5B5EH

Crystal structure analysis of photosystem ii complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
63
structure length
63
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 14
structure length 63
sequence length 63
chains with identical sequence h
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 5b5eH01
3WU2H 5E79H 3A0HH 5KAFH 5TISH 5H2FH 3JCUH 3A0BH 1S5LH 5B5EH 4IL6H 4UB8H 2AXTH 5GTHH 5GTIH 4PJ0H 5B66H 3KZIH 4UB6H 5KAIH
chains in the Genus database with same CATH superfamily
5GTIE 3PHLA 1NYHA 4U3FD 2PFXA 3L37A 1VF5C 2L5GB 4C7RA 2BASA 3PTZA 1LTIC 2NPSA 3FWNA 1LT9C 2QM8A 1YIJP 3ZDMA 3BCCE 1QLED 1FOSF 2BCCG 1KB9I 2YMYA 3SWKA 2RN0A 2OTKE 1GDTA 5AVSB 3RK2B 1VF5B 2IZ0A 1YJNP 2KB7P 3NXSA 1AA0A 1PPJE 5AVRB 1GZLA 5AW2B 1ZP0C 3RK3B 1OIPA 1DEBA 3EWKA 2E75B 2E5TA 5AW9B 4BXLA 3MUDA 1KN7A 2ZT9B 1AVOA 3TYYA 3AE3C 5AVVB 1NOHA 5KLVD 4I6MC 1NTZD 1ZV8A 2FXPA 5KAFH 3H1LJ 3A0HE 1PGPA 5APWA 3L72D 3N7NA 1PPJG 2GA1A 3S9OA 2HFED 2W6BA 1BE3D 3HD7B 1SFCA 3II6A 4PJ0H 2GUSA 1VQ8P 2ZFCA 2E42A 4GODA 3D71A 2YO2A 3GG2A 2A06D 1KMIZ 1Q86Q 3CPWO 1FZBA 5GTIH 2D2CD 2O01J 3G6EP 4M3LA 5APSA 3VMXA 2V4HA 1TU3F 3GHGB 1IFJA 1RF1A 2M5AB 2YIUB 3VMZA 1SQBG 2GM4A 4N78E 2K37A 5AW7B 2V7QH 2KI7B 4TT3H 5APTA 3HE4A 1LTJA 2L91A 2PP6A 2KNCA 2KLUA 3CCLP 1DH3A 1G2CA 4KHXA 2I1KA 3NMDA 2N9BA 5CCHD 1GL2A 5APUA 4IL6H 3A3YB 2QJKB 2H8PD 3B4SA 1A02F 4NPDA 4WBAA 4RKUJ 1MFTA 3RK3E 3VYIA 1OZHA 3L36A 1T2KC 4WY4B 2XNDH 4U3FG 1VQ7P 4QMAA 5CJ4A 3H1KJ 3FX0A 1OVVA 1GW3A 3F89A 3AEEC 1Q82Q 2KS1B 2E74C 3H6PA 4H0LC 4D6TD 3A0HH 4OGQD 3MP7B 3R4YA 1GK6A 4EDFA 4DZOA 3KPEA 5CHXA 1Q2NA 5AW1B 1USDA 4DT0A 1OVRA 2B9BA 1L0ND 3G9RA 2FY8A 2W27A 4YTPC 1PV3A 1SQQJ 1N2DC 2E74B 1GU4A 4H0LB 1IFMA 1N7SC 1M8OB 3EQ2A 1PL5A 2BCCJ 1L4AB 2IYPA 2P2UA 1L0LE 3HRNA 2KZJA 1AQ5A 3CX5E 2KLVA 5BU8B 2QSIA 1GMJA 4W7YA 1L0LK 3RGUA 4EOTA 3L72G 2YXQB 1SQXD 3E1IA 1HGVA 3KYQA 2C9LY 3E1RA 3HD7A 3L73E 1URQD 2Q3IA 4JYBA 3L35A 5M1BA 2V7QJ 1VQMP 3O8ZA 2IX7C 3BCCJ 3TGUD 5TJHA 3IAOA 1JCCA 2A06G 1SLQA 3AE8C 5AVZB 1KILD 5AW3B 3M06A 4HKZH 2P7JA 3HE5B 2Q1KA 5AW5B 1VL2A 5CCGD 2N1TB 4PV1D 3GHGA 2M5AA 4U7JA 1DEEG 4IFDK 3VP8A 3Q2YA 2QVAA 1NTMD 2Q9IA 4IL6X 2QJYC 2R3SA 3MD0A 3JC22 4JPZB 3U1CA 3K5BA 1IK7A 1GTWA 2C0XA 1Y9BA 3U59A 4L75A 4KJMA 1NTKD 2E5YA 1QVGO 1LWUB 2W6JH 1IO4A 1JEKA 2IZ1A 3GMAA 2IFNA 2OTLP 3FGAD 2QJYB 3P7KA 5KTBA 2P67A 4H44D 2JO1A 1X22A 4WY4A 1SP4A 1WRGA 1FDOA 1OW8A 2E76B 3W67A 4LLHA 3CX5H 3L70E 1HBWA 2IBZE 2B88A 1XTCC 3H1HD 1S72P 1BDDA 1BGYD 2KS1A 2KP8A 1J1EB 1FS0E 1YQ4C 5GTHE 4D6TG 1M57D 4JQ0D 1BCCD 1HGZA 2NRGA 1ZOYC 2WVRA 3SSUA 5EFWB 1L0NG 5CMZA 1EDLA 2NPSD 1RH5B 1VPCA 1PFIA 1SQXK 5APYA 5KAIE 1ZR4A 3VOPA 4ZKPA 1NU1E 1L4AA 3L70G 2WWWA 3CX5I 2IBZG 2RMZA 1IFPA 1PP9D 