2JP3A

Solution structure of the human fxyd4 (chif) protein in sds micelles
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
NGPVDKGSPFYYDWESLQLGGLIFGGLLCIAGIALALSGKCKCRRNHTPSSLPEKVTPLITPGSAST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FXYD domain-containing ion transport regulator 4
publication title Structural similarity of a membrane protein in micelles and membranes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transcription
total genus 14
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2007-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02038 ATP1G1_PLM_MAT8 ATP1G1/PLM/MAT8 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.780 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2jp3A00
2MKVA 2JP3A 1Y9BA 2JO1A
chains in the Genus database with same CATH superfamily
4W7ZA 3SFEC 3A0HE 1P84I 2ZXEB 1GL2D 3KZIH 5AVRB 1SQVJ 3WUVA 2NPSA 3CX5E 1FOSE 1HBWA 2M3BA 1JNMA 3JSVC 1CI6A 1QX8A 5KLIB 2YO3A 1SQBE 2W27A 3CCSP 1AA0A 4XE5B 4PV1C 1Q81Q 3HD7A 1VQOP 3GW6A 2IBZE 4EI2A 4N6JA 2LKMA 1JY2O 2GUVA 1X9VA 2FFDB 2SPZA 2A45I 2B89A 3MP7B 2QA4P 3OJAB 1SQQE 1N2DC 1G2CB 1U7JA 3AE6C 1JOCA 1LTIC 3HTKA 3VYIA 1JY3N 2M3EA 2WSFJ 4BRYA 1AVYA 2BCCE 3VMXA 5AVTB 3RL0B 2E42A 3B5NA 3H1KD 2KK7A 3OA7A 1MFTA 1W2BO 3RK3E 5CCHD 1ZP0C 1N73B 2R5DA 3L74D 3E1IA 2YXQB 1SQQK 3S9OA 3RBXA 1GU5A 2E74D 1KQSO 5AW4B 1M1JB 2W83C 2IX7C 1R8EA 4C7NA 2LR2A 3V2RA 3V2NA 1L4AC 1BCCJ 2H8PD 4Y99C 3H6PA 2B9BA 2A45H 2KLVA 3PH0A 4QMAA 1J1EB 3CX5D 4PJ0H 1YQ3C 4HJGH 1S3JA 4A7PA 1FZFA 1SQBD 2QJKB 3L73J 3Q5SA 1KN7A 1Y8AA 1L0LK 2YO2A 4NPDA 3P8MC 2C9NY 2NPSB 4GOEA 3G4SP 2XV5A 1VQ4P 1CI6B 2IBZD 2JKVA 1LGHB 3AEGC 1SQBG 1NKNA 5BVZA 2B87B 5GTIH 2E76D 1DIPA 2P2UA 4B86A 4PV1D 3HD7B 1GZLA 1SLQA 1KYOE 1LT1A 3KHUA 3N7NA 1NU1K 1SQQD 5KTBA 1BSNA 3E1RA 2KZIA 1AFOA 4O9BA 3LW5H 1KFMA 2QVAA 2BCCD 1K8AQ 2W6BA 1K04A 2BEQD 5AW3B 2P1JA 2AXCA 5GTHE 4AYCA 2M5AA 3FXEA 2Y0CA 3RK3D 5KAFH 3VMZA 2M8RA 4BRYB 1EDJA 3B5NB 3WU2H 1K9MQ 5AW9B 1RHZB 3W68A 1HJ0A 4M3LA 2YKOA 1UIIA 1VDFA 2Q9IA 1FU1A 1SVFA 2HODA 1EDLA 1KQGB 2PFXA 3FGAD 4C7NB 3O8ZA 3AECC 1LWUA 2KS1A 3AE3C 2GM4A 2QIWA 1YJ9P 1NAYA 1PPJG 1FOSF 4OH8B 1L4AD 2YIUC 3KDPB 3TDKA 2XZRA 3L36A 4IFDK 1RE4A 1FDMA 2WMMA 2UWJE 2N9BA 2IDBA 1GW4A 2IPPA 4LGDE 1PFIA 3U59A 4OGQB 1KYOD 3CI9A 4WY4C 1DD4A 3EFGA 1RF0C 2RN0A 1BSHA 1JUNA 1YTZT 1ZR2A 1AQ5A 2MJZA 4Y28J 2O3JA 3BCCJ 5KJ7C 4HH2A 2YMYA 2YKPA 1X79B 2WWWA 2JEEA 1H0TB 3Q5PA 3LIDA 2HG5D 3AE1C 2O01H 3P7KA 1PIXA 3L75E 1N7SD 4W80A 1BE3J 4U3FJ 3CX5I 2M5AB 2FYUE 3BCCG 3IAOA 2WVRA 2Y0EA 3OAKA 3M0AA 3GMAA 2PGDA 2XKMA 3VTPC 4Z1MH 1J2JB 1L2PA 3JCUE 5M1BA 4XFJA 1EDIA 1J1DB 5CCGC 4JF7A 1N8RQ 3B8EB 2R44A 4H13D 2IBZI 1BE3G 2ZT9B 1IFIA 2OTJP 2OYIC 4PD4E 1PGOA 1QGKB 1RQVA 2FYZA 1HF9A 2QG4A 1NAFA 2HODB 2PAJA 1NO4A 2HLOA 1DEEG 1IJDB 2R32A 1LWUB 3AE8C 3PTZA 5B66E 2ZXXA 3GF3A 2WPSA 1T6AA 3MHVA 3A0HH 2GA1A 4H44D 1URQD 1EDKA 1SQVE 2QJYB 3CX5H 2RMZA 1AQTA 2E5TA 1TU3F 1M90Q 1VQPP 1RY3A 1LTJC 3AE9C 3IFMA 1N86A 1GD2E 1RE3C 1KTMA 2Z5IA 3S4RA 3B4SA 4NPFX 3SWKA 1G1JA 3V4QA 4K35A 1OIPA 