5B5EH

Crystal structure analysis of photosystem ii complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
63
structure length
63
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
total genus 14
structure length 63
sequence length 63
chains with identical sequence h
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 5b5eH01
3A0HH 5H2FH 4IL6H 3A0BH 5E79H 1S5LH 5B66H 5GTIH 5GTHH 3KZIH 5KAIH 4UB8H 3WU2H 5B5EH 4PJ0H 2AXTH 4UB6H 3JCUH 5KAFH 5TISH
chains in the Genus database with same CATH superfamily
3T97B 2P1JA 3CMAP 3G4SP 1N73C 2QIWA 1PGJA 1FDIA 4ASWA 3M06A 3U1AA 3H1KG 1RQVA 5KAIH 1R5SA 3VTPC 3LW5H 1RF0C 3IAOA 4RO0A 1S9KE 2OYOA 1N7LA 2WPRA 4NPDA 3SFDC 4WY4D 3ITKA 1PP9G 2FYNC 1KYOD 2WSCJ 3E1IA 4LGDE 4W7YA 2Z5IA 5AVXB 3GMAA 4WY4A 1YHQP 2H43A 1EDJA 1EZVI 1GK4A 4RESB 5CHXA 2AXCA 4GDOA 1GL2C 2WSFH 3KDPB 3ABVC 4ZKPA 1KORA 2E74C 1DEEG 1XTGB 1IZNB 1NTME 2BEQD 1JMMA 1KILE 1SQVJ 3T97A 1SQPE 4MN4C 4ZKUA 1SQXK 3RL0C 5KKZB 1NTKK 3TGUJ 2O1KA 1G2CA 2FYUD 2GM4A 1YI2P 1RE4A 1QLED 1QL2A 2N9YB 1N7SB 2IBZE 1M1JB 2K9JB 3FX0A 3AE2C 3L71J 1YJ9P 2P58A 1J1DB 4I2LC 1P84E 1D7MA 2YMYA 2C9LY 4H44D 1SFCD 3RK3D 4GOFA 1L0NJ 3BASA 3CC7P 1HGZA 1SFCA 3K5BA 5APTA 3LW5J 1IK9A 1LTSC 5B5EH 3L75E 1IFNA 4UB6E 1N7SA 3KQGA 2LR2A 1M1JA 5APVA 2K9JA 1AQ5A 3EWKA 1SLQA 2QJYC 3CPWO 2QJPC 3USSA 2YKPA 2CPSA 2JWDA 1HJ0A 2JJLA 2CK3H 2OGUA 2WSEH 1OWAA 1ZXGA 2Q6QA 1JY3O 2WSFJ 1K73Q 4H0LD 1BCCJ 1S3JA 4IL6H 1ZOYC 1L4AC 1JOCA 2LXCB 2I8DA 2BCCD 4HKZH 3L35A 3VMZA 1KYOE 1J1EB 2A06G 1EQ7A 2A45I 2AEJA 2BASA 2V7QH 1WT6A 4WB4A 3WUTA 4RKUJ 3TDKA 1KC8Q 1GU4A 5AVSB 3OAKA 3H32B 2M8RA 2XV5A 4PJ0E 3RK2B 1KB9D 3CWBJ 2KZIA 4DZOA 1NU1D 2A45H 3Q3DA 3W67A 5CJ4A 4IL6X 5GTIH 3S9OA 1VQMP 1KQSO 2FYUE 3L73J 4GKGA 2IFMA 5KLIC 2QJKC 4I7ZB 3B5ND 5AW2B 1SQQD 2G8YA 1N2DC 4H13C 1L0LJ 3V2NA 4PD4D 2M3EA 2W27A 1A02F 2OYHB 3M0DA 5AVRB 1YJNP 3FWLA 4L76A 3D71A 2AXTE 5KAFE 1AVYA 3D6ZA 2P2UA 2ZT9D 3BCCJ 1KZUB 3IFMA 2HYNA 1LTJC 2RN0A 2DW3A 5H2FH 1Z56A 3TGUG 1NAYA 1SQBD 3H32A 1N73B 1SP4A 4Y28J 2YMKA 1OMIA 1MFZA 3VP9A 4R4LA 3RK3E 1Y47A 2G3AA 2WSEJ 3AE7C 3E1RA 3E7KA 2FYNB 3RBXA 4O9BA 4JYBA 4QMAA 2YXRB 1T2KD 1HTLC 3D6YA 1WRGA 1VQ7P 1VQNP 1JCDA 3VMYA 1PPJD 1FU1A 1U57A 3HTKB 1NOHA 1BGYD 2V7QJ 3TNUB 3VN0A 1GL2B 1UIXA 2HFED 2Q3EA 2E5TA 1S72P 1L0NG 2E74B 5M1BA 1LNQA 2IPPA 1ZMEC 5AW6B 4IFFA 1RF1C 1OW6A 1N73A 3RL0B 1IFDA 4N78D 2H8PD 2BCCE 3MUDC 2QEXP 1W2EA 1H0TB 3CCRP 1RF0A 4D6TJ 3P7KA 1DH3A 3BVHA 2WWWA 3L74D 4PD4I 1GW4A 1IFPA 1W5CE 1AJYA 2HLOA 1RHZB 1PGPA 2WVRA 1BCCG 1KFNA 5TISH 1FAVA 1M8OB 1HH0A 1SQXD 3H1HD 1NTKD 2K1AA 2E76C 2N9BA 3HTKA 5APSA 2Y0EA 3TNUA 1GL2A 3M9BA 2KLVA 4U3FD 1EZVG 3RL0D 2YKOA 3R4YA 3U59A 1BDCA 2JKVA 1FZAA 2ZYGA 3A0BE 1Q7YQ 2KSJA 1SQQE 3MZWB 1YTZI 