2JP3A

Solution structure of the human fxyd4 (chif) protein in sds micelles
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
NGPVDKGSPFYYDWESLQLGGLIFGGLLCIAGIALALSGKCKCRRNHTPSSLPEKVTPLITPGSAST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural similarity of a membrane protein in micelles and membranes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transcription
molecule keywords FXYD domain-containing ion transport regulator 4
total genus 14
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2007-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02038 ATP1G1_PLM_MAT8 ATP1G1/PLM/MAT8 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.780 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2jp3A00
2JO1A 2MKVA 2JP3A 1Y9BA
chains in the Genus database with same CATH superfamily
4XE5B 2P2UA 1BE3G 1DD4A 1FU1A 4WY4B 1CW5A 1SQVJ 1VDFA 1NTZK 2Y0DA 3CXHD 1CI6B 4H13D 3VP8A 3Q3DA 1KB9I 1OXZA 5GTIH 5CBNA 3H1HE 5AVXB 5KJ7A 1NTZJ 1NTME 1JY3N 2O1JA 4KJMA 5E79E 5APQA 3L70D 3OA7A 3L74D 1OX3A 2AEMA 2JWDA 2WPVB 1SQBE 5APTA 2KZJA 1FZEA 2XZRA 2W8ZA 1SQXJ 5AW1B 1SQVD 3GF3A 1SLQA 1H0TA 3GG2A 5BU8B 1JMBA 2YO2A 3R2PA 3R4YA 3EWKA 4PD4I 1NAFA 2NRGA 1PFIA 5GTHE 1DEBA 2Q3IA 3VMYA 1VF5B 3O8ZA 4I2LC 2I8DA 2BASA 2A06D 2FXMA 2WVRA 3LIEA 3E1RA 3KDPB 2WSSH 2MKVA 1BGYJ 1ZV8A 2W6JH 2WITA 2OYOA 1RH5B 1VQMP 1EQ7A 1AVYA 1GL2D 3TSIA 1KC8Q 1PPJE 1CI6A 1SQXE 5CCHC 1VQ7P 4C7NB 1GZLA 2J58A 1M90Q 2NPSB 3F89A 2CPSA 2FXPA 1L0ND 3H1LE 2WSFJ 3QWOC 1VQKP 1IZNB 3HE5B 1M1JA 3D71A 1HGVA 2ITAA 4IL6E 5CHXA 5KAFH 1JM0A 3TGUE 2FYZA 1M56D 2BCCG 2NPSC 1FJPA 5BU5A 1Q86Q 1SFCC 3L73G 5H2FE 4ASWA 1LWUA 5AW6B 2E42A 1DX7A 5GTHH 1YJ9P 3IFMA 1URQD 1IFJA 1KILE 1FZCB 3OAKA 3B5ND 5AW8B 5AVRB 1IK7A 1N7SC 2PGDA 1PGQA 1LT9B 3A0HH 3L71E 3V4WA 3A0HE 3M9BA 4BRYA 3ABVC 2KK7A 1FDOA 2A06G 3CXHI 2OQQA 1BDCA 3NTNA 1EZVE 2KP8A 3H1JD 1ZRTD 2LXCB 1ZN5A 2E74D 3GLMA 3BCCE 1RF1C 2J59M 1L0NG 1N73B 2IBZI 1R5SA 1KYOE 2KZIA 2Q7CA 3MIWA 4W80A 3L74J 2YNYA 2IBZE 3CWBD 2WPRA 3CX5H 3CMEP 3H1KG 5APYA 4A7PA 3Q5RA 2R44A 1YYCA 2YO3A 4WY4C 1RF1B 2P1JA 4D6TE 1Q2NA 5AW0B 4PJ0E 3U1CA 1ZR2A 1KQGB 2AXCA 1KZUB 3RL0C 2WPSA 3HRNA 4IFMA 2ZFCA 5AW9B 2QM7A 2Q9IA 2IFNA 3IF4A 4GKGA 3CX5E 3C8VA 1JO5A 1OMIA 2YKOA 1SVFA 1RHZB 3EFGA 3RK3E 2Q3EA 1TU3F 1QVGO 4N78D 2R5DA 4GDOA 4RJTA 4Y99B 1T2KD 3CCSP 1SQXG 2IYPA 3AE7C 1N73C 2KI7B 1ZR4A 2D2CD 2QEXP 1QX8A 1VF5C 3T97B 2BEQD 3C1LA 2Q5UA 3MD0A 1LTJA 3H1LJ 3P8MC 5E79H 3L72G 3A3YB 4WBAA 1HVVA 3WUTA 3BRVB 1JUNA 4C46A 1PP9J 1G2CB 4U3FD 4HJGH 3RK2B 1PIXA 3USSA 3A7OA 1M1JB 3H1KD 1KB9H 1VF5D 1GL2B 1NO4A 2K1AA 4D6TJ 4H0LD 4UB6E 3FWLA 1PL5A 2WQYC 2WSCJ 3F5HA 2JR8A 5CBOA 4HH2A 1N8RQ 1HBWA 1CZQA 1NTKD 1SQPE 1ZW0A 2D2CB 3SWYA 2N1TA 5AVSB 2FFDB 1A02J 3ZDMA 1BCCE 3O6QA 1XTGB 1EZVG 3VN0A 3HTKA 4W7ZA 2JWAA 1LTJB 1JB0J 3BCCG 3T97A 2YMKA 2E5YA 1KQFB 3TF5A 3RL0D 3Q1MA 1DH3A 3D6YA 1BE3D 2W6AA 5KKZB 3V2PA 2IX7C 2QIWA 2HLOA 4EI2A 1X79B 1BGYD 1NU1E 2E76D 4JYCA 1QEXA 5KLVK 2KOGA 3A0BH 3Q5PA 2O3JA 3VTPC 1OVUA 2CPBA 1P84D 1FZCA 1FOSF 2XNDH 3BATA 2WTYA 3FWNA 3H1JG 