2JP3A

Solution structure of the human fxyd4 (chif) protein in sds micelles
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
NGPVDKGSPFYYDWESLQLGGLIFGGLLCIAGIALALSGKCKCRRNHTPSSLPEKVTPLITPGSAST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords FXYD domain-containing ion transport regulator 4
publication title Structural similarity of a membrane protein in micelles and membranes
pubmed doi rcsb
source organism Rattus norvegicus
total genus 14
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2007-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02038 ATP1G1_PLM_MAT8 ATP1G1/PLM/MAT8 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.780 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2jp3A00
2MKVA 2JO1A 1Y9BA 2JP3A
chains in the Genus database with same CATH superfamily
1FZAA 3H25A 3WUVA 4OVNF 1NTKE 2Q3EA 2O3JA 1NTMK 1AQTA 2A45G 3AE6C 3HE4B 4I6MC 3OJAB 1VQ6P 1SVFA 1FZCC 1VQMP 1X0TA 4EYYQ 2GM4A 1T3UA 2YXRB 2FYUD 3V2PA 5GTIE 1ZLLA 4NPFX 4PV1D 1S2EA 1VQKP 1IFNA 2E74B 5CCGD 4MN4C 1Q7YQ 1EZVG 1YI2P 1LTIC 2N9YB 4UB8E 1KORA 2YIUC 3KZIH 4I7ZC 2WZ7A 1NU1G 2P2UA 1FZCB 1PP9J 2KSJA 4A7PA 2AEFA 1OW8A 5AW8B 1BDDA 1FBMA 1NWQA 4HH2A 2LR2A 2IFMA 4XA4A 1HF9A 1H0TA 3N7NA 1L0LJ 2R5DA 2O01J 4XFJA 4JPZB 3OAKA 4IFMA 2KXPB 3Q5PA 3H1JJ 2JWAA 1W5CE 2Q7CA 5AVQB 2YIUB 3G71P 1MKMA 3KHUA 3CXHH 2C9LY 2XU6A 3G9RA 1KQGB 3C9IA 1L0NG 1BSHA 1Q82Q 2G3AA 4IFFA 3JSVC 1SFCA 3KPEA 3P32A 1U57A 2KIKA 1URQD 4WB4A 1Q90D 4YXWH 3VYIA 1NTZJ 1KFMA 3Q5RA 3H1HE 1KB9I 2K9YA 5DJTB 1YBKA 1K05A 2YMYA 3CI9A 3I56P 1S1CX 1G2CB 1GU5A 4D6TJ 2I1KA 1S9KE 3A3YB 2J5UA 3MHVA 5KJ7D 3CXHE 1NTMG 2YKOA 1FOSE 3M0DA 1SP4A 3CXHD 2YKPA 2FYNC 5AW1B 3RL0C 1SQPK 5L8RJ 4W7YA 5KLVD 1GZLA 2J58A 1L2PA 3H32A 1J1EC 3L75E 2Q9IA 1H88A 1CI6B 3H6PA 3C1LA 1BE3E 1OW6A 1QVGO 3TGUJ 2KZIA 1WT6A 1DD3A 1N7SA 1Q86Q 3PRJA 2Y0CA 2RN0A 4PD4E 2QA4P 1IO4A 3EQ2A 2KLVA 5AW0B 1OX3A 2N1TD 2I1JA 5K5GB 2FYNB 2PFXA 3CCMP 4ZMDA 4UB6H 3O6QA 3RL0B 3CLQA 1Q81Q 1SQBE 4ASVA 1HWTC 4KJMA 5B66H 1SQBD 2WPQA 3B5NA 5CJ0A 3C8VA 2V7QH 3FXEA 3WU2E 1ZW0A 2WQYC 2OQQA 1T3JA 5TISH 1PV3A 3VP8A 4Y28J 4C7RA 3SFDC 1NU1D 3H1IG 1OWAA 2FYZA 1QX8A 1EXIA 3H1KE 1SFCC 1YJ9P 1EDKA 2P1JA 1ZOYC 3H1KD 1OFCX 1YJNP 3L74J 5KAIH 1BGYE 3F5HA 4M3LA 1BCCE 2A45I 1H0TB 5AVUB 2IBZE 1BCCD 1WMKA 2V4HA 3CX5I 3E7KA 5CBOA 4GODA 2IBZD 3FX0A 3WUUA 1N73A 1L4AA 2XKMA 1P84E 1AA0A 3FGAD 1X22A 2B87A 1OVUA 5CMZA 2ZT9D 2E74D 1QVFO 1FJPA 1EZVI 3FWNA 2HYNA 3VMZA 2O1JA 2LXCB 2Y0DA 1FE6A 2R3CA 5KAIE 1JEKA 3PH0A 1LTSC 1SQPG 2WSCH 1U7MA 1EC5A 3L70D 3NMDA 1NHLA 4YXDC 1N7SC 1VQNP 1KFNA 5H2FH 3M0AA 1LNQA 2Z5HA 2HFED 3E1IA 2C0XA 3CWBE 4IOIH 1Y47A 1JTHA 1HJBA 