2K88A

Association of subunit d (vma6p) and e (vma4p) with g (vma10p) and the nmr solution structure of subunit g (g1-59) of the saccharomyces cerevisiae v1vo atpase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
60
structure length
60
Chain Sequence
b'MVSQKNGIATLLQAEKEAHEIVSKARKYRQDKLKQAKTDAAKEIDSYKIQKDKELKEFEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar proton pump subunit G
publication title Assembly of subunit d (Vma6p) and G (Vma10p) and the NMR solution structure of subunit G (G(1-59)) of the Saccharomyces cerevisiae V(1)V(O) ATPase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 22
structure length 60
sequence length 60
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2008-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.620 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces F1F0 ATP synthase subunit B, membrane domain 2k88A00
3V6IA 2KK7A 4DT0A 2K88A 3K5BA 1L2PA
chains in the Genus database with same CATH superfamily
4Y99C 2OYHA 3U1AA 1K73Q 5TISH 3CXHD 4N78D 1N2DC 2PAJA 3MZWB 1LTJC 1K05A 3KZIH 2Y0CA 5AW9B 3H32A 1PP9G 4Y28J 2BCCE 3BATA 1SQBK 1UIXA 2LR2A 3RL0g 1SQXJ 3AEBC 2HG5D 3L73J 4DCKA 1MFTA 1FZGA 3L71E 1ZMEC 5CBOA 1OW8A 1EDIA 1FZFA 1SQPE 3L36A 1Y47A 1URQC 1L0LD 2W83C 4LGDE 1OVUA 2QA4P 1LTAC 2C0XA 4CPGA 2W90A 3L37A 2PGDA 3Q2YA 3P32A 1PGJA 3GW6A 1JY2N 2A45H 4H13B 2BCCD 2G3AA 1S3JA 3AECC 3JCUH 1WT6A 1IO4A 2XZRA 3B8EB 2CPSA 3L71D 3W67A 5K5GB 5KLVJ 1SQXG 1SQPD 1Q2NA 1RY3A 2IFNA 4ASWA 1KILA 2WQYC 5APWA 1OXZA 3CWBJ 1RE3A 2B89A 1SQQJ 1S72P 1JTHB 1T8ZA 3T97B 3OA7A 1VPCA 2XNXA 2WSEJ 2Q9IA 4H13C 2FYUE 1AVOA 3H1LD 2HPCA 4JPZB 1ZOYC 4M3LA 1YJ9P 3NMDA 1U7JA 1SQPK 1KILD 4C7NB 4YTPC 2P58A 3PJSK 1N73B 5KLVG 1PPJD 3RK3D 1NTZD 2ZVNB 1LP1A 1P84E 1JUNA 4I6MC 2WZ7A 3F5HA 4NPEA 2IFMA 4WBAA 2N1TB 4WVZA 3CCRP 3MGNA 3L72J 5APYA 3CWBG 4MN4C 3V2RA 3V4QA 4UB6H 3H1KJ 1IK7A 3S1KA 2FYUD 4PV1D 1SFCA 2FFDA 1BGYD 1RQVA 5AVWB 3VMYA 1RF0C 3LW5H 1LTJA 1QX8A 2D2CC 2KS1A 1VQKP 1NTME 1FJPA 3MHVA 4BRYA 5AVRB 3O6QA 1S9KD 1SFCD 1JY3N 3KDPB 1SQVG 2Q3EA 2R3CA 1YJWP 1L4AD 2IBZD 2FYUK 2OYOA 1IFIA 5AW2B 2M8RA 2G8YA 3IF4A 4AYCA 4WY4C 1P84H 1KQGB 3AE5C 3WUUA 2KNCB 4AUWA 1NTMD 4XA4A 2WSFH 2ZVOB 4L75A 2IYPA 1NTKE 2QVAA 3L70J 3CX5E 5APQA 1BSHA 2JP3A 5KAFE 4NPFX 2KZJA 3MUDA 1IFMA 2WTYA 1HJ0A 3M9BA 2GM4A 1IFDA 3P8CE 3GF7A 2NRGA 3B5NC 1T2KC 1NU1E 5GTIE 1DD3A 3A2AA 1EQ7A 4U3FE 3D71A 3MTUE 1K04A 3OAKA 1S1CX 3TGUJ 5AW5B 2M5AB 3P8MC 1NTKD 3L74G 1NTMK 4D6TJ 3CX5D 1JMBA 1UIIA 3E1IA 3G71P 3A7OA 2YO3A 1KB9I 2WVRA 3BCCD 3F89A 3P8CD 5H2FE 2FY8A 2CK3H 3BVHA 1EXJA 1X79B 3H1IG 2HYNA 1T6AA 1RE4C 4JYBA 2LKMA 1FDMA 1M7LA 3B4SA 1EXIA 3CI9A 1XTCC 4QMAA 2AXTE 3M9HA 2QM8A 1G2CA 4H13D 3AE6C 2E76B 3AE3C 1GU5A 3T97A 1OFCX 