2JP3A

Solution structure of the human fxyd4 (chif) protein in sds micelles
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
NGPVDKGSPFYYDWESLQLGGLIFGGLLCIAGIALALSGKCKCRRNHTPSSLPEKVTPLITPGSAST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural similarity of a membrane protein in micelles and membranes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transcription
molecule keywords FXYD domain-containing ion transport regulator 4
total genus 14
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2007-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02038 ATP1G1_PLM_MAT8 ATP1G1/PLM/MAT8 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.780 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2jp3A00
2JO1A 1Y9BA 2MKVA 2JP3A
chains in the Genus database with same CATH superfamily
1Y47A 1ZN5A 2YIUB 2LXCB 1AV1A 1S3JA 2BCCG 2R32A 2KS1A 3IFMA 2H7HA 3CD6P 5AW8B 4UB6H 1N73A 1H8AA 3KXDA 1SQXK 3R2PA 1AFOA 1EQ7A 1Z56A 4EI2A 1OWAA 4TT3H 1R5SA 1KYOI 4PV1B 1HH0A 5KAFE 2ZVNB 1EZVG 4NPEA 3WUVA 1RF1A 3B4SA 4N78E 1NTMD 1H0TB 2A45I 2E74D 3V2RA 1SQXG 2OYHC 2AXTE 3N4XA 1U7MA 5C39A 5GTHH 5KAIE 1SQVD 1YQ4C 3IR9A 4WY4C 3I55P 3H1IG 3V6IA 1FZBA 4JF7A 1HJ0A 2MJZA 3G71P 1JY2N 1FOSE 1VQ7P 3W67A 2E76B 5EFWB 5KLIC 3Q5SA 1VQ6P 2QJYC 1JUNA 1AJYA 1QL1A 2YKOA 1SQBG 1KILB 1ZV8A 3CWBJ 3M0DA 1NTZG 1K04A 2FYZA 2YO2A 3KDPB 3RK3D 3TGUJ 2WPQA 4A7PA 1YJ9P 2KNCB 3GF3A 1N8RQ 2PGDA 1VPCA 1SQQE 2QIWA 4R4LA 2GA1A 2M3BA 1PIXA 1FS0E 4Z1MH 3USSA 2N9BA 3A7OA 3PLNA 4HH2A 3H1HJ 3L74E 4Y99C 1KORA 2YNYA 5L8RJ 3GHGC 3GG2A 1NAFA 1N7LA 1RQVA 2FY8A 5AVYB 5AW3B 3H1LJ 2A45G 1IFJA 1QL2A 1GTWA 5KLVE 1OW8A 1M1JC 3JCUH 1JY2O 2Q3IA 2FFDB 2OTJP 2L5GB 2KLVA 2YMKA 1WMKA 1L4AD 3FWNA 2NRGA 1BDCA 3CCEP 4GT1A 3M9BA 3Q1MA 4KJMA 5BU8B 1SQPJ 1L2PA 3AE6C 2WVRA 3FXDA 3KPEA 3Q2YA 2UWJE 3M06A 3V4QA 2D2CC 1KB9E 1OIPA 2Z5IA 1NU1D 3KYQA 5APVA 3TGUE 2W83C 3BCCG 3H1IE 3MGNA 3RK2B 3Q5RA 1Q81Q 3U59A 1X8YA 2OYIC 4NPFX 3II6A 4C7NA 5AW4B 1SQBK 4CPGA 1FOSF 3GMAA 3CCVP 1NTZK 2AEJA 3A0HH 1P84I 2WQYC 2KI7B 1IK9A 4YXWH 4BWNA 1DX7A 3ITKA 2BEZF 2NZ2A 3SWYA 1GW4A 2KS1B 2J59M 2R5BA 3B71A 2QRXA 2R44A 3LIEA 2KP8A 2B87A 3RK3C 3RGUA 3LIDA 3MTUE 3L70D 1MZ9A 1RE4C 1X9VA 2POHA 3B5NB 1FZCA 2JR8A 5B5EH 5KTBA 1S1CX 2K9YA 2KSJA 3BRVB 3L75D 4I1LA 1Y8AA 1ZP0C 1VQ8P 1GL2A 2KIKA 2IFMA 3HRNA 1L0LK 1FU1A 3L73D 3H25A 3MD0A 5CCGA 3CC7P 5AVTB 1EDKA 2W6JH 2C0WA 2FXOA 2WSEJ 1MUUA 2FYUE 1K9MQ 1SFCB 1FJPA 1ZRTD 3A2AA 3AEFC 1KTMA 3AE4C 3H1IJ 3RL0g 1BCCD 3PH0A 1VQPP 1LNQA 3VP8A 1RF1B 1H0TA 5CBOA 1CW5A 2B9BA 1LWUB 2G8YA 3VMAA 1KB9I 1URQA 4DCKA 5GTIH 3AEDC 2P67A 5H2FH 2WMMA 2ZFCA 3BCCD 4JYCA 4EYYQ 2WITA 1BDDA 2K88A 3TGUG 2C0XA 3EFFK 1G1IA 1VQ5P 3HTKB 3G9RA 2E76D 1YTZT 3KZIH 1EDLA 3V2PA 4AUWA 1KILD 1URQD 3F5HA 3UIAA 2WSFJ 3VOPA 3HE5A 4GOFA 1VQKP 1FZAA 2QJKC 3RL0D 2ZYDA 5KLVG 5KKZC 3VMXA 4OGQB 1GDTA 3VN0A 2WTYA 2V7QJ 2Q3EA 2WSFH 1NOHA 1GL2C 1J1EB 1IFMA 1WT6A 3CCUP 1USDA 3HD7B 1L0LG 2XNDH 3AEEC 3L71G 2LKMA 2E74B 2HYNA 1IO4A 2BASA 1HBWA 3CXHD 3MZWB 1FZGA 1MFZA 3NTNA 1VQOP 2N1TB 3BCCE 3JCUE 2M0BA 