2K88A

Association of subunit d (vma6p) and e (vma4p) with g (vma10p) and the nmr solution structure of subunit g (g1-59) of the saccharomyces cerevisiae v1vo atpase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
60
structure length
60
Chain Sequence
MVSQKNGIATLLQAEKEAHEIVSKARKYRQDKLKQAKTDAAKEIDSYKIQKDKELKEFEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar proton pump subunit G
publication title Assembly of subunit d (Vma6p) and G (Vma10p) and the NMR solution structure of subunit G (G(1-59)) of the Saccharomyces cerevisiae V(1)V(O) ATPase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 22
structure length 60
sequence length 60
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2008-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.620 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces F1F0 ATP synthase subunit B, membrane domain 2k88A00
1L2PA 4DT0A 2K88A 2KK7A 3K5BA 3V6IA
chains in the Genus database with same CATH superfamily
3M0DA 4ZMDA 3CC7P 3LIDA 1BE3J 1YIJP 1X8YA 1HH0A 1AA0A 2Y0CA 1W2BO 3HE5B 1U7MA 4PJ0H 3H1IE 5KAFH 5APVA 1PGPA 2ZVNB 2Y9ZA 1FJKA 4GODA 3L70J 3RK2C 3H1LD 2Z5HA 1M1JB 1EZVI 2WSEH 1G1IA 2QRXA 1NGMB 2AXTE 1YI2P 2C0XA 3RL0g 1JEKA 2BCCG 4Y28J 4U3FE 1Q90D 2G3AA 1RE4A 1LTBC 3TK1A 2Q3IA 5BU8B 2IZ1A 2YKQA 3H25A 1AQ5A 1E79H 4N78D 1N7SA 4A7PA 3FX0A 1MV8A 1SQXJ 5GTIH 1CZQA 3CCLP 4Y99B 3S1KA 3MZWB 4O9BA 3HD7B 3KPEA 5AVTB 3GHGA 1FZBA 4R4LA 4QMAA 1SFCC 1FZAA 2B89A 3H1HD 2OYHC 4JBZA 2JEEA 3A2AA 5H2FE 1JMBA 4BRYB 3KQGA 2BEQD 1OW6A 2R5BA 5AVQB 1NVOA 2M0BA 4H0LB 3VP9A 4PD4E 2FYUK 1YITP 1K05A 2N1TA 1GW4A 4WWIA 3BCCD 2QSIA 1NKZB 4HH2A 5APTA 1LTJB 1MUUA 1FU1A 4WB4A 2O01N 3HUSC 2KB7P 2V7QH 3AE3C 1FOSF 1GDTA 2BCCJ 1R5LA 2YKOA 4WVZA 1X9VA 1Y47A 2FXPA 2QM8A 1JB0J 5AW8B 1IO4A 3RK3B 2E74B 1J1EB 2IBZI 2J58A 3A0HE 1E5WA 3L73G 1SQXD 1UIIA 3SWYA 4DJGA 1HVVA 4MN4C 1SFCA 2IFMA 1L0LD 4AQRD 4ASWA 3QWOC 4ZKUA 1D7MA 2OYHA 2IBZD 3S4RA 1FAVA 2YIUB 3TGUD 1VQNP 2PRRA 3IF4A 3V4QA 2SPZA 1SQPE 5KAFE 2Q6QA 1GL2C 5CBNA 3P8MC 3RBXA 1PV3A 3RK3E 2WT7B 3KXDA 4TT3H 4H13D 2O3JA 1JCDA 2Y0EA 2CPBA 3HUSA 4L76A 1S4XA 5KJ7D 1AVYA 3L35A 1IFIA 2FKWB 2PFXA 4UB6E 3HD7D 3VYIA 3C8VA 4IL6H 1JY3O 4OVNF 1NU1D 4TLFA 1EXJA 1N86A 1JM0A 2XU6A 2E5YA 1EQ7A 4W80A 1KQLA 4WBAA 3AEDC 3B4SA 3VOPA 3H32A 4JQ0D 1YBKA 2K9JA 3L73J 2KSEA 4GKGA 1BCCG 1NTZG 5AW3B 1OWAA 1JO5A 2QJKC 2YO2A 3AE8C 2R3SA 2OTLP 2XV5A 3M0AA 3H6PA 3KZIE 1J2JB 4ZKPA 3D6YA 2Z4EA 1ZP0C 1GW3A 5GTHE 1GL2A 3UIAA 1UIXA 4KHXA 5KKZB 1G1JA 1PPJG 3CXHI 4W7ZA 3II6A 2QG4A 2E74D 2I1JA 4PV1C 1GK4A 5TISE 1ZOYC 1QLED 4WY4D 1GZLA 5KLVG 3GG2A 1RH5B 1JY2O 3H1KE 1RF1C 1S1CX 4HJGH 2E5TA 1URQB 1GTWA 1YHQP 2KK7A 2OGUA 1H0TB 3WU2H 1ZR4A 1H89A 1LTAC 5BVZA 1Y8AA 2WSCH 1SP4A 