3CLQA 4LC1A 3CX5H 5CCGC 2W27A 3KQGA 1EZVG 2FXOA 4OH8B 5KAFH 3L75G 1NTKK 3CC7P 2R44A 3H25A 4HYTB 1GU4A 3H1IE 2C0WA 3N4XA 1JOCA 4YXWH 3WUTA 5GTIH 1BE3D 1RF1B 2E42A 1JB0J 3L35A 4C7NA 5EFWB 1NU1K 3QH9A 3H1JE 1AA0A 2V7QJ 3SWKA 2QJYB 1JCCA 3G4SP 1ZP0C 3L75E 2KP8A 1FAVA 2P7JA 2ZFCA 2WITA 2FKWB 2NPSC 3JSVC 3D6YA 5H2FH 1NOHA 3V6IA 1L0ND 3R4YA 2KLUA 5AW3B 4PJ0H 3USSA 1D7MA 3I56P 1X22A 2Q5UA 5APUA 1AV1A 2A06G 4I7ZC 3MD0A 3GHGC 2IZ0A 1DEBA 3CCJP 3EFFK 2KZIA 1LP1B 1RF1C 3H1JD 5CCHC 1KYOE 2MKVA 4ZNCA 2B88A 3D6ZA 2N1TD 1OZHA 1L0LJ 1VQMP 2O01N 1VF5C 3G3ZA 3VMZA 2QJYC 1HTLC 2XKMA 2BEZF 2O1JA 1T3UA 4UB8E 4Y99B 3SWYA 4I2LC 4O9BA 5DJTB 2E74B 1AFOA 2BCCJ 1USDA 1N8RQ 1J1DC 3V2PA 2YNYA 4EDFA 2HR3A 2JDIH 5AVVB 2KIKA 3L71J 4PD4I 3M0DA 4YPCA 1FZEA 4KJMA 1JEKA 1K9MQ 1SQPJ 3FX0A 5CMZA 3JC22 1GDTA 2IX7C 2KNCA 1SQBD 1CSBA 1KQLA 2Y0DA 5AVTB 2AEJA 3AEEC 2Y9ZA 4OVNF 5AW8B 1X9VA 1YBKA 5KAIE 4BRYB 3C1LA 1BCCE 1T2KD 5AVUB 4RJTA 2Z5IA 2QSIA 3RBXA 1IK9A 1Y9BA 2YMKA 1L0LG 1GW4A 3TYYA 1DX7A 3Q5RA 1JMMA 2E75C 4W7YA 1URQB 1KV4A 2HLOA 1Z56A 1IC2A 5AW7B 4WWIA 1QGKB 2E74C 4HJGH 3H1LJ 3CXHI 4H44C 1YQ3C 2K37A 3CCQP 2J5UA 5CCGA 1NWQA 1M57D 2J59M 2M5AA 3CC4P 3OW2O 1FU1A 1NTZJ 2SPZA 4IOIH 2W6BA 2N9BA 1BCCD 5L8RJ 4C7RA 1OMIA 1KZUB 4UB8H 5APVA 1FOSE 3LIDA 5E79E 5AW1B 3M06A 3TNUB 1VQ5P 2K1AA 2B87B 2FYUJ 3ZDMA 3AEDC 1IFNA 1NVOA 1FS0E 3U1CA 1BGYJ 1SLQA 1PP9E 3H1HG 3SWFA 1YQ4C 1CI6B 3BASA 3H1LG 3PHLA 5B66E 2HFED 1ZLLA 3CCLP 1ZR4A 5C39A 2WMMA 3E7KA 4K35A 4NPDA 1A02J 1PGQA 2O1KA 1PPJG 2Q3IA 2P10A 1NTZG 2Z5HA 3WU2E 3G6EP 4IFMA 2QIWA 3L73G 3GHGA 3M91A 1HUCA 1RF1A 3H1HE 5CCHA 4Z1MH 2ITAA 1PP9D 3D70A 1J1EC 1Q90D 1ZXGA 2E76D 4YXDC 1G2CB 5KKZC 1J2JB 3HE5A 1TU3F 2OARA 4U7JA 2L91A 3WMM0 1LTBC 1W2EA 1ZN5A 1NTMJ 5E79H 3Q1MA 2ZT9C 2QJKB 1SQXE 2QE7H 4B86A 1M1JC 2KYVA 1MV8A 5KLIB 3FXDA 2YKPA 3S9OA 4L74A 2JWAA 1N7LA 1HF9A 1LT1A 1USEA 2D2CB 1OX3A 1HH0A 2I1JA 2RMZA 2FXMA 2QM7A 1GK4A 1KFNA 4XE5B 2K9JB 4H0LC 1LWUC 1H88A 4BWNA 5B66H 1MKMA 1N7SB 1RH5B 2QJPC 1AQTA 3PTZA 2IBZG 2AEFA 1YJNP 3RBZA 1SQQG 2WPSA 1LTSC 1NTKJ 1ZW0A 1M8OB 3VOPA 2C9LY 3WU2H 4EI2A 2QJKC 2L5GB 1FZCC 4WY4B 4A7PA 5KLVE 3BCCJ 5KLIC 1Q82Q 2RN0A 1P84D 2FYNC 3AEAC 1VQ8P 4TLFA 1RQUA 1ZRTE 3CWBE 3CCEP 1OW7A 1PFIA 1AQ5A 1YTZI 2OGUA 2KI7B 2E74D 1N7SC 5KJ7C 4N3YB 3B5NB 1QL1A 5CJ0A 3BRVB 2E5TA 1URQA 2IBZI 1SQXK 3L72G 2P1JA 2ZYGA 3H1KG 3CCSP 2LXCB 2UWJE 1PL5A 1OIPA 3HUSB 1BE3J 5M1BA 1NHLA 2O01H 1H0TB 1X0TA 2HODA 3M9QA 1VQ4P 2PP6A 4C46A 2AXCA 3AE8C 1ZV8A 1SQVE 5CBNA 5APXA 3AE4C 3TNUA 1URQD 3L72E 2PFXA 5AW6B 1FZBA 4IFDK 1QLED 2B87A 2I8DA 3RK2B 1VQOP 2ZXXA 2Y9YA 2R32A 3G9RA 1L0NJ 5KLVK 1FDIA 5AVXB 2YXQB 2E5YA 4HKZH 1N86A 3CD6P 1HVVA 2MJZA 1CI6A 2YIUB 3HUSC 3CX5I 1PGOA 3H1JJ 2QG4A 2W6JH 3TSIA 1EDKA 1BE3G 4RESB 