1NTZD 1MUUA 5AVYB 5AVZB 3CCQP 4PD4E 1M90Q 4OGQD 1H0TA 5CMZA 5CCGC 2LXBA 1FZGA 2QJYB 1HUCA 1SQBE 3KXDA 1YITP 4KHXA 2QJPB 3L73G 1S2EA 1N8RQ 5EFWB 4ZMDA 3PJSK 1LGHB 3AE9C 1VQLP 1ZW0A 1SQVK 2R3SA 1L0LG 5AVVB 1EXJA 1DX7A 3AE8C 3H1IJ 1N86A 3L72J 1YJWP 3L75G 2BCCJ 1L4AB 5CJ0A 1RH5B 2YNYA 2K37A 3BATA 2E42A 3BCCG 2ZYDA 1ZP0C 2H88C 2JP3A 1R5LA 1S1CX 2KB7P 2Y9YA 1OVVA 3HD7C 4UB8E 3IR9A 1LT9C 1BGYE 1Q86Q 3H1LJ 2IFNA 3H1JD 2YIUC 2H89C 2JWAA 1CZQA 1BSHA 2N1TC 1OW7A 1FZFA 2KI7B 2I1JA 1DD3A 2B87B 3BRVB 1IFJA 4C7NB 4N78E 5GTHH 1L2PA 3H1KD 2WQYC 4EIJA 5KLIB 2QJKB 1L0NK 2IBZI 1EDLA 1LTBC 5AVUB 4H13B 3MTUE 4GOEA 1L4AA 3VYIA 1NAFA 1PP9D 3AEEC 4RJTA 1YBKA 3GF3A 3PLNA 3L74E 1AV1A 3A3YB 2NRGA 1NYHA 1KILC 1H89A 1LTJB 3M91A 2A45G 1P84I 1SQXE 1IFMA 3H1HE 1X9VA 4Z1MH 1FZBA 4WBAA 1K9MQ 1VDFA 3TYYA 1U7MA 1BE3D 3V4WA 4D6TG 2KP8A 1USEA 2HPCB 1FJKA 3ZDMA 1UIIA 1FZCC 2B87A 2O1JA 1K05A 4C7NA 1IFIA 4DCKA 1P84H 3MGNA 4Y99C 1NTZE 1NGMB 5AW9B 1JY2P 2R5DA 1IJDB 1RE3C 4I6MC 2ZAEB 2QM7A 1JCCA 1JB0J 3SFEC 3L70D 2LKMA 5AVQB 2O3JA 2HR3A 4UB6H 3CCVP 1JO5A 3AE3C 5KJ7C 1W2BO 1N7SD 5KLVD 1VQ4P 3D70A 1URQC 1JTHB 2GA1A 3WU2E 2P10A 1RF1B 5CBOA 3QH9A 2K88A 1JMBA 3B4SA 2KIKA 1KYOI 2HPCA 3A0HE 1G1IA 1S5LE 1L0LK 2J58A 1M1KQ 5APUA 3KZIE 1S4XA 1NTMJ 1LTGC 3H25A 1KYOH 3WUUA 1SQPJ 1E5WA 3H1IG 3H1JE 3L72G 4W7ZA 1VQ9P 1WMKA 3AECC 1T8ZA 2BCCG 1VL2A 1LWUC 1K8AQ 2AEMA 2E76B 4PJ0H 2KXPB 2O01H 3H1KE 1NKNA 1QGKB 3HE5B 2PGDA 1FS0E 2FXMA 3Q5SA 1MZ9A 1JTHA 2W8ZA 1RF1A 3MD0A 3H1LG 1X79B 4EI2A 3O8ZA 4WVZA 1OW8A 1PP9E 3MUDA 1RY3A 3OA7A 2O01N 1RQUA 4ASVA 4YXDC 2M0BA 3CXHD 1GZLA 3B71A 4L75A 3CI9A 3JCUE 1NVOA 1BE3E 2AXTH 2E76D 3NXSA 4IFMA 5DJUB 3FXEA 2C9NY 4BRYB 2Z4EA 1DIPA 3AE1C 4JF7A 4PV1C 3L75J 1KD1Q 3TK1A 5CCHD 3M0AA 2P67A 3RK2D 3HE5A 3CX5D 1IC2A 5CCHA 2FFDC 1VQOP 4TLFA 3VMXA 3HD7B 3L70E 5CCGD 4CPGA 4WWIA 1LT9B 4KT0J 2KK7A 4H44C 2YIUB 1J2JB 1SQVD 2RKLA 5B66E 3RK3C 5CCGA 2N1TB 3AEAC 4BWNA 2ZVNB 5KLVE 1YTZT 2H7HA 2NPSC 2ZJSE 2QE7H 1EDIA 1JEKA 1VQPP 2K3RA 1GU5A 5K5GB 1JNMA 1FC2C 4BRYA 2JEEA 1GD2E 1BGYG 1A02J 2XKMA 2QSIA 1BSNA 2O01J 3JC22 2OYHA 2WT7B 3L71D 1JY2N 3SSUA 1M56D 3P32A 2HG5D 3GHGC 1KB9I 3HD7D 4L74A 3VMAA 4U7JA 4DJGA 2KOGA 2OYIC 1USDA 2L5GB 1MKMA 1FE6A 3AEFC 1KILB 2FYUJ 2KS1B 3HD7A 3JSVC 2UWJE 4H0LC 3UIAA 1LT9A 2P7JA 3IN6A 2D2CC 2Q1KA 3W68A 2PAJA 2NZ2A 1KMIZ 1L0ND 2VRSA 2N1TA 3Q1MA 1FZCB 2JR8A 1Q90D 3RBZA 1NTMG 3P8MC 2PRRA 1EXIA 1HJBA 1SQPG 4Y99B 2WITA 1KB9E 2R44A 3HUSC 2W83C 3WUVA 1E79H 1GL2D 1NU1E 3VOPA 4C46A 4HB1A 1IK7A 3A0BH 2E74D 2WPSA 3Q5PA 3CX5I 2QM8A 2IBZG 2WT7A 3CXHE 2ITAA 5KTBA 4PD4H 4HJGH 2B9BA 3C9IA 3SWKA 1NTZG 2R3CA 5KLVJ 2FXPA 1BCCD 2AEFA 3B5NC 1KILA 2B89A 2KS1A 1GMJA 1KTMA 1URQB 2SPZA 4DOJA 4EDFA 5TISE 3MP7B 1JY3P 1Y8AA 1EZVD 