3L73D 1SLQA 1SQVG 3VP8A 1BCCJ 3BASA 4JYBA 1NTZJ 1LGHB 2NPSA 4AYCA 2M3EA 3L75E 4H44B 1NTKE 2OTKE 2KP8A 2QJYC 1VQ5P 2FYUD 1EDIA 5AVVB 1PGOA 2GA1A 3AE5C 2FBWC 3H1JG 1FZGA 3TF5A 2CK3H 3B5NC 1ZMEC 1NO4A 1L4AC 3NXSA 1LWUC 5E79E 1IK7A 3MP7B 4N3YB 1KB9I 3RL0C 2QJPB 2I8DA 2W6BA 1CI6B 2FYNC 1GU4A 1EC5A 3T97A 5CCGC 4L75A 3CCSP 1RF1A 4DCKA 3VMZA 1SQQE 3CC4P 5KLVJ 2FFDC 1KN7A 1WRGA 1IFNA 1JUNA 1Q81Q 3R4YA 1YQ4C 1RF0C 3CI9A 1BGYD 1ZLLA 2A06D 1ZV8A 3U1CA 1ZR2A 1NJIQ 2VRSA 2W27A 1KILC 3P8CE 3WUUA 2OYOA 1NH4A 1P84I 3L74E 2IZ0A 2HODB 1SQVJ 1NTZD 1FZFA 5DJTB 1X79B 2R44A 2Y9YA 3I5CA 3PJSK 4C7RA 4HYTB 2RH0A 1SQXK 1T3JA 1L4AA 1NTMG 3H1JJ 5C39A 1L0LK 1FZCB 2E76C 3M9BA 4NPFX 1LP1B 1PPJD 3I56P 1URQD 4K3AA 1S9KD 2W83C 1G2CA 5AW6B 2P1JA 1J1DC 2ZYDA 1YTZT 3H1LE 3N4XA 3SSUA 3CMAP 1IFDA 4GT1A 1YJWP 3HE5A 3U59A 5AVZB 4KJMA 3CL3D 5AVSB 4H0LC 4XA4A 2JKVA 3VMAA 1RF0A 2BEZF 3H1IG 3WU2E 3VMYA 3F5HA 1N73B 4OGQC 1S3JA 1PP9D 3L37A 4ASVA 1KD1Q 5APQA 1SQBG 1TU3F 3BRVB 4N78E 1LTSC 2V4HA 3L71G 4U3FG 4I1LA 1SQVD 1N7SC 1MKMA 2ZXEB 1M8OB 2C9LY 2OYIB 3B8EB 4K35A 3H1HE 1T3UA 1EDLA 3Q3DA 3CWBG 5CBOA 2KLUA 3HE4B 3M9HA 3HTKB 2YO3A 5AVXB 3H1JD 1VQOP 1NTMJ 1M1KQ 1Q82Q 1EDKA 1YJ9P 3BCCE 1KYOD 1FE6A 2ZT9C 2N1TC 2PP6A 5AW1B 1FS0E 2D2CC 3CXHH 3O8ZA 2WSSH 1IZNB 3C1LA 3H1IJ 3MGNA 4I7ZB 2AXCA 1EZVD 4H13B 1SQBJ 3FXEA 1RQUA 1SQXE 1OW7A 2QEXP 2KS1B 1VQMP 3L71J 4U3FJ 1L0LE 3A0BE 1NWQA 3AEBC 5B66H 2W90A 2W6JH 2IBZE 2IPPA 3PTZA 3G4SP 1SVFA 3TGUE 2E75C 5AW4B 2K3RA 2WPVB 2P2UA 3A3YB 3CWBJ 5APXA 2CPSA 3O6QB 1YQ3C 4JPZB 1BE3D 1VQ7P 4YPCA 5AVYB 4AUWA 3L70D 3WMM0 1IC2A 2XZRA 5CJ0A 2WT7A 1MZ9A 3PH0A 1VF5C 1SQPG 1GK6A 1AQTA 3EQ2A 1NU1E 4I6MC 1JTHA 1SQBD 3CMEP 1FDOA 1VL2A 4WY4B 3L71D 1FZEA 1LNQA 2ZFCA 3B5ND 4HB1A 4C7NB 5B5EH 1R8EA 3PRJA 3CWBD 3GF3A 3RL0D 3GHGB 1P84H 1USEA 4CPGA 3E1IA 5CCGD 1NTZK 4H44C 4PJ0E 3KYQA 3SFDC 3GMAA 2K1AA 4Z1MH 4PD4I 4UB8H 1KTMA 3RK2B 4BWNA 1T8ZA 1KILD 5AW2B 2GM4A 2BCCD 1SQPJ 1LTTC 1HBWA 1FJPA 4L74A 3AE4C 2L91A 2H43A 5APUA 1N7LA 3B71A 2HFED 2ZYAA 4RO0A 1Y9BA 2KUBA 3L73E 2POHA 3TNUA 3MIWA 1H0TA 1K9MQ 2HPCB 5GTIE 2G8YA 5KLVK 2E42A 5B66E 3H1KG 2JJLA 2WSFJ 1NYHA 5CMZA 3GLMA 2P7JA 5AVUB 2E76D 1T6AA 2FYUE 2H89C 2WQYC 3S9OA 2NPSC 3CCJP 4YXWH 3CD6P 1SFCB 3Q5RA 5KTBA 2RN0A 1H88A 2FXMA 3JCUH 4GOEA 4IOIH 2OYHB 1SQVK 1QX8A 2Q7CA 1PZQA 1VQ6P 3L75G 1JOCA 1NTKG 1KMIZ 2OTJP 1OZHA 1BDCA 1KYOH 5KLIC 3CCUP 3CCVP 3AE2C 3RBZA 3CXHD 4OWFA 3HUSB 2O1JA 1N7SD 1HJ0A 1BGYE 2A06E 1OMIA 5AW7B 3BRTB 4B86A 4LGDE 4EDFA 4BXLA 2C9NY 2O01J 1NKNA 1KFMA 2K88A 2R5DA 3TDKA 2XKMA 1NTZE 1SQQG 1LT9C 1PGJA 1L0NG 2ZJSE 4YTPC 3H1KJ 3H32B 2K9JB 2NZ2A 3ITKA 3CX5I 3M9QA 1CSBA 2NRGA 3AE9C 3V2RA 5EFWB 3RK2D 3AE6C 3L74G 2N1TD 3C9IA 1T2KC 3L4FA 2D2CD 2YXRB 3D6ZA 1PPJE 2AEJA 3CX5D 3D70A 