2JP3A

Solution structure of the human fxyd4 (chif) protein in sds micelles
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
NGPVDKGSPFYYDWESLQLGGLIFGGLLCIAGIALALSGKCKCRRNHTPSSLPEKVTPLITPGSAST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FXYD domain-containing ion transport regulator 4
publication title Structural similarity of a membrane protein in micelles and membranes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transcription
total genus 14
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2007-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02038 ATP1G1_PLM_MAT8 ATP1G1/PLM/MAT8 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.780 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2jp3A00
2JO1A 2MKVA 2JP3A 1Y9BA
chains in the Genus database with same CATH superfamily
2HPCB 1RF0C 1KB9E 2Y0CA 3CWBE 3CD6P 3WU2H 1L0NJ 1L0LD 1N86A 2D2CC 4W80A 2WSFJ 4RESB 4OVNF 1WT6A 1OZHA 1LTTC 1JY3O 2WZ7A 3MUDA 4GKGA 1ZW0A 1FZAA 4AUWA 3H1IG 2NPSC 1LWUA 1AJYA 1P84H 1KB9D 1HGVA 3CWBD 4GODA 5AW2B 3L73E 1JTHA 1SFCD 2QVAA 2W8ZA 1SQXJ 4NPFX 4PJ0E 2IDBA 2QEXP 2Q6QA 2BEZF 2ZVOB 3CCMP 3O6QB 1FOSE 1NTZE 2A45I 1D7MA 2QIWA 3B5NA 2OQQA 1PP9G 1NTKE 3KPEA 3BCCG 3CX5I 1VQ4P 5AW0B 2LKMA 1VQ8P 2YO3A 2N1TB 4Y28J 3TGUG 1KYOE 2WSCJ 4YPCA 3TDKA 3A7OA 1RF1A 4OGQC 1VQPP 2DW3A 1URQB 5KLVG 4N3YB 3RK3B 4GT1A 3PRJA 2B87B 3D6ZA 2OYIB 1NTZD 1IK9A 4TLFA 1OVUA 4YXWH 1EDKA 2K9JA 1H8AA 5M1BA 2KS1B 1Y8AA 5AVUB 1BSNA 1J1DB 1KYOD 2ZJSE 4XE5B 1QL1A 1S72P 1L4AA 2XNDH 2IYPA 3T97A 3QWOC 1SQPJ 3Q1MA 2M8RA 5AW8B 1WRGA 3M9BA 3H1JG 3H6PA 4HJGH 4BXLA 2AEFA 4BRYB 2M3EA 1AA0A 1NTMD 3N7NA 3L75E 2A06E 1VQMP 3IR9A 1BGYJ 3TSIA 1GU4A 4YTPC 1YIJP 1DEEG 2YO2A 1EZVE 1G1IA 1RE3A 1HWTC 1DX7A 2Y9YA 2Z5IA 2POHA 3M0DC 2P7JA 2FBWC 1Q2NA 2JP3A 4IL6E 4GDOA 1NAFA 2YNYA 1U7MA 1R8EA 1RF0A 1JY3P 2QJPC 1JCDA 2JDIH 1KILE 5AW4B 3L37A 4L74A 1PGOA 2HR3A 2R3CA 1L0NE 4H0LB 2HG5D 1U57A 3A0BE 2QM8A 5AVWB 1W2EA 1N73B 1KC8Q 1H0TA 1JCCA 1LTSC 4H44B 4RJTA 3RL0B 3SWYA 1LTIC 4KT0J 3H32A 3HUSB 1NHLA 5AW1B 1KILD 2ZYAA 3B5ND 1NWQA 2A45H 2FY8A 3GG2A 2WWWA 3V4QA 2H43A 4N78E 1S5LE 1SP4A 1T2KD 1SQXE 3HE4A 2N1TC 3MIWA 3CX5H 3Q5SA 5GTIE 1RE4A 2YKOA 2LXCB 3H1HE 1VF5D 1M57D 3OJAB 5E79E 3RK3C 1BCCD 2OYIC 2GM4A 5APSA 3AE9C 1JO5A 1W5CE 1MZ9A 1X0TA 1GL2B 3W68A 2C0XA 2ZT9D 1OMIA 2WT7A 3I56P 4N78D 2KOGA 1JNMA 1L0LJ 1T3JA 2OTKE 1SQVK 3JC22 1NU1D 2HODB 2KLUA 1L4AD 3H1HD 2B89A 3RK2D 4Y99C 1XTGB 1EZVI 2OTLP 2QSIA 3V2PA 3KDPB 3FX0A 1YQ3C 1OXZA 1GD2E 1SLQA 2L91A 3CWBJ 3HE5B 2FKWB 1Q7YQ 3L71E 1E79H 2W83C 5APUA 1BGYG 1SQPE 4EOTA 3G3ZA 1EQ7A 3M0AA 2XZRA 4O9BA 3H1LG 1VQLP 5KTBA 1VQOP 3NTNA 3C8VA 1LTGC 3AEFC 2HPCA 1HGZA 3M0DA 3PHLA 3AE7C 1AQ5A 3MUDC 3L71D 3CCSP 1K73Q 2MKVA 5DJUB 1LT9B 1LWUC 2D2CD 1M1JB 1S9KE 1N7SD 4JYBA 1E5WA 2WSSH 2M0BA 3OA7A 1JOCA 1NTZJ 3BRVB 2SPZA 5EFWB 1JY2O 3D71A 2P58A 2AEMA 1RY3A 4JF7A 1N73C 5KLVK 1QVFO 1M8OB 2V4HA 2NZ2A 2NPSD 2OYOA 3EFGA 1BSHA 1R5SA 3GW6A 3HUSC 1VQNP 4BWNA 2HFED 2E42A 1PFIA 5KAFE 1EC5A 2A45G 5APQA 3FXEA 1S9KD 2E74C 2Y9ZA 1ZXGA 1FDOA 3O6QA 