2FBWC 5AW1B 3I5CA 1ZN5A 3LIEA 1FZCA 2Q5UA 3NFQA 3CX5E 1JM0A 5BU8B 2ZT9C 3EFFK 1PZQA 5AW5B 3CWBD 4A7PA 3F5HA 3L4FA 3QWOC 1AFOA 2Y0CA 3C1LA 1M57D 4OWFA 1GDTA 5AVWB 1RE3A 5E79E 4GIFA 3G6EP 1SQVE 4OH8B 1LWUB 1U7JA 1EC5A 4YTPC 1QVFO 4UB8H 5KJ7D 3L73D 2W6AA 2GUSA 4WY4B 1URQD 2RMZA 3EQ2A 2RH0A 1CW5A 1MFTA 1L0LD 5AVTB 1LP1B 5KJ7A 3NMDA 1URQA 3H1JG 1PPJE 3KYQA 2K9YA 1NU1J 3L71E 3NTNA 1HBWA 3V2QA 1DEBA 1OFCX 3BCCD 1K04A 3CCSP 4LLHA 5C39A 3AE6C 3I55P 3L36A 1VPCA 1YIJP 1G2CB 1KV4A 4C7RA 1ZRTD 3CCEP 1VQ6P 2POHA 1L4AD 2ZXEB 1SQQJ 2JO1A 1H88A 1DD4A 3BRTB 2C0XA 1L0NE 3FGAD 2FY8A 1PFIA 1FZEA 1ZLLA 1LWUA 5KAIE 3V4QA 3SWYA 3HE4B 4PV1B 1QEXA 4R4MA 3CCJP 3U1CA 5TJHA 3TSIA 3CMEP 4LC1A 3AEGC 2WMMA 4AYCA 1NO4A 1LP1A 1SQBJ 2FYUG 5GTHE 4HYTB 3S4RA 2E43A 1BE3G 2FFDB 1NTKE 1NTMK 3CCUP 3CCLP 4XA4A 2HODB 3HRNA 1SQPK 4U3FE 3CLQA 3M9QA 1VF5C 4H44B 4ZNCA 3O6QB 1SFCB 3RK3B 1BCCE 5APXA 2CPBA 2Q9IA 4DT0A 4H13D 3PH0A 1KFMA 2E75C 2NPSB 4L73A 5APYA 1OVRA 2XNDH 4PV1D 2ZYAA 3V6IA 2YO3A 1EZVE 4D6TD 4OGQC 3L70G 2YO2A 1NTZK 3PP5A 3HE4A 1R8EA 1BGYJ 3AEDC 5BU5A 1AVOA 3WU2H 1HVVA 3VP8A 3CWBE 5L8RJ 3P8CD 5KLVG 3OW2O 3GHGB 2WPVB 3CCMP 3A0HH 1LTJA 1OIPA 4W80A 2OYIB 1S5LH 1LTAC 3N4XA 2FFDA 1YYCA 3IF4A 3KZIH 3OJAB 5AW4B 2HODA 3GLMA 4H0LB 1T6AA 1PIXA 2WSSH 1MV8A 2J5UA 2XU6A 3L73E 2D2CB 2PFXA 3A5TA 2NPSD 3CC4P 3A7OA 1KQLA 2ZVOB 2IYOA 2QG4A 2Z5HA 3O6QA 1VQKP 2KYVA 1L0LE 5CBNA 3RGUA 2NPSA 3L74J 1JY3N 2KZJA 1FBMA 1Q2NA 4JBZA 1SS1A 1JUNA 4AUWA 3RL0g 3HUSB 3BCCE 5AW0B 1SQXJ 3H1HJ 1NTKJ 3V2RA 1LTTC 3AE4C 2OQQA 2R5BA 2KNCB 5B5EE 1S5LX 4U3FJ 1NKZB 3G9RA 1ZRTE 2L91A 4WY4C 2IYPA 2Y0DA 3GHGA 3H1ID 2OYIA 1AA0A 3L72D 2D2CD 3Q5RA 1NTZJ 3B5NB 4BXLA 1M7LA 3KHUA 1NU1G 1HWTC 2IDBA 3B8EB 3JCUH 4IL6E 2A06D 3R2PA 2Y9ZA 2Q3IA 3G3ZA 2KLUA 3MHVA 2MKVA 4OVNF 4YPCA 2KUBA 2ZT9B 3S1KA 2WTYA 1RE4C 2FXOA 2QVAA 4K3AA 2FYZA 2W6BA 1SQQG 3H1LD 3AEBC 3F89A 2OTJP 4IOIH 1QL1A 3HUSA 5KAFH 2XDJA 3TF5A 1OX3A 1YQ4C 3N7NA 1VQ5P 2JDIH 2KNCA 2FYUK 1ZR4A 2IX7C 3FXDA 3H6PA 3GG2A 2R32A 1X0TA 2OTKE 1SQBG 1PV3A 4D6TE 5GTIE 1TU3F 1LJ2A 3B5NA 5B66H 1NH4A 1KQGB 2Q7CA 1BDDA 1OXZA 3PTZA 4YXWH 1YQ3C 3V2PA 3KPEA 1OZHA 3H1JJ 2IZ1A 1SQVG 4B86A 1FOSE 2V4HA 1PGOA 5KKZC 3P8CE 3CD6P 1SFCC 1FJPA 1OVUA 3AE5C 4M3LA 3TGUD 4EOTA 2PP6A 1N7SC 3H1KJ 1M1JC 4GODA 4I1LA 5H2FE 3PRJA 3M9HA 5KLVK 1PPJG 3GW6A 1KQFB 2MJZA 1QX8A 3L71G 1HF9A 2OTLP 1PP9J 1GTWA 3V5BA 3A2AA 4K35A 2IZ0A 1FOSF 1NWQA 1AQTA 1J1DC 3PHLA 1EDKA 1KN7A 2W90A 1Q82Q 4GT1A 1VQ8P 2N1TD 1BE3J 3CXHI 5DJTB 1SVFA 3LIDA 2E5YA 3WMM0 1S9KD 1KB9H 1JY2O 1QVGO 1T3UA 1FDOA 4EYYQ 1T3JA 3C8VA 1VF5B 3H1IE 3L72E 4JPZB 3L74G 1HGVA 4IFDK 4XFJA 2OARA 3CC2P 3CXHH 4JQ0D 2E75B 2GUVA 2QRXA 1IO4A 1FDMA 1SQXG 3H1HG 1CI6B 1NTKG 2A06E 1PGQA 1Y9BA 2FKWB 4OGQB 