3FWLA 4KT0J 3Q5PA 3H1KG 4WY4B 4H44B 5AVUB 5CCGC 2WSSH 3SFEC 2CK3H 1AQ5A 2RMZA 1W2EA 1M1JA 3N7NA 4WBAA 3TDKA 3V2QA 3MIWA 1FZFA 1G2CA 1JOCA 2K3RA 3GW6A 3BCCJ 2R5DA 4H13D 4WB4A 2V7QH 3NMDA 3KQGA 4RKUJ 4W7ZA 2P10A 4UB8E 1FZEA 1UIXA 1LWUA 4XFJA 5TISH 1N7SC 1U57A 3HUSC 4IOIH 1JM0A 1KILE 1OVUA 4XA4A 2WPVB 4RJTA 4ZNCA 1OXZA 1SS1A 4B86A 2IBZG 1JMMA 1IFNA 3PJSK 2OQQA 5CJ4A 5GTHE 1Q2NA 3CL3D 4YXDC 2NPSD 2A06D 2Q5UA 3L70E 1BGYG 3AE8C 1HVVA 1EZVD 2M8RA 2OYIA 3SSUA 1SQQD 1GL2B 1JEKA 1NKNA 2M3EA 2W90A 3HE4A 4L75A 3H1HD 2Q1KA 1L4AA 1BCCE 1NAYA 2KZIA 2AXTH 2QJPB 2XV5A 3CX5H 3VTPC 1KQGB 3SWFA 2H89C 2K37A 5AVZB 3B5NA 3H1HG 1LJ2A 2KYVA 3L75J 3GLMA 4WY4D 4ASVA 1KB9H 3M91A 1IZNB 1GK6A 1P84H 1SQBE 2A06G 1NTZE 2RH0A 2QEXP 1IK7A 2K1AA 1Y9BA 4W80A 2IBZD 1X22A 3CX5I 3IN6A 1OW6A 4GIFA 1CI6B 4LLHA 4OWFA 3D6ZA 4U3FG 5AVXB 2K9JB 4OGQD 2AEMA 1LWUC 1ZR4A 3FGAD 1IC2A 1ZLLA 3CXHH 3MUDA 2HG5D 4H0LC 1HGZA 1QEXA 3VMYA 4DOJA 4RESB 1SFCC 1J1DC 1NTMJ 3P8MC 2KXPB 5KKZB 1NTKD 1PP9E 2B88A 1FDOA 3H1KD 1GL2D 2I1KA 3P8CE 3PTZA 1RE3A 2AXCA 3G4SP 1N7SD 3OJAB 4PD4D 1BE3D 3ZDMA 1QVGO 1FE6A 1NTME 1S4XA 1BE3J 1HUCA 2IZ1A 4H13B 3WU2H 1KILA 2E5YA 3B5NC 1LT9B 1RY3A 4GDOA 3AECC 2O1KA 1NWQA 1L0NJ 2IPPA 1BGYD 1NTKJ 3E1RA 1SQXE 3RK3B 2D2CD 1LTJC 4Y99B 2P2UA 2GUVA 1P84E 3H1KJ 3HD7D 2YMYA 1FDIA 1VQ4P 1L0NE 1JMBA 2I8DA 2KOGA 3AEGC 3H1JE 2O01N 2YKQA 1JCCA 3HE4B 3L74D 2Y9YA 3NXSA 4BRYB 1BSHA 3CX5E 1W2BO 1TU3F 1KD1Q 3RBXA 1SLQA 2HFED 2WPSA 4H0LB 2B89A 4K35A 5APSA 5AW1B 3S4RA 3CCJP 4U3FE 1VF5D 1LTTC 2D2CB 2E75D 1RHZB 1GZLA 2PP6A 2Z5HA 1NU1K 1BCCG 2LXBA 2V4HA 1KQFB 1U7JA 4O9BA 1SQVJ 4IL6X 1BGYJ 5AW5B 1YHQP 1VDFA 2Y0EA 1USEA 5AW2B 2FFDC 1PL5A 1L0LD 2WSCH 3L71D 4UB8H 3RK2C 4ZKUA 1Q82Q 4H0LD 3A0HE 3GHGB 2E75B 2ZT9D 1T2KD 1L0ND 1VQLP 2GM4A 3OAKA 3Q3DA 2W6BA 2L91A 3L75G 1K8AQ 2J5UA 2OYIB 2QJPC 5KLVD 2Y0CA 1VQ9P 1PGOA 5AVVB 3H1LD 1EXJA 1NJIQ 1L4AB 2KNCA 3L70G 1AVYA 3E1IA 3L72G 2YXRB 1YITP 1XTGB 4PV1D 3QH9A 1L0LJ 3L71J 1KFNA 2IYPA 1JY3N 5CMZA 3RK3E 3TYYA 1N7SA 2JDIH 5DJUB 3VMZA 1DD3A 4U3FJ 3CCQP 1OVVA 1MV8A 3HUSB 1YBKA 3PP5A 5AW6B 2NPSA 2HPCA 2VRSA 1AA0A 3HD7C 4BRYA 1S5LX 3EFGA 1S9KE 1GK4A 1SQVE 1CI6A 2PFXA 3FXEA 3K5BA 3V5BA 4N6JA 3L35A 3A3YB 5AVWB 1K73Q 1PGPA 1PGJA 4N3YB 5AW9B 4M3LA 1IJDB 4GOEA 1L0NK 1W5CE 4DT0A 1J2JB 3H1LE 4PD4E 3B5ND 3L73G 2P7JA 1EDIA 1JCDA 1PPJD 1K05A 1URQB 2FYNB 3CXHE 3H1KE 3P8CD 2E5TA 2YKPA 1E5WA 1JY3O 1KQLA 3AE3C 3B8EB 3H1JD 3M0AA 5GTIE 1LTSC 1L0NG 1VL2A 3QWOC 1SQPK 1JTHB 3H1JJ 2ZJSE 1SQPE 2O01J 4H13C 4L74A 4D6TJ 1P84D 3CMAP 1M7LA 1SQQJ 3IAOA 1KFMA 2Z4EA 1RE3C 1LTBC 1QLED 1LT9A 2J58A 2QJKB 5M1BA 3RK2D 1IFPA 3L72E 5CCGD 3ABVC 4JQ0D 1RF1C 1T6AA 1S2EA 4D6TE 1H89A 2XU6A 2N1TD 1EZVI 1YTZI 3AEAC 3M9HA 3EQ2A 1FZCB 1NTZD 1SFCA 3L36A 3OA7A 1DH3A 2NPSC 3CLQA 3U1AA 1LTJA 1NU1G 2QG4A 2WZ7A 2H88C 3HD7A 3LW5H 4ZKPA 1ZR2A 2ZT9B 2OTLP 3CCRP 2N1TA 4XE5B 4H44C 1G1JA 5CHXA 3T97B 1LTAC 2ZXXA 4WY4A 2IYOA 1SQVG 3LW5J 3WU2E 4GKGA 1OX3A 3H1HE 1Q86Q 3AE2C 1HWTC 2E43A 2ZYGA 1CSBA 1G2CB 1SQXD 4MN4C 2IBZI 2W27A 3RL0B 1BSNA 1NTMG 2Q7CA 2FKWB 1OFCX 3U1CA 1PGQA 3M0DC 