1RF1C 1EDLA 1BDCA 1QX8A 1EXJA 3EWKA 1NTMJ 5APWA 2N1TA 2WT7B 1SQQG 5AVXB 1DEBA 3NFQA 2KNCB 2FXPA 4OGQD 5CCGA 1URQA 2E76B 1S4XA 2I1KA 4JBZA 2B87A 3AEBC 2OYIA 1ZP0C 1KTMA 2ZXXA 1ZRTD 2KSJA 2YMYA 2Q7CA 4IL6X 2WMMA 2QRXA 1UIIA 3L70E 2KS1A 2RKLA 1DD4A 3KZIE 1IFNA 2E75C 5H2FE 3CPWO 1DH3A 4ASWA 1H89A 5B66E 2HYNA 1GK4A 1L0LE 2FYUG 3HTKB 3CXHE 1X22A 5APVA 1KFNA 4ZNCA 4D6TG 3CCEP 1VL2A 1AV1A 3CMEP 1K04A 4ZMDA 3W67A 4H13C 1JEKA 4DOJA 1A02F 3L70D 3H1KE 5CHXA 4WBAA 4U3FG 3VN0A 3I55P 1AFOA 3HD7B 3WUUA 5KLIB 1S5LX 3MGNA 3VP9A 3CXHD 4U7JA 1S3JA 1AVYA 3A0BH 3BATA 3L73G 2UWJE 1MV8A 2WSFH 1FZEA 4PD4D 3JCUE 1JY2P 5KJ7A 4JPZB 4WVZA 3P8CE 1BCCJ 3H1KD 1NTZG 4ZKPA 2IPPA 1SQVE 1IFIA 1W2BO 3P7KA 2CK3H 3TYYA 1NO4A 1NTKG 5AW7B 3VP8A 2IBZE 3MD0A 3U1CA 4UB6E 1YBKA 2BCCD 3RL0g 4Z1MH 3A0HE 1SFCB 1LTJB 1NU1J 1CSBA 5B5EH 1G2CB 4EIJA 1N73A 3H1HJ 5GTIH 3OW2O 1AQTA 3P8CD 2GA1A 4HYTB 3ZDMA 2BASA 1RE4C 3HUSA 1PGJA 1SQVD 3VOPA 3M06A 1JMBA 5CCHA 1HJBA 2O01J 2WSCH 1NKNA 2IBZD 3TF5A 3H1IE 4RO0A 2KP8A 3RGUA 3KXDA 3TNUB 3EFFK 2JO1A 5K5GB 1NTME 2AXTH 1HH0A 4AQRD 1PP9E 1GL2A 2ITAA 1VQ7P 5BU8B 3H1ID 3L75G 2A06G 3L71J 2R44A 2YIUB 1OVRA 2N9BA 4K35A 2O1KA 1EZVG 2HODA 1YYCA 2CPSA 1OFCX 1KB9I 3SWKA 2JR8A 5AVSB 2FXMA 2W90A 1PP9D 4IOIH 3VMXA 3BCCD 4B86A 3L72E 3D6YA 2K9YA 3HE5A 3G6EP 2J58A 5AVZB 2KUBA 2FFDB 5KLIC 5C39A 1L0NG 1T6AA 5AVYB 4TT3H 2G3AA 1PV3A 1ZOYC 1FJKA 1H88A 4LC1A 1TU3F 1QGKB 4WB4A 1SVFA 1IK7A 3II6A 3L72D 3K5BA 1YHQP 3A2AA 1OVVA 1LGHB 3EQ2A 2OYHB 1M7LA 3AEAC 1LT9A 2PFXA 5KAFH 1N7LA 2KZJA 1M1JA 1PZQA 2AXCA 3VTPC 1HUCA 2QJKB 4JYCA 1SQXG 3WU2E 1KYOI 1SQQK 3H1JD 2H89C 1BCCE 5AVVB 1HF9A 1SQBK 4KJMA 3P32A 1FAVA 3CC2P 1KQLA 5KKZB 4NPEA 1YTZI 3L74J 2I8DA 3QH9A 4CPGA 1KILB 2WPSA 4I7ZB 3R2PA 5AW3B 3NXSA 2Q1KA 1NU1E 2E74D 3E1IA 1P84E 1EDIA 3G71P 3S4RA 3H25A 3CC4P 5CCGC 1LTAC 1URQC 1KD1Q 3SSUA 4W7YA 3E7KA 2H8PD 2R5DA 3MP7B 1VF5B 3SFEC 3L70J 2IFMA 3KYQA 2JKVA 1JB0J 2FYUK 1LNQA 2OGUA 3B71A 2C0WA 2WITA 3KZIH 4I2LC 3JSVC 3GF3A 1J2JB 2ZT9B 3F5HA 1YITP 2KNCA 5B66H 1J1DC 1IC2A 3L36A 1EXIA 1P84D 2YKQA 3L71G 3GHGB 1SQPG 1KQFB 2XDJA 3RK2B 2WVRA 2E43A 1HVVA 2CPBA 3H1KJ 1N8RQ 3I5CA 3BVHA 1R5LA 2KYVA 3PP5A 3MZWB 2E75D 1KB9H 2WPVB 3R4YA 2FYNB 1HTLC 1Q81Q 1FZCB 3HTKA 1U7JA 2BCCJ 3M9HA 1NTZK 1NYHA 2V7QJ 1QEXA 2PGDA 1GDTA 5GTHE 3BRTB 2KB7P 1NTKK 1VQ9P 1J1EB 2YXQB 4H13D 3JCUH 1CW5A 2YXRB 2Q5UA 4XA4A 2H7HA 5KJ7C 1SQVJ 4AYCA 3HD7A 2Y0EA 4WY4A 3IF4A 3IAOA 3TK1A 4UB6H 1ZN5A 3AE6C 2Z4EA 4PJ0H 2D2CB 3AEEC 4H0LC 1BE3E 2OYHC 1N7SB 5CMZA 2K3RA 3V6IA 2BEQD 1Y47A 1PPJG 3A5TA 1X9VA 2ZAEB 1AVOA 3H1LE 4H44C 1LTBC 3CL3D 4K3AA 3RL0C 1KYOH 2E5YA 3CI9A 2NPSB 3H1IJ 1FZFA 2PP6A 3FWNA 5TJHA 5CCHC 3CCLP 1SFCA 2IX7C 1LTJA 1KILC 4I7ZC 1G2CA 1BE3D 3C1LA 1PIXA 3L35A 1ZRTE 3IN6A 3NMDA 2GUSA 4LGDE 2OARA 3A3YB 1IO4A 3H1LD 1Q82Q 2XKMA 1PP9J 2P10A 1NKZB 4JQ0D 3BCCJ 3L74E 5BVZA 4UB8E 4GOFA 1GL2C 1KMIZ 1YTZT 3KQGA 2B88A 2AEJA 4OGQB 1FS0E 3TNUA 1YJ9P 1HBWA 1IZNB 1KFMA 2KK7A 1L0LG 3CMAP 4L76A 4DZOA 3CX5E 5BU5A 2ZYDA 5CJ0A 2P1JA 4LLHA 1JMMA 3V2QA 3L74D 3L72J 1FE6A 4IFMA 1L0NK 1OW8A 2G8YA 3H1KG 