1D7MA 2POHA 1QL2A 3PP5A 2PRRA 5EFWB 5KKZB 3TGUJ 2FYUJ 1W5CE 3GHGA 5CJ4A 4GT1A 2FY8A 3L75D 2WT7A 2P58A 2IFNA 5KJ7D 2JWAA 3VMYA 2FYUD 1KV4A 2AXTH 2Z4EA 2D2CC 4N78E 2MKVA 4R4LA 3ABVC 1NYHA 3AE7C 2JWDA 2OYHC 2AEMA 3L75G 3IR9A 4UB6E 4GKGA 1M1JA 2FYUG 2NRGA 2WPQA 2FKWB 3AEFC 1S5LE 2PP6A 3D6ZA 1NOHA 2OYOA 4PD4D 1X0TA 1LT9C 4JBZA 1Q7YQ 3MIWA 1VF5C 1RH5B 3EWKA 1NTKJ 4WWIA 1KYOI 3H1JE 5BU5A 1KQLA 2WSEH 3QH9A 4YXDC 1ZMEC 1PV3A 1H88A 2WQYC 5CCGD 3HE4A 1S4XA 3FWLA 4I7ZC 3RK2C 2E76B 4DZOA 4ZNCA 2A06G 3V2PA 2YKQA 1IK9A 3I55P 3A0BE 1BCCE 1KILE 1YITP 1SQVD 1W2EA 4TLFA 2B87A 3MUDC 1LTSC 2QJPB 2K1AA 1N7SA 1VQLP 3L4FA 3L73E 1NH4A 1SQVG 3PHLA 5APUA 3RK3B 4W7YA 1YI2P 5AVVB 3KQGA 3UIAA 1SFCD 1RQUA 2R5BA 1Y47A 4L74A 5DJUB 3K5BA 1Q90D 2Q5UA 1SQBK 3RL0g 4MN4C 5KLIC 2KOGA 1KYOH 4IL6E 3VP9A 1AJYA 3F89A 1S9KE 1A02J 3AEBC 4N78D 3LIEA 4YTPC 3GHGB 1P84H 1YYCA 3D71A 2WT7B 2N1TD 2FFDC 3H1IE 3USSA 1VPCA 1NTME 1WMKA 1FZBA 5GTHH 2H88C 2FXOA 2WSCH 3H1JJ 2E75D 1QLED 1FDIA 1GK4A 3FXDA 5AVQB 1YTZI 3C1LA 1QVGO 1URQA 1G1IA 1NTZE 4OVNF 3H1JD 3CMAP 4RJTA 3RL0C 3AE2C 2GUSA 3SWYA 1PPJE 2Y9YA 4YPCA 3V5BA 3CCRP 3H25A 3BVHA 2YMKA 3H1JG 1VF5D 3M0DC 1N73C 1BCCD 1KILD 3H1LJ 3KZIE 3CCLP 3HE4B 3CXHI 4RKUJ 4L76A 1M56D 1SS1A 4HKZH 2O1KA 3RK2D 4UB8H 3VN0A 1VQ8P 3CCQP 3TYYA 1BCCG 1HVVA 1BDDA 2M0BA 3L73D 5KLVE 5AVZB 4L73A 3V6IA 5AW0B 1CZQA 2V7QJ 2NZ2A 1N7SB 4EIJA 1J1EC 3L70J 3MZWB 3L73G 1U7MA 3AEDC 2QJKC 3M9QA 1K73Q 1QL1A 2OARA 5CJ0A 3HUSA 3P32A 1T2KC 1YHQP 3H1HJ 1JY2N 1S9KD 3JC22 1H0TA 2NPSC 3L35A 3H1IJ 1OW8A 5KAIH 1NTMJ 1Z56A 3PLNA 2P7JA 4H13B 3V4WA 1JEKA 3H1ID 3L70G 1N7LA 1GW3A 2KB7P 3BCCE 2K9YA 1NTMD 2KNCA 1PL5A 1EXIA 1GL2A 3CXHH 1NTZJ 2Q6QA 3HD7C 1OW6A 2JO1A 1A02F 3AE5C 2KSEA 3H1HG 5K5GB 3H1IG 1OXZA 1AV1A 3FWNA 1M8OB 2Q1KA 2CPBA 1NTZD 2H89C 1NTMG 5C39A 3ZDMA 2OTKE 1BE3E 4U3FE 3C9IA 1L0LJ 1CSBA 1PPJD 1PP9E 4HB1A 1NGMB 4H44B 1URQB 2K3RA 1NTZG 2ZFCA 1S1CX 3BATA 2C9LY 2QE7H 4KT0J 5TJHA 1HH0A 1R5SA 1ZRTE 1SFCA 2R3CA 3O6QA 3Q1MA 3B5NC 1OFCX 5APSA 5KLVJ 3R2PA 3E7KA 5KLVD 5CBOA 3AEAC 2XU6A 5AW7B 2J59M 3AEEC 1OWAA 2N1TA 2IFMA 5B66H 5AW1B 5GTIE 2I8DA 5KLVG 5CCHA 4JQ0D 3KXDA 3CPWO 2W6AA 1HGVA 1IFNA 4BXLA 2VRSA 1NWQA 2W8ZA 2QEXP 1KORA 2JP3A 1E5WA 1JO5A 3BCCD 3HUSB 1FZCA 5B5EE 2O01N 2IYOA 3WUUA 1RF1A 4OGQC 4ZKPA 1JY3P 4ASWA 1T2KD 3L71J 3MTUE 4ZMDA 2NPSD 3M9HA 1EZVE 2KSJA 5APQA 1KILA 2ZAEB 3TGUE 2FYNB 3WMM0 1U57A 3G9RA 2KNCB 5APVA 1PP9J 3WU2E 1BE3D 1WT6A 4U3FD 1GL2B 3CLQA 3KYQA 1FJPA 2JDIH 1SQPE 5AW5B 1WRGA 3CWBJ 1PP9D 1S5LX 3W67A 2OGUA 3NMDA 1YIJP 1FZAA 4H0LC 4U3FG 2WSFH 1E79H 5AVSB 1ZRTD 2ZYDA 1S5LH 3R4YA 1PP9G 2FYUK 3Q5RA 2A06E 1MUUA 1BDCA 4C7RA 2AEFA 3CWBG 1UIXA 2A45G 1Q86Q 2Q7CA 1SFCB 4KHXA 3O6QB 5AW6B 1NTKE 1ZOYC 1LTTC 1OMIA 1J1DC 1T3JA 1YBKA 4JYCA 4RESB 2HPCA 3EQ2A 1GTWA 2DW3A 2ZT9C 3A0BH 3LW5J 2CPSA 2N1TB 1KMIZ 1FAVA 2L5GB 3CC7P 3H32A 1LWUC 2C0WA 3EFFK 4R4MA 3GG2A 1SQXE 4LC1A 4WY4D 1L0NE 2E75B 2J58A 1HTLC 2E74B 2XNDH 2KLUA 1K05A 1IFMA 1SQVK 3FX0A 2QJYC 1EZVD 5APWA 1RE4C 3TGUD 1SQPJ 1IZNB 1FBMA 1T3UA 1FZCB 3CC4P 1RF1B 1YJNP 1L4AA 1SQPD 5CCHC 2Y9ZA 