2OARA 2IZ0A 2QJYB 3AEFC 3L73E 3MUDA 3H25A 1EDIA 2YIUB 5AVQB 2ZXXA 3AE8C 1YHQP 1S9KD 1NTZD 2WZ7A 1J1DC 2E76C 1L2PA 1RF0A 3CXHE 3FX0A 3WU2H 1D7MA 2P58A 3I5CA 2KB7P 1CSBA 1HH0A 1P84H 3L36A 4H13B 1JY3P 1QL2A 3PRJA 2OYIC 3U1AA 5L8RJ 3H1IG 4IOIH 4U7JA 4DZOA 1X8YA 2QJKB 4C7NA 1YIJP 1YJNP 2R3SA 3G9RA 4HYTB 5CCGC 3GHGB 1N73A 3D6ZA 2QSIA 2OTLP 1JY2O 3RGUA 1OWAA 2IBZG 1K73Q 2ZYDA 3CWBE 3AEBC 2N9YB 1FZAA 2W27A 3AE6C 3KPEA 4GOFA 1SQQE 1SQQG 1PGPA 3LW5J 1QL1A 2BCCD 2QE7H 2XKMA 4M3LA 4ZNCA 1K9MQ 1GW4A 1NU1J 3H1ID 3HD7D 1IFNA 1GW3A 1VL2A 3EQ2A 4N6JA 1PPJD 1LWUB 4I1LA 1IC2A 3L72J 4PV1B 1H0TB 2H7HA 3P7KA 1Y47A 1PP9G 5CJ0A 5AW4B 1MKMA 3L72D 3PLNA 2JP3A 1VQPP 1NTMJ 3MHVA 4OH8B 1M8OB 2WSEH 4R4MA 3JCUH 3AECC 5DJTB 2P10A 3H32B 1LP1A 1URQA 1KFNA 2FYUJ 2J5UA 2PRRA 3L74E 1U57A 3H1HJ 1VQNP 1HF9A 3CMAP 3GF7A 1SQBK 1G1JA 3L70G 1Q90D 5AVWB 1SQVE 1JTHB 3TGUD 3CC2P 2PAJA 3B5NA 1SP4A 2WSFH 3TNUB 1PGOA 1FDIA 1LT1A 2G8YA 2KS1B 1U7JA 3TGUJ 1T6AA 1Q7YQ 1U7MA 4U3FE 5C39A 1EXJA 1IFDA 1USDA 2FYUE 2POHA 2KIKA 3CLQA 1JCDA 2W83C 3JC22 1L0LK 4NPDA 1N7LA 3NMDA 1QVFO 3BCCD 1BE3J 1PV3A 1SQVK 5KAIH 3MUDC 5KAFE 3WUVA 3CPWO 4WY4D 2KLVA 1LTIC 2A45H 3EFFK 2HODA 1IJDB 2R3CA 4JYBA 1L4AC 4NPEA 1RF0C 2AEFA 3ITKA 4LLHA 1VPCA 3L75D 4AYCA 1LTBC 1EDJA 4JPZB 2QA4P 3H1JJ 2B9BA 2R32A 1VQLP 1SQQJ 1IFMA 1KYOI 3KYQA 1RQUA 1VQ6P 3CCMP 1H89A 1EDKA 2AXTE 3CX5D 4O9BA 4AUWA 4PV1D 3G4SP 3TNUA 2C0WA 3GHGC 2ZYAA 4H13C 2OYIB 5AVTB 1YQ4C 4L73A 3HE4A 3BRTB 1M1JC 1GDTA 3B8EB 5B5EH 1NTMD 1SFCB 2KYVA 5KTBA 1YTZT 5TISH 3CCUP 4ASVA 3RK2C 1BCCG 2NPSA 2DW3A 5B66E 3CCRP 2Z4EA 1RE3A 3D70A 1SFCA 1FDMA 2OYHA 3L73D 3M91A 3PTZA 5APSA 3HE4B 1MUUA 2FYNC 1AJYA 1L0NJ 1RE4A 1WT6A 2IBZD 2KSEA 3AEEC 2WT7B 2M0BA 1NTZE 2WSEJ 3AEGC 3GMAA 5APXA 5BVZA 1W5CE 4EDFA 4D6TD 3VP9A 4GT1A 1VQOP 3CCQP 2YKQA 2BEZF 3AE3C 4BXLA 1H8AA 2WWWA 2K3RA 2IZ1A 3RK2D 5CCHA 1X0TA 2A45G 3AEDC 1L0NE 3H1LD 3PP5A 1JY2N 4LGDE 3FGAD 1Q81Q 1EDLA 3KQGA 1LNQA 2RKLA 1FZFA 2L91A 2FYUG 1KILC 1FE6A 1QLED 3MTUE 3H1HG 5CMZA 4WY4A 2GA1A 4HB1A 1FZGA 4ZMDA 3H6PA 3L70J 1J1EC 1KN7A 3M0AA 1ZOYC 2E75B 3AE2C 2FY8A 3KXDA 5TJHA 3W67A 1GMJA 1LTGC 1KILD 1MFTA 1SQPJ 3TGUG 2HG5D 3L72E 1LGHB 1JTHA 2OGUA 2ZXEB 3G3ZA 3JCUE 3SFDC 3M9QA 2HR3A 1J1DB 2E76B 3H1JE 1FS0E 1LP1B 1OW8A 1URQB 4TT3H 3HD7C 1AQ5A 2M5AA 2ZT9D 2IDBA 3M0DC 5CJ4A 1YI2P 1K05A 1NKNA 2WPQA 3G71P 2Y9YA 4OGQD 2E75D 4I7ZC 2JDIH 3A5TA 3RK3C 1T3UA 1YQ3C 2XU6A 3WMM0 3VYIA 1FAVA 2B89A 3V2RA 1L0LD 1HTLC 5CCGD 2HPCA 2IFMA 1W2EA 3V4QA 1LT9C 1GTWA 3HTKB 4YPCA 4OWFA 1AQTA 3CCEP 3E1IA 2JO1A 3MP7B 3NFQA 2N1TB 3AE1C 2K9JB 4RESB 3U59A 4Z1MH 1PPJG 2OYHC 2FFDA 4QMAA 1LTAC 4R4LA 2Y9ZA 1W2BO 3FXEA 4JF7A 4N78E 5B5EE 1PP9D 2V7QH 5KLVE 2W6BA 4H44C 4D6TG 2IPPA 1SQQD 2QM8A 2A06E 2KNCA 2BCCE 3WU2E 3TYYA 1EC5A 5AVYB 5APUA 4CPGA 2AXTH 2KSJA 4UB8E 2WSCH 5AW7B 3OW2O 1SQXD 4RO0A 3VMXA 2C0XA 4H44B 4HKZH 1L4AD 4AQRD 4B86A 1JNMA 2I1JA 1A02F 3L35A 2ZVNB 1YITP 3BCCJ 1KQLA 3MGNA 2V7QJ 3LIDA 1JY3O 3KZIH 1KILA 2QRXA 4DCKA 5KJ7C 1GD2E 2C9NY 3CCLP 4DJGA 3CC4P 3TDKA 1LTSC 1KTMA 1NKZB 2HODB 4K3AA 1DD3A 1S2EA 1ZLLA 3IR9A 