4R4MA 1DEBA 1NKZB 2NPSB 5KLVK 1LTGC 1KZUB 1FZCC 4QMAA 3KZIE 3L4FA 4I6MC 3TSIA 1DEEG 3D71A 4I7ZB 2PRRA 2C9LY 3AEBC 3HTKA 3L70J 3L72J 1BE3G 3GHGA 1A02J 1D7MA 4TLFA 1FAVA 2CPSA 3AE9C 2XNXA 3BASA 5B66H 2H43A 2OARA 1H88A 4BXLA 1NTKG 2IFNA 2OGUA 3W68A 5AW7B 3CC2P 1LT9C 5CJ0A 1JB0J 1SVFA 1RQUA 3O6QB 2HPCB 1NH4A 2JO1A 5AVQB 1SFCD 4AYCA 2JP3A 2JJLA 5APTA 3A5TA 2KK7A 1M1JB 2QVAA 5E79H 1URQC 2A06E 2WSCJ 2QM8A 2ZYAA 3MUDC 3H1ID 3L73E 2IBZE 4Y28J 1HF9A 5DJTB 2Q9IA 1PV3A 1KV4A 5B5EE 1N73B 4IFMA 3L73J 2PAJA 2O3JA 3IF4A 1GMJA 5BVZA 1QVFO 4HJGH 1WRGA 1VF5C 1JY3P 1BCCJ 2FYUK 2XDJA 3P7KA 2Y0DA 3AE1C 2FXMA 2H8PD 5H2FE 3F89A 2E74C 1X79B 2ZXEB 3BATA 4WWIA 4AQRD 1KILC 1KYOH 2OTKE 2BCCD 5CCHD 3D70A 1SQQG 1R5LA 1LTIC 2E76C 2JKVA 1YJWP 5TISE 2WWWA 3FX0A 1KC8Q 2CPBA 3S9OA 1LGHB 3AE5C 4I7ZC 4L73A 3O8ZA 3V2NA 1AQTA 2OYHB 2W6AA 3E7KA 5K5GB 2G3AA 2RN0A 1DD4A 3MHVA 3CC4P 1M90Q 4LC1A 3KHUA 1OZHA 1FC2C 2BCCE 2E75C 4UB6E 3SFDC 1OMIA 1NYHA 2FBWC 5KAIH 2SPZA 2KLUA 5KLIB 4PV1C 2B87B 5APUA 4ZMDA 3I56P 3GF7A 3P32A 4HKZH 1GU5A 3C8VA 2FYUD 1EZVE 1LTJB 5KJ7A 1DIPA 3C1LA 4IFFA 1KYOE 1QGKB 2YIUC 2MKVA 3I5CA 2QM7A 2YO3A 1KYOD 3G3ZA 3O6QA 4W7YA 2M5AB 3CI9A 2QSIA 3CXHI 3L74J 5CCHC 3OW2O 1NHLA 2YXQB 1IFIA 1MKMA 5APQA 1RF0C 3CCMP 1YI2P 1ZW0A 2JWDA 4C46A 5TJHA 1NTKK 3CPWO 1J1DB 1FDMA 1E79H 1N2DC 1EDJA 1M8OB 1MFTA 2A45H 3H1JG 1PP9G 2P58A 5KJ7D 1SP4A 3RL0C 4D6TG 2DW3A 3CWBD 1PPJG 3BVHA 1J1EC 2WT7A 1YJNP 1PZQA 3S1KA 3VYIA 4ASWA 1NU1E 1KMIZ 3TGUD 1ZMEC 3PHLA 3CMEP 3SWKA 2HODA 2E42A 2WPRA 1M1KQ 1EC5A 3NFQA 2FYUJ 4OH8B 2FXPA 4HYTB 5APXA 1S5LH 1UIIA 1SQBJ 1NTZJ 3MP7B 1NU1J 4DZOA 2JEEA 2LR2A 4C7RA 2Y9ZA 1SQVK 1YQ3C 2I1JA 2XKMA 2OYHA 1R8EA 3TF5A 1CZQA 3TK1A 1SQPD 3HE5B 5CCHA 3CCLP 2O1JA 3HUSA 5AVSB 5AVRB 1OVRA 4D6TD 1YIJP 1A02F 5APWA 2AEFA 1PFIA 3L72D 3JC22 4EDFA 2HR3A 3H1LG 4DJGA 4EOTA 3L37A 2GUSA 1JO5A 2JWAA 2XZRA 1L4AC 3M9QA 4HB1A 4PJ0H 2BCCJ 1T3JA 4EIJA 4JPZB 5BU5A 1OW7A 2FYNC 1VF5B 1ZRTE 2R3CA 3V4WA 1S9KD 1SQQK 2HLOA 1M56D 1SQPG 2KZJA 1KN7A 4IL6H 1NGMB 4YPCA 4H44D 1N86A 2C9NY 4LGDE 1SQXJ 3TNUA 1T8ZA 4JBZA 4PJ0E 2QJYB 3BRTB 1FBMA 1BGYE 1LP1A 2QE7H 3L75E 1JNMA 4PD4I 2N1TC 3EWKA 3CCSP 1XTCC 4U7JA 4K3AA 3WMM0 4I2LC 1GD2E 1GU4A 1QX8A 3H32B 4N78D 2ZT9C 1T2KC 2IX7C 1JTHA 4NPDA 3C9IA 1N7SB 3L74G 3AE7C 3A0BH 3CWBG 4KHXA 4OGQC 4RO0A 1M57D 1NTKE 1PP9D 2ZVOB 1ZXGA 1NO4A 3PRJA 1L0LE 2ZAEB 3L71E 2P1JA 1S5LE 1PPJE 2M5AA 4WVZA 5KJ7C 1N73C 3VP9A 4IFDK 4OVNF 1LT1A 1Q7YQ 1NTMK 1PP9J 1RF0A 1KB9D 1HTLC 5APYA 1HGVA 1VQNP 1JY2P 1AVOA 3H6PA 3G6EP 1FJKA 2N9YB 2RKLA 1T3UA 2KB7P 3JSVC 5E79E 1ZOYC 2KUBA 1NVOA 3D6YA 2HODB 1BE3E 1SQBD 1YYCA 4JYBA 5CBNA 1IFDA 3WUUA 2FYUG 2IDBA 4IL6E 1S72P 2K9JA 2KSEA 2O01H 2WT7B 2IZ0A 5B66E 5KAFH 3R4YA 1Q90D 2QA4P 3TNUB 4YTPC 3WUTA 2ITAA 1LP1B 1EXIA 2W8ZA 1KQSO 4L76A 4PD4H 4GODA 4U3FD 1RE4A 2BEQD 2WSEH 3A0BE 3T97A 2Q6QA 1RH5B 2OYOA 3H32A 1GW3A 3CX5D 4C7NB 2R3SA 3RBZA 5KLVJ 1VQMP 2FFDA 3CWBE 1HJBA 1X0TA 5AW0B
chains in the Genus database with same CATH topology