3RL0C 1SQVD 4KHXA 3L70G 2DW3A 3AE1C 1NU1D 3M0AA 5CHXA 2FBWC 4U3FD 3V5BA 3RK2C 1LWUA 1W2BO 3IN6A 1LNQA 3NFQA 3UIAA 3L74E 1GD2E 1OVRA 2BEQD 3IR9A 3R2PA 1L0NG 3N7NA 2NPSB 1SQBJ 3HTKB 2W8ZA 3TGUG 3L70E 2OYHC 1A02F 2YIUC 3KPEA 4L73A 1FZCA 1H89A 1GMJA 2WPRA 1RF0A 4I7ZB 4D6TG 1KMIZ 1SQVK 3GHGB 3V2QA 4RO0A 1FDOA 1Q81Q 4OGQB 2IYOA 1LJ2A 1XTGB 2K9JA 1VF5B 2KXPB 3L74D 1EZVE 1NKNA 3HE5B 3VMAA 1IFPA 1NGMB 1N7SA 5KJ7A 4ZKPA 1QEXA 4ASVA 1U57A 1J1DB 2YKQA 4D6TE 1R5LA 1OW6A 4EOTA 3BRTB 1SS1A 3H1ID 1BCCJ 2D2CD 3HE4A 1SQBG 1JY2O 4WY4A 2ZAEB 2M3EA 2R3SA 3GG2A 1BDCA 2AXTH 5DJUB 4OGQC 1N7SD 5KJ7D 1EZVD 3CCUP 1IFJA 2KLVA 3L75D 1YIJP 4PD4E 2KUBA 3RGUA 1VQ9P 1KQFB 1H8AA 2E75B 3B5NA 5KTBA 2OYIC 2A06E 4WY4D 1QL2A 1KILC 2K3RA 4H44B 1RE3C 3RK3C 4GDOA 1W5CE 1VQNP 4OWFA 5TJHA 2RH0A 4W7ZA 3TK1A 3HUSA 1KYOD 1AJYA 1H0TA 5APTA 2O3JA 1GK6A 4IL6X 1PP9J 3KHUA 3CXHE 3OJAB 4JBZA 1YITP 3B5ND 4PV1C 4BXLA 5BVZA 1EDJA 4TT3H 4RKUJ 2OTLP 2JKVA 2H88C 3H6PA 1RE4A 2H89C 3CMEP 1DH3A 1HBWA 3GLMA 2BCCG 1GZLA 2H8PD 2ZJSE 1KYOH 3Q3DA 1PGPA 3CL3D 3LW5J 3L71G 1VQ7P 4EIJA 2HODB 1AVYA 1S5LX 2A45I 4PD4H 1SQPG 1SFCC 1L0LE 2FFDC 3KXDA 4L76A 3IAOA 1PIXA 1L4AC 1VDFA 3AE2C 4K3AA 3TDKA 3RK2D 2YO2A 3K5BA 1RHZB 2IPPA 1J1EB 3HD7C 5CCGD 1R8EA 4W80A 2P2UA 5KKZB 1EDLA 1ZR2A 4JYCA 1JY3O 1DD4A 3FWNA 4EYYQ 1FJKA 2V7QH 2WPQA 4GODA 4AQRD 2ZT9B 3AEFC 5KAIH 3CXHH 3WUVA 2NPSA 3CC2P 1M1JB 3HTKA 1KC8Q 2WSFJ 1FZAA 2O01J 3GF3A 4R4MA 2V4HA 1U7MA 2H7HA 2W6AA 4IL6E 4H0LB 3A3YB 1LWUB 2AEMA 1FC2C 4WB4A 4UB6E 3H1LE 1WMKA 1Q86Q 2KK7A 2QJPB 3MUDC 2FYUG 2KOGA 1KN7A 2NPSD 3CCMP 2WSCH 1KILE 1BGYG 2XU6A 2GA1A 1PPJE 3RK3E 1NTZE 2OYIA 1FZCB 1L0LK 1KFMA 3L73E 1JY2P 3HRNA 3SSUA 1GL2B 1T3JA 5CCHD 1BSNA 4OGQD 1S5LE 2FYNB 3H1HD 1Q7YQ 1YYCA 3U59A 4GKGA 3VYIA 1MZ9A 1VF5D 4GOFA 3V4WA 3MP7B 1YHQP 1BGYE 1K8AQ 2KSJA 4DZOA 1KQSO 1SQXD 2C9NY 2QRXA 2WT7A 3L73D 3HE4B 1NTMG 1LTTC 3QWOC 1SQVJ 4HH2A 2BASA 2Q6QA 4IL6H 3SFDC 1GL2C 1S9KE 2N9YB 5BU8B 1P84I 2Z4EA 1NU1J 4GT1A 2IBZE 4U3FJ 2OTJP 2XNDH 2R5BA 2B9BA 1L4AA 2RKLA 3FXEA 1SQQE 2E75D 2YXRB 3PRJA 3CMAP 3Q5SA 2KB7P 3VP9A 1N73C 4H44D 1NTZK 3HD7A 1FOSF 2JO1A 2WWWA 2ZXEB 1QVFO 5GTHE 1S5LH 5KLVD 2GUSA 1NTKG 1KORA 2N1TC 1M1KQ 1PV3A 3II6A 3VMXA 1LT9B 3BCCG 3B71A 3ABVC 3RL0B 1ZRTD 3CWBD 3I55P 1DIPA 1SQQD 1NU1G 1KD1Q 3L74J 3NTNA 2E43A 5AVYB 3IFMA 4U3FG 3A0BE 3HD7D 1EC5A 2VRSA 2KSEA 1MFZA 3H1KE 2Q7CA 3EWKA 3PLNA 3PP5A 3Q5PA 3VN0A 1VQLP 1KB9E 3H1IJ 3ITKA 1HWTC 1JY3P 3BCCE 2CPBA 2POHA 2WPVB 3NXSA 1IZNB 1NAYA 3W68A 2OYHB 2Q1KA 1DEEG 1LTGC 1L2PA 1LT9C 1LTIC 1M1JA 2OQQA 5CJ4A 4KT0J 1VQPP 1NO4A 3M0DC 3TF5A 3L75J 1SQQK 1OWAA 2WSEH 3L72D 3H32B 2YMYA 2IZ1A 1PZQA 1CZQA 2R5DA 3E1RA 3H1KD 5GTHH 1NKZB 3A5TA 3I5CA 1KB9D 1GW3A 1FBMA 1NH4A 5AVQB 2QEXP 5APSA 4JF7A 4IFFA 1CW5A 