1RY3A 1SQPD 4BWNA 1KB9D 2KUBA 1NJIQ 2KNCB 1MZ9A 1N86A 1NTZG 2I1KA 2QJPC 2YXQB 3L37A 3L71D 3LW5H 1EZVI 3N4XA 5DJUB 3VMAA 1DIPA 2O1KA 1IK9A 1NTMK 3CWBJ 1KQSO 1BSHA 2FYUD 1KFMA 1QGKB 2P7JA 1ZMEC 2E74C 1S1CX 1SQPG 4H0LC 2QJPB 3O6QB 1RF1A 2OTJP 3L73J 2KS1A 4KT0J 3BVHA 1HWTC 3AE5C 2M3EA 3B5NB 1HJ0A 4Y99C 5CCGA 2PP6A 4UB6H 3B71A 5AW2B 1AA0A 3Q5SA 2GM4A 1N7SD 2JJLA 2W90A 2GUVA 1BGYG 4DT0A 4GODA 3H1IJ 1NTMG 3M06A 2NZ2A 4W7YA 4Y28J 2UWJE 2KXPB 4L74A 2D2CC 3RBXA 1GL2A 1LWUC 3JSVC 4GIFA 2H43A 1PGJA 2B87B 5AVUB 3V2NA 3CC7P 4XFJA 1MFZA 2B87A 1AVOA 4IL6X 1IFPA 2RMZA 3L71G 1L0LJ 2WMMA 3SFEC 3TK1A 1S9KE 4JQ0D 2N9BA 2FYNB 2K9YA 1GU4A 2Z5HA 5KAIE 3SSUA 4EOTA 4OGQC 1L4AA 4C7RA 4N3YB 5GTIE 1FJKA 3VMZA 1FOSE 1IO4A 1FC2C 1SQBD 3V2QA 5KLIC 3AEAC 4PD4E 2ZAEB 1K04A 3B4SA 1OFCX 3IN6A 2H88C 3HE5A 1Q82Q 3AE9C 1NWQA 1LTJC 3CD6P 2JKVA 3C9IA 3GHGA 5KLVG 4NPFX 2E5TA 2YIUC 3BASA 3CXHH 1H88A 2YMYA 1OVRA 3Q2YA 3KHUA 1EZVD 1KORA 3H1IE 4I6MC 4LC1A 2K9JA 3I56P 1OW7A 1KYOH 1RE3C 1J1EB 2RN0A 2RH0A 1T2KC 2B88A 1KYOD 1NTKG 1NOHA 3PH0A 4H44D 1NU1K 2HPCB 1L4AB 3CX5I 2V4HA 3RL0B 3N7NA 3P8CD 1UIIA 1YTZI 2A45I 2GUSA 1S4XA 2FXOA 3A0BE 3E7KA 1BCCD 4GOEA 4IFFA 5AW3B 1URQC 5AW5B 1VQ5P 2QG4A 4WWIA 1SQBG 2K88A 4YTPC 1JEKA 3A2AA 2XV5A 1KD1Q 2HYNA 1SFCD 2M5AB 2MJZA 1NAYA 2O01H 3II6A 4I7ZB 3UIAA 4EYYQ 1AFOA 2K37A 4H0LB 3PHLA 1S3JA 2H8PD 1BGYE 1NU1D 3MZWB 3RK3B 3CWBG 1KMIZ 2O01N 1NYHA 3HUSC 2E74B 1L0LG 2Z5IA 1M7LA 3H1HD 3I55P 4L76A 3FXDA 1IFIA 5AVVB 4YXWH 5B66H 3L70E 1ZRTE 2PFXA 5TISE 1T3JA 1P84E 2VRSA 1GL2C 3H1LG 3S4RA 1JCCA 1S5LH 1L0NK 4EIJA 4PD4H 1N7SB 2ZJSE 1HUCA 1KB9E 2N1TC 2OTKE 1RE4C 3RL0g 2QVAA 2ZT9B 3K5BA 2C9LY 3CL3D 3L4FA 5K5GB 1NH4A 1BCCJ 2ZVOB 1Y8AA 4PV1C 5KLVJ 1N2DC 2FYUK 1NVOA 3H1KE 4MN4C 1L0LE 2YKPA 2CK3H 1G2CA 4DOJA 3CCJP 2M3BA 1KV4A 3L71J 4ZKPA 3CI9A 2H89C 4WVZA 1M1KQ 1R8EA 1SQPK 4KHXA 3SWFA 1YJWP 1RQVA 1KILB 2Q1KA 2E75C 3L75J 1OZHA 1S5LX 1WMKA 4YXDC 1OW6A 5EFWB 1PP9E 5KLIB 1M57D 3GW6A 4U3FG 1E79H 1X22A 1GU5A 1K8AQ 1VQ9P 1XTCC 2XNXA 4XA4A 3V5BA 1PZQA 4ZKUA 3S9OA 3M9HA 2WT7A 1E5WA 1SQXK 4OVNF 1S5LE 2G3AA 1NTKK 1SQVG 3VOPA 5KJ7D 5APVA 1ZP0C 5M1BA 2Y0CA 4PJ0H 3QH9A 1FZBA 3H32A 1GK6A 1LJ2A 1NHLA 4L75A 1HJBA 2LR2A 1Y9BA 2LXBA 1P84I 2QJYC 3HD7B 1JY2P 2ZYGA 1YBKA 2O01J 2IYOA 2SPZA 1EXIA 1UIXA 2P67A 5APWA 1NTKJ 1SS1A 3G6EP 1VQ8P 1FBMA 1AV1A 2YXRB 1NTKE 4PD4D 1WRGA 3M0DA 1HGZA 3AE4C 2Q6QA 4JBZA 3B5NC 1X9VA 1GK4A 2M8RA 1JMMA 5KLVD 1SQBJ 2N1TD 3NXSA 2QJKC 1OIPA 3HUSA 2JEEA 4WB4A 1Z56A 3OJAB 1G1IA 1FZCC 3KZIE 1T8ZA 1DEEG 3CCVP 4IFDK 3S1KA 2OYHB 2KLUA 1LT9A 2NPSD 1BE3E 2R5BA 3HUSB 4BRYB 2LKMA 3RK3D 5H2FH 1USEA 2FBWC 3SWKA 2FFDC 4K35A 1BSNA 1N7SA 4UB8H 2BCCJ 4OGQB 2E43A 1R5LA 3PJSK 4RKUJ 1OVVA 1J2JB 3P8CE 3V6IA 1NU1G 2Y0EA 2AEJA 1SQQK 3L74G 2ZT9C 4IL6H 1JOCA 1BDDA 3L75E 3L75G 3H1KJ 5CCHD 2OYIA 3IAOA 1VQ4P 1LTTC 3HD7A 2HFED 1ZXGA 4U3FJ 5AVZB 5KKZC 3P32A 2XDJA 3W68A 2FKWB 1MV8A 3WUUA 1NGMB 2L5GB 4TLFA 3RBZA 1S72P
chains in the Genus database with same CATH topology