3L70J 4U3FG 1NTMD 5APWA 1ZV8A 4N6JA 1KILD 1NU1K 2WSCH 1SQPD 1Q81Q 3H1LE 1NHLA 3EFGA 5AW3B 4HH2A 2M5AB 2YXQB 4XE5B 3L37A 1H8AA 4NPEA 3M0DC 1J1EC 3CX5H 3Q2YA 2YKQA 1CSBA 1VF5D 4JYCA 2IBZD 1LT1A 2WZ7A 2XZRA 1G1JA 2M3BA 1SQQK 2B88A 5CCHC 2E75D 5E79H 3CL3D 3RK2C 3CWBG 2QA4P 3G71P 4TT3H 4NPFX 5AW8B 5BVZA 1CI6A 1LTIC 1P84D 2W6JH 1SQBK 1PL5A 4AQRD 4KJMA 1X8YA 2J59M 2KSEA 3TGUE 5APQA 2I1KA 3MIWA 4I7ZC 1GW3A 2ZXXA 2BEZF 2WPQA 1ZR2A 3FWNA 1XTCC 3SWFA 5AW7B 3GF7A 2M5AA 3II6A 1GK6A 2OYHC 1X22A 2C0WA 1T2KC 3L75D 2ZFCA 4N3YB 1NJIQ 2XNXA 3I56P
chains in the Genus database with same CATH topology
3A0HH 5H2FH 4IL6H 3A0BH 5E79H 1S5LH 5B66H 5GTIH 5GTHH 3KZIH 5KAIH 4UB8H 3WU2H 5B5EH 4PJ0H 2AXTH 4UB6H 3JCUH 5KAFH 5TISH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0H H;  5H2F H;  4IL6 H;  3A0B H;  5E79 H;  1S5L H;  5B66 H;  5GTI H;  5GTH H;  3KZI H;  5KAI H;  4UB8 H;  3WU2 H;  5B5E H;  4PJ0 H;  2AXT H;  4UB6 H;  3JCU H;  5KAF H;  5TIS H; 
#chains in the Genus database with same CATH topology
 3T97 B;  2P1J A;  3CMA P;  3G4S P;  1N73 C;  2QIW A;  1PGJ A;  1FDI A;  4ASW A;  3M06 A;  3U1A A;  3H1K G;  1RQV A;  5KAI H;  1R5S A;  3VTP C;  3LW5 H;  1RF0 C;  3IAO A;  4RO0 A;  1S9K E;  2OYO A;  1N7L A;  2WPR A;  4NPD A;  3SFD C;  4WY4 D;  3ITK A;  1PP9 G;  2FYN C;  1KYO D;  2WSC J;  3E1I A;  4LGD E;  4W7Y A;  2Z5I A;  5AVX B;  3GMA A;  4WY4 A;  1YHQ P;  2H43 A;  1EDJ A;  1EZV I;  1GK4 A;  4RES B;  5CHX A;  2AXC A;  4GDO A;  1GL2 C;  2WSF H;  3KDP B;  3ABV C;  4ZKP A;  1KOR A;  2E74 C;  1DEE G;  1XTG B;  1IZN B;  1NTM E;  2BEQ D;  1JMM A;  1KIL E;  1SQV J;  3T97 A;  1SQP E;  4MN4 C;  4ZKU A;  1SQX K;  3RL0 C;  5KKZ B;  1NTK K;  3TGU J;  2O1K A;  1G2C A;  2FYU D;  2GM4 A;  1YI2 P;  1RE4 A;  1QLE D;  1QL2 A;  2N9Y B;  1N7S B;  2IBZ E;  1M1J B;  2K9J B;  3FX0 A;  3AE2 C;  3L71 J;  1YJ9 P;  2P58 A;  1J1D B;  4I2L C;  1P84 E;  1D7M A;  2YMY A;  2C9L Y;  4H44 D;  1SFC D;  3RK3 D;  4GOF A;  1L0N J;  3BAS A;  3CC7 P;  1HGZ A;  1SFC A;  3K5B A;  5APT A;  3LW5 J;  1IK9 A;  1LTS C;  5B5E H;  3L75 E;  1IFN A;  4UB6 E;  1N7S A;  3KQG A;  2LR2 A;  1M1J A;  5APV A;  2K9J A;  1AQ5 A;  3EWK A;  1SLQ A;  2QJY C;  3CPW O;  2QJP C;  3USS A;  2YKP A;  2CPS A;  2JWD A;  1HJ0 A;  2JJL A;  2CK3 H;  2OGU A;  2WSE H;  1OWA A;  1ZXG A;  2Q6Q A;  1JY3 O;  2WSF J;  1K73 Q;  4H0L D;  1BCC J;  1S3J A;  4IL6 H;  1ZOY C;  1L4A C;  1JOC A;  2LXC B;  2I8D A;  2BCC D;  4HKZ H;  3L35 A;  3VMZ A;  1KYO E;  1J1E B;  2A06 G;  1EQ7 A;  2A45 I;  2AEJ A;  2BAS A;  2V7Q H;  1WT6 A;  4WB4 A;  3WUT A;  4RKU J;  3TDK A;  1KC8 Q;  1GU4 A;  5AVS B;  3OAK A;  3H32 B;  2M8R A;  2XV5 A;  4PJ0 E;  3RK2 B;  1KB9 D;  3CWB J;  2KZI A;  4DZO A;  1NU1 D;  