2QSIA 1EZVG 1GK6A 2B88A 3M9BA 1KILB 1ZW0A 3G6EP 3TGUG 3TSIA 4ZKUA 1HWTC 1IO4A 2YNYA 1EXJA 5KKZC 2W90A 2ITAA 2G8YA 3RK2B 2V4HA 1JB0J 1SQPG 2KZJA 1CW5A 1LTBC 2J5UA 3HRNA 2A06D 4IFFA 4GIFA 2AEJA 3NTNA 5TISE 1KB9E 1NTKD 4H0LD 1ZXGA 4PV1B 3VMAA 4LLHA 1HGZA 2HFED 1JTHB 3C8VA 2QM8A 1NTKG 4EOTA 3A2AA 2KXPB 4OWFA 3H1LE 4D6TE 2Y0DA 2HPCB 1SQXJ 2K88A 1GDTA 1MFZA 1L0NJ 2E76C 1NKZB 1KZUB 1SQXD 2LXBA 2ZT9D 3WUTA 1L0ND 2XNXA 1HUCA 2O01J 3H32B 2K37A 4GOFA 1SQXG 3L70E 3V2QA 1NHLA 3N4XA 2QJPC 2IZ0A 1L0NG 1IFDA 1FE6A 2KUBA 3CD6P 4L75A 4ASVA 3OW2O 2WZ7A 1IC2A 2AXTE 3RK3C 3H1HE 2WSSH 3GF7A 1YQ4C 1NVOA 5DJTB 3H1KJ 1OW7A 1L4AB 4K3AA 1KC8Q 2Q3EA 2D2CD 4Y99B 1VL2A 3L74J 3CCEP 1FDOA 1ZV8A 3SFDC 2QRXA 5E79E 3U1AA 1OVVA 2H43A 3BRTB 1FZGA 3S1KA 2ZJSE 3GHGC 2FXMA 1KB9D 3PRJA 3SWFA 5H2FE 1ZLLA 3H1KG 1NTMK 1L0LE 2Q3IA 2W6JH 2HYNA 1GU4A 1JM0A 3TF5A 1OZHA 4D6TJ 2I1KA 3L74G 3G3ZA 5APTA 4WY4A 3HE5A 2KYVA 1RF0A 4I6MC 1NTZK 3H1LD 4D6TD 1M1JC 1SQBJ 3D70A 1EZVI 5KJ7A 5AW8B 3U1CA 2KI7B 1PGQA 1NU1E 2JR8A 1VQKP 5CMZA 3H1LG 4D6TG 1JMBA 3CCVP 3T97A 3P8CE 5CHXA 3ITKA 1MZ9A 1LJ2A 4I2LC 3VP8A 3L72E 3L70D 1PZQA 4GDOA 1SQQJ 1BGYE 4PD4I 1QVFO 1FJKA 5KLVK 2IBZG 2L91A 4WBAA 2E5YA 3H1HD 4DOJA 2E43A 2BCCJ 5AVYB 1HJBA 5CCGA 3I56P 1P84E 1ZR4A 4JYBA 1N7SC 2BEZF 2OYIA 1USDA 4YXWH 4I1LA 3L37A 1SQQG 2K9JA 1SP4A 5B5EH 3CCMP 1XTGB 3L71E 2WSEJ 3HTKB 1AVOA 3TNUA 2BCCG 1X8YA 4H13C 1T8ZA 2YIUB 1L0LD 3CC2P 3B71A 4KJMA 3JCUH 3CWBE 1KFNA 2KIKA 4PJ0E 2IYPA 4AUWA 3RL0D 1L0LG 5CBNA 4PD4H 3F5HA 1NU1J 1M57D 1LTJA 5AW2B 1RE3A 3SSUA 4HYTB 4UB8E 4WY4B 3I5CA 1NU1D 3HE5B 3RGUA 2HR3A 4H44C 1URQC 2H7HA 4NPEA 4TT3H 1XTCC 2RKLA 3L72J 5AVUB 2N9YB 3P8CD 1BGYJ 1OVUA 3NXSA 1NU1G 2ZVOB 3L72D 2OTLP 3A7OA 1BGYD 1USEA 3GLMA 2IZ1A 1LTGC 3T97B 1H89A 4U7JA 2OYHA 1LP1A 1JCCA 1QEXA 2XDJA 1KD1Q 2RH0A 3L72G 5KAIE 1KQFB 3VOPA 4CPGA 1P84D 1BGYG 1OVRA 1VQMP 1DD3A 4WB4A 1KB9I 1NJIQ 2WSCJ 3M91A 5APXA 4GODA 1R5LA 5AVWB 1FC2C 1M1KQ 1ZN5A 1LT9A 3KPEA 2Z5HA 1S2EA 5KAFE 1Y9BA 1YJWP 3CXHE 3CCUP 3L71D 4C46A 4H0LB 2FXPA 2JJLA 2CK3H 1PGPA 1VQNP 4EDFA 2OYIB 4JPZB 3QWOC 2LXCB 3D6YA 2K9JB 1Q2NA 3HD7D 1IFJA 3CMEP 1EQ7A 3HUSC 3L71G 3PJSK 3CCJP 3TNUB 3CWBD 4UB6H 4AQRD 2WTYA 3MUDA 2FYNC 2P10A 3Q2YA 1Q82Q 2ZYAA 1VQ6P 1JTHA 1GL2C 2C0XA 1SQPK 1S72P 3IF4A 2BASA 5BU8B 5TISH 1KB9H 3B5ND 4RO0A 1LTJB 2G3AA 1VQ7P 2P67A 1VQ9P 3CL3D 3IN6A 4IOIH 2KS1B 4DT0A 2R3SA 2OQQA 3MD0A 3AE4C 1FS0E 1X22A 4XA4A 4EYYQ 2ZVNB 2O1JA 4WVZA 2I1JA 2WITA 1NTKK 1SFCC 1MV8A 1LNQA 3M06A 2FFDA 3MGNA 5L8RJ 1FZEA 3BASA 1DH3A 2D2CB 1JCDA 1DEBA 1JY2P 2OYHB 1LP1B 4IL6X 3TK1A 1JY3O 1IFPA 3CXHD 1JMMA 1G2CA 3L75J 2V7QH 3NFQA 5AVXB 3A5TA 1PGJA 3II6A 2N1TC 2KP8A 4IL6H 1VQ5P 4DCKA 1LT9B 1OX3A 3BRVB 1SQXK 1VF5B 4OGQD 4DJGA 1L0NK 2E75C 3M0DA 1N73A 3G71P 2E74C 2WPRA 2ZYGA 1H8AA 4I7ZB 2WPVB 3H1KE 2YXRB 4IFMA 1M7LA 2FBWC 1FZCC 5APYA 3L74E 1RF1C 1EC5A 1GMJA 2QM7A 5E79H 4BWNA 3A3YB 1LTAC 1KILC 1DX7A 3RBZA 4N3YB 1IK7A 3Q3DA 5H2FH 1MKMA
chains in the Genus database with same CATH topology