1BDDA 2FYZA 2ZT9D 2K88A 4PJ0E 2J58A 3EQ2A 4DOJA 1BE3E 2FXPA 4DJGA 3MIWA 2H43A 2LXBA 3CPWO 2WSSH 5B5EE 2YKOA 3A0BH 5BU5A 4R4LA 1JNMA 1M90Q 4JQ0D 3H1JG 2Y0EA 4ZKUA 1JTHA 1GL2A 2M0BA 4H0LD 5AVZB 1LGHB 1KB9H 1S2EA 1GTWA 4N6JA 1QVGO 1L0NE 2OTKE 3CCVP 1FE6A 4DT0A 3A0HE 3TGUE 1JO5A 1OVVA 3KYQA 1N73A 2OYIB 3AEGC 1KILB 1E5WA 3L70D 2PRRA 1VQ6P 2NZ2A 1S4XA 3RK3B 1G1JA 1GL2D 1IJDB 1YTZT 4HB1A 1NYHA 2N1TA 3EFGA 2ZYAA 1HGZA 5AW4B 1NAFA 1JM0A 2E76C 1SP4A 1R5SA 4GOEA 3P7KA 2HPCB 3PH0A 1EZVI 4PV1B 1WRGA 3TGUD 2M3BA 2GUVA 1HGVA 5TISE 5B5EH 2JR8A 3VP8A 4D6TD 3LIEA 1SQBE 2WSCJ 1NJIQ 3KZIE 2WT7B 5AVSB 3FGAD 1M56D 2K9YA 3O8ZA 4GIFA 2XV5A 2I1KA 2A45G 1BCCG 3GMAA 1KYOI 1VL2A 2XDJA 1SFCB 2FFDB 1LT9A 3A0HH 2JWDA 1L4AB 1L0NK 1LTJB 4PD4D 4N78E 2P67A 3SFEC 1KTMA 1SVFA 2KS1B 5AW0B 4I1LA 4XFJA 3FWLA 3L4FA 1E79H 1X8YA 2A06D 3AE7C 1MUUA 2ZYDA 3HD7B 4LLHA 3V2NA 3VTPC 2JJLA 2IDBA 1HJBA 3O6QB 3AE9C 1G1IA 4ZMDA 1Y8AA 3C8VA 3JCUE 1JCDA 1YI2P 3C9IA 3H1HJ 3RL0D 3S4RA 2JEEA
chains in the Genus database with same CATH topology
3V6IA 2KK7A 4DT0A 2K88A 3K5BA 1L2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V6I A;  2KK7 A;  4DT0 A;  2K88 A;  3K5B A;  1L2P A; 
#chains in the Genus database with same CATH topology
 4Y99 C;  2OYH A;  3U1A A;  1K73 Q;  5TIS H;  3CXH D;  4N78 D;  1N2D C;  2PAJ A;  3MZW B;  1LTJ C;  1K05 A;  3KZI H;  2Y0C A;  5AW9 B;  3H32 A;  1PP9 G;  4Y28 J;  2BCC E;  3BAT A;  1SQB K;  1UIX A;  2LR2 A;  3RL0 g;  1SQX J;  3AEB C;  2HG5 D;  3L73 J;  4DCK A;  1MFT A;  1FZG A;  3L71 E;  1ZME C;  5CBO A;  1OW8 A;  1EDI A;  1FZF A;  1SQP E;  3L36 A;  1Y47 A;  1URQ C;  1L0L D;  2W83 C;  4LGD E;  1OVU A;  2QA4 P;  1LTA C;  2C0X A;  4CPG A;  2W90 A;  3L37 A;  2PGD A;  3Q2Y A;  3P32 A;  1PGJ A;  3GW6 A;  1JY2 N;  2A45 H;  4H13 B;  2BCC D;  2G3A A;  1S3J A;  3AEC C;  3JCU H;  1WT6 A;  1IO4 A;  2XZR A;  3B8E B;  2CPS A;  3L71 D;  3W67 A;  5K5G B;  5KLV J;  1SQX G;  1SQP D;  1Q2N A;  1RY3 A;  2IFN A;  4ASW A;  1KIL A;  2WQY C;  5APW A;  1OXZ A;  3CWB J;  1RE3 A;  2B89 A;  1SQQ J;  1S72 P;  1JTH B;  1T8Z A;  3T97 B;  3OA7 A;  1VPC A;  2XNX A;  2WSE J;  2Q9I A;  4H13 C;  2FYU E;  1AVO A;  3H1L D;  2HPC A;  4JPZ B;  1ZOY C;  4M3L A;  1YJ9 P;  3NMD A;  1U7J A;  1SQP K;  1KIL D;  4C7N B;  4YTP C;  2P58 A;  3PJS K;  1N73 B;  5KLV G;  1PPJ D;  3RK3 D;  1NTZ D;  2ZVN B;  1LP1 A;  1P84 E;  1JUN A;  4I6M C;  2WZ7 A;  3F5H A;  4NPE A;  2IFM A;  4WBA A;  2N1T B;  4WVZ A;  3CCR P;  3MGN A;  3L72 J;  5APY A;  3CWB G;  4MN4 C;  3V2R A;  3V4Q A;  4UB6 H;  3H1K J;  1IK7 A;  3S1K A;  2FYU D;  4PV1 D;  1SFC A;  2FFD A;  1BGY D;  1RQV A;  5AVW B;  3VMY A;  1RF0 C;  3LW5 H;  1LTJ A;  1QX8 A;  2D2C C;  2KS1 A;  1VQK P;  1NTM E;  1FJP A;  3MHV A;  