2A45 H;  3Q3D A;  3W67 A;  5CJ4 A;  4IL6 X;  5GTI H;  3S9O A;  1VQM P;  1KQS O;  2FYU E;  3L73 J;  4GKG A;  2IFM A;  5KLI C;  2QJK C;  4I7Z B;  3B5N D;  5AW2 B;  1SQQ D;  2G8Y A;  1N2D C;  4H13 C;  1L0L J;  3V2N A;  4PD4 D;  2M3E A;  2W27 A;  1A02 F;  2OYH B;  3M0D A;  5AVR B;  1YJN P;  3FWL A;  4L76 A;  3D71 A;  2AXT E;  5KAF E;  1AVY A;  3D6Z A;  2P2U A;  2ZT9 D;  3BCC J;  1KZU B;  3IFM A;  2HYN A;  1LTJ C;  2RN0 A;  2DW3 A;  5H2F H;  1Z56 A;  3TGU G;  1NAY A;  1SQB D;  3H32 A;  1N73 B;  1SP4 A;  4Y28 J;  2YMK A;  1OMI A;  1MFZ A;  3VP9 A;  4R4L A;  3RK3 E;  1Y47 A;  2G3A A;  2WSE J;  3AE7 C;  3E1R A;  3E7K A;  2FYN B;  3RBX A;  4O9B A;  4JYB A;  4QMA A;  2YXR B;  1T2K D;  1HTL C;  3D6Y A;  1WRG A;  1VQ7 P;  1VQN P;  1JCD A;  3VMY A;  1PPJ D;  1FU1 A;  1U57 A;  3HTK B;  1NOH A;  1BGY D;  2V7Q J;  3TNU B;  3VN0 A;  1GL2 B;  1UIX A;  2HFE D;  2Q3E A;  2E5T A;  1S72 P;  1L0N G;  2E74 B;  5M1B A;  1LNQ A;  2IPP A;  1ZME C;  5AW6 B;  4IFF A;  1RF1 C;  1OW6 A;  1N73 A;  3RL0 B;  1IFD A;  4N78 D;  2H8P D;  2BCC E;  3MUD C;  2QEX P;  1W2E A;  1H0T B;  3CCR P;  1RF0 A;  4D6T J;  3P7K A;  1DH3 A;  3BVH A;  2WWW A;  3L74 D;  4PD4 I;  1GW4 A;  1IFP A;  1W5C E;  1AJY A;  2HLO A;  1RHZ B;  1PGP A;  2WVR A;  1BCC G;  1KFN A;  5TIS H;  1FAV A;  1M8O B;  1HH0 A;  1SQX D;  3H1H D;  1NTK D;  2K1A A;  2E76 C;  2N9B A;  3HTK A;  5APS A;  2Y0E A;  3TNU A;  1GL2 A;  3M9B A;  2KLV A;  4U3F D;  1EZV G;  3RL0 D;  2YKO A;  3R4Y A;  3U59 A;  1BDC A;  2JKV A;  1FZA A;  2ZYG A;  3A0B E;  1Q7Y Q;  2KSJ A;  1SQQ E;  3MZW B;  1YTZ I;  1NTZ D;  1MUU A;  5AVY B;  5AVZ B;  3CCQ P;  4PD4 E;  1M90 Q;  4OGQ D;  1H0T A;  5CMZ A;  5CCG C;  2LXB A;  1FZG A;  2QJY B;  1HUC A;  1SQB E;  3KXD A;  1YIT P;  4KHX A;  2QJP B;  3L73 G;  1S2E A;  1N8R Q;  5EFW B;  4ZMD A;  3PJS K;  1LGH B;  3AE9 C;  1VQL P;  1ZW0 A;  1SQV K;  2R3S A;  1L0L G;  5AVV B;  1EXJ A;  1DX7 A;  3AE8 C;  3H1I J;  1N86 A;  3L72 J;  1YJW P;  3L75 G;  2BCC J;  1L4A B;  5CJ0 A;  1RH5 B;  2YNY A;  2K37 A;  3BAT A;  2E42 A;  3BCC G;  2ZYD A;  1ZP0 C;  2H88 C;  2JP3 A;  1R5L A;  1S1C X;  2KB7 P;  2Y9Y A;  1OVV A;  3HD7 C;  4UB8 E;  3IR9 A;  1LT9 C;  1BGY E;  1Q86 Q;  3H1L J;  2IFN A;  3H1J D;  2YIU C;  2H89 C;  2JWA A;  1CZQ A;  1BSH A;  2N1T C;  1OW7 A;  1FZF A;  2KI7 B;  2I1J A;  1DD3 A;  2B87 B;  3BRV B;  1IFJ A;  4C7N B;  4N78 E;  5GTH H;  1L2P A;  3H1K D;  2WQY C;  4EIJ A;  5KLI B;  2QJK B;  1L0N K;  2IBZ I;  1EDL A;  1LTB C;  5AVU B;  4H13 B;  3MTU E;  4GOE A;  1L4A A;  3VYI A;  1NAF A;  1PP9 D;  3AEE C;  4RJT A;  1YBK A;  3GF3 A;  3PLN A;  3L74 E;  1AV1 A;  3A3Y B;  2NRG A;  1NYH A;  1KIL C;  1H89 A;  1LTJ B;  3M91 A;  2A45 G;  1P84 I;  1SQX E;  