1AV1A 1S9KE 1XTGB 3L75J 1ZRTD 1GL2B 1NTKJ 1NAFA 1K8AQ 3OJAB 1Q2NA 1BDDA 5AW9B 3NTNA 2UWJE 4DZOA 4DT0A 1U7JA 3RGUA 2HLOA 1NTMK 2A45G 1LTGC 5K5GB 2KXPB 4IL6E 2P58A 1PP9E 1KB9D 1M1JC 3H1LG 4D6TG 2YNYA 1VQKP 1OX3A 5BU5A 3QH9A 1SFCD 2E75D 3E1RA 4L73A 3D71A 1KORA 1ZN5A 1LT9A 3G9RA 1IJDB 1SQVE 5AVWB 3ABVC 2LXCB 2JWDA 3L72G 1SQQJ 1BCCD 2JWAA 1QVFO 1WMKA 1L0NJ 2JR8A 1SQBK 1S5LX 3IAOA 3WUVA 2QJKB 3IN6A 3JCUE 3KHUA 2OYIA 3NMDA 4EOTA 4Y99C 1P84D 3H1JE 2W6AA 3HD7C 3L74J 1JCCA 3Q5PA 2KIKA 1OXZA 4EI2A 1VF5D 5CCHC 1A02F 1YJNP 2HG5D 1PFIA 1KYOE 1ZXGA 1YTZI 2HYNA 2QIWA 4PV1B 1DX7A 2K37A 4JYCA 3PLNA 1FDMA 3G71P 1M1JA 3BATA 5KLVD 1VQ9P 4RESB 3T97B 3M06A 3JSVC 1HGVA 3AE1C 4PD4H 1SS1A 1RF1B 1A02J 3BCCG 1EZVE 1LTJC 3H1LJ 3CCRP 4D6TJ 2MKVA 2FY8A 2C0WA 2JO1A 1OFCX 3G6EP 2KI7B 2WZ7A 3AEGC 2WPSA 2M5AB 1JNMA 4N6JA 1L0ND 1N2DC 3L72J 2P10A 2Y0DA 3GF7A 2IYOA 3RK3C 4KT0J 2E74C 4GDOA 1J1EC 5AW5B 5KJ7A 1VQ8P 1GL2D 2KS1A 2IX7C 3FXDA 3ZDMA 4EYYQ 3NFQA 2QJYB 3HD7A 3A0HH 3PHLA 5CCHA 1BE3E 2A45I 1L0LG 3AEAC 5L8RJ 1NOHA 3B5NB 2ITAA 2YIUC 1HTLC 3O6QA 1L4AB 3L70E 3TGUG 2KNCB 1LWUB 1IFPA 2B87B 4BRYA 4M3LA 2WVRA 4GIFA 4JF7A 3RL0B 1KFNA 2YMYA 1KZUB 2FYNB 3Q5SA 2B9BA 2KLVA 1RE3A 2MJZA 2WPRA 2KSJA 1LTJA 1NHLA 3AE7C 3JC22 2FFDB 4D6TD 1SQBE 2QM7A 3BCCJ 2NPSD 3L71E 4IFDK 1SQPK 5TJHA 3V5BA 1GU5A 1KILB 3MUDC 2WSFH 3L72D 4UB6H 1K04A 1NU1G 2KZIA 4WY4A 1CW5A 2IYPA 3CWBE 4C7NA 4NPDA 1M56D 4PV1D 3W68A 1NTMD 3G3ZA 1L0LJ 2JDIH 3CX5H 3P32A 3F89A 2WTYA 1HUCA 2M8RA 2E76B 3TGUJ 4ZNCA 3KZIH 1J1DB 5APYA 1DEBA 3SFEC 1KILE 5KKZC 1OVUA 4I2LC 2BCCE 5GTHH 3VMXA 3N7NA 5M1BA 1OVRA 3CCQP 2QVAA 1DEEG 2ZAEB 3CC2P 1WT6A 2WITA 3FWLA 1AJYA 3H1ID 1KB9H 2R3CA 3L36A 2J5UA 3HRNA 4IFMA 4U7JA 4W7YA 3TYYA 4OGQB 2B88A 2O01H 5TISH 2Z5IA 4C46A 2H88C 2PGDA 3MUDA 3KDPB 4OH8B 2QA4P 1URQC 3VTPC 1EDJA 2R32A 3LW5J 4U3FD 1KQSO 1Q86Q 1T2KD 1FOSE 1JMMA 1N7SB 2GUVA 2HPCA 1NU1J 3V2PA 1L4AD 2BASA 3K5BA 2Q5UA 3IFMA 1LT1A 2LKMA 2RKLA 1DD4A 5CHXA 4IFFA 2AEMA 2FYUG 1R5SA 1VQPP 1JY3N 1U57A 2ZT9B 2N1TB 2RMZA 3U1AA 3CXHE 2I1KA 1W5CE 1VDFA 2D2CB 4XE5B 3FWNA 1NTKK 2QJPC 5E79H 3E7KA 2YMKA 1OVVA 1S2EA 4PD4D 1MFZA 4LLHA 2WSEJ 1URQA 1JTHB 4RKUJ 1IFMA 2WMMA 1M90Q 1BGYG 2A06G 5CCHD 1EXIA 1VQLP 3PP5A 2E75B 2L5GB 4DOJA 2QE7H 1S5LH 1SQQK 3OA7A 1S72P 1L0NK 1NAYA 2XNXA 3CX5E 3MD0A 4H0LD 4HKZH 2XNDH 3OAKA 1ZRTE 1USDA 2KZJA 2E43A 1DH3A 2FYUJ 1JY2N 3M91A 1LTIC 2KOGA 4OGQD 1BSHA 1IK9A 1FC2C 2A45H 1FZCC 4NPEA 3IR9A 1SQPD 2FYZA 5DJUB 3V4WA 5CJ4A 1H8AA 1CI6A 1VF5B 1KB9E 5KAIH 2W8ZA 3RK3D 4R4MA 1QEXA 3A7OA 2Q9IA 3SWKA 1PL5A 2V7QJ 1L2PA 3V2QA 1BCCE 1RHZB 2H7HA 2LXBA 2JP3A 1N73C 1KQGB 5AVRB 5B5EE 2M3BA 2HR3A 3TNUB 1PP9G 1X22A 1KC8Q 1BGYJ 2ZYGA 1XTCC 5AW0B 4GOFA 2HODA 3I55P 4EIJA 3GW6A 1P84E 3V6IA 2KYVA 2ZT9D 2OYIC 