4BRY A;  5AVR B;  3O6Q A;  1S9K D;  1SFC D;  1JY3 N;  3KDP B;  1SQV G;  2Q3E A;  2R3C A;  1YJW P;  1L4A D;  2IBZ D;  2FYU K;  2OYO A;  1IFI A;  5AW2 B;  2M8R A;  2G8Y A;  3IF4 A;  4AYC A;  4WY4 C;  1P84 H;  1KQG B;  3AE5 C;  3WUU A;  2KNC B;  4AUW A;  1NTM D;  4XA4 A;  2WSF H;  2ZVO B;  4L75 A;  2IYP A;  1NTK E;  2QVA A;  3L70 J;  3CX5 E;  5APQ A;  1BSH A;  2JP3 A;  5KAF E;  4NPF X;  2KZJ A;  3MUD A;  1IFM A;  2WTY A;  1HJ0 A;  3M9B A;  2GM4 A;  1IFD A;  3P8C E;  3GF7 A;  2NRG A;  3B5N C;  1T2K C;  1NU1 E;  5GTI E;  1DD3 A;  3A2A A;  1EQ7 A;  4U3F E;  3D71 A;  3MTU E;  1K04 A;  3OAK A;  1S1C X;  3TGU J;  5AW5 B;  2M5A B;  3P8M C;  1NTK D;  3L74 G;  1NTM K;  4D6T J;  3CX5 D;  1JMB A;  1UII A;  3E1I A;  3G71 P;  3A7O A;  2YO3 A;  1KB9 I;  2WVR A;  3BCC D;  3F89 A;  3P8C D;  5H2F E;  2FY8 A;  2CK3 H;  3BVH A;  1EXJ A;  1X79 B;  3H1I G;  2HYN A;  1T6A A;  1RE4 C;  4JYB A;  2LKM A;  1FDM A;  1M7L A;  3B4S A;  1EXI A;  3CI9 A;  1XTC C;  4QMA A;  2AXT E;  3M9H A;  2QM8 A;  1G2C A;  4H13 D;  3AE6 C;  2E76 B;  3AE3 C;  1GU5 A;  3T97 A;  1OFC X;  3CLQ A;  4LC1 A;  3CX5 H;  5CCG C;  2W27 A;  3KQG A;  1EZV G;  2FXO A;  4OH8 B;  5KAF H;  3L75 G;  1NTK K;  3CC7 P;  2R44 A;  3H25 A;  4HYT B;  1GU4 A;  3H1I E;  2C0W A;  3N4X A;  1JOC A;  4YXW H;  3WUT A;  5GTI H;  1BE3 D;  1RF1 B;  2E42 A;  1JB0 J;  3L35 A;  4C7N A;  5EFW B;  1NU1 K;  3QH9 A;  3H1J E;  1AA0 A;  2V7Q J;  3SWK A;  2QJY B;  1JCC A;  3G4S P;  1ZP0 C;  3L75 E;  2KP8 A;  1FAV A;  2P7J A;  2ZFC A;  2WIT A;  2FKW B;  2NPS C;  3JSV C;  3D6Y A;  5H2F H;  1NOH A;  3V6I A;  1L0N D;  3R4Y A;  2KLU A;  5AW3 B;  4PJ0 H;  3USS A;  1D7M A;  3I56 P;  1X22 A;  2Q5U A;  5APU A;  1AV1 A;  2A06 G;  4I7Z C;  3MD0 A;  3GHG C;  2IZ0 A;  1DEB A;  3CCJ P;  3EFF K;  2KZI A;  1LP1 B;  1RF1 C;  3H1J D;  5CCH C;  1KYO E;  2MKV A;  4ZNC A;  2B88 A;  3D6Z A;  2N1T D;  1OZH A;  1L0L J;  1VQM P;  2O01 N;  1VF5 C;  3G3Z A;  3VMZ A;  2QJY C;  1HTL C;  2XKM A;  2BEZ F;  2O1J A;  1T3U A;  4UB8 E;  4Y99 B;  3SWY A;  4I2L C;  4O9B A;  5DJT B;  2E74 B;  1AFO A;  2BCC J;  1USD A;  1N8R Q;  1J1D C;  3V2P A;  2YNY A;  4EDF A;  2HR3 A;  2JDI H;  5AVV B;  2KIK A;  3L71 J;  4PD4 I;  3M0D A;  4YPC A;  1FZE A;  4KJM A;  1JEK A;  1K9M Q;  1SQP J;  3FX0 A;  5CMZ A;  3JC2 2;  1GDT A;  2IX7 C;  2KNC A;  1SQB D;  1CSB A;  1KQL A;  2Y0D A;  5AVT B;  2AEJ A;  3AEE C;  2Y9Z A;  4OVN F;  5AW8 B;  1X9V A;  1YBK A;  5KAI E;  4BRY B;  3C1L A;  1BCC E;  1T2K D;  5AVU B;  4RJT A;  2Z5I A;  2QSI A;  3RBX A;  1IK9 A;  1Y9B A;  2YMK A;  1L0L G;  1GW4 A;  3TYY A;  1DX7 A;  3Q5R A;  1JMM A;  2E75 C;  4W7Y A;  1URQ B;  1KV4 A;  2HLO A;  1Z56 A;  1IC2 A;  5AW7 B;  4WWI A;  1QGK B;  2E74 C;  4HJG H;  3H1L