2YIUC 2MKVA 3O6QA 4KT0J 3Q5PA 1S5LX 4H44B 2QSIA 3SFEC 1MKMA 4TT3H 4PV1B 4H13D 4RKUJ 2E74D 2P10A 1UIXA 4XFJA 1K05A 1U57A 1KILE 2WPVB 3AE3C 1YQ4C 1VL2A 2OQQA 1HJ0A 2O01J 4H13C 4YXDC 2E76B 5KLIC 1KMIZ 2QJYC 3AE8C 3IAOA 1ZMEC 1AJYA 5M1BA 1K04A 2FXPA 3ABVC 3GF3A 1KQGB 2H89C 3AEAC 2QIWA 4R4LA 1PIXA 3GLMA 4Z1MH 1YQ3C 1R8EA 2H88C 2ZT9B 1KORA 5L8RJ 1RQVA 3T97B 4H44C 1IK7A 1Y9BA 3IN6A 3LW5J 1OW6A 1OW8A 3D6ZA 3AE2C 4OGQD 2YMKA 1WMKA 3FGAD 4H0LC 3Q1MA 1OW7A 3AE6C 4R4MA 2FYNC 3Q2YA 1VF5B 1ZRTE 2D2CC 3D71A 4I7ZB 1NGMB 1FDOA 3Q5RA 3AEBC 4H44D 3AE9C 3GMAA 2WQYC 4H13B 2BEZF 3EWKA 2NZ2A 4GDOA 1JB0J 3AECC 1RQUA 4U7JA 3B71A 2JO1A 2D2CD 2ZT9C 2JP3A 2WSCJ 3AE7C 4Y28J 1FDIA 1S1CX 2K9YA 4OGQC 3AEGC 1HF9A 1ZP0C 1PV3A 3H25A 1TU3F 4H0LB 1GMJA 2WSEJ 1VF5D 2D2CB 1VF5C 3AEFC 2E75D 3AE1C 1KTMA 3AE4C 3RL0g 2E74C 1KQFB 1ZOYC 2G8YA 3D70A 3AEDC 4IL6X 3D6YA 2E76C 3Q5SA 1PL5A 2IDBA 4H0LD 3AE5C 3G9RA 2E76D 4I7ZC 3S9OA 2E75B 2ZT9D 3R4YA 1Q90D 3Q3DA 4YTPC 2J5UA 2G3AA 2QJPC 1DD4A 1EXIA 2WSFJ 2E75C 1EXJA 2QJKC 2BEQD 3SFDC 1OMIA 1NYHA 5KKZC 2FBWC 4OGQB 4PV1D 4PV1C 2V7QJ 3GF7A 3RK3E 3C8VA 1DD3A 1DIPA 3AEEC 2E74B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JO1 A;  1Y9B A;  2MKV A;  2JP3 A; 
#chains in the Genus database with same CATH topology
 1Y47 A;  1ZN5 A;  2YIU B;  2LXC B;  1AV1 A;  1S3J A;  2BCC G;  2R32 A;  2KS1 A;  3IFM A;  2H7H A;  3CD6 P;  5AW8 B;  4UB6 H;  1N73 A;  1H8A A;  3KXD A;  1SQX K;  3R2P A;  1AFO A;  1EQ7 A;  1Z56 A;  4EI2 A;  1OWA A;  4TT3 H;  1R5S A;  1KYO I;  4PV1 B;  1HH0 A;  5KAF E;  2ZVN B;  1EZV G;  4NPE A;  3WUV A;  1RF1 A;  3B4S A;  4N78 E;  1NTM D;  1H0T B;  2A45 I;  2E74 D;  3V2R A;  1SQX G;  2OYH C;  2AXT E;  3N4X A;  1U7M A;  5C39 A;  5GTH H;  5KAI E;  1SQV D;  1YQ4 C;  3IR9 A;  4WY4 C;  3I55 P;  3H1I G;  3V6I A;  1FZB A;  4JF7 A;  1HJ0 A;  2MJZ A;  3G71 P;  1JY2 N;  1FOS E;  1VQ7 P;  3W67 A;  2E76 B;  5EFW B;  5KLI C;  3Q5S A;  1VQ6 P;  2QJY C;  1JUN A;  1AJY A;  1QL1 A;  2YKO A;  1SQB G;  1KIL B;  1ZV8 A;  3CWB J;  3M0D A;  1NTZ G;  1K04 A;  2FYZ A;  2YO2 A;  3KDP B;  3RK3 D;  3TGU J;  2WPQ A;  4A7P A;  1YJ9 P;  2KNC B;  3GF3 A;  1N8R Q;  2PGD A;  1VPC A;  1SQQ E;  2QIW A;  4R4L A;  2GA1 A;  2M3B A;  1PIX A;  1FS0 E;  4Z1M H;  3USS A;  2N9B A;  3A7O A;  3PLN A;  4HH2 A;  3H1H J;  3L74 E;  4Y99 C;  1KOR A;  2YNY A;  5L8R J;  3GHG C;  3GG2 A;  1NAF A;  1N7L A;  1RQV A;  2FY8 A;  5AVY B;  5AW3 B;  3H1L J;  2A45 G;  1IFJ A;  1QL2 A;  1GTW A;  5KLV E;  1OW8 A;  1M1J C;  3JCU H;  1JY2 O;  2Q3I A;  2FFD B;  2OTJ P;  2L5G B;  2KLV A;  2YMK A;  1WMK A;  1L4A D;  3FWN A;  2NRG A;  1BDC A;  3CCE P;  4GT1 A;  3M9B A;  3Q1M A;  4KJM A;  5BU8 B;  1SQP J;  1L2P A;  3AE6 C;  2WVR A;  3FXD A;  3KPE A;  3Q2Y A;  2UWJ E;  3M06 A;  3V4Q A;  2D2C C;  1KB9 E;  1OIP A;  2Z5I A;  1NU1 D;  3KYQ A;  5APV A;  3TGU E;  2W83 C;  3BCC G;  3H1I E;  3MGN A;  3RK2 B;  3Q5R A;  1Q81 Q;  3U59 A;  1X8Y A;  2OYI C;  4NPF X;  3II6 A;  4C7N A;  5AW4 B;  1SQB K;  4CPG A;  1FOS F;  3GMA A;  3CCV P;  1NTZ K;  2AEJ A;  3A0H H;  1P84 I;  2WQY C;  2KI7 B;  1IK9 A;  4YXW H;  4BWN A;  1DX7 A;  3ITK A;  2BEZ F;  