1GK6A 4KHXA 2Z5HA 1ZV8A 1KV4A 2GUVA 3IFMA 3CWBG 1SQBE 4W7ZA 4PD4E 4IL6H 4PV1B 1Y9BA 3GLMA 3H1JJ 1IFPA 1FDIA 3CX5D 1JM0A 4EYYQ 3C9IA 3KHUA 4C46A 2WSEJ 3SWFA 2M3BA 5AW6B 4WY4B 2W27A 2Q9IA 1SQXK 3LW5J 2KZIA 3CCVP 2WPRA 5L8RJ 2BCCE 2FFDA 4EDFA 1SQBD 2E5TA 3M9QA 4QMAA 4DCKA 1LT9C 3V2NA 4D6TE 1M1JC 4DT0A 1N7SC 2P67A 4U3FE 1IFDA 1YJWP 2QJPB 1FBMA 3CLQA 2OYHA 1S5LH 3PJSK 3B4SA 5TISE 2FYUD 1GW3A 1YJNP 3U59A 4IFFA 4D6TD 1CI6B 1T8ZA 1K8AQ 1GZLA 1KORA 5E79H 2C9NY 3RK3E 2IZ1A 3V4WA 2OTJP 2W6JH 4U3FD 1LJ2A 1DD3A 1NTMG 1SQPK 3ABVC 1KILA 2O01H 1EDJA 2N1TD 3WUTA 4I1LA 1ZR2A 1VQ6P 2KSEA 1PGQA 1KN7A 1M1KQ 1KQGB 2E76C 5CCGD 1URQD 3VMYA 3L73D 1OX3A 1IFJA 1WMKA 3RK3D 5CBNA 5KAIE 5AVTB 1GW4A 3CXHI 4IFDK 1Q90D 1X8YA 3BCCE 1VPCA 1VQKP 1DIPA 2ZFCA 5APXA 3V5BA 1K9MQ 4PD4I 3TGUE 1NTKD 2C9LY 3L72G 2M5AB 5KLVE 3GHGA 3CCRP 2Q3EA 3V2RA 5APTA 4NPDA 5GTHH 1JY3N 4I6MC 3S1KA 3L4FA 2J5UA 4Y99B 1CZQA 4PV1C 3TGUD 2L5GB 1FZCA 3WUVA 3HD7C 1NOHA 3VYIA 2JEEA 4WY4C 1IFMA 1S2EA 5KLVD 3ITKA 1BE3J 2R5BA 1MKMA 3H1JE 2MJZA 2IBZI 2LR2A 1ZLLA 3H1LJ 2IYOA 1OWAA 1LT1A 5KJ7D 1BCCG 2IFNA 1Z56A 3SFDC 3AE8C 2QM7A 1K05A 3PTZA 3L75D 2A06D 3M91A 2PRRA 2ZXEB 1RQUA 1USEA 1LWUB 1N7SA 4H0LD 1EZVD 2RH0A 3LIDA 1QLED 4MN4C 1SFCC 1LTJC 1NU1G 1JTHB 3WMM0 1IJDB 2QJYB 3H1HG 4RKUJ 4H44D 2QG4A 1OW7A 1YI2P 3RL0D 1L0LK 2NPSA 3B5NB 4UB8H 1VDFA 1QL2A 2O1JA 3Q5RA 2W6AA 5CCHD 2WQYC 3HRNA 2LXBA 2XU6A 2RMZA 3G4SP 1RQVA 1M56D 2E74B 1MFZA 1L0ND 1RF1B 1ZR4A 1FDMA 5B5EE 1FC2C 1M90Q 3FXDA 1Q86Q 1YQ4C 1MUUA 2B9BA 5H2FH 2K9JB 4C7RA 4HH2A 1HJ0A 3CCJP 1SQQJ 1GL2D 3AEGC 3LIEA 3CXHH 1XTCC 2KXPB 2O01N 1SQBJ 2XV5A 2YIUC 4WWIA 2ZVNB 5CJ4A 1L4AB 2KIKA 4PD4H 3USSA 3T97B 1SQXD 3F89A 1NH4A 4GOEA 4YXDC 3E1RA 5AW5B 3S9OA 3AE4C 2XNXA 3Q5PA 2E75B 2AXTE 2HLOA 2K1AA 3FWLA 2FYUJ 1QVGO 3UIAA 2V7QH 4XFJA 4D6TJ 1T3UA 3Q3DA 3PLNA 3G9RA 5AVQB 2FFDC 2KLVA 3AE2C 2FXOA 1BE3G 4H13B 2NRGA 3AEDC 4C7NA 1USDA 4U3FJ 1LP1A 5AW9B 5CBOA 2VRSA 3GMAA 1PL5A 5TISH 1BGYE 3A0HH 3GF7A 1NAYA 4M3LA 3U1AA 1FZBA 2P2UA 2JWAA 3AE3C 1G1JA 3L73J 1NTMK 1OIPA 1ZMEC 1SQPD 4ZKUA 2H88C 3VMZA 2O3JA 1NGMB 2QJKC 4OH8B 1X79B 1FJPA 2KI7B 1P84I 3B8EB 2JWDA 4EI2A 2QA4P 4L73A 1H0TB 2I1JA 2QJYC 2JJLA 1NJIQ 1NTKJ 5KKZC 2YKPA 3H32B 1GMJA 3L74G 3VMAA 1BGYD 4ASVA 3AECC 2IZ0A 3AE1C 3B5NC 3MTUE 1CI6A 3PH0A 1T2KC 4OWFA 2ZYGA 4HB1A 1BDDA 3HE4B 3P8MC 5KAIH 1GU5A 5DJTB 1SS1A 2YMKA 1KQSO 1PPJE 2FYZA 2W6BA 2PAJA 1VF5C 2N9YB 3L70G 3FGAD 3CCQP 1VQ5P 2R3SA 3TGUJ 2Y0DA 1KZUB 1FZGA 1A02J 3N4XA 2ZT9C 2K88A 3RBZA 5KLVJ 2E76D 2QE7H 2R32A 2WTYA 4L75A 1SQBG 3GHGC 3Q2YA 1FOSF 1PPJD 1N2DC 1GTWA 1S1CX 3MHVA 4DJGA 1L4AC 3O8ZA 1FU1A 4N6JA 4A7PA 3RK2C 1MFTA 1PGPA 2WPQA 1SQQE 1L2PA 2Q3IA 2M5AA 3L75J 2K37A 1OW6A 1UIXA 2FYNC 1FZCC 1JY2N 4R4LA 3D70A 2BCCG 3RBXA 4HKZH 1RH5B 3CCUP 5AVRB 1RHZB 1RE3C 1J1EC 4C7NB 2WSEH 4PV1D 3AE5C 1NVOA 1JUNA 4R4MA 4GIFA 1LP1B 4BRYA 3LW5H 3BASA 1SQQD 5APYA 3CC7P 1SQVG 2J59M 1NU1K 3HD7D 3OAKA 4WY4D 2FYUE 2IBZG 2RN0A
chains in the Genus database with same CATH topology