2QIWA 2H88C 3AE9C 2E76D 1DD4A 3FGAD 3Q3DA 4H13D 2YIUC 3Q5PA 3Q2YA 1KORA 2WPVB 1ZOYC 1OW7A 2E75B 3AEFC 3AE2C 3H25A 3GF3A 1GMJA 3AE8C 4H44D 3R4YA 3EWKA 2E76C 4I7ZC 3SFDC 1VF5B 2E76B 2MKVA 4H13B 4YTPC 1OW8A 4TT3H 5L8RJ 4U7JA 1ZMEC 4I7ZB 3G9RA 2ZT9D 2IDBA 3D6ZA 2QSIA 1K05A 4H0LB 2FXPA 4OGQD 2WSFJ 2E75D 3D71A 1KMIZ 1NYHA 3AEBC 2E74B 3AE6C 1YQ3C 3LW5J 1ZRTE 1VL2A 4PV1B 2JO1A 4Z1MH 3AE1C 1KILE 1MKMA 4R4LA 2JP3A 1IK7A 3RL0g 2ZT9B 4H44C 3ABVC 4PV1C 4R4MA 1FDOA 3AECC 2P10A 2OQQA 2J5UA 1U57A 2E74D 3GLMA 1HF9A 3GF7A 1Q90D 2H89C 4H44B 1R8EA 1RQVA 1FDIA 2E75C 2G8YA 1WMKA 1S5LX 4YXDC 1OW6A 3Q5RA 2V7QJ 1EXJA 1KQGB 3S9OA 1KTMA 1PV3A 1DD3A 2G3AA 3C8VA 1OMIA 1ZP0C 3RK3E 5M1BA 1TU3F 2QJPC 1DIPA 1Y9BA 2QJYC 4GDOA 2O01J 1EXIA 3AE7C 1UIXA 2E74C 1S1CX 4H0LC 1RQUA 2D2CD 4KT0J 1VF5C 3T97B 2BEQD 3AE5C 1HJ0A 4PV1D 3B71A 3AE4C 4H13C 3Q5SA 1YQ4C 2QJKC 1PIXA 4Y28J 2NZ2A 1VF5D 2D2CC 4H0LD 3D70A 1PL5A 2WQYC 2WSCJ 4XFJA 4IL6X 2FYNC 2FBWC 1AJYA 3SFEC 2D2CB 3AEEC 4OGQB 2WSEJ 2K9YA 3AEGC 3GMAA 4RKUJ 3O6QA 4OGQC 2ZT9C 2BEZF 3AE3C 1JB0J 3IAOA 1NGMB 2YMKA 5KKZC 1KQFB 5KLIC 3Q1MA 3D6YA 3AEAC 3AEDC 3IN6A 1K04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JO1 A;  2MKV A;  2JP3 A;  1Y9B A; 
#chains in the Genus database with same CATH topology
 4XE5 B;  2P2U A;  1BE3 G;  1DD4 A;  1FU1 A;  4WY4 B;  1CW5 A;  1SQV J;  1VDF A;  1NTZ K;  2Y0D A;  3CXH D;  1CI6 B;  4H13 D;  3VP8 A;  3Q3D A;  1KB9 I;  1OXZ A;  5GTI H;  5CBN A;  3H1H E;  5AVX B;  5KJ7 A;  1NTZ J;  1NTM E;  1JY3 N;  2O1J A;  4KJM A;  5E79 E;  5APQ A;  3L70 D;  3OA7 A;  3L74 D;  1OX3 A;  2AEM A;  2JWD A;  2WPV B;  1SQB E;  5APT A;  2KZJ A;  1FZE A;  2XZR A;  2W8Z A;  1SQX J;  5AW1 B;  1SQV D;  3GF3 A;  1SLQ A;  1H0T A;  3GG2 A;  5BU8 B;  1JMB A;  2YO2 A;  3R2P A;  3R4Y A;  3EWK A;  4PD4 I;  1NAF A;  2NRG A;  1PFI A;  5GTH E;  1DEB A;  2Q3I A;  3VMY A;  1VF5 B;  3O8Z A;  4I2L C;  2I8D A;  2BAS A;  2A06 D;  2FXM A;  2WVR A;  3LIE A;  3E1R A;  3KDP B;  2WSS H;  2MKV A;  1BGY J;  1ZV8 A;  2W6J H;  2WIT A;  2OYO A;  1RH5 B;  1VQM P;  1EQ7 A;  1AVY A;  1GL2 D;  3TSI A;  1KC8 Q;  1PPJ E;  1CI6 A;  1SQX E;  5CCH C;  1VQ7 P;  4C7N B;  1GZL A;  2J58 A;  1M90 Q;  2NPS B;  3F89 A;  2CPS A;  2FXP A;  1L0N D;  3H1L E;  2WSF J;  3QWO C;  1VQK P;  1IZN B;  3HE5 B;  1M1J A;  3D71 A;  1HGV A;  2ITA A;  4IL6 E;  5CHX A;  5KAF H;  1JM0 A;  3TGU E;  2FYZ A;  1M56 D;  2BCC G;  2NPS C;  1FJP A;  5BU5 A;  1Q86 Q;  1SFC C;  3L73 G;  5H2F E;  4ASW A;  1LWU A;  5AW6 B;  2E42 A;  1DX7 A;  5GTH H;  1YJ9 P;  3IFM A;  1URQ D;  1IFJ A;  1KIL E;  1FZC B;  3OAK A;  3B5N D;  5AW8 B;  5AVR B;  1IK7 A;  1N7S C;  2PGD A;  1PGQ A;  1LT9 B;  3A0H H;  3L71 E;  3V4W A;  3A0H E;  3M9B A;  4BRY A;  3ABV C;  2KK7 A;  1FDO A;  2A06 G;  3CXH I;  2OQQ A;  1BDC A;  3NTN A;  1EZV E;  2KP8 A;  3H1J D;  1ZRT D;  2LXC B;  1ZN5 A;  2E74 D;  3GLM A;  3BCC E;  1RF1 C;  2J59 M;  1L0N G;  1N73 B;  2IBZ I;  1R5S A;  1KYO E;  2KZI A;  2Q7C A;  3MIW A;  4W80 A;  3L74 J;  2YNY A;  2IBZ E;  3CWB D;  2WPR A;  3CX5 H;  3CME P;  3H1K G;  5APY A;  4A7P A;  3Q5R A;  2R44 A;  1YYC A;  2YO3 A;  4WY4 C;  1RF1 B;  