H 3A5TA 2XZRA 3H1JJ 2HFED 1P84D 3KPEA 3GMAA 2QA4P 1KB9E 3H1KE 5KJ7A 2IBZI 1SQXG 3M9HA 3PJSK 5APSA 5APYA 3MD0A 4L74A 1LTBC 3B5NA 1KB9D 1IZNB 4ZKUA 3JCUH 3A3YB 3GG2A 1N2DC 3H1KD 4ZMDA 3FWNA 2XNXA 1FZAA 2XKMA 3CWBG 1KQLA 1VF5C 2W6JH 3MHVA 3A7OA 3HE4B 2Z5IA 4GKGA 1NKNA 1AVOA 2D2CC 1RE3C 1L4AD 2KUBA 1LP1B 1S5LH 1SQPK 2FYUE 4U3FJ 3RK2C 2R32A 4WVZA 3LIEA 3KQGA 2OYOA 1Z56A 1FDOA 4K35A 1NTKG 1NU1E 4OGQD 3H1IG 1ZN5A 2SPZA 2P10A 3II6A 2B88A 4OGQC 2P7JA 2FYUD 1M7LA 2HODA 1ZW0A 3LIDA 1KFMA 1RE3A 5KAIH 5KLVE 1RF0C 2HG5D 1NU1D 1EDKA 1SQPJ 1VL2A 1W2EA 2BCCJ 2FYNB 3Q5PA 2FFDC 1JY2O 3F89A 3R2PA 3A0BE 3WUTA 3CCEP 2O3JA 2ZXEB 5KLVD 1JNMA 3D6ZA 2ITAA 2Q9IA 1NTMG 1KYOH 4UB6H 1CZQA 1SQQE 5AVUB 1RF0A 2Y9YA 1Q86Q 1CI6B 3C8VA 1EZVE 1URQB 1T2KD 3CI9A 4H13B 2FFDA 4LGDE 3U1CA 2N1TB 3L74E 1SQQD 2P1JA 1L0NG 1ZR2A 2IZ0A 1NTZG 2QE7H 1SQXJ 3ITKA 3GHGC 2GUSA 3MZWB 4JYBA 5APWA 1OMIA 3L74D 1MFZA 4MN4C 1QGKB 1KQGB 3OJAB 1GL2B 2KOGA 3FWLA 2WZ7A 3M0DC 1SFCB 5C39A 4TT3H 1FZCC 3RGUA 4AUWA 5M1BA 5BU8B 1W2BO 1S5LX 3EQ2A 4WY4D 1JY3P 3N7NA 5H2FH 2WSCJ 3GHGA 1N73C 1PP9J 3L75G 2AXTE 4OWFA 1YJNP 2Y0CA 3BCCG 2BASA 2POHA 3M0DA 1NTKJ 1FZCA 3H1IJ 5KLIB 2K9JA 2FKWB 2YXQB 1NTMK 3M9QA 5GTHH 1VQLP 4JBZA 1Q90D 2KNCA 5TISE 1BCCJ 1KC8Q 1N7SD 1NJIQ 3VYIA 1N7SC 2W90A 3E7KA 2IYPA 4N78D 4DJGA 4IFDK 1GK6A 3VMXA 3MTUE 3BASA 4L75A 1YTZI 2M5AA 1L0NK 3G6EP 1HBWA 1NTZK 4JPZB 3RBZA 1VQ6P 1NTMJ 1DX7A 1CW5A 1HH0A 4PV1D 1P84H 5B5EH 1LTTC 3Q2YA 1FDMA 1H89A 2KSEA 2OARA 1PL5A 4H0LB 5KAFH 2A06G 1K8AQ 3T97B 2CK3H 2JWDA 3H1JE 5GTIE 2IBZE 4EIJA 1FAVA 2AEJA 1NTZJ 2PFXA 1KB9H 3VMAA 1SQBG 1BE3G 3CCLP 5B66E 3U59A 1KILB 2IBZD 1USEA 2Q6QA 3D71A 1IFJA 1FJPA 1VDFA 2JJLA
chains in the Genus database with same CATH topology
2KK7A 2K88A 1L2PA 3V6IA 4DT0A 3K5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KK7 A;  2K88 A;  1L2P A;  3V6I A;  4DT0 A;  3K5B A; 
#chains in the Genus database with same CATH topology