3FGAD 3Q3DA 3G9RA 1VL2A 5KLIC 3AE6C 3B71A 2J5UA 3Q5RA 1K04A 3AE2C 4TT3H 5M1BA 2D2CB 3AEEC 2O01J 4H0LB 4H13B 2D2CC 2G3AA 2WQYC 4H0LC 4H13C 1PV3A 1U57A 3GF3A 2QSIA 3AEDC 4PV1C 1ZOYC 2ZT9B 2ZT9C 1OW8A 2G8YA 2BEQD 1RQVA 2E74B 2WSFJ 1TU3F 2E74C 1KORA 1YQ3C 2E76D 3RK3E 1FDOA 3O6QA 1EXIA 4H44B 1IK7A 4H44C 3GMAA 3Q2YA 1PL5A 1KQFB 3Q1MA 4KT0J 2JO1A 3Q5SA 1S5LX 1YQ4C 3GF7A 1S1CX 1EXJA 3EWKA 1DD3A 3ABVC 3AEAC 4U7JA 4PV1B 1Y9BA 3GLMA 1AJYA 1FDIA 1MKMA 3AE3C 1ZMEC 1HJ0A 2H88C 3AEGC 1NGMB 2QJKC 2WSEJ 4I7ZC 2FXPA 1PIXA 2E75D 4OGQD 2IDBA 2E76B 2WPVB 3R4YA 1KQGB 1ZRTE 2E76C 3C8VA 2H89C 3IN6A 2BEZF 2YIUC 1OW6A 3LW5J 1UIXA 2FYNC 3AEFC 1WMKA 4YTPC 3SFDC 3AE8C 3AEBC 1HF9A 4R4LA 1ZP0C 2QJYC 5L8RJ 3D70A 2QIWA 1VF5D 3T97B 1KTMA 2OQQA 1K05A 1NYHA 2P10A 3AE7C 5KKZC 2V7QJ 1Q90D 1GMJA 4IL6X 1RQUA 4YXDC 3AECC 2MKVA 1JB0J 3AE1C 3AE9C 4I7ZB 1DIPA 2D2CD 4H13D 4H0LD 2FBWC 4PV1D 4Y28J 3AE5C 3RL0g 1KMIZ 3S9OA 4Z1MH 2ZT9D 2JP3A 2WSCJ 4R4MA 3AE4C 1OMIA 1DD4A 3Q5PA 2E74D 2E75B 4GDOA 4OGQB 2E75C 4OGQC 3H25A 3D71A 1R8EA 3D6YA 4RKUJ 2K9YA 4H44D 2YMKA 3IAOA 1OW7A 1VF5B 4XFJA 3D6ZA 1VF5C 2QJPC 3SFEC 2NZ2A 1KILE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JO1 A;  2MKV A;  2JP3 A;  1Y9B A; 
#chains in the Genus database with same CATH topology
 2HPC B;  1RF0 C;  1KB9 E;  2Y0C A;  3CWB E;  3CD6 P;  3WU2 H;  1L0N J;  1L0L D;  1N86 A;  2D2C C;  4W80 A;  2WSF J;  4RES B;  4OVN F;  1WT6 A;  1OZH A;  1LTT C;  1JY3 O;  2WZ7 A;  3MUD A;  4GKG A;  1ZW0 A;  1FZA A;  4AUW A;  3H1I G;  2NPS C;  1LWU A;  1AJY A;  1P84 H;  1KB9 D;  1HGV A;  3CWB D;  4GOD A;  5AW2 B;  3L73 E;  1JTH A;  1SFC D;  2QVA A;  2W8Z A;  1SQX J;  4NPF X;  4PJ0 E;  2IDB A;  2QEX P;  2Q6Q A;  2BEZ F;  2ZVO B;  3CCM P;  3O6Q B;  1FOS E;  1NTZ E;  2A45 I;  1D7M A;  2QIW A;  3B5N A;  2OQQ A;  1PP9 G;  1NTK E;  3KPE A;  3BCC G;  3CX5 I;  1VQ4 P;  5AW0 B;  2LKM A;  1VQ8 P;  2YO3 A;  2N1T B;  4Y28 J;  3TGU G;  1KYO E;  2WSC J;  4YPC A;  3TDK A;  3A7O A;  1RF1 A;  4OGQ C;  1VQP P;  2DW3 A;  1URQ B;  5KLV G;  4N3Y B;  3RK3 B;  4GT1 A;  3PRJ A;  2B87 B;  3D6Z A;  2OYI B;  1NTZ D;  1IK9 A;  4TLF A;  1OVU A;  4YXW H;  1EDK A;  2K9J A;  1H8A A;  5M1B A;  2KS1 B;  1Y8A A;  5AVU B;  1BSN A;  1J1D B;  1KYO D;  2ZJS E;  4XE5 B;  1QL1 A;  1S72 P;  1L4A A;  2XND H;  2IYP A;  3T97 A;  3QWO C;  1SQP J;  3Q1M A;  2M8R A;  5AW8 B;  1WRG A;  3M9B A;  3H1J G;  3H6P A;  4HJG H;  4BXL A;  2AEF A;  4BRY B;  2M3E A;  1AA0 A;  1NTM D;  3N7N A;  3L75 E;  2A06 E;  1VQM P;  3IR9 A;  1BGY J;  3TSI A;  1GU4 A;  4YTP C;  1YIJ P;  1DEE G;  2YO2 A;  1EZV E;  1G1I A;  1RE3 A;  1HWT C;  1DX7 A;  2Y9Y A;  2Z5I A;  2POH A;  3M0D C;  2P7J A;  2FBW C;  1Q2N A;  2JP3 A;  4IL6 E;  4GDO A;  1NAF A;  2YNY A;  1U7M A;  1R8E A;  1RF0 A;  1JY3 P;  2QJP C;  1JCD A;  2JDI H;  1KIL E;  5AW4 B;  3L37 A;  4L74 A;  1PGO A;  2HR3 A;  2R3C A;  1L0N E;  4H0L B;  2HG5 D;  1U57 A;  3A0B E;  2QM8 A;  5AVW B;  1W2E A;  1N73 B;  1KC8 Q;  1H0T A;  1JCC A;  1LTS C;  4H44 B;  4RJT A;  3RL0 B;  3SWY A;  1LTI C;  4KT0 J;  3H32 A;  3HUS B;  1NHL A;  5AW1 B;  1KIL D;  2ZYA A;  3B5N D;  1NWQ A;  2A45 H;  2FY8 A;  