2P1J A;  4D6T E;  1Q2N A;  5AW0 B;  4PJ0 E;  3U1C A;  1ZR2 A;  1KQG B;  2AXC A;  1KZU B;  3RL0 C;  2WPS A;  3HRN A;  4IFM A;  2ZFC A;  5AW9 B;  2QM7 A;  2Q9I A;  2IFN A;  3IF4 A;  4GKG A;  3CX5 E;  3C8V A;  1JO5 A;  1OMI A;  2YKO A;  1SVF A;  1RHZ B;  3EFG A;  3RK3 E;  2Q3E A;  1TU3 F;  1QVG O;  4N78 D;  2R5D A;  4GDO A;  4RJT A;  4Y99 B;  1T2K D;  3CCS P;  1SQX G;  2IYP A;  3AE7 C;  1N73 C;  2KI7 B;  1ZR4 A;  2D2C D;  2QEX P;  1QX8 A;  1VF5 C;  3T97 B;  2BEQ D;  3C1L A;  2Q5U A;  3MD0 A;  1LTJ A;  3H1L J;  3P8M C;  5E79 H;  3L72 G;  3A3Y B;  4WBA A;  1HVV A;  3WUT A;  3BRV B;  1JUN A;  4C46 A;  1PP9 J;  1G2C B;  4U3F D;  4HJG H;  3RK2 B;  1PIX A;  3USS A;  3A7O A;  1M1J B;  3H1K D;  1KB9 H;  1VF5 D;  1GL2 B;  1NO4 A;  2K1A A;  4D6T J;  4H0L D;  4UB6 E;  3FWL A;  1PL5 A;  2WQY C;  2WSC J;  3F5H A;  2JR8 A;  5CBO A;  4HH2 A;  1N8R Q;  1HBW A;  1CZQ A;  1NTK D;  1SQP E;  1ZW0 A;  2D2C B;  3SWY A;  2N1T A;  5AVS B;  2FFD B;  1A02 J;  3ZDM A;  1BCC E;  3O6Q A;  1XTG B;  1EZV G;  3VN0 A;  3HTK A;  4W7Z A;  2JWA A;  1LTJ B;  1JB0 J;  3BCC G;  3T97 A;  2YMK A;  2E5Y A;  1KQF B;  3TF5 A;  3RL0 D;  3Q1M A;  1DH3 A;  3D6Y A;  1BE3 D;  2W6A A;  5KKZ B;  3V2P A;  2IX7 C;  2QIW A;  2HLO A;  4EI2 A;  1X79 B;  1BGY D;  1NU1 E;  2E76 D;  4JYC A;  1QEX A;  5KLV K;  2KOG A;  3A0B H;  3Q5P A;  2O3J A;  3VTP C;  1OVU A;  2CPB A;  1P84 D;  1FZC A;  1FOS F;  2XND H;  3BAT A;  2WTY A;  3FWN A;  3H1J G;  2OAR A;  2IZ0 A;  2QJY B;  3AEF C;  3L73 E;  3MUD A;  3H25 A;  1EDI A;  2YIU B;  5AVQ B;  2ZXX A;  3AE8 C;  1YHQ P;  1S9K D;  1NTZ D;  2WZ7 A;  1J1D C;  2E76 C;  1L2P A;  1RF0 A;  3CXH E;  3FX0 A;  3WU2 H;  1D7M A;  2P58 A;  3I5C A;  2KB7 P;  1CSB A;  1HH0 A;  1P84 H;  3L36 A;  4H13 B;  1JY3 P;  1QL2 A;  3PRJ A;  2OYI C;  3U1A A;  5L8R J;  3H1I G;  4IOI H;  4U7J A;  4DZO A;  1X8Y A;  2QJK B;  4C7N A;  1YIJ P;  1YJN P;  2R3S A;  3G9R A;  4HYT B;  5CCG C;  3GHG B;  1N73 A;  3D6Z A;  2QSI A;  2OTL P;  1JY2 O;  3RGU A;  1OWA A;  2IBZ G;  1K73 Q;  2ZYD A;  3CWB E;  3AEB C;  2N9Y B;  1FZA A;  2W27 A;  3AE6 C;  3KPE A;  4GOF A;  1SQQ E;  1SQQ G;  1PGP A;  3LW5 J;  1QL1 A;  2BCC D;  2QE7 H;  2XKM A;  4M3L A;  4ZNC A;  1K9M Q;  1GW4 A;  1NU1 J;  3H1I D;  3HD7 D;  1IFN A;  1GW3 A;  1VL2 A;  3EQ2 A;  4N6J A;  1PPJ D;  1LWU B;  4I1L A;  1IC2 A;  3L72 J;  4PV1 B;  1H0T B;  2H7H A;  3P7K A;  1Y47 A;  1PP9 G;  5CJ0 A;  5AW4 B;  1MKM A;  3L72 D;  3PLN A;  2JP3 A;  1VQP P;  1NTM J;  3MHV A;  4OH8 B;  1M8O B;  2WSE H;  4R4M A;  3JCU H;  3AEC C;  5DJT B;  2P10 A;  3H32 B;  1LP1 A;  1URQ A;  1KFN A;  2FYU J;  2J5U A;  2PRR A;  3L74 E;  1U57 A;  3H1H J;  1VQN P;  1HF9 A;  3CMA P;  3GF7 A;  1SQB K;  1G1J A;  3L70 G;  1Q90 D;  5AVW B;  1SQV E;  1JTH B;  3TGU D;  3CC2 P;  2PAJ A;  3B5N A;  1SP4 A;  2WSF H;  3TNU B;  1PGO A;  1FDI A;  1LT1 A;  2G8Y A;  2KS1 B;  1U7J A;  3TGU J;  1T6A A;  1Q7Y Q;  1U7M A;  4U3F E;  5C39 A;  1EXJ A;  1IFD A;  1USD A;  2FYU E;  2POH A;  2KIK A;  3CLQ A;  1JCD A;  2W83 C;  3JC2 2;  1L0L K;  4NPD A;  1N7L