3D6ZA 2XZRA 3SWYA 1PIXA 1FE6A 1NU1K 2I8DA 2R5BA 1SFCC 1SQPD 1SQXG 4Z1MH 2O1JA 2H43A 1N73C 1JY2O 3AEGC 4NPFX 3HUSB 1NVOA 3TGUG 2FFDB 1NU1G 2WPRA 2Z5HA 4UB6E 3KQGA 1N73B 1RQVA 5AVYB 3A0BE 4EI2A 3HE5A 3FWLA 2H7HA 2N1TA 2QM7A 3AE7C 5C39A 3B5NC 1LTJC 2W8ZA 4K35A 4ZKUA 2G8YA 1LTSC 2R3CA 2HG5D 1R5LA 4IOIH 1JO5A 1NTMG 1L0LJ 1J2JB 1Q7YQ 5BU5A 1GL2C 1YJ9P 5KLIC 4JYCA 1AFOA 1SQVD 5GTHH 1KQFB 4H13C 3B5NB 4HYTB 2CPSA 1JMBA 3CD6P 3GLMA 1NTKG 1K8AQ 1LWUA 3L74D 3L73J 4L76A 3RBZA 3VN0A 3CL3D 3L71E 2R32A 5KAIH 3H1IE 1AV1A 1KFNA 2WPSA 2IBZI 4IFMA 2GUVA 3RK2C 3H1HG 2FXMA 2NZ2A 1KQLA 1T8ZA 3M9BA 1BGYG 1N8RQ 1BSHA 4ZMDA 1KD1Q 1QVFO 2HPCB 1OW6A 1BCCG 1H89A 3RK3C 1CI6B 2IDBA 2M3BA 2WPQA 3Q1MA 1IC2A 1DD3A 3GF7A 1S9KD 1VQ5P 2E75C 4R4LA 1P84D 3L71G 3BATA 2W83C 4IL6E 1S2EA 3H1IG 1MKMA 2ZT9C 4UB6H 5CBOA 3LW5H 1EZVD 3FXDA 3R2PA 1PP9G 4KT0J 4CPGA 2QEXP 2JEEA 4LGDE 4BRYA 3A0BH 3L75D 1DD4A 1YTZI 2W6AA 1SQPG 3HD7C 3H1JD 1KYOE 1VQ9P 5B66E 2Y0EA 1X79B 4OVNF 1YTZT 1LJ2A 3L70J 2LXBA 3HUSA 4AYCA 3BVHA 2Z5IA 1CSBA 2FFDA 4I7ZB 1SQBE 2JKVA 3CMEP 3Q5RA 1NWQA 3VMYA 4RJTA 1N73A 2Y9ZA 1MUUA 3LIDA 3GHGC 5KJ7A 2FYNC 1S5LH 1SQBK 2YIUC 1RF0A 4NPEA 2I1JA 5APVA 3B71A 3BRVB 4GDOA 3G4SP 2D2CB 4O9BA 5L8RJ 1NU1J 1HWTC 3KHUA 1ZLLA 3RBXA 2YXRB 2FBWC 2FYNB 3A7OA 4U3FE 3SWFA 1SQVG 5K5GB 3W68A 2WPVB 1Q90D 1GK4A 2QJKC 4R4MA 4JBZA 3B5NA 3L4FA 3C8VA 4WY4C 4PD4D 2FYUD 2Q7CA 3JSVC 1U7JA 3L74G 2J59M 2POHA 2ZVOB 4WVZA 1R8EA 1AVYA 3CXHD 3AE1C 2Y0CA 4DJGA 4B86A 3RL0C 3LW5J 3N4XA 3H25A 5AVTB 3P8CD 1FC2C 4N6JA 1YJWP 3CWBJ 2Y0DA 1YBKA 2HPCA 1KYOH 5B66H 2W90A 3RL0B 1CI6A 2AXTE 3D70A 3CC7P 5KLVE 1EDIA 1W5CE 1NTZE 3G71P 2C0WA 4OGQB 1L4AC 2WQYC 2WTYA 1BSNA 5AW6B 3L72E 5KKZB 1PGOA 4GOEA 1NKNA 3A2AA 1N86A 1BE3E 5KLVK 1EZVG 4N3YB 1NTZK 1T2KD 1MV8A 1QX8A 1J1DB 1R5SA 1ZRTD 4IFFA 1LT1A 3U1AA 1VQNP 1JUNA 3AEAC 2UWJE 3WUVA 3L75G 4A7PA 1HVVA 1H88A 2A06E 1KYOI 3H1JG 3EFGA 1MZ9A 2B87B 3L71J 2E74D 1FOSE 1QGKB 3I56P 1HJ0A 4H0LD 5KLVG 1PZQA 3H1IJ 3KDPB 1NTZG 2R5DA 3H1LD 1FZCB 1BE3G 1NAFA 1S5LX 4HB1A 1H8AA 1URQB 3MIWA 4UB8E 3NFQA 5AVWB 1LNQA 1M7LA 3CCEP 1N7SD 2P1JA 2FYZA 2N1TC 2A45G 1NAYA 1KB9D 1RY3A 1HF9A 3MZWB 1NGMB 1K04A 2O1KA 1YYCA 1SVFA 2AXCA 3CXHE 2FYUK 2LKMA 4YPCA 2KYVA 3V4QA 1AQTA 4WB4A 1OVUA 4PV1B 3WMM0 1LP1B 1Z56A 5AW4B 1YITP 2P58A 1IFIA 3UIAA 3AEFC 1LWUC 2JWAA 2AEJA 2AXTH 1NKZB 1K9MQ 2FYUG 4W80A 4H44C 1U57A 3D6YA 3M91A 4D6TE 3PRJA 2CPBA 2K9JB 5CCHA 2E76C 1S3JA 1LTTC 2OYHB 1SQBJ 1L0NE 1J1EC 3CI9A 4H44B 3VTPC 1UIXA 2RH0A 2QRXA 1RE3A 2XV5A 1JY2N 2P10A 3M9QA 3TF5A 2M8RA 1LTBC 3H1KD 2FXOA 3CCMP 1S4XA 1L0NK 1W2EA 1FZAA 1WMKA 3ABVC 4YXWH 4GIFA 4XFJA 1JY3P 3M0AA 1H0TB 2HYNA 3AEBC 3E7KA 2M3EA 2YKOA 1JOCA 3H1LE 4U3FJ 1SQXE 1ZXGA 1JY3O 2Z4EA 1LTGC 1N7LA 2WMMA 