3GG2 A;  2WWW A;  3V4Q A;  2H43 A;  4N78 E;  1S5L E;  1SP4 A;  1T2K D;  1SQX E;  3HE4 A;  2N1T C;  3MIW A;  3CX5 H;  3Q5S A;  5GTI E;  1RE4 A;  2YKO A;  2LXC B;  3H1H E;  1VF5 D;  1M57 D;  3OJA B;  5E79 E;  3RK3 C;  1BCC D;  2OYI C;  2GM4 A;  5APS A;  3AE9 C;  1JO5 A;  1W5C E;  1MZ9 A;  1X0T A;  1GL2 B;  3W68 A;  2C0X A;  2ZT9 D;  1OMI A;  2WT7 A;  3I56 P;  4N78 D;  2KOG A;  1JNM A;  1L0L J;  1T3J A;  2OTK E;  1SQV K;  3JC2 2;  1NU1 D;  2HOD B;  2KLU A;  1L4A D;  3H1H D;  2B89 A;  3RK2 D;  4Y99 C;  1XTG B;  1EZV I;  2OTL P;  2QSI A;  3V2P A;  3KDP B;  3FX0 A;  1YQ3 C;  1OXZ A;  1GD2 E;  1SLQ A;  2L91 A;  3CWB J;  3HE5 B;  2FKW B;  1Q7Y Q;  3L71 E;  1E79 H;  2W83 C;  5APU A;  1BGY G;  1SQP E;  4EOT A;  3G3Z A;  1EQ7 A;  3M0A A;  2XZR A;  4O9B A;  3H1L G;  1VQL P;  5KTB A;  1VQO P;  3NTN A;  3C8V A;  1LTG C;  3AEF C;  2HPC A;  1HGZ A;  3M0D A;  3PHL A;  3AE7 C;  1AQ5 A;  3MUD C;  3L71 D;  3CCS P;  1K73 Q;  2MKV A;  5DJU B;  1LT9 B;  1LWU C;  2D2C D;  1M1J B;  1S9K E;  1N7S D;  4JYB A;  1E5W A;  2WSS H;  2M0B A;  3OA7 A;  1JOC A;  1NTZ J;  3BRV B;  2SPZ A;  5EFW B;  1JY2 O;  3D71 A;  2P58 A;  2AEM A;  1RY3 A;  4JF7 A;  1N73 C;  5KLV K;  1QVF O;  1M8O B;  2V4H A;  2NZ2 A;  2NPS D;  2OYO A;  3EFG A;  1BSH A;  1R5S A;  3GW6 A;  3HUS C;  1VQN P;  4BWN A;  2HFE D;  2E42 A;  1PFI A;  5KAF E;  1EC5 A;  2A45 G;  5APQ A;  3FXE A;  1S9K D;  2E74 C;  2Y9Z A;  1ZXG A;  1FDO A;  3O6Q A;  1RF1 C;  1EDL A;  1BDC A;  1QX8 A;  1EXJ A;  3EWK A;  1NTM J;  5APW A;  2N1T A;  2WT7 B;  1SQQ G;  5AVX B;  1DEB A;  3NFQ A;  2KNC B;  2FXP A;  4OGQ D;  5CCG A;  1URQ A;  2E76 B;  1S4X A;  2I1K A;  4JBZ A;  2B87 A;  3AEB C;  2OYI A;  1ZP0 C;  1KTM A;  2ZXX A;  1ZRT D;  2KSJ A;  2YMY A;  2Q7C A;  4IL6 X;  2WMM A;  2QRX A;  1UII A;  3L70 E;  2KS1 A;  2RKL A;  1DD4 A;  3KZI E;  1IFN A;  2E75 C;  5H2F E;  3CPW O;  1DH3 A;  4ASW A;  1H89 A;  5B66 E;  2HYN A;  1GK4 A;  1L0L E;  2FYU G;  3HTK B;  3CXH E;  1X22 A;  5APV A;  1KFN A;  4ZNC A;  4D6T G;  3CCE P;  1VL2 A;  1AV1 A;  3CME P;  1K04 A;  4ZMD A;  3W67 A;  4H13 C;  1JEK A;  4DOJ A;  1A02 F;  3L70 D;  3H1K E;  5CHX A;  4WBA A;  4U3F G;  3VN0 A;  3I55 P;  1AFO A;  3HD7 B;  3WUU A;  5KLI B;  1S5L X;  3MGN A;  3VP9 A;  3CXH D;  4U7J A;  1S3J A;  1AVY A;  3A0B H;  3BAT A;  3L73 G;  2UWJ E;  1MV8 A;  2WSF H;  1FZE A;  4PD4 D;  3JCU E;  1JY2 P;  5KJ7 A;  4JPZ B;  4WVZ A;  3P8C E;  1BCC J;  3H1K D;  1NTZ G;  4ZKP A;  2IPP A;  1SQV E;  1IFI A;  1W2B O;  3P7K A;  2CK3 H;  3TYY A;  1NO4 A;  1NTK G;  5AW7 B;  3VP8 A;  2IBZ E;  3MD0 A;  3U1C A;  4UB6 E;  1YBK A;  2BCC D;  3RL0 g;  4Z1M H;  3A0H E;  1SFC B;  1LTJ B;  1NU1 J;  1CSB A;  5B5E H;  1G2C B;  4EIJ A;  1N73 A;  3H1H J;  5GTI H;  3OW2 O;  1AQT A;  3P8C D;  2GA1 A;  4HYT B;  3ZDM A;  2BAS A;  1RE4 C;  3HUS A;  1PGJ A;  1SQV D;  3VOP A;  3M06 A;  1JMB A;  5CCH A;  1HJB A;  2O01 J;  2WSC H;  1NKN A;  2IBZ D;  3TF5 A;  3H1I E;  4RO0 A;  2KP8 A;  3RGU A;  3KXD A;  3TNU B;  3EFF K;  2JO1 A;  5K5G B;  1NTM E;  2AXT H;  1HH0 A;  4AQR