3AEFC 4H13C 4OGQB 1S5LX 2ZT9D 3AEBC 3SFEC 1Y9BA 3D6ZA 3S9OA 1K04A 4YTPC 2BEQD 5L8RJ 2E74D 3AE8C 4H0LC 3B71A 3D71A 1DD4A 3AEDC 2O01J 3D70A 1VF5C 3GF3A 2D2CB 2FXPA 4H0LB 3EWKA 2QJKC 2QSIA 3R4YA 1R8EA 3AEAC 1WMKA 3Q5RA 4YXDC 1ZMEC 4Y28J 1PV3A 4H44D 3D6YA 3AEEC 2WQYC 4IL6X 1OW8A 2QJPC 2H88C 4I7ZC 1EXJA 4PV1C 1UIXA 2E75D 2E76B 5KKZC 1FDIA 4H13B 1HJ0A 2G8YA 1JB0J 1TU3F 1ZOYC 2K9YA 3AE9C 3Q5PA 1OMIA 3GF7A 2J5UA 1KILE 1YQ4C 1YQ3C 3AE1C 1KTMA 1VF5B 4H44C 1PL5A 1PIXA 4GDOA 4OGQD 1EXIA 1OW6A 3AE2C 3Q5SA 2FYNC 2JO1A 3AE5C 4TT3H 2P10A 2ZT9C 3Q2YA 2E75C 1OW7A 3IAOA 2E74C 1KQGB 1KORA 2JP3A 2D2CD 4H0LD 3H25A 3FGAD 1VL2A 4I7ZB 2H89C 3GMAA 4PV1B 2WPVB 3LW5J 2YMKA 3AECC 1VF5D 1FDOA 3AE3C 4Z1MH 3AEGC 3SFDC 2QIWA 1KMIZ 4OGQC 4RKUJ 5M1BA 3GLMA 3AE6C 2FBWC 4XFJA 2YIUC 2E76D 3T97B 3C8VA 2G3AA 1DIPA 4R4MA 2BEZF 4U7JA 3IN6A 4H13D 1NGMB 4H44B 2WSFJ 4PV1D 1RQUA 1S1CX 1U57A 2D2CC 1GMJA 2OQQA 2MKVA 4R4LA 3G9RA 2ZT9B 3AE4C 4KT0J 2E75B 1Q90D 3ABVC 1NYHA 3AE7C 1KQFB 2E74B 2WSEJ 1RQVA 3RL0g 1ZRTE 1K05A 1HF9A 5KLIC 3O6QA 3RK3E 1DD3A 3Q1MA 1IK7A 3Q3DA 1ZP0C 2IDBA 2WSCJ 2QJYC 1MKMA 2E76C 2V7QJ 1AJYA 2NZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MKV A;  2JP3 A;  1Y9B A;  2JO1 A; 
#chains in the Genus database with same CATH topology
 4W7Z A;  3SFE C;  3A0H E;  1P84 I;  2ZXE B;  1GL2 D;  3KZI H;  5AVR B;  1SQV J;  3WUV A;  2NPS A;  3CX5 E;  1FOS E;  1HBW A;  2M3B A;  1JNM A;  3JSV C;  1CI6 A;  1QX8 A;  5KLI B;  2YO3 A;  1SQB E;  2W27 A;  3CCS P;  1AA0 A;  4XE5 B;  4PV1 C;  1Q81 Q;  3HD7 A;  1VQO P;  3GW6 A;  2IBZ E;  4EI2 A;  4N6J A;  2LKM A;  1JY2 O;  2GUV A;  1X9V A;  2FFD B;  2SPZ A;  2A45 I;  2B89 A;  3MP7 B;  2QA4 P;  3OJA B;  1SQQ E;  1N2D C;  1G2C B;  1U7J A;  3AE6 C;  1JOC A;  1LTI C;  3HTK A;  3VYI A;  1JY3 N;  2M3E A;  2WSF J;  4BRY A;  1AVY A;  2BCC E;  3VMX A;  5AVT B;  3RL0 B;  2E42 A;  3B5N A;  3H1K D;  2KK7 A;  3OA7 A;  1MFT A;  1W2B O;  3RK3 E;  5CCH D;  1ZP0 C;  1N73 B;  2R5D A;  3L74 D;  3E1I A;  2YXQ B;  1SQQ K;  3S9O A;  3RBX A;  1GU5 A;  2E74 D;  1KQS O;  5AW4 B;  1M1J B;  2W83 C;  2IX7 C;  1R8E A;  4C7N A;  2LR2 A;  3V2R A;  3V2N A;  1L4A C;  1BCC J;  2H8P D;  4Y99 C;  3H6P A;  2B9B A;  2A45 H;  2KLV A;  3PH0 A;  4QMA A;  1J1E B;  3CX5 D;  4PJ0 H;  1YQ3 C;  4HJG H;  1S3J A;  4A7P A;  1FZF A;  1SQB D;  2QJK B;  3L73 J;  3Q5S A;  1KN7 A;  1Y8A A;  1L0L K;  2YO2 A;  4NPD A;  3P8M C;  2C9N Y;  2NPS B;  4GOE A;  3G4S P;  2XV5 A;  1VQ4 P;  1CI6 B;  2IBZ D;  2JKV A;  1LGH B;  3AEG C;  1SQB G;  1NKN A;  5BVZ A;  2B87 B;  5GTI H;  2E76 D;  1DIP A;  2P2U A;  4B86 A;  4PV1 D;  3HD7 B;  1GZL A;  1SLQ A;  1KYO E;  1LT1 A;  3KHU A;  3N7N A;  1NU1 K;  1SQQ D;  5KTB A;  1BSN A;  3E1R A;  2KZI A;  1AFO A;  4O9B A;  3LW5 H;  1KFM A;  2QVA A;  2BCC D;  1K8A Q;  2W6B A;  1K04 A;  2BEQ D;  5AW3 B;  2P1J A;  2AXC A;  5GTH E;  4AYC A;  2M5A A;  3FXE A;  2Y0C A;  3RK3 D;  5KAF H;  3VMZ A;  2M8R A;  4BRY B;  1EDJ A;  3B5N B;  3WU2 H;  1K9M Q;  5AW9 B;  1RHZ B;  3W68 A;  1HJ0 A;  4M3L A;  2YKO A;  1UII A;  1VDF A;  2Q9I A;  1FU1 A;  1SVF A;  2HOD A;  1EDL A;  1KQG B;  2PFX A;  3FGA D;  4C7N