1NO4A 4UB8H 1IFDA 1FZGA 3FXEA 1PGQA 1Y8AA 1SQQD 3TGUE 1M90Q 1NHLA 2WSCH 2BCCD 2KOGA 1KILE 4BRYB 3CXHH 5B5EE 2B87A 3HUSC 2XNXA 1LTAC 1JY2P 2FFDC 3OAKA 4HJGH 2O01N 3H1LG 1HH0A 1KQGB 3TNUB 1FZCA 3IN6A 1XTGB 1M1KQ 1DIPA 5KJ7C 1URQA 1VQPP 2JP3A 1NTME 3BASA 2JJLA 2IFMA 1RF0C 2JDIH 3BCCD 4MN4C 5KLVJ 1IFNA 1NTZJ 2C9NY 2ZXEB 1E5WA 1NTMK 3ITKA 4AUWA 3CXHI 3L72J 1NTKE 1PPJD 1BE3J 1SFCD 2PAJA 3CLQA 1OXZA 5CCGA 3TDKA 1LP1A 3OA7A 1KV4A 3IFMA 2DW3A 1NTKK 2VRSA 1OW7A 5E79E 2HLOA 3RL0g 3Q5SA 1VQ6P 3H1KE 3S1KA 1YHQP 3H1HE 3VMAA 1YI2P 3QWOC 1EC5A 1BGYE 1D7MA 1DX7A 2K9JA 1BCCE 1KQSO 3CCUP 1HUCA 1T3UA 2QE7H 2OYHA 1S5LE 3OJAB 2BEQD 1VQKP 3B5ND 1SQQE 1K05A 1YQ3C 3H1KG 1ZN5A 4JF7A 2WSEH 4Y99C 5B5EH 1GL2D 4W7ZA 1PP9E 1JCDA 1VQLP 1SQQK 2K1AA 2Q3EA 1EDJA 4H13D 1VQOP 2YKPA 1H0TA 1IK9A 1KTMA 1GU5A 1SQPE 5APXA 1QL1A 1CW5A 2LR2A 2Q6QA 1GD2E 4Y99B 4N78D 2MKVA 1SQPK 2BEZF 1M1JC 1FZFA 1BDCA 1SQQG 4ZNCA 4DCKA 3AEDC 3GW6A 2ZVNB 1NH4A 4D6TJ 3Q3DA 3RK2D 1VF5D 3OW2O 2G3AA 3MGNA 1T6AA 1M1JB 2IYOA 1L0NJ 1LT9B 2H89C 4I7ZC 3RK3D 1FJKA 5AVQB 4I1LA 3TNUA 5E79H 2E75D 2OYIC 3CC2P 1RHZB 1RE4C 2ZT9D 5AW8B 1OWAA 3BCCG 2XDJA 1SQVE 3V2NA 2D2CC 2KK7A 3V2PA 2LXCB 2OYIB 1SS1A 2WZ7A 4EYYQ 1SQXJ 3TK1A 1JB0J 1A02J 1G1IA 1SQVK 1EXIA 3L74E 3HD7D 4K3AA 1ZMEC 2PGDA 1GW4A 2HR3A 2SPZA 1IJDB 3IF4A 4LC1A 1E79H 3TGUJ 2ZYGA 1OFCX 1JNMA 4HH2A 5AVUB 1ZW0A 1L0LD 4TLFA 2WSEJ 2YMKA 3CX5D 5CCHC 1KORA 3I5CA 3AECC 1FU1A 4YXDC 1JTHB 2AEFA 3CC4P 3M0DC 3CCRP 1S9KE 1RE3C 3L73D 5H2FE 3H32B 2QA4P 1NTMJ 1P84E 2KIKA 1USEA 1OX3A 3AE4C 1EZVE 3WU2E 5APQA 4OGQC 4I2LC 1NJIQ 2JWDA 2ZXXA 1NTKJ 2KZIA 5KKZC 3L75E 3S4RA 2OARA 1X0TA 2Y9YA 3PH0A 1FAVA 3AE9C 3H1JE 1KC8Q 4WY4D 1J1DC 1KZUB 1L2PA 5BVZA 3NTNA 2ZJSE 1VQ4P 3H1HJ 2XKMA 5CJ0A 4RESB 3RL0D 1BGYJ 3WUTA 3KZIE 4RO0A 1BCCJ 5DJTB 5AW0B 1JMMA 2FKWB 1FZCC 2YKQA 1K73Q 1M1JA 3CCVP 1LT9A 3HTKB 1AJYA 3C1LA 1URQC 1W2BO 2WT7B 2WSFH 4XE5B 1L4AD 2PRRA 1HTLC 3L70D 1PP9J 2IBZD 1KILC 3SFEC 4ASWA 2M0BA 2B89A 1SQPJ 2OYIA 3AE2C 5CCGC 1N7SB 3T97B 3V5BA 1M56D 4PV1C 4PD4E 3CCJP 2FYUE 1X9VA 2XU6A 5H2FH 1RE4A 1KILB 1P84H 3P32A 4DOJA 3I55P 2KUBA 2RKLA 1S1CX 1FZEA 3WU2H 1NU1D 2QIWA 3A5TA 3LIEA 1L0LG 3PLNA 3VP9A 3CCQP 3KXDA 1JY3N 3P8CE 3JCUE 2OGUA 1QL2A 2OYHC 4GKGA 2HODB 1FDMA 2N1TD 1JTHA 3TSIA 1FJPA 2E43A 2QJPC 3L73G 1P84I 5CBNA 3WUUA 2YNYA 3H32A 4OH8B 2H88C 1EZVI 4C7NB 1SQVJ 3KZIH 2WSSH 1ZRTE 3M0DA 4L74A 3V2RA 4L73A 2A45H 2QJPB 3O6QB 2ITAA 3L74J 1LGHB 2YO3A 3CWBD 1PGJA 1X8YA 1Y47A 2AEMA 3V4WA 1IZNB 2NPSC 1Q81Q 1RQUA 2WSFJ 2E76D 3PP5A 2OYOA 3SFDC 4C46A 2Q5UA 2ZYDA 2NPSB 2A45I 1MFZA 4GT1A 4GOFA 4PD4H 4EIJA 2IPPA 3C9IA 1EQ7A 3EFFK 2MJZA 2R44A 5TISE 1OMIA 3HTKA 1KB9E 3MUDC 3L71D 1HJBA 1WT6A 2WT7A 1JM0A 5DJUB 3H1ID 2O3JA 4ASVA 2K9YA 3JCUH 