2NZ2 A;  3SWY A;  1GW4 A;  2KS1 B;  2J59 M;  2R5B A;  3B71 A;  2QRX A;  2R44 A;  3LIE A;  2KP8 A;  2B87 A;  3RK3 C;  3RGU A;  3LID A;  3MTU E;  3L70 D;  1MZ9 A;  1RE4 C;  1X9V A;  2POH A;  3B5N B;  1FZC A;  2JR8 A;  5B5E H;  5KTB A;  1S1C X;  2K9Y A;  2KSJ A;  3BRV B;  3L75 D;  4I1L A;  1Y8A A;  1ZP0 C;  1VQ8 P;  1GL2 A;  2KIK A;  2IFM A;  3HRN A;  1L0L K;  1FU1 A;  3L73 D;  3H25 A;  3MD0 A;  5CCG A;  3CC7 P;  5AVT B;  1EDK A;  2W6J H;  2C0W A;  2FXO A;  2WSE J;  1MUU A;  2FYU E;  1K9M Q;  1SFC B;  1FJP A;  1ZRT D;  3A2A A;  3AEF C;  1KTM A;  3AE4 C;  3H1I J;  3RL0 g;  1BCC D;  3PH0 A;  1VQP P;  1LNQ A;  3VP8 A;  1RF1 B;  1H0T A;  5CBO A;  1CW5 A;  2B9B A;  1LWU B;  2G8Y A;  3VMA A;  1KB9 I;  1URQ A;  4DCK A;  5GTI H;  3AED C;  2P67 A;  5H2F H;  2WMM A;  2ZFC A;  3BCC D;  4JYC A;  4EYY Q;  2WIT A;  1BDD A;  2K88 A;  3TGU G;  2C0X A;  3EFF K;  1G1I A;  1VQ5 P;  3HTK B;  3G9R A;  2E76 D;  1YTZ T;  3KZI H;  1EDL A;  3V2P A;  4AUW A;  1KIL D;  1URQ D;  3F5H A;  3UIA A;  2WSF J;  3VOP A;  3HE5 A;  4GOF A;  1VQK P;  1FZA A;  2QJK C;  3RL0 D;  2ZYD A;  5KLV G;  5KKZ C;  3VMX A;  4OGQ B;  1GDT A;  3VN0 A;  2WTY A;  2V7Q J;  2Q3E A;  2WSF H;  1NOH A;  1GL2 C;  1J1E B;  1IFM A;  1WT6 A;  3CCU P;  1USD A;  3HD7 B;  1L0L G;  2XND H;  3AEE C;  3L71 G;  2LKM A;  2E74 B;  2HYN A;  1IO4 A;  2BAS A;  1HBW A;  3CXH D;  3MZW B;  1FZG A;  1MFZ A;  3NTN A;  1VQO P;  2N1T B;  3BCC E;  3JCU E;  2M0B A;  3FWL A;  4KT0 J;  3Q5P A;  3H1K G;  4WY4 B;  4H44 B;  5AVU B;  5CCG C;  2WSS H;  3SFE C;  2CK3 H;  1AQ5 A;  2RMZ A;  1W2E A;  1M1J A;  3N7N A;  4WBA A;  3TDK A;  3V2Q A;  3MIW A;  1FZF A;  1G2C A;  1JOC A;  2K3R A;  3GW6 A;  3BCC J;  2R5D A;  4H13 D;  4WB4 A;  2V7Q H;  3NMD A;  3KQG A;  4RKU J;  4W7Z A;  2P10 A;  4UB8 E;  1FZE A;  1UIX A;  1LWU A;  4XFJ A;  5TIS H;  1N7S C;  1U57 A;  3HUS C;  4IOI H;  1JM0 A;  1KIL E;  1OVU A;  4XA4 A;  2WPV B;  4RJT A;  4ZNC A;  1OXZ A;  1SS1 A;  4B86 A;  2IBZ G;  1JMM A;  1IFN A;  3PJS K;  2OQQ A;  5CJ4 A;  5GTH E;  1Q2N A;  3CL3 D;  4YXD C;  2NPS D;  2A06 D;  2Q5U A;  3L70 E;  1BGY G;  3AE8 C;  1HVV A;  1EZV D;  2M8R A;  2OYI A;  3SSU A;  1SQQ D;  1GL2 B;  1JEK A;  1NKN A;  2M3E A;  2W90 A;  3HE4 A;  4L75 A;  3H1H D;  2Q1K A;  1L4A A;  1BCC E;  1NAY A;  2KZI A;  2AXT H;  2QJP B;  2XV5 A;  3CX5 H;  3VTP C;  1KQG B;  3SWF A;  2H89 C;  2K37 A;  5AVZ B;  3B5N A;  3H1H G;  1LJ2 A;  2KYV A;  3L75 J;  3GLM A;  4WY4 D;  4ASV A;  1KB9 H;  3M91 A;  1IZN B;  1GK6 A;  1P84 H;  1SQB E;  2A06 G;  1NTZ E;  2RH0 A;  2QEX P;  1IK7 A;  2K1A A;  1Y9B A;  4W80 A;  2IBZ D;  1X22 A;  3CX5 I;  3IN6 A;  1OW6 A;  4GIF A;  1CI6 B;  4LLH A;  4OWF A;  3D6Z A;  4U3F G;  5AVX B;  2K9J B;  4OGQ D;  2AEM A;  1LWU C;  1ZR4 A;  3FGA D;  1IC2 A;  1ZLL A;  3CXH H;  3MUD A;  2HG5 D;  4H0L C;  1HGZ A;  1QEX A;  3VMY A;  4DOJ A;  4RES B;  1SFC C;  1J1D C;  1NTM J;  3P8M C;  2KXP B;  5KKZ B;  1NTK D;  1PP9 E;  2B88 A;  1FDO A;  3H1K D;  1GL2 D;  2I1K A;  3P8C E;  3PTZ A;  1RE3 A;  2AXC A;  3G4S P;  1N7S D;  3OJA B;  