3P7KA 1JY3P 4YXDC 4LC1A 1M7LA 1AFOA 1HJBA 2WPQA 1FDIA 1Q7YQ 3TSIA 4UB8E 3WUTA 1FZCA 1LP1A 2OARA 2DW3A 5KLVE 1GMJA 3USSA 1AVOA 1QL1A 1PIXA 1BSNA 1HGZA 1M57D 3Q2YA 3FGAD 3EFGA 4IL6X 1N73A 2AXTH 3CLQA 2GUSA 1L0NE 2IDBA 3H1KD 1MFTA 2Q1KA 4I7ZC 4H13C 1PP9J 2Q3EA 1EZVG 2N9BA 2M5AA 2AEFA 1ZW0A 5KJ7C 1S5LE 2NPSB 5APSA 1JY2P 2YKPA 1GD2E 3SWFA 1VPCA 1DD3A 2O1KA 2YXQB 3A0BH 3EWKA 3BVHA 3EFFK 1KV4A 2XDJA 3HE4A 3HTKA 3L75D 3MHVA 3H1HG 1QVGO 1NTKD 3AECC 3B5NA 2PAJA 3R2PA 3A5TA 5KLIB 2KNCA 1LWUA 3CCEP 2B87A 1BE3G 1RY3A 5H2FH 2K9YA 2H8PD 5KAIE 3M0DC 1HF9A 2P67A 3L70G 4D6TE 1RE3C 5CCGA 2J59M 1Z56A 2LR2A 1YYCA 2FFDA 1OW8A 3LIEA 3L72E 3LW5H 1K73Q 1SQQD 1VQ4P 5APWA 1FBMA 1LT9B 2ZXXA 4H44D 3OW2O 1X0TA 1QL2A 1RE4C 1HWTC 1KILA 1LJ2A 3CPWO 3AEEC 3W67A 1PGQA 2WSCJ 3Q1MA 4WY4C 3VN0A 1SQXG 3CCMP 3P8CD 1NTME 4XFJA 2IFNA 1IFJA 3L74D 1DIPA 1RQVA 1QGKB 1NU1K 2OQQA 2FXOA 3V2NA 1KQFB 2WWWA 2IBZG 1N8RQ 3MTUE 3GHGC 3H1HJ 1OIPA 4RJTA 3AEFC 1KYOI 2N9YB 1W2EA 2ZVOB 1G2CB
chains in the Genus database with same CATH topology
1L2PA 4DT0A 2K88A 2KK7A 3K5BA 3V6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2P A;  4DT0 A;  2K88 A;  2KK7 A;  3K5B A;  3V6I A; 
#chains in the Genus database with same CATH topology
 3M0D A;  4ZMD A;  3CC7 P;  3LID A;  1BE3 J;  1YIJ P;  1X8Y A;  1HH0 A;  1AA0 A;  2Y0C A;  1W2B O;  3HE5 B;  1U7M A;  4PJ0 H;  3H1I E;  5KAF H;  5APV A;  1PGP A;  2ZVN B;  2Y9Z A;  1FJK A;  4GOD A;  3L70 J;  3RK2 C;  3H1L D;  2Z5H A;  1M1J B;  1EZV I;  2WSE H;  1G1I A;  2QRX A;  1NGM B;  2AXT E;  1YI2 P;  2C0X A;  3RL0 g;  1JEK A;  2BCC G;  4Y28 J;  4U3F E;  1Q90 D;  2G3A A;  1RE4 A;  1LTB C;  3TK1 A;  2Q3I A;  5BU8 B;  2IZ1 A;  2YKQ A;  3H25 A;  1AQ5 A;  1E79 H;  4N78 D;  1N7S A;  4A7P A;  3FX0 A;  1MV8 A;  1SQX J;  5GTI H;  1CZQ A;  3CCL P;  4Y99 B;  3S1K A;  3MZW B;  4O9B A;  3HD7 B;  3KPE A;  5AVT B;  3GHG A;  1FZB A;  4R4L A;  4QMA A;  1SFC C;  1FZA A;  2B89 A;  3H1H D;  2OYH C;  4JBZ A;  2JEE A;  3A2A A;  5H2F E;  1JMB A;  4BRY B;  3KQG A;  2BEQ D;  1OW6 A;  2R5B A;  5AVQ B;  1NVO A;  2M0B A;  4H0L B;  3VP9 A;  4PD4 E;  2FYU K;  1YIT P;  1K05 A;  2N1T A;  1GW4 A;  4WWI A;  3BCC D;  2QSI A;  1NKZ B;  4HH2 A;  5APT A;  1LTJ B;  1MUU A;  1FU1 A;  4WB4 A;  2O01 N;  3HUS C;  2KB7 P;  2V7Q H;  3AE3 C;  1FOS F;  1GDT A;  2BCC J;  1R5L A;  2YKO A;  4WVZ A;  1X9V A;  1Y47 A;  2FXP A;  2QM8 A;  1JB0 J;  5AW8 B;  1IO4 A;  3RK3 B;  2E74 B;  1J1E B;  2IBZ I;  2J58 A;  3A0H E;  1E5W A;  3L73 G;  1SQX D;  1UII A;  3SWY A;  4DJG A;  1HVV A;  4MN4 C;  1SFC A;  2IFM A;  1L0L D;  4AQR D;  4ASW A;  3QWO C;  4ZKU A;  1D7M A;  2OYH A;  2IBZ D;  3S4R A;  1FAV A;  2YIU B;  3TGU D;  1VQN P;  2PRR A;  3IF4 A;  3V4Q A;  2SPZ A;  1SQP E;  