J;  3CXH I;  4H44 C;  1YQ3 C;  2K37 A;  3CCQ P;  2J5U A;  5CCG A;  1NWQ A;  1M57 D;  2J59 M;  2M5A A;  3CC4 P;  3OW2 O;  1FU1 A;  1NTZ J;  2SPZ A;  4IOI H;  2W6B A;  2N9B A;  1BCC D;  5L8R J;  4C7R A;  1OMI A;  1KZU B;  4UB8 H;  5APV A;  1FOS E;  3LID A;  5E79 E;  5AW1 B;  3M06 A;  3TNU B;  1VQ5 P;  2K1A A;  2B87 B;  2FYU J;  3ZDM A;  3AED C;  1IFN A;  1NVO A;  1FS0 E;  3U1C A;  1BGY J;  1SLQ A;  1PP9 E;  3H1H G;  3SWF A;  1YQ4 C;  1CI6 B;  3BAS A;  3H1L G;  3PHL A;  5B66 E;  2HFE D;  1ZLL A;  3CCL P;  1ZR4 A;  5C39 A;  2WMM A;  3E7K A;  4K35 A;  4NPD A;  1A02 J;  1PGQ A;  2O1K A;  1PPJ G;  2Q3I A;  2P10 A;  1NTZ G;  2Z5H A;  3WU2 E;  3G6E P;  4IFM A;  2QIW A;  3L73 G;  3GHG A;  3M91 A;  1HUC A;  1RF1 A;  3H1H E;  5CCH A;  4Z1M H;  2ITA A;  1PP9 D;  3D70 A;  1J1E C;  1Q90 D;  1ZXG A;  2E76 D;  4YXD C;  1G2C B;  5KKZ C;  1J2J B;  3HE5 A;  1TU3 F;  2OAR A;  4U7J A;  2L91 A;  3WMM 0;  1LTB C;  1W2E A;  1ZN5 A;  1NTM J;  5E79 H;  3Q1M A;  2ZT9 C;  2QJK B;  1SQX E;  2QE7 H;  4B86 A;  1M1J C;  2KYV A;  1MV8 A;  5KLI B;  3FXD A;  2YKP A;  3S9O A;  4L74 A;  2JWA A;  1N7L A;  1HF9 A;  1LT1 A;  1USE A;  2D2C B;  1OX3 A;  1HH0 A;  2I1J A;  2RMZ A;  2FXM A;  2QM7 A;  1GK4 A;  1KFN A;  4XE5 B;  2K9J B;  4H0L C;  1LWU C;  1H88 A;  4BWN A;  5B66 H;  1MKM A;  1N7S B;  1RH5 B;  2QJP C;  1AQT A;  3PTZ A;  2IBZ G;  2AEF A;  1YJN P;  3RBZ A;  1SQQ G;  2WPS A;  1LTS C;  1NTK J;  1ZW0 A;  1M8O B;  3VOP A;  2C9L Y;  3WU2 H;  4EI2 A;  2QJK C;  2L5G B;  1FZC C;  4WY4 B;  4A7P A;  5KLV E;  3BCC J;  5KLI C;  1Q82 Q;  2RN0 A;  1P84 D;  2FYN C;  3AEA C;  1VQ8 P;  4TLF A;  1RQU A;  1ZRT E;  3CWB E;  3CCE P;  1OW7 A;  1PFI A;  1AQ5 A;  1YTZ I;  2OGU A;  2KI7 B;  2E74 D;  1N7S C;  5KJ7 C;  4N3Y B;  3B5N B;  1QL1 A;  5CJ0 A;  3BRV B;  2E5T A;  1URQ A;  2IBZ I;  1SQX K;  3L72 G;  2P1J A;  2ZYG A;  3H1K G;  3CCS P;  2LXC B;  2UWJ E;  1PL5 A;  1OIP A;  3HUS B;  1BE3 J;  5M1B A;  1NHL A;  2O01 H;  1H0T B;  1X0T A;  2HOD A;  3M9Q A;  1VQ4 P;  2PP6 A;  4C46 A;  2AXC A;  3AE8 C;  1ZV8 A;  1SQV E;  5CBN A;  5APX A;  3AE4 C;  3TNU A;  1URQ D;  3L72 E;  2PFX A;  5AW6 B;  1FZB A;  4IFD K;  1QLE D;  2B87 A;  2I8D A;  3RK2 B;  1VQO P;  2ZXX A;  2Y9Y A;  2R32 A;  3G9R A;  1L0N J;  5KLV K;  1FDI A;  5AVX B;  2YXQ B;  2E5Y A;  4HKZ H;  1N86 A;  3CD6 P;  1HVV A;  2MJZ A;  1CI6 A;  2YIU B;  3HUS C;  3CX5 I;  1PGO A;  3H1J J;  2QG4 A;  2W6J H;  3TSI A;  1EDK A;  1BE3 G;  4RES B;  3RL0 C;  1SQV D;  4KHX A;  3L70 G;  2DW3 A;  3AE1 C;  1NU1 D;  3M0A A;  5CHX A;  2FBW C;  4U3F D;  3V5B A;  3RK2 C;  1LWU A;  1W2B O;  3IN6 A;  1LNQ A;  3NFQ A;  3UIA A;  3L74 E;  1GD2 E;  1OVR A;  2BEQ D;  3IR9 A;  3R2P A;  1L0N G;  3N7N A;  2NPS B;  1SQB J;  