4PD4 D;  1BE3 D;  3ZDM A;  1QVG O;  1FE6 A;  1NTM E;  1S4X A;  1BE3 J;  1HUC A;  2IZ1 A;  4H13 B;  3WU2 H;  1KIL A;  2E5Y A;  3B5N C;  1LT9 B;  1RY3 A;  4GDO A;  3AEC C;  2O1K A;  1NWQ A;  1L0N J;  2IPP A;  1BGY D;  1NTK J;  3E1R A;  1SQX E;  3RK3 B;  2D2C D;  1LTJ C;  4Y99 B;  2P2U A;  2GUV A;  1P84 E;  3H1K J;  3HD7 D;  2YMY A;  1FDI A;  1VQ4 P;  1L0N E;  1JMB A;  2I8D A;  2KOG A;  3AEG C;  3H1J E;  2O01 N;  2YKQ A;  1JCC A;  3HE4 B;  3L74 D;  2Y9Y A;  3NXS A;  4BRY B;  1BSH A;  3CX5 E;  1W2B O;  1TU3 F;  1KD1 Q;  3RBX A;  1SLQ A;  2HFE D;  2WPS A;  4H0L B;  2B89 A;  4K35 A;  5APS A;  5AW1 B;  3S4R A;  3CCJ P;  4U3F E;  1VF5 D;  1LTT C;  2D2C B;  2E75 D;  1RHZ B;  1GZL A;  2PP6 A;  2Z5H A;  1NU1 K;  1BCC G;  2LXB A;  2V4H A;  1KQF B;  1U7J A;  4O9B A;  1SQV J;  4IL6 X;  1BGY J;  5AW5 B;  1YHQ P;  1VDF A;  2Y0E A;  1USE A;  5AW2 B;  2FFD C;  1PL5 A;  1L0L D;  2WSC H;  3L71 D;  4UB8 H;  3RK2 C;  4ZKU A;  1Q82 Q;  4H0L D;  3A0H E;  3GHG B;  2E75 B;  2ZT9 D;  1T2K D;  1L0N D;  1VQL P;  2GM4 A;  3OAK A;  3Q3D A;  2W6B A;  2L91 A;  3L75 G;  1K8A Q;  2J5U A;  2OYI B;  2QJP C;  5KLV D;  2Y0C A;  1VQ9 P;  1PGO A;  5AVV B;  3H1L D;  1EXJ A;  1NJI Q;  1L4A B;  2KNC A;  3L70 G;  1AVY A;  3E1I A;  3L72 G;  2YXR B;  1YIT P;  1XTG B;  4PV1 D;  3QH9 A;  1L0L J;  3L71 J;  1KFN A;  2IYP A;  1JY3 N;  5CMZ A;  3RK3 E;  3TYY A;  1N7S A;  2JDI H;  5DJU B;  3VMZ A;  1DD3 A;  4U3F J;  3CCQ P;  1OVV A;  1MV8 A;  3HUS B;  1YBK A;  3PP5 A;  5AW6 B;  2NPS A;  2HPC A;  2VRS A;  1AA0 A;  3HD7 C;  4BRY A;  1S5L X;  3EFG A;  1S9K E;  1GK4 A;  1SQV E;  1CI6 A;  2PFX A;  3FXE A;  3K5B A;  3V5B A;  4N6J A;  3L35 A;  3A3Y B;  5AVW B;  1K73 Q;  1PGP A;  1PGJ A;  4N3Y B;  5AW9 B;  4M3L A;  1IJD B;  4GOE A;  1L0N K;  1W5C E;  4DT0 A;  1J2J B;  3H1L E;  4PD4 E;  3B5N D;  3L73 G;  2P7J A;  1EDI A;  1JCD A;  1PPJ D;  1K05 A;  1URQ B;  2FYN B;  3CXH E;  3H1K E;  3P8C D;  2E5T A;  2YKP A;  1E5W A;  1JY3 O;  1KQL A;  3AE3 C;  3B8E B;  3H1J D;  3M0A A;  5GTI E;  1LTS C;  1L0N G;  1VL2 A;  3QWO C;  1SQP K;  1JTH B;  3H1J J;  2ZJS E;  1SQP E;  2O01 J;  4H13 C;  4L74 A;  4D6T J;  1P84 D;  3CMA P;  1M7L A;  1SQQ J;  3IAO A;  1KFM A;  2Z4E A;  1RE3 C;  1LTB C;  1QLE D;  1LT9 A;  2J58 A;  2QJK B;  5M1B A;  3RK2 D;  1IFP A;  3L72 E;  5CCG D;  3ABV C;  4JQ0 D;  1RF1 C;  1T6A A;  1S2E A;  4D6T E;  1H89 A;  2XU6 A;  2N1T D;  1EZV I;  1YTZ I;  3AEA C;  3M9H A;  3EQ2 A;  1FZC B;  1NTZ D;  1SFC A;  3L36 A;  3OA7 A;  1DH3 A;  2NPS C;  3CLQ A;  3U1A A;  1LTJ A;  1NU1 G;  2QG4 A;  2WZ7 A;  2H88 C;  3HD7 A;  3LW5 H;  4ZKP A;  1ZR2 A;  2ZT9 B;  2OTL P;  3CCR P;  2N1T A;  4XE5 B;  4H44 C;  1G1J A;  5CHX A;  3T97 B;  1LTA C;  2ZXX A;  4WY4 A;  2IYO A;  1SQV G;  3LW5 J;  3WU2 E;  4GKG A;  1OX3 A;  3H1H E;  1Q86 Q;  3AE2 C;  1HWT C;  2E43 A;  2ZYG A;  1CSB A;  1G2C B;  1SQX D;  4MN4 C;  2IBZ I;  2W27 A;  3RL0 B;  1BSN A;  1NTM G;  2Q7C A;  2FKW B;  1OFC X;  3U1C A;  1PGQ A;  3M0D C;  4R4M A;  1DEB A;  1NKZ B;  2NPS B;  5KLV K;  1LTG C;  1KZU B;  1FZC