5KAF E;  2Q6Q A;  1GL2 C;  5CBN A;  3P8M C;  3RBX A;  1PV3 A;  3RK3 E;  2WT7 B;  3KXD A;  4TT3 H;  4H13 D;  2O3J A;  1JCD A;  2Y0E A;  2CPB A;  3HUS A;  4L76 A;  1S4X A;  5KJ7 D;  1AVY A;  3L35 A;  1IFI A;  2FKW B;  2PFX A;  4UB6 E;  3HD7 D;  3VYI A;  3C8V A;  4IL6 H;  1JY3 O;  4OVN F;  1NU1 D;  4TLF A;  1EXJ A;  1N86 A;  1JM0 A;  2XU6 A;  2E5Y A;  1EQ7 A;  4W80 A;  1KQL A;  4WBA A;  3AED C;  3B4S A;  3VOP A;  3H32 A;  4JQ0 D;  1YBK A;  2K9J A;  3L73 J;  2KSE A;  4GKG A;  1BCC G;  1NTZ G;  5AW3 B;  1OWA A;  1JO5 A;  2QJK C;  2YO2 A;  3AE8 C;  2R3S A;  2OTL P;  2XV5 A;  3M0A A;  3H6P A;  3KZI E;  1J2J B;  4ZKP A;  3D6Y A;  2Z4E A;  1ZP0 C;  1GW3 A;  5GTH E;  1GL2 A;  3UIA A;  1UIX A;  4KHX A;  5KKZ B;  1G1J A;  1PPJ G;  3CXH I;  4W7Z A;  3II6 A;  2QG4 A;  2E74 D;  2I1J A;  4PV1 C;  1GK4 A;  5TIS E;  1ZOY C;  1QLE D;  4WY4 D;  1GZL A;  5KLV G;  3GG2 A;  1RH5 B;  1JY2 O;  3H1K E;  1RF1 C;  1S1C X;  4HJG H;  2E5T A;  1URQ B;  1GTW A;  1YHQ P;  2KK7 A;  2OGU A;  1H0T B;  3WU2 H;  1ZR4 A;  1H89 A;  1LTA C;  5BVZ A;  1Y8A A;  2WSC H;  1SP4 A;  3L73 D;  1SLQ A;  1SQV G;  3VP8 A;  1BCC J;  3BAS A;  4JYB A;  1NTZ J;  1LGH B;  2NPS A;  4AYC A;  2M3E A;  3L75 E;  4H44 B;  1NTK E;  2OTK E;  2KP8 A;  2QJY C;  1VQ5 P;  2FYU D;  1EDI A;  5AVV B;  1PGO A;  2GA1 A;  3AE5 C;  2FBW C;  3H1J G;  1FZG A;  3TF5 A;  2CK3 H;  3B5N C;  1ZME C;  1NO4 A;  1L4A C;  3NXS A;  1LWU C;  5E79 E;  1IK7 A;  3MP7 B;  4N3Y B;  1KB9 I;  3RL0 C;  2QJP B;  2I8D A;  2W6B A;  1CI6 B;  2FYN C;  1GU4 A;  1EC5 A;  3T97 A;  5CCG C;  4L75 A;  3CCS P;  1RF1 A;  4DCK A;  3VMZ A;  1SQQ E;  3CC4 P;  5KLV J;  2FFD C;  1KN7 A;  1WRG A;  1IFN A;  1JUN A;  1Q81 Q;  3R4Y A;  1YQ4 C;  1RF0 C;  3CI9 A;  1BGY D;  1ZLL A;  2A06 D;  1ZV8 A;  3U1C A;  1ZR2 A;  1NJI Q;  2VRS A;  2W27 A;  1KIL C;  3P8C E;  3WUU A;  2OYO A;  1NH4 A;  1P84 I;  3L74 E;  2IZ0 A;  2HOD B;  1SQV J;  1NTZ D;  1FZF A;  5DJT B;  1X79 B;  2R44 A;  2Y9Y A;  3I5C A;  3PJS K;  4C7R A;  4HYT B;  2RH0 A;  1SQX K;  1T3J A;  1L4A A;  1NTM G;  3H1J J;  5C39 A;  1L0L K;  1FZC B;  2E76 C;  3M9B A;  4NPF X;  1LP1 B;  1PPJ D;  3I56 P;  1URQ D;  4K3A A;  1S9K D;  2W83 C;  1G2C A;  5AW6 B;  2P1J A;  1J1D C;  2ZYD A;  1YTZ T;  3H1L E;  3N4X A;  3SSU A;  3CMA P;  1IFD A;  4GT1 A;  1YJW P;  3HE5 A;  3U59 A;  5AVZ B;  4KJM A;  3CL3 D;  5AVS B;  4H0L C;  4XA4 A;  2JKV A;  3VMA A;  1RF0 A;  2BEZ F;  3H1I G;  3WU2 E;  3VMY A;  3F5H A;  1N73 B;  4OGQ C;  1S3J A;  1PP9 D;  3L37 A;  4ASV A;  1KD1 Q;  5APQ A;  1SQB G;  1TU3 F;  3BRV B;  4N78 E;  1LTS C;  2V4H A;  3L71 G;  4U3F G;  4I1L A;  1SQV D;  1N7S C;  1MKM A;  2ZXE B;  1M8O B;  2C9L Y;  2OYI B;  3B8E B;  4K35 A;  3H1H E;  1T3U A;  1EDL A;  3Q3D