1IFM A;  3H1H E;  1X9V A;  4Z1M H;  1FZB A;  4WBA A;  1K9M Q;  1VDF A;  3TYY A;  1U7M A;  1BE3 D;  3V4W A;  4D6T G;  2KP8 A;  1USE A;  2HPC B;  1FJK A;  3ZDM A;  1UII A;  1FZC C;  2B87 A;  2O1J A;  1K05 A;  4C7N A;  1IFI A;  4DCK A;  1P84 H;  3MGN A;  4Y99 C;  1NTZ E;  1NGM B;  5AW9 B;  1JY2 P;  2R5D A;  1IJD B;  1RE3 C;  4I6M C;  2ZAE B;  2QM7 A;  1JCC A;  1JB0 J;  3SFE C;  3L70 D;  2LKM A;  5AVQ B;  2O3J A;  2HR3 A;  4UB6 H;  3CCV P;  1JO5 A;  3AE3 C;  5KJ7 C;  1W2B O;  1N7S D;  5KLV D;  1VQ4 P;  3D70 A;  1URQ C;  1JTH B;  2GA1 A;  3WU2 E;  2P10 A;  1RF1 B;  5CBO A;  3QH9 A;  2K88 A;  1JMB A;  3B4S A;  2KIK A;  1KYO I;  2HPC A;  3A0H E;  1G1I A;  1S5L E;  1L0L K;  2J58 A;  1M1K Q;  5APU A;  3KZI E;  1S4X A;  1NTM J;  1LTG C;  3H25 A;  1KYO H;  3WUU A;  1SQP J;  1E5W A;  3H1I G;  3H1J E;  3L72 G;  4W7Z A;  1VQ9 P;  1WMK A;  3AEC C;  1T8Z A;  2BCC G;  1VL2 A;  1LWU C;  1K8A Q;  2AEM A;  2E76 B;  4PJ0 H;  2KXP B;  2O01 H;  3H1K E;  1NKN A;  1QGK B;  3HE5 B;  2PGD A;  1FS0 E;  2FXM A;  3Q5S A;  1MZ9 A;  1JTH A;  2W8Z A;  1RF1 A;  3MD0 A;  3H1L G;  1X79 B;  4EI2 A;  3O8Z A;  4WVZ A;  1OW8 A;  1PP9 E;  3MUD A;  1RY3 A;  3OA7 A;  2O01 N;  1RQU A;  4ASV A;  4YXD C;  2M0B A;  3CXH D;  1GZL A;  3B71 A;  4L75 A;  3CI9 A;  3JCU E;  1NVO A;  1BE3 E;  2AXT H;  2E76 D;  3NXS A;  4IFM A;  5DJU B;  3FXE A;  2C9N Y;  4BRY B;  2Z4E A;  1DIP A;  3AE1 C;  4JF7 A;  4PV1 C;  3L75 J;  1KD1 Q;  3TK1 A;  5CCH D;  3M0A A;  2P67 A;  3RK2 D;  3HE5 A;  3CX5 D;  1IC2 A;  5CCH A;  2FFD C;  1VQO P;  4TLF A;  3VMX A;  3HD7 B;  3L70 E;  5CCG D;  4CPG A;  4WWI A;  1LT9 B;  4KT0 J;  2KK7 A;  4H44 C;  2YIU B;  1J2J B;  1SQV D;  2RKL A;  5B66 E;  3RK3 C;  5CCG A;  2N1T B;  3AEA C;  4BWN A;  2ZVN B;  5KLV E;  1YTZ T;  2H7H A;  2NPS C;  2ZJS E;  2QE7 H;  1EDI A;  1JEK A;  1VQP P;  2K3R A;  1GU5 A;  5K5G B;  1JNM A;  1FC2 C;  4BRY A;  2JEE A;  1GD2 E;  1BGY G;  1A02 J;  2XKM A;  2QSI A;  1BSN A;  2O01 J;  3JC2 2;  2OYH A;  2WT7 B;  3L71 D;  1JY2 N;  3SSU A;  1M56 D;  3P32 A;  2HG5 D;  3GHG C;  1KB9 I;  3HD7 D;  4L74 A;  3VMA A;  4U7J A;  4DJG A;  2KOG A;  2OYI C;  1USD A;  2L5G B;  1MKM A;  1FE6 A;  3AEF C;  1KIL B;  2FYU J;  2KS1 B;  3HD7 A;  3JSV C;  2UWJ E;  4H0L C;  3UIA A;  1LT9 A;  2P7J A;  3IN6 A;  2D2C C;  2Q1K A;  3W68 A;  2PAJ A;  2NZ2 A;  1KMI Z;  1L0N D;  2VRS A;  2N1T A;  3Q1M A;  1FZC B;  2JR8 A;  1Q90 D;  3RBZ A;  1NTM G;  3P8M C;  2PRR A;  1EXI A;  1HJB A;  1SQP G;  4Y99 B;  2WIT A;  1KB9 E;  2R44 A;  3HUS C;  2W83 C;  3WUV A;  1E79 H;  1GL2 D;  1NU1 E;  3VOP A;  4C46 A;  4HB1 A;  1IK7 A;  3A0B H;  2E74 D;  2WPS A;  3Q5P A;  3CX5 I;  2QM8 A;  2IBZ G;  2WT7 A;  3CXH E;  2ITA A;  5KTB A;  4PD4 H;  