B;  3O8Z A;  3AEC C;  1LWU A;  2KS1 A;  3AE3 C;  2GM4 A;  2QIW A;  1YJ9 P;  1NAY A;  1PPJ G;  1FOS F;  4OH8 B;  1L4A D;  2YIU C;  3KDP B;  3TDK A;  2XZR A;  3L36 A;  4IFD K;  1RE4 A;  1FDM A;  2WMM A;  2UWJ E;  2N9B A;  2IDB A;  1GW4 A;  2IPP A;  4LGD E;  1PFI A;  3U59 A;  4OGQ B;  1KYO D;  3CI9 A;  4WY4 C;  1DD4 A;  3EFG A;  1RF0 C;  2RN0 A;  1BSH A;  1JUN A;  1YTZ T;  1ZR2 A;  1AQ5 A;  2MJZ A;  4Y28 J;  2O3J A;  3BCC J;  5KJ7 C;  4HH2 A;  2YMY A;  2YKP A;  1X79 B;  2WWW A;  2JEE A;  1H0T B;  3Q5P A;  3LID A;  2HG5 D;  3AE1 C;  2O01 H;  3P7K A;  1PIX A;  3L75 E;  1N7S D;  4W80 A;  1BE3 J;  4U3F J;  3CX5 I;  2M5A B;  2FYU E;  3BCC G;  3IAO A;  2WVR A;  2Y0E A;  3OAK A;  3M0A A;  3GMA A;  2PGD A;  2XKM A;  3VTP C;  4Z1M H;  1J2J B;  1L2P A;  3JCU E;  5M1B A;  4XFJ A;  1EDI A;  1J1D B;  5CCG C;  4JF7 A;  1N8R Q;  3B8E B;  2R44 A;  4H13 D;  2IBZ I;  1BE3 G;  2ZT9 B;  1IFI A;  2OTJ P;  2OYI C;  4PD4 E;  1PGO A;  1QGK B;  1RQV A;  2FYZ A;  1HF9 A;  2QG4 A;  1NAF A;  2HOD B;  2PAJ A;  1NO4 A;  2HLO A;  1DEE G;  1IJD B;  2R32 A;  1LWU B;  3AE8 C;  3PTZ A;  5B66 E;  2ZXX A;  3GF3 A;  2WPS A;  1T6A A;  3MHV A;  3A0H H;  2GA1 A;  4H44 D;  1URQ D;  1EDK A;  1SQV E;  2QJY B;  3CX5 H;  2RMZ A;  1AQT A;  2E5T A;  1TU3 F;  1M90 Q;  1VQP P;  1RY3 A;  1LTJ C;  3AE9 C;  3IFM A;  1N86 A;  1GD2 E;  1RE3 C;  1KTM A;  2Z5I A;  3S4R A;  3B4S A;  4NPF X;  3SWK A;  1G1J A;  3V4Q A;  4K35 A;  1OIP A;  1D7M A;  2POH A;  1QL2 A;  3PP5 A;  2PRR A;  5EFW B;  5KKZ B;  3TGU J;  2FYU J;  1W5C E;  3GHG A;  5CJ4 A;  4GT1 A;  2FY8 A;  3L75 D;  2WT7 A;  2P58 A;  2IFN A;  5KJ7 D;  2JWA A;  3VMY A;  2FYU D;  1KV4 A;  2AXT H;  2Z4E A;  2D2C C;  4N78 E;  2MKV A;  4R4L A;  3ABV C;  1NYH A;  3AE7 C;  2JWD A;  2OYH C;  2AEM A;  3L75 G;  3IR9 A;  4UB6 E;  4GKG A;  1M1J A;  2FYU G;  2NRG A;  2WPQ A;  2FKW B;  3AEF C;  1S5L E;  2PP6 A;  3D6Z A;  1NOH A;  2OYO A;  4PD4 D;  1X0T A;  1LT9 C;  4JBZ A;  1Q7Y Q;  3MIW A;  1VF5 C;  1RH5 B;  3EWK A;  1NTK J;  4WWI A;  1KYO I;  3H1J E;  5BU5 A;  1KQL A;  2WSE H;  3QH9 A;  4YXD C;  1ZME C;  1PV3 A;  1H88 A;  2WQY C;  5CCG D;  3HE4 A;  1S4X A;  3FWL A;  4I7Z C;  3RK2 C;  2E76 B;  4DZO A;  4ZNC A;  2A06 G;  3V2P A;  2YKQ A;  1IK9 A;  3I55 P;  3A0B E;  1BCC E;  1KIL E;  1YIT P;  1SQV D;  1W2E A;  4TLF A;  2B87 A;  3MUD C;  1LTS C;  2QJP B;  2K1A A;  1N7S A;  1VQL P;  3L4F A;  3L73 E;  1NH4 A;  1SQV G;  3PHL A;  5APU A;  3RK3 B;  4W7Y A;  1YI2 P;  5AVV B;  3KQG A;  3UIA A;  1SFC D;  1RQU A;  2R5B A;  1Y47 A;  4L74 A;  5DJU B;  3K5B A;  1Q90 D;  2Q5U A;  1SQB K;  3RL0 g;  4MN4 C;  5KLI C;  2KOG A;  1KYO H;  4IL6 E;  3VP9 A;  1AJY A;  3F89 A;  1S9K E;  1A02 J;  3AEB C;  4N78 D;  3LIE A;  4YTP C;  3GHG B;  1P84 H;  1YYC A;  3D71 A;  2WT7 B;  2N1T D;  2FFD C;  3H1I E;  3USS A;  1VPC A;  1NTM E;  1WMK A;  1FZB A;  5GTH H;  2H88 C;  2FXO A;  2WSC H;  3H1J J;  2E75 D;  1QLE D;  1FDI A;  1GK4 A;  3FXD A;  5AVQ B;  1YTZ I;  3C1L A;  1QVG O;  1URQ A;  1G1I A;  1NTZ E;  4OVN F;  3H1J D;  3CMA P;  4RJT A;  3RL0 