3HTK B;  2W8Z A;  3TGU G;  3L70 E;  2OYH C;  1A02 F;  2YIU C;  3KPE A;  4L73 A;  1FZC A;  1H89 A;  1GMJ A;  2WPR A;  1RF0 A;  4I7Z B;  4D6T G;  1KMI Z;  1SQV K;  3GHG B;  3V2Q A;  4RO0 A;  1FDO A;  1Q81 Q;  4OGQ B;  2IYO A;  1LJ2 A;  1XTG B;  2K9J A;  1VF5 B;  2KXP B;  3L74 D;  1EZV E;  1NKN A;  3HE5 B;  3VMA A;  1IFP A;  1NGM B;  1N7S A;  5KJ7 A;  4ZKP A;  1QEX A;  4ASV A;  1U57 A;  1J1D B;  2YKQ A;  4D6T E;  1R5L A;  1OW6 A;  4EOT A;  3BRT B;  1SS1 A;  3H1I D;  1BCC J;  2D2C D;  3HE4 A;  1SQB G;  1JY2 O;  4WY4 A;  2ZAE B;  2M3E A;  2R3S A;  3GG2 A;  1BDC A;  2AXT H;  5DJU B;  4OGQ C;  1N7S D;  5KJ7 D;  1EZV D;  3CCU P;  1IFJ A;  2KLV A;  3L75 D;  1YIJ P;  4PD4 E;  2KUB A;  3RGU A;  1VQ9 P;  1KQF B;  1H8A A;  2E75 B;  3B5N A;  5KTB A;  2OYI C;  2A06 E;  4WY4 D;  1QL2 A;  1KIL C;  2K3R A;  4H44 B;  1RE3 C;  3RK3 C;  4GDO A;  1W5C E;  1VQN P;  4OWF A;  5TJH A;  2RH0 A;  4W7Z A;  3TK1 A;  3HUS A;  1KYO D;  1AJY A;  1H0T A;  5APT A;  2O3J A;  1GK6 A;  4IL6 X;  1PP9 J;  3KHU A;  3CXH E;  3OJA B;  4JBZ A;  1YIT P;  3B5N D;  4PV1 C;  4BXL A;  5BVZ A;  1EDJ A;  4TT3 H;  4RKU J;  2OTL P;  2JKV A;  2H88 C;  3H6P A;  1RE4 A;  2H89 C;  3CME P;  1DH3 A;  1HBW A;  3GLM A;  2BCC G;  1GZL A;  2H8P D;  2ZJS E;  1KYO H;  3Q3D A;  1PGP A;  3CL3 D;  3LW5 J;  3L71 G;  1VQ7 P;  4EIJ A;  2HOD B;  1AVY A;  1S5L X;  2A45 I;  4PD4 H;  1SQP G;  1SFC C;  1L0L E;  2FFD C;  3KXD A;  4L76 A;  3IAO A;  1PIX A;  1L4A C;  1VDF A;  3AE2 C;  4K3A A;  3TDK A;  3RK2 D;  2YO2 A;  3K5B A;  1RHZ B;  2IPP A;  1J1E B;  3HD7 C;  5CCG D;  1R8E A;  4W80 A;  2P2U A;  5KKZ B;  1EDL A;  1ZR2 A;  4JYC A;  1JY3 O;  1DD4 A;  3FWN A;  4EYY Q;  1FJK A;  2V7Q H;  2WPQ A;  4GOD A;  4AQR D;  2ZT9 B;  3AEF C;  5KAI H;  3CXH H;  3WUV A;  2NPS A;  3CC2 P;  1M1J B;  3HTK A;  1KC8 Q;  2WSF J;  1FZA A;  2O01 J;  3GF3 A;  4R4M A;  2V4H A;  1U7M A;  2H7H A;  2W6A A;  4IL6 E;  4H0L B;  3A3Y B;  1LWU B;  2AEM A;  1FC2 C;  4WB4 A;  4UB6 E;  3H1L E;  1WMK A;  1Q86 Q;  2KK7 A;  2QJP B;  3MUD C;  2FYU G;  2KOG A;  1KN7 A;  2NPS D;  3CCM P;  2WSC H;  1KIL E;  1BGY G;  2XU6 A;  2GA1 A;  1PPJ E;  3RK3 E;  1NTZ E;  2OYI A;  1FZC B;  1L0L K;  1KFM A;  3L73 E;  1JY2 P;  3HRN A;  3SSU A;  1GL2 B;  1T3J A;  5CCH D;  1BSN A;  4OGQ D;  1S5L E;  2FYN B;  3H1H D;  1Q7Y Q;  1YYC A;  3U59 A;  4GKG A;  3VYI A;  1MZ9 A;  1VF5 D;  4GOF A;  3V4W A;  3MP7 B;  1YHQ P;  1BGY E;  1K8A Q;  2KSJ A;  4DZO A;  1KQS O;  1SQX D;  2C9N Y;  2QRX A;  2WT7 A;  3L73 D;  3HE4 B;  1NTM G;  1LTT C;  3QWO C;  1SQV J;  4HH2 A;  2BAS A;  2Q6Q A;  4IL6 H;  3SFD C;  1GL2 C;  1S9K E;  2N9Y B;  5BU8 B;  1P84 I;  2Z4E A;  1NU1 J;  4GT1 A;  2IBZ E;  4U3F J;  2OTJ P;  2XND H;  2R5B A;  2B9B A;  1L4A A;  