A;  3NMD A;  1QVF O;  3BCC D;  1BE3 J;  1PV3 A;  1SQV K;  5KAI H;  3MUD C;  5KAF E;  3WUV A;  3CPW O;  4WY4 D;  2KLV A;  1LTI C;  2A45 H;  3EFF K;  2HOD A;  1IJD B;  2R3C A;  4JYB A;  1L4A C;  4NPE A;  1RF0 C;  2AEF A;  3ITK A;  4LLH A;  1VPC A;  3L75 D;  4AYC A;  1LTB C;  1EDJ A;  4JPZ B;  2QA4 P;  3H1J J;  2B9B A;  2R32 A;  1VQL P;  1SQQ J;  1IFM A;  1KYO I;  3KYQ A;  1RQU A;  1VQ6 P;  3CCM P;  1H89 A;  1EDK A;  2AXT E;  3CX5 D;  4O9B A;  4AUW A;  4PV1 D;  3G4S P;  3TNU A;  2C0W A;  3GHG C;  2ZYA A;  4H13 C;  2OYI B;  5AVT B;  1YQ4 C;  4L73 A;  3HE4 A;  3BRT B;  1M1J C;  1GDT A;  3B8E B;  5B5E H;  1NTM D;  1SFC B;  2KYV A;  5KTB A;  1YTZ T;  5TIS H;  3CCU P;  4ASV A;  3RK2 C;  1BCC G;  2NPS A;  2DW3 A;  5B66 E;  3CCR P;  2Z4E A;  1RE3 A;  3D70 A;  1SFC A;  1FDM A;  2OYH A;  3L73 D;  3M91 A;  3PTZ A;  5APS A;  3HE4 B;  1MUU A;  2FYN C;  1AJY A;  1L0N J;  1RE4 A;  1WT6 A;  2IBZ D;  2KSE A;  3AEE C;  2WT7 B;  2M0B A;  1NTZ E;  2WSE J;  3AEG C;  3GMA A;  5APX A;  5BVZ A;  1W5C E;  4EDF A;  4D6T D;  3VP9 A;  4GT1 A;  1VQO P;  3CCQ P;  2YKQ A;  2BEZ F;  3AE3 C;  4BXL A;  1H8A A;  2WWW A;  2K3R A;  2IZ1 A;  3RK2 D;  5CCH A;  1X0T A;  2A45 G;  3AED C;  1L0N E;  3H1L D;  3PP5 A;  1JY2 N;  4LGD E;  3FGA D;  1Q81 Q;  1EDL A;  3KQG A;  1LNQ A;  2RKL A;  1FZF A;  2L91 A;  2FYU G;  1KIL C;  1FE6 A;  1QLE D;  3MTU E;  3H1H G;  5CMZ A;  4WY4 A;  2GA1 A;  4HB1 A;  1FZG A;  4ZMD A;  3H6P A;  3L70 J;  1J1E C;  1KN7 A;  3M0A A;  1ZOY C;  2E75 B;  3AE2 C;  2FY8 A;  3KXD A;  5TJH A;  3W67 A;  1GMJ A;  1LTG C;  1KIL D;  1MFT A;  1SQP J;  3TGU G;  2HG5 D;  3L72 E;  1LGH B;  1JTH A;  2OGU A;  2ZXE B;  3G3Z A;  3JCU E;  3SFD C;  3M9Q A;  2HR3 A;  1J1D B;  2E76 B;  3H1J E;  1FS0 E;  1LP1 B;  1OW8 A;  1URQ B;  4TT3 H;  3HD7 C;  1AQ5 A;  2M5A A;  2ZT9 D;  2IDB A;  3M0D C;  5CJ4 A;  1YI2 P;  1K05 A;  1NKN A;  2WPQ A;  3G71 P;  2Y9Y A;  4OGQ D;  2E75 D;  4I7Z C;  2JDI H;  3A5T A;  3RK3 C;  1T3U A;  1YQ3 C;  2XU6 A;  3WMM 0;  3VYI A;  1FAV A;  2B89 A;  3V2R A;  1L0L D;  1HTL C;  5CCG D;  2HPC A;  2IFM A;  1W2E A;  3V4Q A;  1LT9 C;  1GTW A;  3HTK B;  4YPC A;  4OWF A;  1AQT A;  3CCE P;  3E1I A;  2JO1 A;  3MP7 B;  3NFQ A;  2N1T B;  3AE1 C;  2K9J B;  4RES B;  3U59 A;  4Z1M H;  1PPJ G;  2OYH C;  2FFD A;  4QMA A;  1LTA C;  4R4L A;  2Y9Z A;  1W2B O;  3FXE A;  4JF7 A;  4N78 E;  5B5E E;  1PP9 D;  2V7Q H;  5KLV E;  2W6B A;  4H44 C;  4D6T G;  2IPP A;  1SQQ D;  2QM8 A;  2A06 E;  2KNC A;  2BCC E;  3WU2 E;  3TYY A;  1EC5 A;  5AVY B;  5APU A;  4CPG A;  2AXT H;  2KSJ A;  4UB8 E;  2WSC H;  5AW7 B;  3OW2 O;  1SQX D;  4RO0 A;  3VMX A;  2C0X A;  4H44 B;  4HKZ H;  1L4A D;  4AQR D;  4B86 A;  1JNM A;  2I1J A;  1A02 F;  3L35 A;  2ZVN B;  1YIT P;  3BCC J;  1KQL A;  3MGN A;  2V7Q J;  3LID A;  1JY3 O;  3KZI H;  1KIL A;  2QRX A;  4DCK A;  5KJ7 C;  1GD2 E;  2C9N Y;  3CCL P;  4DJG A;  3CC4 P;  3TDK A;  1LTS C;  1KTM A;  1NKZ B;  2HOD B;  4K3A A;  1DD3 A;  1S2E A;  1ZLL A;  3IR9 A;  1RY3 A;  1SQP D;  4BWN A;  1KB9 D;  2KUB A;  1NJI Q;  2KNC B;  1MZ9 