C;  3AE2 C;  2GUS A;  3SWY A;  1PPJ E;  2Y9Y A;  4YPC A;  3V5B A;  3CCR P;  3H25 A;  3BVH A;  2YMK A;  3H1J G;  1VF5 D;  3M0D C;  1N73 C;  1BCC D;  1KIL D;  3H1L J;  3KZI E;  3CCL P;  3HE4 B;  3CXH I;  4RKU J;  4L76 A;  1M56 D;  1SS1 A;  4HKZ H;  2O1K A;  3RK2 D;  4UB8 H;  3VN0 A;  1VQ8 P;  3CCQ P;  3TYY A;  1BCC G;  1HVV A;  1BDD A;  2M0B A;  3L73 D;  5KLV E;  5AVZ B;  4L73 A;  3V6I A;  5AW0 B;  1CZQ A;  2V7Q J;  2NZ2 A;  1N7S B;  4EIJ A;  1J1E C;  3L70 J;  3MZW B;  3L73 G;  1U7M A;  3AED C;  2QJK C;  3M9Q A;  1K73 Q;  1QL1 A;  2OAR A;  5CJ0 A;  3HUS A;  3P32 A;  1T2K C;  1YHQ P;  3H1H J;  1JY2 N;  1S9K D;  3JC2 2;  1H0T A;  2NPS C;  3L35 A;  3H1I J;  1OW8 A;  5KAI H;  1NTM J;  1Z56 A;  3PLN A;  2P7J A;  4H13 B;  3V4W A;  1JEK A;  3H1I D;  3L70 G;  1N7L A;  1GW3 A;  2KB7 P;  3BCC E;  2K9Y A;  1NTM D;  2KNC A;  1PL5 A;  1EXI A;  1GL2 A;  3CXH H;  1NTZ J;  2Q6Q A;  3HD7 C;  1OW6 A;  2JO1 A;  1A02 F;  3AE5 C;  2KSE A;  3H1H G;  5K5G B;  3H1I G;  1OXZ A;  1AV1 A;  3FWN A;  1M8O B;  2Q1K A;  2CPB A;  1NTZ D;  2H89 C;  1NTM G;  5C39 A;  3ZDM A;  2OTK E;  1BE3 E;  4U3F E;  3C9I A;  1L0L J;  1CSB A;  1PPJ D;  1PP9 E;  4HB1 A;  1NGM B;  4H44 B;  1URQ B;  2K3R A;  1NTZ G;  2ZFC A;  1S1C X;  3BAT A;  2C9L Y;  2QE7 H;  4KT0 J;  5TJH A;  1HH0 A;  1R5S A;  1ZRT E;  1SFC A;  2R3C A;  3O6Q A;  3Q1M A;  3B5N C;  1OFC X;  5APS A;  5KLV J;  3R2P A;  3E7K A;  5KLV D;  5CBO A;  3AEA C;  2XU6 A;  5AW7 B;  2J59 M;  3AEE C;  1OWA A;  2N1T A;  2IFM A;  5B66 H;  5AW1 B;  5GTI E;  2I8D A;  5KLV G;  5CCH A;  4JQ0 D;  3KXD A;  3CPW O;  2W6A A;  1HGV A;  1IFN A;  4BXL A;  2VRS A;  1NWQ A;  2W8Z A;  2QEX P;  1KOR A;  2JP3 A;  1E5W A;  1JO5 A;  3BCC D;  3HUS B;  1FZC A;  5B5E E;  2O01 N;  2IYO A;  3WUU A;  1RF1 A;  4OGQ C;  4ZKP A;  1JY3 P;  4ASW A;  1T2K D;  3L71 J;  3MTU E;  4ZMD A;  2NPS D;  3M9H A;  1EZV E;  2KSJ A;  5APQ A;  1KIL A;  2ZAE B;  3TGU E;  2FYN B;  3WMM 0;  1U57 A;  3G9R A;  2KNC B;  5APV A;  1PP9 J;  3WU2 E;  1BE3 D;  1WT6 A;  4U3F D;  1GL2 B;  3CLQ A;  3KYQ A;  1FJP A;  2JDI H;  1SQP E;  5AW5 B;  1WRG A;  3CWB J;  1PP9 D;  1S5L X;  3W67 A;  2OGU A;  3NMD A;  1YIJ P;  1FZA A;  4H0L C;  4U3F G;  2WSF H;  1E79 H;  5AVS B;  1ZRT D;  2ZYD A;  1S5L H;  3R4Y A;  1PP9 G;  2FYU K;  3Q5R A;  2A06 E;  1MUU A;  1BDC A;  4C7R A;  2AEF A;  3CWB G;  1UIX A;  2A45 G;  1Q86 Q;  2Q7C A;  1SFC B;  4KHX A;  3O6Q B;  5AW6 B;  1NTK E;  1ZOY C;  1LTT C;  1OMI A;  1J1D C;  1T3J A;  1YBK A;  4JYC A;  4RES B;  2HPC A;  3EQ2 A;  1GTW A;  2DW3 A;  2ZT9 C;  3A0B H;  3LW5 J;  2CPS A;  2N1T B;  1KMI Z;  1FAV A;  2L5G B;  3CC7 P;  3H32 A;  1LWU C;  2C0W A;  3EFF K;  4R4M A;  3GG2 A;  1SQX E;  4LC1 A;  4WY4 D;  1L0N E;  2E75 B;  2J58 A;  1HTL C;  2E74 B;  2XND H;  2KLU A;  1K05 A;  1IFM A;  1SQV K;  3FX0 A;  2QJY C;  1EZV D;  5APW A;  1RE4 C;  3TGU D;  1SQP J;  1IZN B;  1FBM A;  1T3U A;  1FZC B;  3CC4 P;  1RF1 B;  1YJN P;  1L4A A;  1SQP D;  5CCH C;  2Y9Z A;  2QSI A;  1EZV G;  1GK6 A;  2B88 A;  3M9B A;  1KIL B;  1ZW0 A;  3G6E P;  