 1OVU A;  2GUV A;  2QJY B;  1VQ5 P;  2Y0D A;  1X0T A;  3HTK B;  1IFI A;  1HJ0 A;  3AEG C;  1YJW P;  3L75 J;  3S4R A;  4KT0 J;  4WB4 A;  2G3A A;  4YXW H;  5AVV B;  1T8Z A;  3SFE C;  4U3F E;  5CCH D;  4DCK A;  1OWA A;  1FZF A;  3HE5 A;  1RF1 A;  2I1J A;  2KLU A;  5CCH C;  1NVO A;  1AFO A;  1PPJ G;  5AW3 B;  2YIU B;  4BRY A;  3CX5 I;  2WSF H;  4I7Z C;  3USS A;  2KXP B;  1KYO D;  2Y0E A;  2N9B A;  4U3F D;  3EFF K;  1KTM A;  2KYV A;  2YMK A;  2H88 C;  3CCJ P;  2O1J A;  3FX0 A;  2JP3 A;  2BCC E;  3L36 A;  4HB1 A;  3Q5S A;  4YXD C;  2YKP A;  1FZE A;  1U57 A;  2P58 A;  3CCQ P;  3A0B H;  2Q3E A;  1IK7 A;  1R5L A;  3CL3 D;  5KKZ B;  4IOI H;  1JM0 A;  1HWT C;  1L0L J;  3JC2 2;  3AE2 C;  1D7M A;  3G9R A;  2IFM A;  2KLV A;  3AE8 C;  4W7Y A;  2XU6 A;  1NGM B;  2B87 A;  1SQB J;  2ZFC A;  1PIX A;  3HD7 B;  1OW7 A;  1SQX E;  3M9B A;  1JMB A;  4JQ0 D;  4PJ0 H;  4IL6 X;  1IC2 A;  3H25 A;  3MP7 B;  3L73 G;  3U1A A;  1J1D B;  3P8C E;  1E5W A;  2V7Q H;  1U7M A;  1MFT A;  2FXM A;  4DZO A;  5APQ A;  1MUU A;  4D6T G;  5E79 H;  2WPV B;  1PZQ A;  3CXH I;  1T3U A;  3Q3D A;  2M8R A;  2BEZ F;  2KIK A;  3P8C D;  4GDO A;  5APT A;  5AVW B;  1XTC C;  2NPS D;  1GTW A;  2R44 A;  3G4S P;  3NXS A;  2K37 A;  1G2C A;  2NPS C;  3PP5 A;  1SVF A;  1VQ4 P;  1PP9 E;  5CBN A;  2AXT H;  1OFC X;  2ZT9 C;  3RK3 D;  2Y9Z A;  2GM4 A;  3WUU A;  3RK3 C;  1NTK E;  3OAK A;  1HTL C;  3H1I E;  4H44 B;  3RL0 B;  3Q5R A;  3CCV P;  3G71 P;  4JYC A;  1PP9 D;  2WSE J;  1JOC A;  1OVV A;  1LJ2 A;  3SWY A;  4O9B A;  1TU3 F;  2V4H A;  3B5N B;  2K9Y A;  2WT7 A;  5TIS H;  3IN6 A;  1BCC E;  3V2Q A;  3VP9 A;  4ASW A;  3H1I D;  1HUC A;  3HRN A;  4M3L A;  2WTY A;  5AVS B;  2PGD A;  3VTP C;  3MGN A;  4PD4 I;  3L71 J;  4GOD A;  4IL6 E;  2OTL P;  1BCC D;  3L70 J;  1NTM E;  2JEE A;  4C7N A;  3VN0 A;  2YO2 A;  1YJ9 P;  2Q7C A;  2A45 G;  3OA7 A;  3H1L E;  3AEF C;  3BRV B;  1VF5 B;  2JO1 A;  4UB8 E;  5GTI H;  1LTJ C;  1L4A C;  4C46 A;  4W7Z A;  4HYT B;  3TYY A;  2HOD B;  5AVR B;  2D2C B;  3H1L D;  1EXJ A;  3IAO A;  3L73 J;  1Q81 Q;  5B66 H;  4XE5 B;  3RK2 B;  1OXZ A;  2OQQ A;  2HPC A;  1N86 A;  3SFD C;  3LW5 J;  5APX A;  2HLO A;  2E5T A;  