C;  4QMA A;  3KZI E;  3L4F A;  4I6M C;  3TSI A;  1DEE G;  3D71 A;  4I7Z B;  2PRR A;  2C9L Y;  3AEB C;  3HTK A;  3L70 J;  3L72 J;  1BE3 G;  3GHG A;  1A02 J;  1D7M A;  4TLF A;  1FAV A;  2CPS A;  3AE9 C;  2XNX A;  3BAS A;  5B66 H;  2H43 A;  2OAR A;  1H88 A;  4BXL A;  1NTK G;  2IFN A;  2OGU A;  3W68 A;  5AW7 B;  3CC2 P;  1LT9 C;  5CJ0 A;  1JB0 J;  1SVF A;  1RQU A;  3O6Q B;  2HPC B;  1NH4 A;  2JO1 A;  5AVQ B;  1SFC D;  4AYC A;  2JP3 A;  2JJL A;  5APT A;  3A5T A;  2KK7 A;  1M1J B;  2QVA A;  5E79 H;  1URQ C;  2A06 E;  2WSC J;  2QM8 A;  2ZYA A;  3MUD C;  3H1I D;  3L73 E;  2IBZ E;  4Y28 J;  1HF9 A;  5DJT B;  2Q9I A;  1PV3 A;  1KV4 A;  5B5E E;  1N73 B;  4IFM A;  3L73 J;  2PAJ A;  2O3J A;  3IF4 A;  1GMJ A;  5BVZ A;  1QVF O;  4HJG H;  1WRG A;  1VF5 C;  1JY3 P;  1BCC J;  2FYU K;  2XDJ A;  3P7K A;  2Y0D A;  3AE1 C;  2FXM A;  2H8P D;  5H2F E;  3F89 A;  2E74 C;  1X79 B;  2ZXE B;  3BAT A;  4WWI A;  4AQR D;  1KIL C;  1KYO H;  2OTK E;  2BCC D;  5CCH D;  3D70 A;  1SQQ G;  1R5L A;  1LTI C;  2E76 C;  2JKV A;  1YJW P;  5TIS E;  2WWW A;  3FX0 A;  1KC8 Q;  2CPB A;  3S9O A;  1LGH B;  3AE5 C;  4I7Z C;  4L73 A;  3O8Z A;  3V2N A;  1AQT A;  2OYH B;  2W6A A;  3E7K A;  5K5G B;  2G3A A;  2RN0 A;  1DD4 A;  3MHV A;  3CC4 P;  1M90 Q;  4LC1 A;  3KHU A;  1OZH A;  1FC2 C;  2BCC E;  2E75 C;  4UB6 E;  3SFD C;  1OMI A;  1NYH A;  2FBW C;  5KAI H;  2SPZ A;  2KLU A;  5KLI B;  4PV1 C;  2B87 B;  5APU A;  4ZMD A;  3I56 P;  3GF7 A;  3P32 A;  4HKZ H;  1GU5 A;  3C8V A;  2FYU D;  1EZV E;  1LTJ B;  5KJ7 A;  1DIP A;  3C1L A;  4IFF A;  1KYO E;  1QGK B;  2YIU C;  2MKV A;  3I5C A;  2QM7 A;  2YO3 A;  1KYO D;  3G3Z A;  3O6Q A;  4W7Y A;  2M5A B;  3CI9 A;  2QSI A;  3CXH I;  3L74 J;  5CCH C;  3OW2 O;  1NHL A;  2YXQ B;  1IFI A;  1MKM A;  5APQ A;  1RF0 C;  3CCM P;  1YI2 P;  1ZW0 A;  2JWD A;  4C46 A;  5TJH A;  1NTK K;  3CPW O;  1J1D B;  1FDM A;  1E79 H;  1N2D C;  1EDJ A;  1M8O B;  1MFT A;  2A45 H;  3H1J G;  1PP9 G;  2P58 A;  5KJ7 D;  1SP4 A;  3RL0 C;  4D6T G;  2DW3 A;  3CWB D;  1PPJ G;  3BVH A;  1J1E C;  2WT7 A;  1YJN P;  1PZQ A;  3S1K A;  3VYI A;  4ASW A;  1NU1 E;  1KMI Z;  3TGU D;  1ZME C;  3PHL A;  3CME P;  3SWK A;  2HOD A;  2E42 A;  2WPR A;  1M1K Q;  1EC5 A;  3NFQ A;  2FYU J;  4OH8 B;  2FXP A;  4HYT B;  5APX A;  1S5L H;  1UII A;  1SQB J;  1NTZ J;  3MP7 B;  1NU1 J;  4DZO A;  2JEE A;  2LR2 A;  4C7R A;  2Y9Z A;  1SQV K;  1YQ3 C;  2I1J A;  2XKM A;  2OYH A;  1R8E A;  3TF5 A;  1CZQ A;  3TK1 A;  1SQP D;  3HE5 B;  5CCH A;  3CCL P;  2O1J A;  3HUS A;  5AVS B;  5AVR B;  1OVR A;  4D6T D;  1YIJ P;  1A02 F;  5APW A;  2AEF A;  1PFI A;  3L72 D;  3JC2 2;  4EDF A;  2HR3 A;  3H1L G;  4DJG A;  4EOT A;  3L37 A;  2GUS A;  1JO5 A;  2JWA A;  2XZR A;  1L4A C;  3M9Q A;  4HB1 A;  4PJ0 H;  2BCC J;  1T3J A;  4EIJ A;  4JPZ B;  5BU5 A;  1OW7 A;  2FYN C;  1VF5 B;  1ZRT E;  2R3C A;  3V4W A;  1S9K D;  1SQQ K;  2HLO A;  1M56 D;  1SQP G;  2KZJ A;  1KN7 A;  4IL6 H;  1NGM B;  4YPC A;  4H44 D;  1N86 A;  2C9N Y;  4LGD E;  1SQX J;  3TNU A;  1T8Z A;  4JBZ A;  4PJ0 E;  2QJY B;  3BRT B;  