A;  3CWB G;  5CBO A;  2KLU A;  3HE4 B;  3M9H A;  3HTK B;  2YO3 A;  5AVX B;  3H1J D;  1VQO P;  1NTM J;  1M1K Q;  1Q82 Q;  1EDK A;  1YJ9 P;  3BCC E;  1KYO D;  1FE6 A;  2ZT9 C;  2N1T C;  2PP6 A;  5AW1 B;  1FS0 E;  2D2C C;  3CXH H;  3O8Z A;  2WSS H;  1IZN B;  3C1L A;  3H1I J;  3MGN A;  4I7Z B;  2AXC A;  1EZV D;  4H13 B;  1SQB J;  3FXE A;  1RQU A;  1SQX E;  1OW7 A;  2QEX P;  2KS1 B;  1VQM P;  3L71 J;  4U3F J;  1L0L E;  3A0B E;  1NWQ A;  3AEB C;  5B66 H;  2W90 A;  2W6J H;  2IBZ E;  2IPP A;  3PTZ A;  3G4S P;  1SVF A;  3TGU E;  2E75 C;  5AW4 B;  2K3R A;  2WPV B;  2P2U A;  3A3Y B;  3CWB J;  5APX A;  2CPS A;  3O6Q B;  1YQ3 C;  4JPZ B;  1BE3 D;  1VQ7 P;  4YPC A;  5AVY B;  4AUW A;  3L70 D;  3WMM 0;  1IC2 A;  2XZR A;  5CJ0 A;  2WT7 A;  1MZ9 A;  3PH0 A;  1VF5 C;  1SQP G;  1GK6 A;  1AQT A;  3EQ2 A;  1NU1 E;  4I6M C;  1JTH A;  1SQB D;  3CME P;  1FDO A;  1VL2 A;  4WY4 B;  3L71 D;  1FZE A;  1LNQ A;  2ZFC A;  3B5N D;  4HB1 A;  4C7N B;  5B5E H;  1R8E A;  3PRJ A;  3CWB D;  3GF3 A;  3RL0 D;  3GHG B;  1P84 H;  1USE A;  4CPG A;  3E1I A;  5CCG D;  1NTZ K;  4H44 C;  4PJ0 E;  3KYQ A;  3SFD C;  3GMA A;  2K1A A;  4Z1M H;  4PD4 I;  4UB8 H;  1KTM A;  3RK2 B;  4BWN A;  1T8Z A;  1KIL D;  5AW2 B;  2GM4 A;  2BCC D;  1SQP J;  1LTT C;  1HBW A;  1FJP A;  4L74 A;  3AE4 C;  2L91 A;  2H43 A;  5APU A;  1N7L A;  3B71 A;  2HFE D;  2ZYA A;  4RO0 A;  1Y9B A;  2KUB A;  3L73 E;  2POH A;  3TNU A;  3MIW A;  1H0T A;  1K9M Q;  2HPC B;  5GTI E;  2G8Y A;  5KLV K;  2E42 A;  5B66 E;  3H1K G;  2JJL A;  2WSF J;  1NYH A;  5CMZ A;  3GLM A;  2P7J A;  5AVU B;  2E76 D;  1T6A A;  2FYU E;  2H89 C;  2WQY C;  3S9O A;  2NPS C;  3CCJ P;  4YXW H;  3CD6 P;  1SFC B;  3Q5R A;  5KTB A;  2RN0 A;  1H88 A;  2FXM A;  3JCU H;  4GOE A;  4IOI H;  2OYH B;  1SQV K;  1QX8 A;  2Q7C A;  1PZQ A;  1VQ6 P;  3L75 G;  1JOC A;  1NTK G;  1KMI Z;  2OTJ P;  1OZH A;  1BDC A;  1KYO H;  5KLI C;  3CCU P;  3CCV P;  3AE2 C;  3RBZ A;  3CXH D;  4OWF A;  3HUS B;  2O1J A;  1N7S D;  1HJ0 A;  1BGY E;  2A06 E;  1OMI A;  5AW7 B;  3BRT B;  4B86 A;  4LGD E;  4EDF A;  4BXL A;  2C9N Y;  2O01 J;  1NKN A;  1KFM A;  2K88 A;  2R5D A;  3TDK A;  2XKM A;  1NTZ E;  1SQQ G;  1LT9 C;  1PGJ A;  1L0N G;  2ZJS E;  4YTP C;  3H1K J;  3H32 B;  2K9J B;  2NZ2 A;  3ITK A;  3CX5 I;  3M9Q A;  1CSB A;  2NRG A;  3AE9 C;  3V2R A;  5EFW B;  3RK2 D;  3AE6 C;  3L74 G;  2N1T D;  3C9I A;  1T2K C;  3L4F A;  2D2C D;  2YXR B;  3D6Z A;  1PPJ E;  2AEJ A;  3CX5 D;  3D70 A;  1AV1 A;  1S9K E;  1XTG B;  3L75 J;  1ZRT D;  1GL2 B;  1NTK J;  1NAF A;  1K8A Q;  3OJA B;  1Q2N A;  1BDD A;  5AW9 B;  3NTN A;  2UWJ E;  4DZO A;  4DT0 A;  1U7J A;  3RGU A;  2HLO A;  1NTM K;  2A45 G;  1LTG C;  5K5G B;  2KXP B;  4IL6 E;  2P58 A;  1PP9 E;  1KB9 D;  1M1J