2RKL A;  3FXE A;  1SQQ E;  2E75 D;  2YXR B;  3PRJ A;  3CMA P;  3Q5S A;  2KB7 P;  3VP9 A;  1N73 C;  4H44 D;  1NTZ K;  3HD7 A;  1FOS F;  2JO1 A;  2WWW A;  2ZXE B;  1QVF O;  5GTH E;  1S5L H;  5KLV D;  2GUS A;  1NTK G;  1KOR A;  2N1T C;  1M1K Q;  1PV3 A;  3II6 A;  3VMX A;  1LT9 B;  3BCC G;  3B71 A;  3ABV C;  3RL0 B;  1ZRT D;  3CWB D;  3I55 P;  1DIP A;  1SQQ D;  1NU1 G;  1KD1 Q;  3L74 J;  3NTN A;  2E43 A;  5AVY B;  3IFM A;  4U3F G;  3A0B E;  3HD7 D;  1EC5 A;  2VRS A;  2KSE A;  1MFZ A;  3H1K E;  2Q7C A;  3EWK A;  3PLN A;  3PP5 A;  3Q5P A;  3VN0 A;  1VQL P;  1KB9 E;  3H1I J;  3ITK A;  1HWT C;  1JY3 P;  3BCC E;  2CPB A;  2POH A;  2WPV B;  3NXS A;  1IZN B;  1NAY A;  3W68 A;  2OYH B;  2Q1K A;  1DEE G;  1LTG C;  1L2P A;  1LT9 C;  1LTI C;  1M1J A;  2OQQ A;  5CJ4 A;  4KT0 J;  1VQP P;  1NO4 A;  3M0D C;  3TF5 A;  3L75 J;  1SQQ K;  1OWA A;  2WSE H;  3L72 D;  3H32 B;  2YMY A;  2IZ1 A;  1PZQ A;  1CZQ A;  2R5D A;  3E1R A;  3H1K D;  5GTH H;  1NKZ B;  3A5T A;  3I5C A;  1KB9 D;  1GW3 A;  1FBM A;  1NH4 A;  5AVQ B;  2QEX P;  5APS A;  4JF7 A;  4IFF A;  1CW5 A;  1BDD A;  2FYZ A;  2ZT9 D;  2K88 A;  4PJ0 E;  2J58 A;  3EQ2 A;  4DOJ A;  1BE3 E;  2FXP A;  4DJG A;  3MIW A;  2H43 A;  2LXB A;  3CPW O;  2WSS H;  5B5E E;  2YKO A;  3A0B H;  5BU5 A;  4R4L A;  1JNM A;  1M90 Q;  4JQ0 D;  3H1J G;  2Y0E A;  4ZKU A;  1JTH A;  1GL2 A;  2M0B A;  4H0L D;  5AVZ B;  1LGH B;  1KB9 H;  1S2E A;  1GTW A;  4N6J A;  1QVG O;  1L0N E;  2OTK E;  3CCV P;  1FE6 A;  4DT0 A;  3A0H E;  3TGU E;  1JO5 A;  1OVV A;  3KYQ A;  1N73 A;  2OYI B;  3AEG C;  1KIL B;  1E5W A;  3L70 D;  2PRR A;  1VQ6 P;  2NZ2 A;  1S4X A;  3RK3 B;  1G1J A;  1GL2 D;  1IJD B;  1YTZ T;  4HB1 A;  1NYH A;  2N1T A;  3EFG A;  2ZYA A;  1HGZ A;  5AW4 B;  1NAF A;  1JM0 A;  2E76 C;  1SP4 A;  1R5S A;  4GOE A;  3P7K A;  2HPC B;  3PH0 A;  1EZV I;  4PV1 B;  1WRG A;  3TGU D;  2M3B A;  2GUV A;  1HGV A;  5TIS E;  5B5E H;  2JR8 A;  3VP8 A;  4D6T D;  3LIE A;  1SQB E;  2WSC J;  1NJI Q;  3KZI E;  2WT7 B;  5AVS B;  3FGA D;  1M56 D;  2K9Y A;  3O8Z A;  4GIF A;  2XV5 A;  2I1K A;  2A45 G;  1BCC G;  3GMA A;  1KYO I;  1VL2 A;  2XDJ A;  1SFC B;  2FFD B;  1LT9 A;  3A0H H;  2JWD A;  1L4A B;  1L0N K;  1LTJ B;  4PD4 D;  4N78 E;  2P67 A;  3SFE C;  1KTM A;  1SVF A;  2KS1 B;  5AW0 B;  4I1L A;  4XFJ A;  3FWL A;  3L4F A;  1E79 H;  1X8Y A;  2A06 D;  3AE7 C;  1MUU A;  2ZYD A;  3HD7 B;  4LLH A;  3V2N A;  3VTP C;  2JJL A;  2IDB A;  1HJB A;  3O6Q B;  3AE9 C;  1G1I A;  4ZMD A;  1Y8A A;  3C8V A;  3JCU E;  1JCD A;  1YI2 P;  3C9I A;  3H1H J;  3RL0 D;  3S4R A;  2JEE A; 
#chains in the Genus database with same CATH homology
 3V6I A;  2KK7 A;  4DT0 A;  2K88 A;  3K5B A;  1L2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...