3TGU G;  3TSI A;  4ZKU A;  1HWT C;  1IO4 A;  2YNY A;  1EXJ A;  5KKZ C;  2W90 A;  2ITA A;  2G8Y A;  3RK2 B;  2V4H A;  1JB0 J;  1SQP G;  2KZJ A;  1CW5 A;  1LTB C;  2J5U A;  3HRN A;  2A06 D;  4IFF A;  4GIF A;  2AEJ A;  3NTN A;  5TIS E;  1KB9 E;  1NTK D;  4H0L D;  1ZXG A;  4PV1 B;  3VMA A;  4LLH A;  1HGZ A;  2HFE D;  1JTH B;  3C8V A;  2QM8 A;  1NTK G;  4EOT A;  3A2A A;  2KXP B;  4OWF A;  3H1L E;  4D6T E;  2Y0D A;  2HPC B;  1SQX J;  2K88 A;  1GDT A;  1MFZ A;  1L0N J;  2E76 C;  1NKZ B;  1KZU B;  1SQX D;  2LXB A;  2ZT9 D;  3WUT A;  1L0N D;  2XNX A;  1HUC A;  2O01 J;  3H32 B;  2K37 A;  4GOF A;  1SQX G;  3L70 E;  3V2Q A;  1NHL A;  3N4X A;  2QJP C;  2IZ0 A;  1L0N G;  1IFD A;  1FE6 A;  2KUB A;  3CD6 P;  4L75 A;  4ASV A;  3OW2 O;  2WZ7 A;  1IC2 A;  2AXT E;  3RK3 C;  3H1H E;  2WSS H;  3GF7 A;  1YQ4 C;  1NVO A;  5DJT B;  3H1K J;  1OW7 A;  1L4A B;  4K3A A;  1KC8 Q;  2Q3E A;  2D2C D;  4Y99 B;  1VL2 A;  3L74 J;  3CCE P;  1FDO A;  1ZV8 A;  3SFD C;  2QRX A;  5E79 E;  3U1A A;  1OVV A;  2H43 A;  3BRT B;  1FZG A;  3S1K A;  2ZJS E;  3GHG C;  2FXM A;  1KB9 D;  3PRJ A;  3SWF A;  5H2F E;  1ZLL A;  3H1K G;  1NTM K;  1L0L E;  2Q3I A;  2W6J H;  2HYN A;  1GU4 A;  1JM0 A;  3TF5 A;  1OZH A;  4D6T J;  2I1K A;  3L74 G;  3G3Z A;  5APT A;  4WY4 A;  3HE5 A;  2KYV A;  1RF0 A;  4I6M C;  1NTZ K;  3H1L D;  4D6T D;  1M1J C;  1SQB J;  3D70 A;  1EZV I;  5KJ7 A;  5AW8 B;  3U1C A;  2KI7 B;  1PGQ A;  1NU1 E;  2JR8 A;  1VQK P;  5CMZ A;  3H1L G;  4D6T G;  1JMB A;  3CCV P;  3T97 A;  3P8C E;  5CHX A;  3ITK A;  1MZ9 A;  1LJ2 A;  4I2L C;  3VP8 A;  3L72 E;  3L70 D;  1PZQ A;  4GDO A;  1SQQ J;  1BGY E;  4PD4 I;  1QVF O;  1FJK A;  5KLV K;  2IBZ G;  2L91 A;  4WBA A;  2E5Y A;  3H1H D;  4DOJ A;  2E43 A;  2BCC J;  5AVY B;  1HJB A;  5CCG A;  3I56 P;  1P84 E;  1ZR4 A;  4JYB A;  1N7S C;  2BEZ F;  2OYI A;  1USD A;  4YXW H;  4I1L A;  3L37 A;  1SQQ G;  2K9J A;  1SP4 A;  5B5E H;  3CCM P;  1XTG B;  3L71 E;  2WSE J;  3HTK B;  1AVO A;  3TNU A;  2BCC G;  1X8Y A;  4H13 C;  1T8Z A;  2YIU B;  1L0L D;  3CC2 P;  3B71 A;  4KJM A;  3JCU H;  3CWB E;  1KFN A;  2KIK A;  4PJ0 E;  2IYP A;  4AUW A;  3RL0 D;  1L0L G;  5CBN A;  4PD4 H;  3F5H A;  1NU1 J;  1M57 D;  1LTJ A;  5AW2 B;  1RE3 A;  3SSU A;  4HYT B;  4UB8 E;  4WY4 B;  3I5C A;  1NU1 D;  3HE5 B;  3RGU A;  2HR3 A;  4H44 C;  1URQ C;  2H7H A;  4NPE A;  4TT3 H;  1XTC C;  2RKL A;  3L72 J;  5AVU B;  2N9Y B;  3P8C D;  1BGY J;  1OVU A;  3NXS A;  1NU1 G;  2ZVO B;  3L72 D;  2OTL P;  3A7O A;  1BGY D;  1USE A;  3GLM A;  2IZ1 A;  1LTG C;  3T97 B;  1H89 A;  4U7J A;  2OYH A;  1LP1 A;  1JCC A;  1QEX A;  2XDJ A;  1KD1 Q;  2RH0 A;  3L72 G;  5KAI E;  1KQF B;  3VOP A;  4CPG A;  1P84 D;  1BGY G;  1OVR A;  1VQM P;  1DD3 A;  4WB4 A;  1KB9 I;  1NJI Q;  2WSC J;  3M91 A;  5APX A;  4GOD A;  1R5L A;  5AVW B;  1FC2 C;  1M1K Q;  1ZN5 A;  1LT9 A;  3KPE A;  2Z5H A;  1S2E A;  5KAF E;  1Y9B A;  1YJW P;  3CXH E;  3CCU P;  3L71 D;  4C46 A;  4H0L B;  2FXP A;  2JJL A;  2CK3 H;  1PGP A;  1VQN P;  4EDF A;  2OYI B;  4JPZ B;  3QWO C;  2LXC B;  3D6Y A;  2K9J B;  