5TJH A;  3KDP B;  4D6T J;  1PGP A;  1LTJ A;  1L4A A;  1ZLL A;  1X22 A;  1LWU C;  4GIF A;  4XFJ A;  2QSI A;  5CBO A;  2WQY C;  1JY2 P;  2FYZ A;  1NWQ A;  3L75 E;  1JEK A;  3L37 A;  1SQV K;  2FFD B;  3PHL A;  1HF9 A;  3N4X A;  4HKZ H;  4U7J A;  1RQV A;  1YHQ P;  3CX5 E;  3P8M C;  5AW6 B;  3SWK A;  1URQ D;  4H13 D;  3PTZ A;  1URQ C;  1KD1 Q;  1AQ5 A;  1LWU A;  1T2K C;  1AJY A;  2N1T D;  1LTI C;  3I55 P;  3CX5 D;  1GW4 A;  1EZV D;  2C0X A;  3A0H E;  1PFI A;  3BVH A;  1NYH A;  2OYI C;  1GMJ A;  1N7L A;  3H32 A;  1EXI A;  1GL2 D;  2IX7 C;  3E1I A;  3FGA D;  4HH2 A;  1BSH A;  1SFC D;  5AVQ B;  3AE1 C;  2QJK C;  1YYC A;  2L91 A;  1GU4 A;  1BSN A;  3GHG B;  1NU1 G;  3CWB J;  3QWO C;  1M1J C;  1IFD A;  3B4S A;  2O01 N;  1L0L E;  2WWW A;  4AQR D;  2W83 C;  2NRG A;  1A02 J;  1K05 A;  1NHL A;  2E75 B;  5AW2 B;  1FZC B;  1KQF B;  2PP6 A;  1W5C E;  2AEM A;  2K9J B;  2WMM A;  2A45 I;  4WY4 C;  2OYI A;  2WSS H;  2KZI A;  1VQ9 P;  3BAT A;  2J5U A;  1SQB E;  1UII A;  5AVY B;  1L0L D;  1KMI Z;  2KNC B;  1N73 B;  2QJP C;  1M1J A;  1FZB A;  3KZI E;  1FDI A;  4RJT A;  1KZU B;  1S4X A;  2IDB A;  1SQQ G;  2M5A B;  1SQB D;  3CXH E;  1N73 A;  1T6A A;  4WY4 A;  4GOE A;  1OIP A;  1PGO A;  1EDL A;  2J59 M;  4YTP C;  3CMA P;  4BXL A;  5CJ0 A;  3R4Y A;  4R4L A;  3L74 G;  3TGU G;  3CXH D;  1LT9 C;  2IPP A;  1G1I A;  3QH9 A;  2YXR B;  1CSB A;  4Z1M H;  1KQS O;  1FE6 A;  1SLQ A;  4GOF A;  2FYU K;  4H0L D;  4PV1 C;  1ZME C;  3I5C A;  4GT1 A;  4H0L C;  1PPJ E;  1N7S A;  2IZ1 A;  1NU1 K;  1KIL E;  1OW6 A;  2E74 D;  5AVZ B;  4B86 A;  1A02 F;  1L0N J;  2E74 B;  3K5B A;  1LT9 A;  4PD4 E;  5AW8 B;  1PPJ D;  3RBX A;  5KLV K;  4L73 A;  1GD2 E;  1RY3 A;  1QL1 A;  1KIL D;  1VQM P;  3OW2 O;  3A2A A;  3H1J D;  1YTZ T;  3L71 E;  2H7H A;  4L76 A;  4IL6 H;  1DH3 A;  2YKO A;  4PD4 D;  3AE7 C;  4Y99 B;  4RES B;  1NU1 J;  1DEB A;  3L70 E;  4LC1 A;  4I6M C;  2WSF J;  1OZH A;  2LR2 A;  1VQ8 P;  2Q5U A;  2QJY C;  1YI2 P;  1SQQ K;  2B89 A;  3F5H A;  3AE4 C;  3L71 D;  3HE5 B;  1RF1 B;  2NZ2 A;  5KAI