D;  1PP9 E;  1GL2 A;  2ITA A;  1VQ7 P;  5BU8 B;  3H1I D;  3L75 G;  2A06 G;  3L71 J;  2R44 A;  2YIU B;  1OVR A;  2N9B A;  4K35 A;  2O1K A;  1EZV G;  2HOD A;  1YYC A;  2CPS A;  1OFC X;  1KB9 I;  3SWK A;  2JR8 A;  5AVS B;  2FXM A;  2W90 A;  1PP9 D;  4IOI H;  3VMX A;  3BCC D;  4B86 A;  3L72 E;  3D6Y A;  2K9Y A;  3HE5 A;  3G6E P;  2J58 A;  5AVZ B;  2KUB A;  2FFD B;  5KLI C;  5C39 A;  1L0N G;  1T6A A;  5AVY B;  4TT3 H;  2G3A A;  1PV3 A;  1ZOY C;  1FJK A;  1H88 A;  4LC1 A;  1TU3 F;  1QGK B;  4WB4 A;  1SVF A;  1IK7 A;  3II6 A;  3L72 D;  3K5B A;  1YHQ P;  3A2A A;  1OVV A;  1LGH B;  3EQ2 A;  2OYH B;  1M7L A;  3AEA C;  1LT9 A;  2PFX A;  5KAF H;  1N7L A;  2KZJ A;  1M1J A;  1PZQ A;  2AXC A;  3VTP C;  1HUC A;  2QJK B;  4JYC A;  1SQX G;  3WU2 E;  1KYO I;  1SQQ K;  3H1J D;  2H89 C;  1BCC E;  5AVV B;  1HF9 A;  1SQB K;  4KJM A;  3P32 A;  1FAV A;  3CC2 P;  1KQL A;  5KKZ B;  4NPE A;  1YTZ I;  3L74 J;  2I8D A;  3QH9 A;  4CPG A;  1KIL B;  2WPS A;  4I7Z B;  3R2P A;  5AW3 B;  3NXS A;  2Q1K A;  1NU1 E;  2E74 D;  3E1I A;  1P84 E;  1EDI A;  3G71 P;  3S4R A;  3H25 A;  3CC4 P;  5CCG C;  1LTA C;  1URQ C;  1KD1 Q;  3SSU A;  4W7Y A;  3E7K A;  2H8P D;  2R5D A;  3MP7 B;  1VF5 B;  3SFE C;  3L70 J;  2IFM A;  3KYQ A;  2JKV A;  1JB0 J;  2FYU K;  1LNQ A;  2OGU A;  3B71 A;  2C0W A;  2WIT A;  3KZI H;  4I2L C;  3JSV C;  3GF3 A;  1J2J B;  2ZT9 B;  3F5H A;  1YIT P;  2KNC A;  5B66 H;  1J1D C;  1IC2 A;  3L36 A;  1EXI A;  1P84 D;  2YKQ A;  3L71 G;  3GHG B;  1SQP G;  1KQF B;  2XDJ A;  3RK2 B;  2WVR A;  2E43 A;  1HVV A;  2CPB A;  3H1K J;  1N8R Q;  3I5C A;  3BVH A;  1R5L A;  2KYV A;  3PP5 A;  3MZW B;  2E75 D;  1KB9 H;  2WPV B;  3R4Y A;  2FYN B;  1HTL C;  1Q81 Q;  1FZC B;  3HTK A;  1U7J A;  2BCC J;  3M9H A;  1NTZ K;  1NYH A;  2V7Q J;  1QEX A;  2PGD A;  1GDT A;  5GTH E;  3BRT B;  2KB7 P;  1NTK K;  1VQ9 P;  1J1E B;  2YXQ B;  4H13 D;  3JCU H;  1CW5 A;  2YXR B;  2Q5U A;  4XA4 A;  2H7H A;  5KJ7 C;  1SQV J;  4AYC A;  3HD7 A;  2Y0E A;  4WY4 A;  3IF4 A;  3IAO A;  3TK1 A;  4UB6 H;  1ZN5 A;  3AE6 C;  2Z4E A;  4PJ0 H;  2D2C B;  3AEE C;  4H0L C;  1BE3 E;  2OYH C;  1N7S B;  5CMZ A;  2K3R A;  3V6I A;  2BEQ D;  1Y47 A;  1PPJ G;  3A5T A;  1X9V A;  2ZAE B;  1AVO A;  3H1L E;  4H44 C;  1LTB C;  3CL3 D;  4K3A A;  3RL0 C;  1KYO H;  2E5Y A;  3CI9 A;  2NPS B;  3H1I J;  1FZF A;  2PP6 A;  3FWN A;  5TJH A;  5CCH C;  3CCL P;  1SFC A;  2IX7 C;  1LTJ A;  1KIL C;  4I7Z C;  1G2C A;  1BE3 D;  3C1L A;  1PIX A;  3L35 A;  1ZRT E;  3IN6 A;  3NMD A;  2GUS A;  4LGD E;  2OAR A;  3A3Y B;  1IO4 A;  3H1L D;  1Q82 Q;  2XKM A;  1PP9 J;  2P10 A;  1NKZ B;  4JQ0 D;  3BCC J;  3L74 E;  5BVZ A;  4UB8 E;  4GOF A;  1GL2 C;  1KMI Z;  1YTZ T;  3KQG A;  2B88 A;  2AEJ A;  4OGQ B;  1FS0 E;  3TNU A;  1YJ9 P;  1HBW A;  1IZN B;  1KFM A;  2KK7 A;  1L0L G;  3CMA P;  4L76 A;  4DZO A;  3CX5 E;  5BU5 A;  2ZYD A;  5CJ0 A;  2P1J A;  4LLH A;  1JMM A;  3V2Q A;  3L74 D;  3L72 J;  1FE6 A;  4IFM A;  1L0N K;  1OW8 A;  2G8Y A;  3H1K G;  1GK6 A;  4KHX A;  2Z5H A;  1ZV8 A;  1KV4 A;  2GUV A;  3IFM A;  3CWB G;  1SQB