C;  3H1L G;  4D6T G;  2YNY A;  1VQK P;  1OX3 A;  5BU5 A;  3QH9 A;  1SFC D;  2E75 D;  3E1R A;  4L73 A;  3D71 A;  1KOR A;  1ZN5 A;  1LT9 A;  3G9R A;  1IJD B;  1SQV E;  5AVW B;  3ABV C;  2LXC B;  2JWD A;  3L72 G;  1SQQ J;  1BCC D;  2JWA A;  1QVF O;  1WMK A;  1L0N J;  2JR8 A;  1SQB K;  1S5L X;  3IAO A;  3WUV A;  2QJK B;  3IN6 A;  3JCU E;  3KHU A;  2OYI A;  3NMD A;  4EOT A;  4Y99 C;  1P84 D;  3H1J E;  2W6A A;  3HD7 C;  3L74 J;  1JCC A;  3Q5P A;  2KIK A;  1OXZ A;  4EI2 A;  1VF5 D;  5CCH C;  1A02 F;  1YJN P;  2HG5 D;  1PFI A;  1KYO E;  1ZXG A;  1YTZ I;  2HYN A;  2QIW A;  4PV1 B;  1DX7 A;  2K37 A;  4JYC A;  3PLN A;  1FDM A;  3G71 P;  1M1J A;  3BAT A;  5KLV D;  1VQ9 P;  4RES B;  3T97 B;  3M06 A;  3JSV C;  1HGV A;  3AE1 C;  4PD4 H;  1SS1 A;  1RF1 B;  1A02 J;  3BCC G;  1EZV E;  1LTJ C;  3H1L J;  3CCR P;  4D6T J;  2MKV A;  2FY8 A;  2C0W A;  2JO1 A;  1OFC X;  3G6E P;  2KI7 B;  2WZ7 A;  3AEG C;  2WPS A;  2M5A B;  1JNM A;  4N6J A;  1L0N D;  1N2D C;  3L72 J;  2P10 A;  2Y0D A;  3GF7 A;  2IYO A;  3RK3 C;  4KT0 J;  2E74 C;  4GDO A;  1J1E C;  5AW5 B;  5KJ7 A;  1VQ8 P;  1GL2 D;  2KS1 A;  2IX7 C;  3FXD A;  3ZDM A;  4EYY Q;  3NFQ A;  2QJY B;  3HD7 A;  3A0H H;  3PHL A;  5CCH A;  1BE3 E;  2A45 I;  1L0L G;  3AEA C;  5L8R J;  1NOH A;  3B5N B;  2ITA A;  2YIU C;  1HTL C;  3O6Q A;  1L4A B;  3L70 E;  3TGU G;  2KNC B;  1LWU B;  1IFP A;  2B87 B;  4BRY A;  4M3L A;  2WVR A;  4GIF A;  4JF7 A;  3RL0 B;  1KFN A;  2YMY A;  1KZU B;  2FYN B;  3Q5S A;  2B9B A;  2KLV A;  1RE3 A;  2MJZ A;  2WPR A;  2KSJ A;  1LTJ A;  1NHL A;  3AE7 C;  3JC2 2;  2FFD B;  4D6T D;  1SQB E;  2QM7 A;  3BCC J;  2NPS D;  3L71 E;  4IFD K;  1SQP K;  5TJH A;  3V5B A;  1GU5 A;  1KIL B;  3MUD C;  2WSF H;  3L72 D;  4UB6 H;  1K04 A;  1NU1 G;  2KZI A;  4WY4 A;  1CW5 A;  2IYP A;  3CWB E;  4C7N A;  4NPD A;  1M56 D;  4PV1 D;  3W68 A;  1NTM D;  3G3Z A;  1L0L J;  2JDI H;  3CX5 H;  3P32 A;  3F89 A;  2WTY A;  1HUC A;  2M8R A;  2E76 B;  3TGU J;  4ZNC A;  3KZI H;  1J1D B;  5APY A;  1DEB A;  3SFE C;  1KIL E;  5KKZ C;  1OVU A;  4I2L C;  2BCC E;  5GTH H;  3VMX A;  3N7N A;  5M1B A;  1OVR A;  3CCQ P;  2QVA A;  1DEE G;  2ZAE B;  3CC2 P;  1WT6 A;  2WIT A;  3FWL A;  1AJY A;  3H1I D;  1KB9 H;  2R3C A;  3L36 A;  2J5U A;  3HRN A;  4IFM A;  4U7J A;  4W7Y A;  3TYY A;  4OGQ B;  2B88 A;  2O01 H;  5TIS H;  2Z5I A;  4C46 A;  2H88 C;  2PGD A;  3MUD A;  3KDP B;  4OH8 B;  2QA4 P;  1URQ C;  3VTP C;  1EDJ A;  2R32 A;  3LW5 J;  4U3F D;  1KQS O;  1Q86 Q;  1T2K D;  1FOS E;  1JMM A;  1N7S B;  2GUV A;  2HPC A;  1NU1 J;  3V2P A;  1L4A D;  2BAS A;  3K5B A;  2Q5U A;  3IFM A;  1LT1 A;  2LKM A;  2RKL A;  1DD4 A;  5CHX A;  4IFF A;  2AEM A;  2FYU G;  1R5S A;  1VQP P;  1JY3 N;  1U57 A;  2ZT9 B;  2N1T B;  