3V6IA 1FBMA 2N9YB 3GF3A 3L75J 1G1JA 4AQRD 3G3ZA 1KFMA 3H1JJ 2K3RA 4PD4I 1N7SA 3T97A 2OQQA 2WITA 2KSJA 2J58A 3PJSK 3BRTB 1KILA 1QEXA 3AE5C 3AE6C 3QH9A 1SFCB 4WWIA 2K88A 3USSA 2KSEA 3CCSP 5KJ7D 1VDFA 2KXPB 1RF1C 5AVXB 2CK3H 3CWBE 2HODA 1FDIA 1U7MA 1KYOD 2QG4A 4BWNA 3P8MC 1EDKA 2J5UA 1EXJA 1T3JA 2OTJP 1RF1B 3IR9A 5KAFE 3MTUE 4C7NA 3MHVA 2JR8A 4XA4A 1SQBD 3V2QA 3HE4B 4PJ0E 1LTJB 2KNCB 2ZYAA 2ZAEB 2FYUJ 3O6QA 5TISH 3CWBG 3M9HA 1G2CB 2BCCE 1KB9H 1ZR2A 2WSCJ 3CMAP 4Y28J 1CZQA 1GL2B 3B8EB 1UIIA 3Q5PA 5KLIB 4OWFA 4H13B 2O01H 3F5HA
chains in the Genus database with same CATH topology
3WU2H 5E79H 3A0HH 5KAFH 5TISH 5H2FH 3JCUH 3A0BH 1S5LH 5B5EH 4IL6H 4UB8H 2AXTH 5GTHH 5GTIH 4PJ0H 5B66H 3KZIH 4UB6H 5KAIH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WU2 H;  5E79 H;  3A0H H;  5KAF H;  5TIS H;  5H2F H;  3JCU H;  3A0B H;  1S5L H;  5B5E H;  4IL6 H;  4UB8 H;  2AXT H;  5GTH H;  5GTI H;  4PJ0 H;  5B66 H;  3KZI H;  4UB6 H;  5KAI H; 
#chains in the Genus database with same CATH topology
 5GTI E;  3PHL A;  1NYH A;  4U3F D;  2PFX A;  3L37 A;  1VF5 C;  2L5G B;  4C7R A;  2BAS A;  3PTZ A;  1LTI C;  2NPS A;  3FWN A;  1LT9 C;  2QM8 A;  1YIJ P;  3ZDM A;  3BCC E;  1QLE D;  1FOS F;  2BCC G;  1KB9 I;  2YMY A;  3SWK A;  2RN0 A;  2OTK E;  1GDT A;  5AVS B;  3RK2 B;  1VF5 B;  2IZ0 A;  1YJN P;  2KB7 P;  3NXS A;  1AA0 A;  1PPJ E;  5AVR B;  1GZL A;  5AW2 B;  1ZP0 C;  3RK3 B;  1OIP A;  1DEB A;  3EWK A;  2E75 B;  2E5T A;  5AW9 B;  4BXL A;  3MUD A;  1KN7 A;  2ZT9 B;  1AVO A;  3TYY A;  3AE3 C;  5AVV B;  1NOH A;  5KLV D;  4I6M C;  1NTZ D;  1ZV8 A;  2FXP A;  5KAF H;  3H1L J;  3A0H E;  1PGP A;  5APW A;  3L72 D;  3N7N A;  1PPJ G;  2GA1 A;  3S9O A;  2HFE D;  2W6B A;  1BE3 D;  3HD7 B;  1SFC A;  3II6 A;  4PJ0 H;  2GUS A;  1VQ8 P;  2ZFC A;  2E42 A;  4GOD A;  3D71 A;  2YO2 A;  3GG2 A;  2A06 D;  1KMI Z;  1Q86 Q;  3CPW O;  1FZB A;  5GTI H;  2D2C D;  2O01 J;  3G6E P;  4M3L A;  5APS A;  3VMX A;  2V4H A;  1TU3 F;  3GHG B;  1IFJ A;  1RF1 A;  2M5A B;  2YIU B;  3VMZ A;  1SQB G;  2GM4 A;  4N78 E;  2K37 A;  5AW7 B;  2V7Q H;  2KI7 B;  4TT3 H;  5APT A;  3HE4 A;  1LTJ A;  2L91 A;  2PP6 A;  2KNC A;  2KLU A;  3CCL P;  1DH3 A;  1G2C A;  4KHX A;  2I1K A;  3NMD A;  2N9B A;  5CCH D;  1GL2 A;  5APU A;  4IL6 H;  3A3Y B;  2QJK B;  2H8P D;  3B4S A;  1A02 F;  4NPD A;  4WBA A;  4RKU J;  1MFT A;  3RK3 E;  3VYI A;  1OZH A;  3L36 A;  1T2K C;  4WY4 B;  2XND H;  4U3F G;  1VQ7 P;  4QMA A;  5CJ4 A;  3H1K J;  3FX0 A;  1OVV A;  1GW3 A;  3F89 A;  3AEE C;  1Q82 Q;  2KS1 B;  2E74 C;  3H6P A;  4H0L C;  4D6T D;  3A0H H;  4OGQ D;  3MP7 B;  3R4Y A;  1GK6 A;  4EDF A;  4DZO A;  3KPE A;  5CHX A;  1Q2N A;  5AW1 B;  1USD A;  4DT0 A;  1OVR A;  2B9B A;  1L0N D;  3G9R