4HJG H;  2B9B A;  3C9I A;  3SWK A;  1NTZ G;  2R3C A;  5KLV J;  2FXP A;  1BCC D;  2AEF A;  3B5N C;  1KIL A;  2B89 A;  2KS1 A;  1GMJ A;  1KTM A;  1URQ B;  2SPZ A;  4DOJ A;  4EDF A;  5TIS E;  3MP7 B;  1JY3 P;  1Y8A A;  1EZV D;  2FBW C;  5AW1 B;  3I5C A;  1ZN5 A;  3LIE A;  1FZC A;  2Q5U A;  3NFQ A;  3CX5 E;  1JM0 A;  5BU8 B;  2ZT9 C;  3EFF K;  1PZQ A;  5AW5 B;  3CWB D;  4A7P A;  3F5H A;  3L4F A;  3QWO C;  1AFO A;  2Y0C A;  3C1L A;  1M57 D;  4OWF A;  1GDT A;  5AVW B;  1RE3 A;  5E79 E;  4GIF A;  3G6E P;  1SQV E;  4OH8 B;  1LWU B;  1U7J A;  1EC5 A;  4YTP C;  1QVF O;  4UB8 H;  5KJ7 D;  3L73 D;  2W6A A;  2GUS A;  4WY4 B;  1URQ D;  2RMZ A;  3EQ2 A;  2RH0 A;  1CW5 A;  1MFT A;  1L0L D;  5AVT B;  1LP1 B;  5KJ7 A;  3NMD A;  1URQ A;  3H1J G;  1PPJ E;  3KYQ A;  2K9Y A;  1NU1 J;  3L71 E;  3NTN A;  1HBW A;  3V2Q A;  1DEB A;  1OFC X;  3BCC D;  1K04 A;  3CCS P;  4LLH A;  5C39 A;  3AE6 C;  3I55 P;  3L36 A;  1VPC A;  1YIJ P;  1G2C B;  1KV4 A;  4C7R A;  1ZRT D;  3CCE P;  1VQ6 P;  2POH A;  1L4A D;  2ZXE B;  1SQQ J;  2JO1 A;  1H88 A;  1DD4 A;  3BRT B;  2C0X A;  1L0N E;  3FGA D;  2FY8 A;  1PFI A;  1FZE A;  1ZLL A;  1LWU A;  5KAI E;  3V4Q A;  3SWY A;  3HE4 B;  4PV1 B;  1QEX A;  4R4M A;  3CCJ P;  3U1C A;  5TJH A;  3TSI A;  3CME P;  4LC1 A;  3AEG C;  2WMM A;  4AYC A;  1NO4 A;  1LP1 A;  1SQB J;  2FYU G;  5GTH E;  4HYT B;  3S4R A;  2E43 A;  1BE3 G;  2FFD B;  1NTK E;  1NTM K;  3CCU P;  3CCL P;  4XA4 A;  2HOD B;  3HRN A;  1SQP K;  4U3F E;  3CLQ A;  3M9Q A;  1VF5 C;  4H44 B;  4ZNC A;  3O6Q B;  1SFC B;  3RK3 B;  1BCC E;  5APX A;  2CPB A;  2Q9I A;  4DT0 A;  4H13 D;  3PH0 A;  1KFM A;  2E75 C;  2NPS B;  4L73 A;  5APY A;  1OVR A;  2XND H;  4PV1 D;  2ZYA A;  3V6I A;  2YO3 A;  1EZV E;  4D6T D;  4OGQ C;  3L70 G;  2YO2 A;  1NTZ K;  3PP5 A;  3HE4 A;  1R8E A;  1BGY J;  3AED C;  5BU5 A;  1AVO A;  3WU2 H;  1HVV A;  3VP8 A;  3CWB E;  5L8R J;  3P8C D;  5KLV G;  3OW2 O;  3GHG B;  2WPV B;  3CCM P;  3A0H H;  1LTJ A;  1OIP A;  4W80 A;  2OYI B;  1S5L H;  1LTA C;  3N4X A;  2FFD A;  1YYC A;  3IF4 A;  3KZI H;  3OJA B;  5AW4 B;  2HOD A;  3GLM A;  4H0L B;  1T6A A;  1PIX A;  2WSS H;  1MV8 A;  2J5U A;  2XU6 A;  3L73 E;  2D2C B;  2PFX A;  3A5T A;  2NPS D;  3CC4 P;  3A7O A;  1KQL A;  2ZVO B;  2IYO A;  2QG4 A;  2Z5H A;  3O6Q A;  1VQK P;  2KYV A;  1L0L E;  5CBN A;  3RGU A;  2NPS A;  3L74 J;  1JY3 N;  2KZJ A;  1FBM A;  1Q2N A;  4JBZ A;  1SS1 A;  1JUN A;  4AUW A;  3RL0 g;  3HUS B;  3BCC E;  5AW0 B;  1SQX J;  3H1H J;  1NTK J;  3V2R A;  1LTT C;  3AE4 C;  2OQQ A;  2R5B A;  2KNC B;  5B5E E;  1S5L X;  4U3F J;  1NKZ B;  3G9R A;  1ZRT E;  2L91 A;  4WY4 C;  2IYP A;  2Y0D A;  3GHG A;  3H1I D;  2OYI A;  1AA0 A;  3L72 D;  2D2C D;  3Q5R A;  1NTZ J;  