A;  1N86 A;  1NTZ G;  2I1K A;  2QJP C;  2YXQ B;  3L37 A;  3L71 D;  3LW5 H;  1EZV I;  3N4X A;  5DJU B;  3VMA A;  1DIP A;  2O1K A;  1IK9 A;  1NTM K;  3CWB J;  1KQS O;  1BSH A;  2FYU D;  1KFM A;  1QGK B;  2P7J A;  1ZME C;  2E74 C;  1S1C X;  1SQP G;  4H0L C;  2QJP B;  3O6Q B;  1RF1 A;  2OTJ P;  3L73 J;  2KS1 A;  4KT0 J;  3BVH A;  1HWT C;  3AE5 C;  2M3E A;  3B5N B;  1HJ0 A;  4Y99 C;  5CCG A;  2PP6 A;  4UB6 H;  3B71 A;  5AW2 B;  1AA0 A;  3Q5S A;  2GM4 A;  1N7S D;  2JJL A;  2W90 A;  2GUV A;  1BGY G;  4DT0 A;  4GOD A;  3H1I J;  1NTM G;  3M06 A;  2NZ2 A;  4W7Y A;  4Y28 J;  2UWJ E;  2KXP B;  4L74 A;  2D2C C;  3RBX A;  1GL2 A;  1LWU C;  3JSV C;  4GIF A;  2H43 A;  1PGJ A;  2B87 B;  5AVU B;  3V2N A;  3CC7 P;  4XFJ A;  1MFZ A;  2B87 A;  1AVO A;  4IL6 X;  1IFP A;  2RMZ A;  3L71 G;  1L0L J;  2WMM A;  3SFE C;  3TK1 A;  1S9K E;  4JQ0 D;  2N9B A;  2FYN B;  2K9Y A;  1GU4 A;  2Z5H A;  5KAI E;  3SSU A;  4EOT A;  4OGQ C;  1L4A A;  4C7R A;  4N3Y B;  5GTI E;  1FJK A;  3VMZ A;  1FOS E;  1IO4 A;  1FC2 C;  1SQB D;  3V2Q A;  5KLI C;  3AEA C;  4PD4 E;  2ZAE B;  1K04 A;  3B4S A;  1OFC X;  3IN6 A;  2H88 C;  3HE5 A;  1Q82 Q;  3AE9 C;  1NWQ A;  1LTJ C;  3CD6 P;  2JKV A;  3C9I A;  3GHG A;  5KLV G;  4NPF X;  2E5T A;  2YIU C;  3BAS A;  3CXH H;  1H88 A;  2YMY A;  1OVR A;  3Q2Y A;  3KHU A;  1EZV D;  1KOR A;  3H1I E;  4I6M C;  4LC1 A;  2K9J A;  3I56 P;  1OW7 A;  1KYO H;  1RE3 C;  1J1E B;  2RN0 A;  2RH0 A;  1T2K C;  2B88 A;  1KYO D;  1NTK G;  1NOH A;  3PH0 A;  4H44 D;  1NU1 K;  2HPC B;  1L4A B;  3CX5 I;  2V4H A;  3RL0 B;  3N7N A;  3P8C D;  1UII A;  1YTZ I;  2A45 I;  2GUS A;  1S4X A;  2FXO A;  3A0B E;  3E7K A;  1BCC D;  4GOE A;  4IFF A;  5AW3 B;  1URQ C;  5AW5 B;  1VQ5 P;  2QG4 A;  4WWI A;  1SQB G;  2K88 A;  4YTP C;  1JEK A;  3A2A A;  2XV5 A;  1KD1 Q;  2HYN A;  1SFC D;  2M5A B;  2MJZ A;  1NAY A;  2O01 H;  3II6 A;  4I7Z B;  3UIA A;  4EYY Q;  1AFO A;  2K37 A;  4H0L B;  3PHL A;  1S3J A;  2H8P D;  1BGY E;  1NU1 D;  3MZW B;  3RK3 B;  3CWB G;  1KMI Z;  2O01 N;  1NYH A;  3HUS C;  2E74 B;  1L0L G;  2Z5I A;  1M7L A;  3H1H D;  3I55 P;  4L76 A;  3FXD A;  1IFI A;  5AVV B;  4YXW H;  5B66 H;  3L70 E;  1ZRT E;  2PFX A;  5TIS E;  1T3J A;  1P84 E;  2VRS A;  1GL2 C;  3H1L G;  3S4R A;  1JCC A;  1S5L H;  1L0N K;  4EIJ A;  4PD4 H;  1N7S B;  2ZJS E;  1HUC A;  1KB9 E;  2N1T C;  2OTK E;  1RE4 C;  3RL0 g;  2QVA A;  2ZT9 B;  3K5B A;  2C9L Y;  3CL3 D;  3L4F A;  5K5G B;  1NH4 A;  1BCC J;  2ZVO B;  1Y8A A;  4PV1 C;  5KLV J;  1N2D C;  2FYU K;  1NVO A;  3H1K E;  4MN4 C;  1L0L E;  2YKP A;  2CK3 H;  1G2C A;  4DOJ A;  3CCJ P;  2M3B A;  1KV4 A;  3L71 J;  4ZKP A;  3CI9 A;  2H89 C;  4WVZ A;  1M1K Q;  1R8E A;  1SQP K;  4KHX A;  3SWF A;  1YJW P;  1RQV A;  1KIL B;  2Q1K A;  2E75 C;  3L75 J;  1OZH A;  1S5L X;  1WMK A;  4YXD C;  1OW6 A;  5EFW B;  1PP9 E;  5KLI B;  1M57 D;  3GW6 A;  4U3F G;  1E79 H;  1X22 A;  1GU5 A;  1K8A Q;  1VQ9 P;  1XTC C;  2XNX A;  4XA4 A;  3V5B A;  1PZQ A;  4ZKU A;  3S9O A;  3M9H A;  2WT7 A;  1E5W A;  1SQX K;  4OVN F;  1S5L E;  2G3A A;  1NTK K;  