E;  3L70 D;  4EYY Q;  4BRY B;  3BCC J;  3W67 A;  1S9K E;  2R3S A;  2L5G B;  1PV3 A;  2QEX P;  4A7P A;  2ZVO B;  2XDJ A;  2R5D A;  2QM7 A;  4WBA A;  2YO3 A;  1JMM A;  1SQQ J;  1S9K D;  3D70 A;  2C0W A;  5KTB A;  1H0T A;  1SQP E;  4I7Z B;  1S72 P;  2W8Z A;  1K73 Q;  3AE9 C;  5AW1 B;  2P67 A;  1Y8A A;  3MIW A;  2IBZ G;  3TGU J;  5CCH A;  5AW0 B;  1S2E A;  4OH8 B;  4QMA A;  3KYQ A;  1QL2 A;  1KN7 A;  4N3Y B;  1YBK A;  3IFM A;  3M06 A;  1SQP D;  2BCC D;  2DW3 A;  1FS0 E;  1JO5 A;  5KKZ C;  3CC2 P;  1VQK P;  1JCD A;  2C9L Y;  3H1H G;  3CX5 H;  2B87 B;  2V7Q J;  2FBW C;  2ZVN B;  3AEB C;  4NPF X;  2G8Y A;  4JF7 A;  3HUS C;  2JKV A;  1AA0 A;  3ABV C;  1BE3 J;  3AE6 C;  3HD7 D;  2WPS A;  2PAJ A;  1BGY G;  2O01 J;  1X8Y A;  1IK9 A;  4LLH A;  5H2F E;  1G1J A;  3CCM P;  3A0H H;  3MUD C;  5CCG D;  1HVV A;  1NOH A;  1J1D C;  3O6Q A;  2E76 B;  3TNU A;  3S9O A;  1ZXG A;  3CC4 P;  1SQX D;  2KZJ A;  2K88 A;  1G2C B;  3HUS A;  1GW3 A;  3CWB E;  3C9I A;  4EI2 A;  2FXP A;  1H88 A;  3NFQ A;  4I1L A;  2Q1K A;  5GTH E;  2JDI H;  2KSJ A;  1UIX A;  3MUD A;  2OYH C;  3D6Y A;  2WVR A;  2BEQ D;  3CWB D;  1HGZ A;  1J1E B;  2KK7 A;  3VP8 A;  5AW9 B;  4H44 D;  3L35 A;  3RL0 D;  3JSV C;  1OVR A;  2WT7 B;  2XV5 A;  5KJ7 D;  3PLN A;  4H44 C;  2M3E A;  3KZI H;  2KS1 A;  2K3R A;  3C1L A;  3L4F A;  1J2J B;  1NKZ B;  5KJ7 C;  2ZT9 B;  5B5E E;  3GLM A;  3B5N D;  1LTS C;  2W6A A;  2LXB A;  3CXH H;  2OYH A;  2PRR A;  2NPS A;  4OVN F;  1VQN P;  1NTK D;  2QG4 A;  2OGU A;  2E43 A;  2KI7 B;  2KP8 A;  1SQV G;  1YIJ P;  4C7N B;  2H89 C;  1JTH A;  1HGV A;  1AVY A;  3H1H J;  3ZDM A;  1DEE G;  1MKM A;  4YPC A;  1QVG O;  4ZNC A;  1WMK A;  3L72 G;  1JUN A;  4ZKP A;  1MZ9 A;  3PRJ A;  1GU5 A;  3CC7 P;  1VF5 D;  1NTM D;  2I1K A;  2JR8 A;  3M0A A;  2WSE H;  1RE4 C;  2RH0 A;  1L0N E;  1BGY J;  2HPC B;  1NTZ E;  3VMY A;  2D2C D;  4PD4 H;  4NPE A;  3TK1 A;  1VQP P;  1S3J A;  1PGQ A;  1EDI A;  2M0B A;  2H43 A;  1LTJ B;  1L4A B;  3RK2 D;  1PP9 G;  1M8O B;  3HE4 A;  1L0N D;  1RH5 B;  4I2L C;  2FXO A;  