3B5N B;  4BXL A;  1M7L A;  3KHU A;  1NU1 G;  1HWT C;  2IDB A;  3B8E B;  3JCU H;  4IL6 E;  2A06 D;  3R2P A;  2Y9Z A;  2Q3I A;  3G3Z A;  2KLU A;  3MHV A;  2MKV A;  4OVN F;  4YPC A;  2KUB A;  2ZT9 B;  3S1K A;  2WTY A;  1RE4 C;  2FXO A;  2QVA A;  4K3A A;  2FYZ A;  2W6B A;  1SQQ G;  3H1L D;  3AEB C;  3F89 A;  2OTJ P;  4IOI H;  1QL1 A;  3HUS A;  5KAF H;  2XDJ A;  3TF5 A;  1OX3 A;  1YQ4 C;  3N7N A;  1VQ5 P;  2JDI H;  2KNC A;  2FYU K;  1ZR4 A;  2IX7 C;  3FXD A;  3H6P A;  3GG2 A;  2R32 A;  1X0T A;  2OTK E;  1SQB G;  1PV3 A;  4D6T E;  5GTI E;  1TU3 F;  1LJ2 A;  3B5N A;  5B66 H;  1NH4 A;  1KQG B;  2Q7C A;  1BDD A;  1OXZ A;  3PTZ A;  4YXW H;  1YQ3 C;  3V2P A;  3KPE A;  1OZH A;  3H1J J;  2IZ1 A;  1SQV G;  4B86 A;  1FOS E;  2V4H A;  1PGO A;  5KKZ C;  3P8C E;  3CD6 P;  1SFC C;  1FJP A;  1OVU A;  3AE5 C;  4M3L A;  3TGU D;  4EOT A;  2PP6 A;  1N7S C;  3H1K J;  1M1J C;  4GOD A;  4I1L A;  5H2F E;  3PRJ A;  3M9H A;  5KLV K;  1PPJ G;  3GW6 A;  1KQF B;  2MJZ A;  1QX8 A;  3L71 G;  1HF9 A;  2OTL P;  1PP9 J;  1GTW A;  3V5B A;  3A2A A;  4K35 A;  2IZ0 A;  1FOS F;  1NWQ A;  1AQT A;  1J1D C;  3PHL A;  1EDK A;  1KN7 A;  2W90 A;  1Q82 Q;  4GT1 A;  1VQ8 P;  2N1T D;  1BE3 J;  3CXH I;  5DJT B;  1SVF A;  3LID A;  2E5Y A;  3WMM 0;  1S9K D;  1KB9 H;  1JY2 O;  1QVG O;  1T3U A;  1FDO A;  4EYY Q;  1T3J A;  3C8V A;  1VF5 B;  3H1I E;  3L72 E;  4JPZ B;  3L74 G;  1HGV A;  4IFD K;  4XFJ A;  2OAR A;  3CC2 P;  3CXH H;  4JQ0 D;  2E75 B;  2GUV A;  2QRX A;  1IO4 A;  1FDM A;  1SQX G;  3H1H G;  1CI6 B;  1NTK G;  2A06 E;  1PGQ A;  1Y9B A;  2FKW B;  4OGQ B;  3L70 J;  4U3F G;  1NTM D;  5APW A;  1ZV8 A;  4N6J A;  1KIL D;  1NU1 K;  2WSC H;  1SQP D;  1Q81 Q;  3H1L E;  1NHL A;  3EFG A;  5AW3 B;  4HH2 A;  2M5A B;  2YXQ B;  4XE5 B;  3L37 A;  1H8A A;  4NPE A;  3M0D C;  1J1E C;  3CX5 H;  3Q2Y A;  2YKQ A;  1CSB A;  1VF5 D;  4JYC A;  2IBZ D;  1LT1 A;  2WZ7 A;  2XZR A;  1G1J A;  2M3B A;  1SQQ K;  2B88 A;  5CCH C;  2E75 D;  5E79 H;  3CL3 D;  3RK2 C;  3CWB G;  2QA4 P;  3G71 P;  4TT3 H;  4NPF X;  5AW8 B;  5BVZ A;  1CI6 A;  1LTI C;  1P84 D;  2W6J H;  1SQB K;  1PL5 A;  4AQR D;  4KJM A;  1X8Y A;  2J59 M;  2KSE A;  3TGU E;  5APQ A;  2I1K A;  3MIW A;  4I7Z C;  1GW3 A;  2ZXX A;  2BEZ F;  2WPQ A;  1ZR2 A;  3FWN A;  1XTC C;  3SWF A;  5AW7 B;  3GF7 A;  2M5A A;  3II6 A;  1GK6 A;  2OYH C;  1X22 A;  2C0W A;  1T2K C;  3L75 D;  2ZFC A;  4N3Y B;  1NJI Q;  2XNX A;  3I56 P; 
#chains in the Genus database with same CATH homology
 3A0H H;  5H2F H;  4IL6 H;  3A0B H;  5E79 H;  1S5L H;  5B66 H;  5GTI H;  5GTH H;  3KZI H;  5KAI H;  4UB8 H;  3WU2 H;  5B5E H;  4PJ0 H;  2AXT H;  4UB6 H;  3JCU H;  5KAF H;  5TIS H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...