A;  2FY8 A;  2W27 A;  4YTP C;  1PV3 A;  1SQQ J;  1N2D C;  2E74 B;  1GU4 A;  4H0L B;  1IFM A;  1N7S C;  1M8O B;  3EQ2 A;  1PL5 A;  2BCC J;  1L4A B;  2IYP A;  2P2U A;  1L0L E;  3HRN A;  2KZJ A;  1AQ5 A;  3CX5 E;  2KLV A;  5BU8 B;  2QSI A;  1GMJ A;  4W7Y A;  1L0L K;  3RGU A;  4EOT A;  3L72 G;  2YXQ B;  1SQX D;  3E1I A;  1HGV A;  3KYQ A;  2C9L Y;  3E1R A;  3HD7 A;  3L73 E;  1URQ D;  2Q3I A;  4JYB A;  3L35 A;  5M1B A;  2V7Q J;  1VQM P;  3O8Z A;  2IX7 C;  3BCC J;  3TGU D;  5TJH A;  3IAO A;  1JCC A;  2A06 G;  1SLQ A;  3AE8 C;  5AVZ B;  1KIL D;  5AW3 B;  3M06 A;  4HKZ H;  2P7J A;  3HE5 B;  2Q1K A;  5AW5 B;  1VL2 A;  5CCG D;  2N1T B;  4PV1 D;  3GHG A;  2M5A A;  4U7J A;  1DEE G;  4IFD K;  3VP8 A;  3Q2Y A;  2QVA A;  1NTM D;  2Q9I A;  4IL6 X;  2QJY C;  2R3S A;  3MD0 A;  3JC2 2;  4JPZ B;  3U1C A;  3K5B A;  1IK7 A;  1GTW A;  2C0X A;  1Y9B A;  3U59 A;  4L75 A;  4KJM A;  1NTK D;  2E5Y A;  1QVG O;  1LWU B;  2W6J H;  1IO4 A;  1JEK A;  2IZ1 A;  3GMA A;  2IFN A;  2OTL P;  3FGA D;  2QJY B;  3P7K A;  5KTB A;  2P67 A;  4H44 D;  2JO1 A;  1X22 A;  4WY4 A;  1SP4 A;  1WRG A;  1FDO A;  1OW8 A;  2E76 B;  3W67 A;  4LLH A;  3CX5 H;  3L70 E;  1HBW A;  2IBZ E;  2B88 A;  1XTC C;  3H1H D;  1S72 P;  1BDD A;  1BGY D;  2KS1 A;  2KP8 A;  1J1E B;  1FS0 E;  1YQ4 C;  5GTH E;  4D6T G;  1M57 D;  4JQ0 D;  1BCC D;  1HGZ A;  2NRG A;  1ZOY C;  2WVR A;  3SSU A;  5EFW B;  1L0N G;  5CMZ A;  1EDL A;  2NPS D;  1RH5 B;  1VPC A;  1PFI A;  1SQX K;  5APY A;  5KAI E;  1ZR4 A;  3VOP A;  4ZKP A;  1NU1 E;  1L4A A;  3L70 G;  2WWW A;  3CX5 I;  2IBZ G;  2RMZ A;  1IFP A;  1PP9 D;  3D6Z A;  2XZR A;  3SWY A;  1PIX A;  1FE6 A;  1NU1 K;  2I8D A;  2R5B A;  1SFC C;  1SQP D;  1SQX G;  4Z1M H;  2O1J A;  2H43 A;  1N73 C;  1JY2 O;  3AEG C;  4NPF X;  3HUS B;  1NVO A;  3TGU G;  2FFD B;  1NU1 G;  2WPR A;  2Z5H A;  4UB6 E;  3KQG A;  1N73 B;  1RQV A;  5AVY B;  3A0B E;  4EI2 A;  3HE5 A;  3FWL A;  2H7H A;  2N1T A;  2QM7 A;  3AE7 C;  5C39 A;  3B5N C;  1LTJ C;  2W8Z A;  4K35 A;  4ZKU A;  2G8Y A;  1LTS C;  2R3C A;  2HG5 D;  1R5L A;  4IOI H;  1JO5 A;  1NTM G;  1L0L J;  1J2J B;  1Q7Y Q;  5BU5 A;  1GL2 C;  1YJ9 P;  5KLI C;  4JYC A;  1AFO A;  1SQV D;  5GTH H;  1KQF B;  4H13 C;  3B5N B;  4HYT B;  2CPS A;  1JMB A;  3CD6 P;  3GLM A;  1NTK G;  1K8A Q;  1LWU A;  3L74 D;  3L73 J;  4L76 A;  3RBZ A;  3VN0 A;  3CL3 D;  3L71 E;  2R32 A;  5KAI H;  3H1I E;  1AV1 A;  1KFN A;  2WPS A;  2IBZ I;  4IFM A;  2GUV A;  3RK2 C;  3H1H G;  2FXM A;  2NZ2 A;  1KQL A;  1T8Z A;  3M9B A;  1BGY G;  1N8R Q;  1BSH A;  4ZMD A;  1KD1 Q;  1QVF O;  2HPC B;  1OW6 A;  1BCC G;  1H89 A;  3RK3 C;  1CI6 B;  2IDB A;  2M3B A;  2WPQ A;  3Q1M A;  1IC2 A;  1DD3 A;  3GF7 A;  1S9K D;  1VQ5 P;  2E75 C;  4R4L