1Q2N A;  3HD7 D;  1IFJ A;  3CME P;  1EQ7 A;  3HUS C;  3L71 G;  3PJS K;  3CCJ P;  3TNU B;  3CWB D;  4UB6 H;  4AQR D;  2WTY A;  3MUD A;  2FYN C;  2P10 A;  3Q2Y A;  1Q82 Q;  2ZYA A;  1VQ6 P;  1JTH A;  1GL2 C;  2C0X A;  1SQP K;  1S72 P;  3IF4 A;  2BAS A;  5BU8 B;  5TIS H;  1KB9 H;  3B5N D;  4RO0 A;  1LTJ B;  2G3A A;  1VQ7 P;  2P67 A;  1VQ9 P;  3CL3 D;  3IN6 A;  4IOI H;  2KS1 B;  4DT0 A;  2R3S A;  2OQQ A;  3MD0 A;  3AE4 C;  1FS0 E;  1X22 A;  4XA4 A;  4EYY Q;  2ZVN B;  2O1J A;  4WVZ A;  2I1J A;  2WIT A;  1NTK K;  1SFC C;  1MV8 A;  1LNQ A;  3M06 A;  2FFD A;  3MGN A;  5L8R J;  1FZE A;  3BAS A;  1DH3 A;  2D2C B;  1JCD A;  1DEB A;  1JY2 P;  2OYH B;  1LP1 B;  4IL6 X;  3TK1 A;  1JY3 O;  1IFP A;  3CXH D;  1JMM A;  1G2C A;  3L75 J;  2V7Q H;  3NFQ A;  5AVX B;  3A5T A;  1PGJ A;  3II6 A;  2N1T C;  2KP8 A;  4IL6 H;  1VQ5 P;  4DCK A;  1LT9 B;  1OX3 A;  3BRV B;  1SQX K;  1VF5 B;  4OGQ D;  4DJG A;  1L0N K;  2E75 C;  3M0D A;  1N73 A;  3G71 P;  2E74 C;  2WPR A;  2ZYG A;  1H8A A;  4I7Z B;  2WPV B;  3H1K E;  2YXR B;  4IFM A;  1M7L A;  2FBW C;  1FZC C;  5APY A;  3L74 E;  1RF1 C;  1EC5 A;  1GMJ A;  2QM7 A;  5E79 H;  4BWN A;  3A3Y B;  1LTA C;  1KIL C;  1DX7 A;  3RBZ A;  4N3Y B;  1IK7 A;  3Q3D A;  5H2F H;  1MKM A; 
#chains in the Genus database with same CATH homology
 3AEF C;  4H13 C;  4OGQ B;  1S5L X;  2ZT9 D;  3AEB C;  3SFE C;  1Y9B A;  3D6Z A;  3S9O A;  1K04 A;  4YTP C;  2BEQ D;  5L8R J;  2E74 D;  3AE8 C;  4H0L C;  3B71 A;  3D71 A;  1DD4 A;  3AED C;  2O01 J;  3D70 A;  1VF5 C;  3GF3 A;  2D2C B;  2FXP A;  4H0L B;  3EWK A;  2QJK C;  2QSI A;  3R4Y A;  1R8E A;  3AEA C;  1WMK A;  3Q5R A;  4YXD C;  1ZME C;  4Y28 J;  1PV3 A;  4H44 D;  3D6Y A;  3AEE C;  2WQY C;  4IL6 X;  1OW8 A;  2QJP C;  2H88 C;  4I7Z C;  1EXJ A;  4PV1 C;  1UIX A;  2E75 D;  2E76 B;  5KKZ C;  1FDI A;  4H13 B;  1HJ0 A;  2G8Y A;  1JB0 J;  1TU3 F;  1ZOY C;  2K9Y A;  3AE9 C;  3Q5P A;  1OMI A;  3GF7 A;  2J5U A;  1KIL E;  1YQ4 C;  1YQ3 C;  3AE1 C;  1KTM A;  1VF5 B;  4H44 C;  1PL5 A;  1PIX A;  4GDO A;  4OGQ D;  1EXI A;  1OW6 A;  3AE2 C;  3Q5S A;  2FYN C;  2JO1 A;  3AE5 C;  4TT3 H;  2P10 A;  2ZT9 C;  3Q2Y A;  2E75 C;  1OW7 A;  3IAO A;  2E74 C;  1KQG B;  1KOR A;  2JP3 A;  2D2C D;  4H0L D;  3H25 A;  3FGA D;  1VL2 A;  4I7Z B;  2H89 C;  3GMA A;  4PV1 B;  2WPV B;  3LW5 J;  2YMK A;  3AEC C;  1VF5 D;  1FDO A;  3AE3 C;  4Z1M H;  3AEG C;  3SFD C;  2QIW A;  1KMI Z;  4OGQ C;  4RKU J;  5M1B A;  3GLM A;  3AE6 C;  2FBW C;  4XFJ A;  2YIU C;  2E76 D;  3T97 B;  3C8V A;  2G3A A;  1DIP A;  4R4M A;  2BEZ F;  4U7J A;  3IN6 A;  4H13 D;  1NGM B;  4H44 B;  2WSF J;  4PV1 D;  1RQU A;  1S1C X;  1U57 A;  2D2C C;  1GMJ A;  2OQQ A;  2MKV A;  4R4L A;  3G9R A;  2ZT9 B;  3AE4 C;  4KT0 J;  2E75 B;  1Q90 D;  3ABV C;  1NYH A;  3AE7 C;  1KQF B;  2E74 B;  2WSE J;  1RQV A;  3RL0 g;  1ZRT E;  1K05 A;  1HF9 A;  5KLI C;  3O6Q A;  3RK3 E;  1DD3 A;  3Q1M A;  1IK7 A;  3Q3D A;  1ZP0 C;  2IDB A;  2WSC J;  2QJY C;  1MKM A;  2E76 C;  2V7Q J;  1AJY A;  2NZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...