E;  4W7Z A;  4PD4 E;  4IL6 H;  4PV1 B;  1Y9B A;  3GLM A;  3H1J J;  1IFP A;  1FDI A;  3CX5 D;  1JM0 A;  4EYY Q;  3C9I A;  3KHU A;  4C46 A;  2WSE J;  3SWF A;  2M3B A;  5AW6 B;  4WY4 B;  2W27 A;  2Q9I A;  1SQX K;  3LW5 J;  2KZI A;  3CCV P;  2WPR A;  5L8R J;  2BCC E;  2FFD A;  4EDF A;  1SQB D;  2E5T A;  3M9Q A;  4QMA A;  4DCK A;  1LT9 C;  3V2N A;  4D6T E;  1M1J C;  4DT0 A;  1N7S C;  2P67 A;  4U3F E;  1IFD A;  1YJW P;  2QJP B;  1FBM A;  3CLQ A;  2OYH A;  1S5L H;  3PJS K;  3B4S A;  5TIS E;  2FYU D;  1GW3 A;  1YJN P;  3U59 A;  4IFF A;  4D6T D;  1CI6 B;  1T8Z A;  1K8A Q;  1GZL A;  1KOR A;  5E79 H;  2C9N Y;  3RK3 E;  2IZ1 A;  3V4W A;  2OTJ P;  2W6J H;  4U3F D;  1LJ2 A;  1DD3 A;  1NTM G;  1SQP K;  3ABV C;  1KIL A;  2O01 H;  1EDJ A;  2N1T D;  3WUT A;  4I1L A;  1ZR2 A;  1VQ6 P;  2KSE A;  1PGQ A;  1KN7 A;  1M1K Q;  1KQG B;  2E76 C;  5CCG D;  1URQ D;  3VMY A;  3L73 D;  1OX3 A;  1IFJ A;  1WMK A;  3RK3 D;  5CBN A;  5KAI E;  5AVT B;  1GW4 A;  3CXH I;  4IFD K;  1Q90 D;  1X8Y A;  3BCC E;  1VPC A;  1VQK P;  1DIP A;  2ZFC A;  5APX A;  3V5B A;  1K9M Q;  4PD4 I;  3TGU E;  1NTK D;  2C9L Y;  3L72 G;  2M5A B;  5KLV E;  3GHG A;  3CCR P;  2Q3E A;  3V2R A;  5APT A;  4NPD A;  5GTH H;  1JY3 N;  4I6M C;  3S1K A;  3L4F A;  2J5U A;  4Y99 B;  1CZQ A;  4PV1 C;  3TGU D;  2L5G B;  1FZC A;  3WUV A;  3HD7 C;  1NOH A;  3VYI A;  2JEE A;  4WY4 C;  1IFM A;  1S2E A;  5KLV D;  3ITK A;  1BE3 J;  2R5B A;  1MKM A;  3H1J E;  2MJZ A;  2IBZ I;  2LR2 A;  1ZLL A;  3H1L J;  2IYO A;  1OWA A;  1LT1 A;  5KJ7 D;  1BCC G;  2IFN A;  1Z56 A;  3SFD C;  3AE8 C;  2QM7 A;  1K05 A;  3PTZ A;  3L75 D;  2A06 D;  3M91 A;  2PRR A;  2ZXE B;  1RQU A;  1USE A;  1LWU B;  1N7S A;  4H0L D;  1EZV D;  2RH0 A;  3LID A;  1QLE D;  4MN4 C;  1SFC C;  1LTJ C;  1NU1 G;  1JTH B;  3WMM 0;  1IJD B;  2QJY B;  3H1H G;  4RKU J;  4H44 D;  2QG4 A;  1OW7 A;  1YI2 P;  3RL0 D;  1L0L K;  2NPS A;  3B5N B;  4UB8 H;  1VDF A;  1QL2 A;  2O1J A;  3Q5R A;  2W6A A;  5CCH D;  2WQY C;  3HRN A;  2LXB A;  2XU6 A;  2RMZ A;  3G4S P;  1RQV A;  1M56 D;  2E74 B;  1MFZ A;  1L0N D;  1RF1 B;  1ZR4 A;  1FDM A;  5B5E E;  1FC2 C;  1M90 Q;  3FXD A;  1Q86 Q;  1YQ4 C;  1MUU A;  2B9B A;  5H2F H;  2K9J B;  4C7R A;  4HH2 A;  1HJ0 A;  3CCJ P;  1SQQ J;  1GL2 D;  3AEG C;  3LIE A;  3CXH H;  1XTC C;  2KXP B;  2O01 N;  1SQB J;  2XV5 A;  2YIU C;  4WWI A;  2ZVN B;  5CJ4 A;  1L4A B;  2KIK A;  4PD4 H;  3USS A;  3T97 B;  1SQX D;  3F89 A;  1NH4 A;  4GOE A;  4YXD C;  3E1R A;  5AW5 B;  3S9O A;  3AE4 C;  2XNX A;  3Q5P A;  2E75 B;  2AXT E;  2HLO A;  2K1A A;  3FWL A;  2FYU J;  1QVG O;  3UIA A;  2V7Q H;  4XFJ A;  4D6T J;  1T3U A;  3Q3D A;  3PLN A;  3G9R A;  5AVQ B;  2FFD C;  2KLV A;  3AE2 C;  2FXO A;  1BE3 G;  4H13 B;  2NRG A;  3AED C;  4C7N A;  1USD A;  4U3F J;  1LP1 A;  5AW9 B;  5CBO A;  2VRS A;  3GMA A;  1PL5 A;  5TIS H;  1BGY E;  3A0H H;  3GF7 A;  1NAY A;  4M3L A;  3U1A A;  1FZB A;  2P2U A;  2JWA A;  3AE3 C;  1G1J A;  3L73 J;  1NTM K;  1OIP A;  1ZME C;  1SQP D;  4ZKU A;  2H88 C;  3VMZ A;  2O3J A;  1NGM B;  2QJK C;  4OH8 B;  