A;  1P84 D;  3L71 G;  3BAT A;  2W83 C;  4IL6 E;  1S2E A;  3H1I G;  1MKM A;  2ZT9 C;  4UB6 H;  5CBO A;  3LW5 H;  1EZV D;  3FXD A;  3R2P A;  1PP9 G;  4KT0 J;  4CPG A;  2QEX P;  2JEE A;  4LGD E;  4BRY A;  3A0B H;  3L75 D;  1DD4 A;  1YTZ I;  2W6A A;  1SQP G;  3HD7 C;  3H1J D;  1KYO E;  1VQ9 P;  5B66 E;  2Y0E A;  1X79 B;  4OVN F;  1YTZ T;  1LJ2 A;  3L70 J;  2LXB A;  3HUS A;  4AYC A;  3BVH A;  2Z5I A;  1CSB A;  2FFD A;  4I7Z B;  1SQB E;  2JKV A;  3CME P;  3Q5R A;  1NWQ A;  3VMY A;  4RJT A;  1N73 A;  2Y9Z A;  1MUU A;  3LID A;  3GHG C;  5KJ7 A;  2FYN C;  1S5L H;  1SQB K;  2YIU C;  1RF0 A;  4NPE A;  2I1J A;  5APV A;  3B71 A;  3BRV B;  4GDO A;  3G4S P;  2D2C B;  4O9B A;  5L8R J;  1NU1 J;  1HWT C;  3KHU A;  1ZLL A;  3RBX A;  2YXR B;  2FBW C;  2FYN B;  3A7O A;  4U3F E;  3SWF A;  1SQV G;  5K5G B;  3W68 A;  2WPV B;  1Q90 D;  1GK4 A;  2QJK C;  4R4M A;  4JBZ A;  3B5N A;  3L4F A;  3C8V A;  4WY4 C;  4PD4 D;  2FYU D;  2Q7C A;  3JSV C;  1U7J A;  3L74 G;  2J59 M;  2POH A;  2ZVO B;  4WVZ A;  1R8E A;  1AVY A;  3CXH D;  3AE1 C;  2Y0C A;  4DJG A;  4B86 A;  3RL0 C;  3LW5 J;  3N4X A;  3H25 A;  5AVT B;  3P8C D;  1FC2 C;  4N6J A;  1YJW P;  3CWB J;  2Y0D A;  1YBK A;  2HPC A;  1KYO H;  5B66 H;  2W90 A;  3RL0 B;  1CI6 A;  2AXT E;  3D70 A;  3CC7 P;  5KLV E;  1EDI A;  1W5C E;  1NTZ E;  3G71 P;  2C0W A;  4OGQ B;  1L4A C;  2WQY C;  2WTY A;  1BSN A;  5AW6 B;  3L72 E;  5KKZ B;  1PGO A;  4GOE A;  1NKN A;  3A2A A;  1N86 A;  1BE3 E;  5KLV K;  1EZV G;  4N3Y B;  1NTZ K;  1T2K D;  1MV8 A;  1QX8 A;  1J1D B;  1R5S A;  1ZRT D;  4IFF A;  1LT1 A;  3U1A A;  1VQN P;  1JUN A;  3AEA C;  2UWJ E;  3WUV A;  3L75 G;  4A7P A;  1HVV A;  1H88 A;  2A06 E;  1KYO I;  3H1J G;  3EFG A;  1MZ9 A;  2B87 B;  3L71 J;  2E74 D;  1FOS E;  1QGK B;  3I56 P;  1HJ0 A;  4H0L D;  5KLV G;  1PZQ A;  3H1I J;  3KDP B;  1NTZ G;  2R5D A;  3H1L D;  1FZC B;  1BE3 G;  1NAF A;  1S5L X;  4HB1 A;  1H8A A;  1URQ B;  3MIW A;  4UB8 E;  3NFQ A;  5AVW B;  1LNQ A;  1M7L A;  3CCE P;  1N7S D;  2P1J A;  2FYZ A;  2N1T C;  2A45 G;  1NAY A;  1KB9 D;  1RY3 A;  1HF9 A;  3MZW B;  1NGM B;  1K04 A;  2O1K A;  1YYC A;  1SVF A;  2AXC A;  3CXH E;  2FYU K;  2LKM A;  4YPC A;  2KYV A;  3V4Q A;  1AQT A;  4WB4 A;  1OVU A;  4PV1 B;  3WMM 0;  1LP1 B;  1Z56 A;  5AW4 B;  1YIT P;  2P58 A;  1IFI A;  3UIA A;  3AEF C;  1LWU C;  2JWA A;  2AEJ A;  2AXT H;  1NKZ B;  1K9M Q;  2FYU G;  4W80 A;  4H44 C;  1U57 A;  3D6Y A;  3M91 A;  4D6T E;  3PRJ A;  2CPB A;  2K9J B;  5CCH A;  2E76 C;  1S3J A;  1LTT C;  2OYH B;  1SQB J;  1L0N E;  1J1E C;  3CI9 A;  4H44 B;  3VTP C;  1UIX A;  2RH0 A;  2QRX A;  1RE3 A;  2XV5 A;  1JY2 N;  2P10 A;  3M9Q A;  3TF5 A;  2M8R A;  1LTB C;  3H1K D;  2FXO A;  3CCM P;  1S4X A;  