1NTZ D;  1ZOY C;  1KV4 A;  3RL0 g;  2CPB A;  1KYO I;  1LNQ A;  1RE4 A;  1DIP A;  4OGQ B;  1LP1 A;  3FXD A;  2FYN C;  5AVX B;  2YMY A;  1FJK A;  1QEX A;  1PGJ A;  3W68 A;  3KHU A;  1M1K Q;  1JB0 J;  1QLE D;  1FBM A;  3P32 A;  4TLF A;  3CCS P;  2I8D A;  3V5B A;  2IYO A;  1USD A;  1BCC G;  3H1K G;  3CCR P;  1LWU B;  3BCC E;  1KOR A;  2AEF A;  2RN0 A;  4C7R A;  1JY2 N;  1SQX K;  2Q3I A;  3L75 D;  3CLQ A;  4H13 C;  1YQ4 C;  3KXD A;  1NH4 A;  1U7J A;  3BCC D;  4Y28 J;  4XA4 A;  2N1T C;  4ASV A;  1VPC A;  3H32 B;  5K5G B;  3H6P A;  3Q1M A;  4DT0 A;  3LW5 H;  2E42 A;  1SQV J;  1X79 B;  3H1L G;  5APU A;  2QM8 A;  2ZXX A;  4RKU J;  1S1C X;  1XTG B;  2JWA A;  1SP4 A;  3AEA C;  2FYU G;  3TGU E;  1CI6 A;  1URQ A;  3AEC C;  1LTG C;  1GL2 C;  5AW4 B;  3CPW O;  1SFC C;  4PJ0 E;  1YQ3 C;  2HYN A;  2ZYG A;  3V2P A;  2OYI B;  2N1T A;  3L72 J;  1EQ7 A;  2A06 E;  3V4W A;  3TGU D;  2E75 D;  1GZL A;  1M90 Q;  2QJK B;  1NTK K;  3AE3 C;  1RQU A;  2E75 C;  5KLV G;  5CMZ A;  1M1J B;  2O1K A;  1T3J A;  5E79 E;  3G3Z A;  3M91 A;  1FZG A;  2ZYD A;  1BE3 E;  1DD4 A;  1GL2 A;  1JY3 O;  1NO4 A;  2A06 D;  1M56 D;  1JY3 N;  1SFC A;  1IFP A;  4WY4 B;  1Q7Y Q;  5KLI C;  3TF5 A;  1GDT A;  1Q82 Q;  1BE3 D;  3GF3 A;  5CHX A;  2LXC B;  2QJP B;  3V4Q A;  3SSU A;  1P84 I;  1EZV G;  4NPD A;  1FC2 C;  1X9V A;  5DJT B;  4N78 E;  3WU2 E;  2A45 H;  2OTK E;  1L2P A;  2WSC H;  3H1K J;  1N7S B;  1H8A A;  2ZJS E;  3P7K A;  3AED C;  1KB9 I;  2E5Y A;  3WMM 0;  2R5B A;  2YNY A;  1QVF O;  1FU1 A;  2VRS A;  1FOS F;  1LT9 B;  5DJU B;  1RHZ B;  3JCU E;  3B8E B;  1VQ7 P;  5APV A;  4KJM A;  4PV1 B;  2W27 A;  2WPQ A;  2E74 C;  3IF4 A;  1L0L G;  1SS1 A;  4W80 A;  3H1L J;  2ZYA A;  2W6B A;  1EDJ A;  1IFN A;  1S5L E;  1M57 D;  2M3B A;  2FYU J;  2P2U A;  2R3C A;  4IFM A;  1GK4 A;  1KIL C;  1NAF A;  1ZP0 C;  4KHX A;  3T97 A;  4Y99 C;  5CJ4 A;  1K9M Q;  3E1R A;  3H1H E;  2ZAE B;  2KB7 P;  1LGH B;  1Q2N A;  1WRG A;  4AYC A;  5KLV J;  3UIA A;  1RF1 C;  3VOP A;  3EWK A;  4BWN A;  2C9N Y;  4UB8 H;  1KIL A;  2QRX