1SQV G;  3VOP A;  5KJ7 D;  5APV A;  1ZP0 C;  5M1B A;  2Y0C A;  4PJ0 H;  3QH9 A;  1FZB A;  3H32 A;  1GK6 A;  1LJ2 A;  1NHL A;  4L75 A;  1HJB A;  2LR2 A;  1Y9B A;  2LXB A;  1P84 I;  2QJY C;  3HD7 B;  1JY2 P;  2ZYG A;  1YBK A;  2O01 J;  2IYO A;  2SPZ A;  1EXI A;  1UIX A;  2P67 A;  5APW A;  1NTK J;  1SS1 A;  3G6E P;  1VQ8 P;  1FBM A;  1AV1 A;  2YXR B;  1NTK E;  4PD4 D;  1WRG A;  3M0D A;  1HGZ A;  3AE4 C;  2Q6Q A;  4JBZ A;  3B5N C;  1X9V A;  1GK4 A;  2M8R A;  1JMM A;  5KLV D;  1SQB J;  2N1T D;  3NXS A;  2QJK C;  1OIP A;  3HUS A;  2JEE A;  4WB4 A;  1Z56 A;  3OJA B;  1G1I A;  1FZC C;  3KZI E;  1T8Z A;  1DEE G;  3CCV P;  4IFD K;  3S1K A;  2OYH B;  2KLU A;  1LT9 A;  2NPS D;  1BE3 E;  2R5B A;  3HUS B;  4BRY B;  2LKM A;  3RK3 D;  5H2F H;  1USE A;  2FBW C;  3SWK A;  2FFD C;  4K35 A;  1BSN A;  1N7S A;  4UB8 H;  2BCC J;  4OGQ B;  2E43 A;  1R5L A;  3PJS K;  4RKU J;  1OVV A;  1J2J B;  3P8C E;  3V6I A;  1NU1 G;  2Y0E A;  2AEJ A;  1SQQ K;  3L74 G;  2ZT9 C;  4IL6 H;  1JOC A;  1BDD A;  3L75 E;  3L75 G;  3H1K J;  5CCH D;  2OYI A;  3IAO A;  1VQ4 P;  1LTT C;  3HD7 A;  2HFE D;  1ZXG A;  4U3F J;  5AVZ B;  5KKZ C;  3P32 A;  2XDJ A;  3W68 A;  2FKW B;  1MV8 A;  3WUU A;  1NGM B;  2L5G B;  4TLF A;  3RBZ A;  1S72 P; 
#chains in the Genus database with same CATH homology
 2QIW A;  2H88 C;  3AE9 C;  2E76 D;  1DD4 A;  3FGA D;  3Q3D A;  4H13 D;  2YIU C;  3Q5P A;  3Q2Y A;  1KOR A;  2WPV B;  1ZOY C;  1OW7 A;  2E75 B;  3AEF C;  3AE2 C;  3H25 A;  3GF3 A;  1GMJ A;  3AE8 C;  4H44 D;  3R4Y A;  3EWK A;  2E76 C;  4I7Z C;  3SFD C;  1VF5 B;  2E76 B;  2MKV A;  4H13 B;  4YTP C;  1OW8 A;  4TT3 H;  5L8R J;  4U7J A;  1ZME C;  4I7Z B;  3G9R A;  2ZT9 D;  2IDB A;  3D6Z A;  2QSI A;  1K05 A;  4H0L B;  2FXP A;  4OGQ D;  2WSF J;  2E75 D;  3D71 A;  1KMI Z;  1NYH A;  3AEB C;  2E74 B;  3AE6 C;  1YQ3 C;  3LW5 J;  1ZRT E;  1VL2 A;  4PV1 B;  2JO1 A;  4Z1M H;  3AE1 C;  1KIL E;  1MKM A;  4R4L A;  2JP3 A;  1IK7 A;  3RL0 g;  2ZT9 B;  4H44 C;  3ABV C;  4PV1 C;  4R4M A;  1FDO A;  3AEC C;  2P10 A;  2OQQ A;  2J5U A;  1U57 A;  2E74 D;  3GLM A;  1HF9 A;  3GF7 A;  1Q90 D;  2H89 C;  4H44 B;  1R8E A;  1RQV A;  1FDI A;  2E75 C;  2G8Y A;  1WMK A;  1S5L X;  4YXD C;  1OW6 A;  3Q5R A;  2V7Q J;  1EXJ A;  1KQG B;  3S9O A;  1KTM A;  1PV3 A;  1DD3 A;  2G3A A;  3C8V A;  1OMI A;  1ZP0 C;  3RK3 E;  5M1B A;  1TU3 F;  2QJP C;  1DIP A;  1Y9B A;  2QJY C;  4GDO A;  2O01 J;  1EXI A;  3AE7 C;  1UIX A;  2E74 C;  1S1C X;  4H0L C;  1RQU A;  2D2C D;  4KT0 J;  1VF5 C;  3T97 B;  2BEQ D;  3AE5 C;  1HJ0 A;  4PV1 D;  3B71 A;  3AE4 C;  4H13 C;  3Q5S A;  1YQ4 C;  2QJK C;  1PIX A;  4Y28 J;  2NZ2 A;  1VF5 D;  2D2C C;  4H0L D;  3D70 A;  1PL5 A;  2WQY C;  2WSC J;  4XFJ A;  4IL6 X;  2FYN C;  2FBW C;  1AJY A;  3SFE C;  2D2C B;  3AEE C;  4OGQ B;  2WSE J;  2K9Y A;  3AEG C;  3GMA A;  4RKU J;  3O6Q A;  4OGQ C;  2ZT9 C;  2BEZ F;  3AE3 C;  1JB0 J;  3IAO A;  1NGM B;  2YMK A;  5KKZ C;  1KQF B;  5KLI C;  3Q1M A;  3D6Y A;  3AEA C;  3AED C;  3IN6 A;  1K04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...