1L0N K;  1W2E A;  1FZA A;  1WMK A;  3ABV C;  4YXW H;  4GIF A;  4XFJ A;  1JY3 P;  3M0A A;  1H0T B;  2HYN A;  3AEB C;  3E7K A;  2M3E A;  2YKO A;  1JOC A;  3H1L E;  4U3F J;  1SQX E;  1ZXG A;  1JY3 O;  2Z4E A;  1LTG C;  1N7L A;  2WMM A;  1NO4 A;  4UB8 H;  1IFD A;  1FZG A;  3FXE A;  1PGQ A;  1Y8A A;  1SQQ D;  3TGU E;  1M90 Q;  1NHL A;  2WSC H;  2BCC D;  2KOG A;  1KIL E;  4BRY B;  3CXH H;  5B5E E;  2B87 A;  3HUS C;  2XNX A;  1LTA C;  1JY2 P;  2FFD C;  3OAK A;  4HJG H;  2O01 N;  3H1L G;  1HH0 A;  1KQG B;  3TNU B;  1FZC A;  3IN6 A;  1XTG B;  1M1K Q;  1DIP A;  5KJ7 C;  1URQ A;  1VQP P;  2JP3 A;  1NTM E;  3BAS A;  2JJL A;  2IFM A;  1RF0 C;  2JDI H;  3BCC D;  4MN4 C;  5KLV J;  1IFN A;  1NTZ J;  2C9N Y;  2ZXE B;  1E5W A;  1NTM K;  3ITK A;  4AUW A;  3CXH I;  3L72 J;  1NTK E;  1PPJ D;  1BE3 J;  1SFC D;  2PAJ A;  3CLQ A;  1OXZ A;  5CCG A;  3TDK A;  1LP1 A;  3OA7 A;  1KV4 A;  3IFM A;  2DW3 A;  1NTK K;  2VRS A;  1OW7 A;  5E79 E;  2HLO A;  3RL0 g;  3Q5S A;  1VQ6 P;  3H1K E;  3S1K A;  1YHQ P;  3H1H E;  3VMA A;  1YI2 P;  3QWO C;  1EC5 A;  1BGY E;  1D7M A;  1DX7 A;  2K9J A;  1BCC E;  1KQS O;  3CCU P;  1HUC A;  1T3U A;  2QE7 H;  2OYH A;  1S5L E;  3OJA B;  2BEQ D;  1VQK P;  3B5N D;  1SQQ E;  1K05 A;  1YQ3 C;  3H1K G;  1ZN5 A;  4JF7 A;  2WSE H;  4Y99 C;  5B5E H;  1GL2 D;  4W7Z A;  1PP9 E;  1JCD A;  1VQL P;  1SQQ K;  2K1A A;  2Q3E A;  1EDJ A;  4H13 D;  1VQO P;  2YKP A;  1H0T A;  1IK9 A;  1KTM A;  1GU5 A;  1SQP E;  5APX A;  1QL1 A;  1CW5 A;  2LR2 A;  2Q6Q A;  1GD2 E;  4Y99 B;  4N78 D;  2MKV A;  1SQP K;  2BEZ F;  1M1J C;  1FZF A;  1BDC A;  1SQQ G;  4ZNC A;  4DCK A;  3AED C;  3GW6 A;  2ZVN B;  1NH4 A;  4D6T J;  3Q3D A;  3RK2 D;  1VF5 D;  3OW2 O;  2G3A A;  3MGN A;  1T6A A;  1M1J B;  2IYO A;  1L0N J;  1LT9 B;  2H89 C;  4I7Z C;  3RK3 D;  1FJK A;  5AVQ B;  4I1L A;  3TNU A;  5E79 H;  2E75 D;  2OYI C;  3CC2 P;  1RHZ B;  1RE4 C;  2ZT9 D;  5AW8 B;  1OWA A;  3BCC G;  2XDJ A;  1SQV E;  3V2N A;  2D2C C;  2KK7 A;  3V2P A;  2LXC B;  2OYI B;  1SS1 A;  2WZ7 A;  4EYY Q;  1SQX J;  3TK1 A;  1JB0 J;  1A02 J;  1G1I A;  1SQV K;  1EXI A;  3L74 E;  3HD7 D;  4K3A A;  1ZME C;  2PGD A;  1GW4 A;  2HR3 A;  2SPZ A;  1IJD B;  3IF4 A;  4LC1 A;  1E79 H;  3TGU J;  2ZYG A;  1OFC X;  1JNM A;  4HH2 A;  5AVU B;  1ZW0 A;  1L0L D;  4TLF A;  2WSE J;  2YMK A;  3CX5 D;  5CCH C;  1KOR A;  3I5C A;  3AEC C;  1FU1 A;  4YXD C;  1JTH B;  2AEF A;  3CC4 P;  3M0D C;  3CCR P;  1S9K E;  1RE3 C;  3L73 D;  5H2F E;  3H32 B;  2QA4 P;  1NTM J;  1P84 E;  2KIK A;  1USE A;  1OX3 A;  3AE4 C;  1EZV E;  3WU2 E;  5APQ A;  4OGQ C;  4I2L C;  1NJI Q;  2JWD A;  2ZXX A;  1NTK J;  2KZI A;  5KKZ C;  3L75 E;  3S4R A;  2OAR A;  1X0T A;  2Y9Y A;  3PH0 A;  1FAV A;  3AE9 C;  