A;  3H1H D;  5BU5 A;  1R8E A;  1BGY E;  1EC5 A;  1KFN A;  1H0T B;  3NTN A;  3L73 E;  4EOT A;  2YIU C;  1KYO E;  4K3A A;  4UB6 E;  1VQO P;  3CD6 P;  1AV1 A;  3HTK A;  1BGY D;  1MV8 A;  3BRT B;  2B9B A;  4IFF A;  4R4M A;  4D6T E;  4EDF A;  1R5S A;  2HR3 A;  3L73 D;  3I56 P;  4WWI A;  1NAY A;  3L74 J;  2OTJ P;  1EZV I;  3H1J G;  3CME P;  1LT1 A;  2WPR A;  1L0L K;  1IJD B;  4D6T D;  3V2R A;  2RKL A;  3PH0 A;  3SWF A;  1JCC A;  3VMZ A;  1SQB K;  3O8Z A;  3L71 G;  2QVA A;  3FXE A;  4HJG H;  1BDD A;  1YIT P;  3TDK A;  3L70 G;  3AEE C;  1AQT A;  2YKQ A;  1OX3 A;  3O6Q B;  3TNU B;  2WIT A;  3HD7 C;  1SQV E;  2UWJ E;  3HUS B;  2AXC A;  5AVT B;  2E76 D;  1QX8 A;  1ZRT E;  4U3F G;  5CCG C;  3CCU P;  1K04 A;  1N8R Q;  1E79 H;  2E76 C;  3V6I A;  1IFM A;  5AW5 B;  2MJZ A;  1SQV D;  1FOS E;  5AW7 B;  3IR9 A;  5L8R J;  3L72 E;  1ZR4 A;  1HJB A;  3V2N A;  1LTA C;  2XND H;  5EFW B;  5BVZ A;  1BDC A;  1ZRT D;  1DD3 A;  3HD7 A;  3EFG A;  2K1A A;  4RO0 A;  1ZV8 A;  3S1K A;  2IFN A;  2GA1 A;  2H8P D;  2KS1 B;  3TSI A;  1SQP G;  2BCC G;  1OW8 A;  3RK3 E;  5CCG A;  2CPS A;  3L72 D;  2RMZ A;  4DOJ A;  1J1E C;  3GF7 A;  2O01 H;  2OYH B;  1Y47 A;  2QIW A;  1IO4 A;  2NPS B;  4CPG A;  2Z4E A;  3RL0 C;  2ZT9 D;  1Y9B A;  2J58 A;  1P84 E;  4N6J A;  1WT6 A;  2MKV A;  3B71 A;  3RK3 B;  2LKM A;  3NMD A;  2N9Y B;  3AE5 C;  5KAF E;  3B5N C;  2FY8 A;  3GW6 A;  3WUV A;  1JTH B;  2Z5H A;  3WU2 H;  3A5T A;  2XZR A;  3H1J J;  2HFE D;  1P84 D;  3KPE A;  3GMA A;  2QA4 P;  1KB9 E;  3H1K E;  5KJ7 A;  2IBZ I;  1SQX G;  3M9H A;  3PJS K;  5APS A;  5APY A;  3MD0 A;  4L74 A;  1LTB C;  3B5N A;  1KB9 D;  1IZN B;  4ZKU A;  3JCU H;  3A3Y B;  3GG2 A;  1N2D C;  3H1K D;  4ZMD A;  3FWN A;  2XNX A;  1FZA A;  2XKM A;  3CWB G;  1KQL A;  1VF5 C;  2W6J H;  3MHV A;  3A7O A;  3HE4 B;  2Z5I A;  4GKG A;  1NKN A;  1AVO A;  2D2C C;  1RE3 C;  1L4A D;  2KUB A;  1LP1 B;  1S5L H;  1SQP K;  2FYU E;  4U3F J;  3RK2 C;  2R32 A;  4WVZ A;  3LIE A;  3KQG A;  2OYO A;  1Z56 A;  1FDO A;  4K35 A;  1NTK G;  1NU1 E;  4OGQ D;  