1FBM A;  1BGY E;  1LP1 A;  2QE7 H;  3L75 E;  1JNM A;  4PD4 I;  2N1T C;  3EWK A;  3CCS P;  1XTC C;  4U7J A;  4K3A A;  3WMM 0;  4I2L C;  1GD2 E;  1GU4 A;  1QX8 A;  3H32 B;  4N78 D;  2ZT9 C;  1T2K C;  2IX7 C;  1JTH A;  4NPD A;  3C9I A;  1N7S B;  3L74 G;  3AE7 C;  3A0B H;  3CWB G;  4KHX A;  4OGQ C;  4RO0 A;  1M57 D;  1NTK E;  1PP9 D;  2ZVO B;  1ZXG A;  1NO4 A;  3PRJ A;  1L0L E;  2ZAE B;  3L71 E;  2P1J A;  1S5L E;  1PPJ E;  2M5A A;  4WVZ A;  5KJ7 C;  1N73 C;  3VP9 A;  4IFD K;  4OVN F;  1LT1 A;  1Q7Y Q;  1NTM K;  1PP9 J;  1RF0 A;  1KB9 D;  1HTL C;  5APY A;  1HGV A;  1VQN P;  1JY2 P;  1AVO A;  3H6P A;  3G6E P;  1FJK A;  2N9Y B;  2RKL A;  1T3U A;  2KB7 P;  3JSV C;  5E79 E;  1ZOY C;  2KUB A;  1NVO A;  3D6Y A;  2HOD B;  1BE3 E;  1SQB D;  1YYC A;  4JYB A;  5CBN A;  1IFD A;  3WUU A;  2FYU G;  2IDB A;  4IL6 E;  1S72 P;  2K9J A;  2KSE A;  2O01 H;  2WT7 B;  2IZ0 A;  5B66 E;  5KAF H;  3R4Y A;  1Q90 D;  2QA4 P;  3TNU B;  4YTP C;  3WUT A;  2ITA A;  1LP1 B;  1EXI A;  2W8Z A;  1KQS O;  4L76 A;  4PD4 H;  4GOD A;  4U3F D;  1RE4 A;  2BEQ D;  2WSE H;  3A0B E;  3T97 A;  2Q6Q A;  1RH5 B;  2OYO A;  3H32 A;  1GW3 A;  3CX5 D;  4C7N B;  2R3S A;  3RBZ A;  5KLV J;  1VQM P;  2FFD A;  3CWB E;  1HJB A;  1X0T A;  5AW0 B; 
#chains in the Genus database with same CATH homology
 2YIU C;  2MKV A;  3O6Q A;  4KT0 J;  3Q5P A;  1S5L X;  4H44 B;  2QSI A;  3SFE C;  1MKM A;  4TT3 H;  4PV1 B;  4H13 D;  4RKU J;  2E74 D;  2P10 A;  1UIX A;  4XFJ A;  1K05 A;  1U57 A;  1KIL E;  2WPV B;  3AE3 C;  1YQ4 C;  1VL2 A;  2OQQ A;  1HJ0 A;  2O01 J;  4H13 C;  4YXD C;  2E76 B;  5KLI C;  1KMI Z;  2QJY C;  3AE8 C;  3IAO A;  1ZME C;  1AJY A;  5M1B A;  1K04 A;  2FXP A;  3ABV C;  3GF3 A;  1KQG B;  2H89 C;  3AEA C;  2QIW A;  4R4L A;  1PIX A;  3GLM A;  4Z1M H;  1YQ3 C;  1R8E A;  2H88 C;  2ZT9 B;  1KOR A;  5L8R J;  1RQV A;  3T97 B;  4H44 C;  1IK7 A;  1Y9B A;  3IN6 A;  3LW5 J;  1OW6 A;  1OW8 A;  3D6Z A;  3AE2 C;  4OGQ D;  2YMK A;  1WMK A;  3FGA D;  4H0L C;  3Q1M A;  1OW7 A;  3AE6 C;  4R4M A;  2FYN C;  3Q2Y A;  1VF5 B;  1ZRT E;  2D2C C;  3D71 A;  4I7Z B;  1NGM B;  1FDO A;  3Q5R A;  3AEB C;  4H44 D;  3AE9 C;  3GMA A;  2WQY C;  4H13 B;  2BEZ F;  3EWK A;  2NZ2 A;  4GDO A;  1JB0 J;  3AEC C;  1RQU A;  4U7J A;  3B71 A;  2JO1 A;  2D2C D;  2ZT9 C;  2JP3 A;  2WSC J;  3AE7 C;  4Y28 J;  1FDI A;  1S1C X;  2K9Y A;  4OGQ C;  3AEG C;  1HF9 A;  1ZP0 C;  1PV3 A;  3H25 A;  1TU3 F;  4H0L B;  1GMJ A;  2WSE J;  1VF5 D;  2D2C B;  1VF5 C;  3AEF C;  2E75 D;  3AE1 C;  1KTM A;  3AE4 C;  3RL0 g;  2E74 C;  1KQF B;  1ZOY C;  2G8Y A;  3D70 A;  3AED C;  4IL6 X;  3D6Y A;  2E76 C;  3Q5S A;  1PL5 A;  2IDB A;  4H0L D;  3AE5 C;  3G9R A;  2E76 D;  4I7Z C;  3S9O A;  2E75 B;  2ZT9 D;  3R4Y A;  1Q90 D;  3Q3D A;  4YTP C;  2J5U A;  2G3A A;  2QJP C;  1DD4 A;  1EXI A;  2WSF J;  2E75 C;  1EXJ A;  2QJK C;  2BEQ D;  3SFD C;  1OMI A;  1NYH A;  5KKZ C;  2FBW C;  4OGQ B;  4PV1 D;  4PV1 C;  2V7Q J;  3GF7 A;  3RK3 E;  3C8V A;  1DD3 A;  1DIP A;  3AEE C;  2E74 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...