3H1J E;  1KC8 Q;  4WY4 D;  1J1D C;  1KZU B;  1L2P A;  5BVZ A;  3NTN A;  2ZJS E;  1VQ4 P;  3H1H J;  2XKM A;  5CJ0 A;  4RES B;  3RL0 D;  1BGY J;  3WUT A;  3KZI E;  4RO0 A;  1BCC J;  5DJT B;  5AW0 B;  1JMM A;  2FKW B;  1FZC C;  2YKQ A;  1K73 Q;  1M1J A;  3CCV P;  1LT9 A;  3HTK B;  1AJY A;  3C1L A;  1URQ C;  1W2B O;  2WT7 B;  2WSF H;  4XE5 B;  1L4A D;  2PRR A;  1HTL C;  3L70 D;  1PP9 J;  2IBZ D;  1KIL C;  3SFE C;  4ASW A;  2M0B A;  2B89 A;  1SQP J;  2OYI A;  3AE2 C;  5CCG C;  1N7S B;  3T97 B;  3V5B A;  1M56 D;  4PV1 C;  4PD4 E;  3CCJ P;  2FYU E;  1X9V A;  2XU6 A;  5H2F H;  1RE4 A;  1KIL B;  1P84 H;  3P32 A;  4DOJ A;  3I55 P;  2KUB A;  2RKL A;  1S1C X;  1FZE A;  3WU2 H;  1NU1 D;  2QIW A;  3A5T A;  3LIE A;  1L0L G;  3PLN A;  3VP9 A;  3CCQ P;  3KXD A;  1JY3 N;  3P8C E;  3JCU E;  2OGU A;  1QL2 A;  2OYH C;  4GKG A;  2HOD B;  1FDM A;  2N1T D;  1JTH A;  3TSI A;  1FJP A;  2E43 A;  2QJP C;  3L73 G;  1P84 I;  5CBN A;  3WUU A;  2YNY A;  3H32 A;  4OH8 B;  2H88 C;  1EZV I;  4C7N B;  1SQV J;  3KZI H;  2WSS H;  1ZRT E;  3M0D A;  4L74 A;  3V2R A;  4L73 A;  2A45 H;  2QJP B;  3O6Q B;  2ITA A;  3L74 J;  1LGH B;  2YO3 A;  3CWB D;  1PGJ A;  1X8Y A;  1Y47 A;  2AEM A;  3V4W A;  1IZN B;  2NPS C;  1Q81 Q;  1RQU A;  2WSF J;  2E76 D;  3PP5 A;  2OYO A;  3SFD C;  4C46 A;  2Q5U A;  2ZYD A;  2NPS B;  2A45 I;  1MFZ A;  4GT1 A;  4GOF A;  4PD4 H;  4EIJ A;  2IPP A;  3C9I A;  1EQ7 A;  3EFF K;  2MJZ A;  2R44 A;  5TIS E;  1OMI A;  3HTK A;  1KB9 E;  3MUD C;  3L71 D;  1HJB A;  1WT6 A;  2WT7 A;  1JM0 A;  5DJU B;  3H1I D;  2O3J A;  4ASV A;  2K9Y A;  3JCU H;  3V6I A;  1FBM A;  2N9Y B;  3GF3 A;  3L75 J;  1G1J A;  4AQR D;  3G3Z A;  1KFM A;  3H1J J;  2K3R A;  4PD4 I;  1N7S A;  3T97 A;  2OQQ A;  2WIT A;  2KSJ A;  2J58 A;  3PJS K;  3BRT B;  1KIL A;  1QEX A;  3AE5 C;  3AE6 C;  3QH9 A;  1SFC B;  4WWI A;  2K88 A;  3USS A;  2KSE A;  3CCS P;  5KJ7 D;  1VDF A;  2KXP B;  1RF1 C;  5AVX B;  2CK3 H;  3CWB E;  2HOD A;  1FDI A;  1U7M A;  1KYO D;  2QG4 A;  4BWN A;  3P8M C;  1EDK A;  2J5U A;  1EXJ A;  1T3J A;  2OTJ P;  1RF1 B;  3IR9 A;  5KAF E;  3MTU E;  4C7N A;  3MHV A;  2JR8 A;  4XA4 A;  1SQB D;  3V2Q A;  3HE4 B;  4PJ0 E;  1LTJ B;  2KNC B;  2ZYA A;  2ZAE B;  2FYU J;  3O6Q A;  5TIS H;  3CWB G;  3M9H A;  1G2C B;  2BCC E;  1KB9 H;  1ZR2 A;  2WSC J;  3CMA P;  4Y28 J;  1CZQ A;  1GL2 B;  3B8E B;  1UII A;  3Q5P A;  5KLI B;  4OWF A;  4H13 B;  2O01 H;  3F5H A; 
#chains in the Genus database with same CATH homology
 3WU2 H;  5E79 H;  3A0H H;  5KAF H;  5TIS H;  5H2F H;  3JCU H;  3A0B H;  1S5L H;  5B5E H;  4IL6 H;  4UB8 H;  2AXT H;  5GTH H;  5GTI H;  4PJ0 H;  5B66 H;  3KZI H;  4UB6 H;  5KAI H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...