3H1I G;  1ZN5 A;  2SPZ A;  2P10 A;  3II6 A;  2B88 A;  4OGQ C;  2P7J A;  2FYU D;  1M7L A;  2HOD A;  1ZW0 A;  3LID A;  1KFM A;  1RE3 A;  5KAI H;  5KLV E;  1RF0 C;  2HG5 D;  1NU1 D;  1EDK A;  1SQP J;  1VL2 A;  1W2E A;  2BCC J;  2FYN B;  3Q5P A;  2FFD C;  1JY2 O;  3F89 A;  3R2P A;  3A0B E;  3WUT A;  3CCE P;  2O3J A;  2ZXE B;  5KLV D;  1JNM A;  3D6Z A;  2ITA A;  2Q9I A;  1NTM G;  1KYO H;  4UB6 H;  1CZQ A;  1SQQ E;  5AVU B;  1RF0 A;  2Y9Y A;  1Q86 Q;  1CI6 B;  3C8V A;  1EZV E;  1URQ B;  1T2K D;  3CI9 A;  4H13 B;  2FFD A;  4LGD E;  3U1C A;  2N1T B;  3L74 E;  1SQQ D;  2P1J A;  1L0N G;  1ZR2 A;  2IZ0 A;  1NTZ G;  2QE7 H;  1SQX J;  3ITK A;  3GHG C;  2GUS A;  3MZW B;  4JYB A;  5APW A;  1OMI A;  3L74 D;  1MFZ A;  4MN4 C;  1QGK B;  1KQG B;  3OJA B;  1GL2 B;  2KOG A;  3FWL A;  2WZ7 A;  3M0D C;  1SFC B;  5C39 A;  4TT3 H;  1FZC C;  3RGU A;  4AUW A;  5M1B A;  5BU8 B;  1W2B O;  1S5L X;  3EQ2 A;  4WY4 D;  1JY3 P;  3N7N A;  5H2F H;  2WSC J;  3GHG A;  1N73 C;  1PP9 J;  3L75 G;  2AXT E;  4OWF A;  1YJN P;  2Y0C A;  3BCC G;  2BAS A;  2POH A;  3M0D A;  1NTK J;  1FZC A;  3H1I J;  5KLI B;  2K9J A;  2FKW B;  2YXQ B;  1NTM K;  3M9Q A;  5GTH H;  1VQL P;  4JBZ A;  1Q90 D;  2KNC A;  5TIS E;  1BCC J;  1KC8 Q;  1N7S D;  1NJI Q;  3VYI A;  1N7S C;  2W90 A;  3E7K A;  2IYP A;  4N78 D;  4DJG A;  4IFD K;  1GK6 A;  3VMX A;  3MTU E;  3BAS A;  4L75 A;  1YTZ I;  2M5A A;  1L0N K;  3G6E P;  1HBW A;  1NTZ K;  4JPZ B;  3RBZ A;  1VQ6 P;  1NTM J;  1DX7 A;  1CW5 A;  1HH0 A;  4PV1 D;  1P84 H;  5B5E H;  1LTT C;  3Q2Y A;  1FDM A;  1H89 A;  2KSE A;  2OAR A;  1PL5 A;  4H0L B;  5KAF H;  2A06 G;  1K8A Q;  3T97 B;  2CK3 H;  2JWD A;  3H1J E;  5GTI E;  2IBZ E;  4EIJ A;  1FAV A;  2AEJ A;  1NTZ J;  2PFX A;  1KB9 H;  3VMA A;  1SQB G;  1BE3 G;  3CCL P;  5B66 E;  3U59 A;  1KIL B;  2IBZ D;  1USE A;  2Q6Q A;  3D71 A;  1IFJ A;  1FJP A;  1VDF A;  2JJL A; 
#chains in the Genus database with same CATH homology
 2KK7 A;  2K88 A;  1L2P A;  3V6I A;  4DT0 A;  3K5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...