2RMZ A;  3U1A A;  3CXH E;  2I1K A;  1W5C E;  1VDF A;  2D2C B;  4XE5 B;  3FWN A;  1NTK K;  2QJP C;  5E79 H;  3E7K A;  2YMK A;  1OVV A;  1S2E A;  4PD4 D;  1MFZ A;  4LLH A;  2WSE J;  1URQ A;  1JTH B;  4RKU J;  1IFM A;  2WMM A;  1M90 Q;  1BGY G;  2A06 G;  5CCH D;  1EXI A;  1VQL P;  3PP5 A;  2E75 B;  2L5G B;  4DOJ A;  2QE7 H;  1S5L H;  1SQQ K;  3OA7 A;  1S72 P;  1L0N K;  1NAY A;  2XNX A;  3CX5 E;  3MD0 A;  4H0L D;  4HKZ H;  2XND H;  3OAK A;  1ZRT E;  1USD A;  2KZJ A;  2E43 A;  1DH3 A;  2FYU J;  1JY2 N;  3M91 A;  1LTI C;  2KOG A;  4OGQ D;  1BSH A;  1IK9 A;  1FC2 C;  2A45 H;  1FZC C;  4NPE A;  3IR9 A;  1SQP D;  2FYZ A;  5DJU B;  3V4W A;  5CJ4 A;  1H8A A;  1CI6 A;  1VF5 B;  1KB9 E;  5KAI H;  2W8Z A;  3RK3 D;  4R4M A;  1QEX A;  3A7O A;  2Q9I A;  3SWK A;  1PL5 A;  2V7Q J;  1L2P A;  3V2Q A;  1BCC E;  1RHZ B;  2H7H A;  2LXB A;  2JP3 A;  1N73 C;  1KQG B;  5AVR B;  5B5E E;  2M3B A;  2HR3 A;  3TNU B;  1PP9 G;  1X22 A;  1KC8 Q;  1BGY J;  2ZYG A;  1XTC C;  5AW0 B;  4GOF A;  2HOD A;  3I55 P;  4EIJ A;  3GW6 A;  1P84 E;  3V6I A;  2KYV A;  2ZT9 D;  2OYI C;  3P7K A;  1JY3 P;  4YXD C;  4LC1 A;  1M7L A;  1AFO A;  1HJB A;  2WPQ A;  1FDI A;  1Q7Y Q;  3TSI A;  4UB8 E;  3WUT A;  1FZC A;  1LP1 A;  2OAR A;  2DW3 A;  5KLV E;  1GMJ A;  3USS A;  1AVO A;  1QL1 A;  1PIX A;  1BSN A;  1HGZ A;  1M57 D;  3Q2Y A;  3FGA D;  3EFG A;  4IL6 X;  1N73 A;  2AXT H;  3CLQ A;  2GUS A;  1L0N E;  2IDB A;  3H1K D;  1MFT A;  2Q1K A;  4I7Z C;  4H13 C;  1PP9 J;  2Q3E A;  1EZV G;  2N9B A;  2M5A A;  2AEF A;  1ZW0 A;  5KJ7 C;  1S5L E;  2NPS B;  5APS A;  1JY2 P;  2YKP A;  1GD2 E;  3SWF A;  1VPC A;  1DD3 A;  2O1K A;  2YXQ B;  3A0B H;  3EWK A;  3BVH A;  3EFF K;  1KV4 A;  2XDJ A;  3HE4 A;  3HTK A;  3L75 D;  3MHV A;  3H1H G;  1QVG O;  1NTK D;  3AEC C;  3B5N A;  2PAJ A;  3R2P A;  3A5T A;  5KLI B;  2KNC A;  1LWU A;  3CCE P;  2B87 A;  1BE3 G;  1RY3 A;  5H2F H;  2K9Y A;  2H8P D;  5KAI E;  3M0D C;  1HF9 A;  2P67 A;  3L70 G;  4D6T E;  1RE3 C;  5CCG A;  2J59 M;  1Z56 A;  2LR2 A;  1YYC A;  2FFD A;  1OW8 A;  3LIE A;  3L72 E;  3LW5 H;  1K73 Q;  1SQQ D;  1VQ4 P;  5APW A;  1FBM A;  1LT9 B;  2ZXX A;  4H44 D;  3OW2 O;  1X0T A;  1QL2 A;  1RE4 C;  1HWT C;  1KIL A;  1LJ2 A;  3CPW O;  3AEE C;  3W67 A;  1PGQ A;  2WSC J;  3Q1M A;  4WY4 C;  3VN0 A;  1SQX G;  3CCM P;  3P8C D;  1NTM E;  4XFJ A;  2IFN A;  1IFJ A;  3L74 D;  1DIP A;  1RQV A;  1QGK B;  1NU1 K;  2OQQ A;  2FXO A;  3V2N A;  1KQF B;  2WWW A;  2IBZ G;  1N8R Q;  3MTU E;  3GHG C;  3H1H J;  1OIP A;  4RJT A;  3AEF C;  1KYO I;  2N9Y B;  1W2E A;  2ZVO B;  1G2C B; 
#chains in the Genus database with same CATH homology
 1L2P A;  4DT0 A;  2K88 A;  2KK7 A;  3K5B A;  3V6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...