1X79 B;  1FJP A;  2KI7 B;  1P84 I;  3B8E B;  2JWD A;  4EI2 A;  2QA4 P;  4L73 A;  1H0T B;  2I1J A;  2QJY C;  2JJL A;  1NJI Q;  1NTK J;  5KKZ C;  2YKP A;  3H32 B;  1GMJ A;  3L74 G;  3VMA A;  1BGY D;  4ASV A;  3AEC C;  2IZ0 A;  3AE1 C;  3B5N C;  3MTU E;  1CI6 A;  3PH0 A;  1T2K C;  4OWF A;  2ZYG A;  4HB1 A;  1BDD A;  3HE4 B;  3P8M C;  5KAI H;  1GU5 A;  5DJT B;  1SS1 A;  2YMK A;  1KQS O;  1PPJ E;  2FYZ A;  2W6B A;  2PAJ A;  1VF5 C;  2N9Y B;  3L70 G;  3FGA D;  3CCQ P;  1VQ5 P;  2R3S A;  3TGU J;  2Y0D A;  1KZU B;  1FZG A;  1A02 J;  3N4X A;  2ZT9 C;  2K88 A;  3RBZ A;  5KLV J;  2E76 D;  2QE7 H;  2R32 A;  2WTY A;  4L75 A;  1SQB G;  3GHG C;  3Q2Y A;  1FOS F;  1PPJ D;  1N2D C;  1GTW A;  1S1C X;  3MHV A;  4DJG A;  1L4A C;  3O8Z A;  1FU1 A;  4N6J A;  4A7P A;  3RK2 C;  1MFT A;  1PGP A;  2WPQ A;  1SQQ E;  1L2P A;  2Q3I A;  2M5A A;  3L75 J;  2K37 A;  1OW6 A;  1UIX A;  2FYN C;  1FZC C;  1JY2 N;  4R4L A;  3D70 A;  2BCC G;  3RBX A;  4HKZ H;  1RH5 B;  3CCU P;  5AVR B;  1RHZ B;  1RE3 C;  1J1E C;  4C7N B;  2WSE H;  4PV1 D;  3AE5 C;  1NVO A;  1JUN A;  4R4M A;  4GIF A;  1LP1 B;  4BRY A;  3LW5 H;  3BAS A;  1SQQ D;  5APY A;  3CC7 P;  1SQV G;  2J59 M;  1NU1 K;  3HD7 D;  3OAK A;  4WY4 D;  2FYU E;  2IBZ G;  2RN0 A; 
#chains in the Genus database with same CATH homology
 3FGA D;  3Q3D A;  3G9R A;  1VL2 A;  5KLI C;  3AE6 C;  3B71 A;  2J5U A;  3Q5R A;  1K04 A;  3AE2 C;  4TT3 H;  5M1B A;  2D2C B;  3AEE C;  2O01 J;  4H0L B;  4H13 B;  2D2C C;  2G3A A;  2WQY C;  4H0L C;  4H13 C;  1PV3 A;  1U57 A;  3GF3 A;  2QSI A;  3AED C;  4PV1 C;  1ZOY C;  2ZT9 B;  2ZT9 C;  1OW8 A;  2G8Y A;  2BEQ D;  1RQV A;  2E74 B;  2WSF J;  1TU3 F;  2E74 C;  1KOR A;  1YQ3 C;  2E76 D;  3RK3 E;  1FDO A;  3O6Q A;  1EXI A;  4H44 B;  1IK7 A;  4H44 C;  3GMA A;  3Q2Y A;  1PL5 A;  1KQF B;  3Q1M A;  4KT0 J;  2JO1 A;  3Q5S A;  1S5L X;  1YQ4 C;  3GF7 A;  1S1C X;  1EXJ A;  3EWK A;  1DD3 A;  3ABV C;  3AEA C;  4U7J A;  4PV1 B;  1Y9B A;  3GLM A;  1AJY A;  1FDI A;  1MKM A;  3AE3 C;  1ZME C;  1HJ0 A;  2H88 C;  3AEG C;  1NGM B;  2QJK C;  2WSE J;  4I7Z C;  2FXP A;  1PIX A;  2E75 D;  4OGQ D;  2IDB A;  2E76 B;  2WPV B;  3R4Y A;  1KQG B;  1ZRT E;  2E76 C;  3C8V A;  2H89 C;  3IN6 A;  2BEZ F;  2YIU C;  1OW6 A;  3LW5 J;  1UIX A;  2FYN C;  3AEF C;  1WMK A;  4YTP C;  3SFD C;  3AE8 C;  3AEB C;  1HF9 A;  4R4L A;  1ZP0 C;  2QJY C;  5L8R J;  3D70 A;  2QIW A;  1VF5 D;  3T97 B;  1KTM A;  2OQQ A;  1K05 A;  1NYH A;  2P10 A;  3AE7 C;  5KKZ C;  2V7Q J;  1Q90 D;  1GMJ A;  4IL6 X;  1RQU A;  4YXD C;  3AEC C;  2MKV A;  1JB0 J;  3AE1 C;  3AE9 C;  4I7Z B;  1DIP A;  2D2C D;  4H13 D;  4H0L D;  2FBW C;  4PV1 D;  4Y28 J;  3AE5 C;  3RL0 g;  1KMI Z;  3S9O A;  4Z1M H;  2ZT9 D;  2JP3 A;  2WSC J;  4R4M A;  3AE4 C;  1OMI A;  1DD4 A;  3Q5P A;  2E74 D;  2E75 B;  4GDO A;  4OGQ B;  2E75 C;  4OGQ C;  3H25 A;  3D71 A;  1R8E A;  3D6Y A;  4RKU J;  2K9Y A;  4H44 D;  2YMK A;  3IAO A;  1OW7 A;  1VF5 B;  4XFJ A;  3D6Z A;  1VF5 C;  2QJP C;  3SFE C;  2NZ2 A;  1KIL E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...