1NTMD 5B5EE 3CWBD 2O1KA 1YQ3C 1FZGA 1K9MQ 2GUSA 4I2LC 3B4SA 3P8MC 3H32B 1PGQA 3S4RA 1RF1A 3L71E 3B5NC 2R32A 1VQ4P 1N7SB 3LW5J 3L71D 3L4FA 5APSA 1USDA 3L72J 2ZXXA 3V6IA 1M7LA 2SPZA 1ZP0C 3RK2C 5H2FE 3S9OA 1FZBA 2BCCJ 4IL6E 4OWFA 3O6QB 2G8YA 1SQBK 3KQGA 5KKZC 1SQVJ 1KYOH 2OTJP 3B5NB 3TDKA 1VF5C 4U3FE 1IK7A 1N73C 1L4AC 1L0NJ 1G1IA 2E76C 1SQXD 4TLFA 1KTMA 4L76A 2WPSA 3ABVC 3RK2B 3TNUA 5KAFH 2FXMA 3SFEC 3HRNA 1FOSF 2O01H 3EWKA 1ZR4A 3ZDMA 3BVHA 1KC8Q 5KKZB 3VTPC 2N9BA 4IL6X 2H43A 4W7ZA 4GKGA 2E43A 4ZKPA 1VF5B 4TT3H 1PP9E 4WY4A 2HLOA 1N73B 2Z5IA 1L4AB 1VPCA 1VQPP 1EQ7A 2E76B 3U1CA 4GDOA 1KYOD 2NPSA 1QGKB 4AYCA 2YNYA 1SQQJ 3RL0D 2B87B 1ZR2A 1KD1Q 1L0LE 2E5TA 3V4QA 3V2RA 5KAFE 2KLUA 1GTWA 3BATA 1L0LD 3H1JE 2CK3H 3BCCJ 2W6JH 4EIJA 1NAFA 1JY2P 2KS1A 1RF1C 2QJYC 1DD4A 1J2JB 4UB8H 1JY3N 2JO1A 3AE4C 2OARA 3Q3DA 2P58A 2PP6A 1NTZE 3VP9A 1VL2A 3HTKA 3PHLA 4WWIA 1JY3O 1NTKD 1JTHB 1S4XA 1AFOA 4U3FJ 1IJDB 3GF7A 1VQ5P 2HPCA 2WSEH 4C46A 3M9BA 1H89A 4D6TE 1RF1B 1PPJE 2QJYB 1JMMA 4HYTB 1RHZB 3UIAA 4D6TD 1SQBG 5BU8B 4JQ0D 1PPJD 2KNCA 1SFCD 2KYVA 1JUNA 3M06A 3I5CA 4IFDK 1FAVA 1RF0A 3CCRP 1ZRTE 1X9VA 2OGUA 3AEGC 3CC2P 3USSA 3TGUE 1M90Q 5GTHH 3H1KG 2IZ1A 2RKLA 1Q2NA 3TGUD 3IAOA 1KB9E 1LWUA 2IPPA 2W27A 3L36A 4I1LA 1BGYG 4DJGA 1BCCG 2M8RA 1E79H 1SQXK 1XTCC 4WY4C 4GOFA 4Z1MH 2IBZG 4HKZH 1KQLA 2K37A 3AE7C 1KQFB 2R3SA 2NPSC 5AVTB 1FU1A 5APWA 3TNUB 1GD2E 1IK9A 4KHXA 2ITAA 3NXSA 1YIJP 1AVYA 3E1RA 3A0BH 4DCKA 1AQ5A 3L73J 3HUSA 1R8EA 1VQ7P 1N7SD 5GTHE 1SLQA 3CPWO 4WY4B 1FS0E 1YITP 4JBZA 3L70G 3CMEP 1T8ZA 3H1HD 1M1JA 4OGQC 2NPSB 3WUTA 3IF4A 4PD4H 3ITKA 3L74E 2B88A 3A2AA 4JYBA 3H1LJ 3SWKA 1U7JA 1L0LK 1T2KC 3L74D 4HJGH 3V2NA 2FYUJ 1S9KD 3KYQA 3B5ND 3CWBG 4KT0J 3LIEA 4NPEA 5CJ4A 3A0BE 2FBWC 2WWWA 3LIDA 4H0LC 3CCEP 2VRSA 1ZXGA 2KS1B 5AVWB 4RJTA 3EFFK 2E75C 1EDJA 3RK2D 3WU2H 1K04A 1S5LE 3CC7P 3L75D 1NO4A 2WTYA 3L71G 4OGQB 1BE3D 1NTKK 5APVA 5AW2B 2W6BA 3HTKB 1RF0C 1YTZI 3M9QA 2B9BA 1DIPA 1IFMA 5EFWB 3SSUA 4U7JA 2HPCB 4PD4D 4C7NA 1VF5D 4YTPC 3RBZA 2R44A 4H0LB 3BRVB 1LWUC 1L4AD 2H88C 3BASA 2W6AA 5CCHA 3IR9A 1K8AQ 2ZYDA 2E75B 1LGHB 2KNCB 1X8YA 2C0WA 1KV4A 2ZJSE 1P84H 1MUUA 3CXHI 3BRTB 3Q1MA 1SQXG 1S5LX 2RMZA 3RL0g 1W2EA 2KSEA 3HUSC 1CZQA 1HVVA 2IX7C 1LT9A 1LWUB 1M1KQ 3L72E 5AVZB 2WPVB 5CBNA 1BGYD 2GA1A 5AVVB 1NAYA 3L72D 1N86A 3AEEC 2P67A 2BCCE 3AE9C 1NKZB 1M1JC 3G6EP 1XTGB 1UIXA 2QRXA 3G3ZA 2BCCD 3CCQP 2Q6QA 1QEXA 3TF5A 1SQVE 5B5EH 2QIWA 1MFZA 1P84D 4R4MA 3HUSB 1SQVD 4GT1A 3M0DC 1JCDA 5KLVJ 2ZYGA 3Q5SA 4PV1B 3W67A 1L0LG 1K73Q 4N78E 5AVXB 1L0NE 2Y9YA 3H1JG 1RQVA 2BEZF 5AVYB 1KMIZ 2C9NY 1M1JB 3PTZA 4BXLA 1T6AA 1LTAC 3F89A 2OYOA 2QM8A 3VN0A 3MIWA 2AXCA 3S1KA 3QH9A 4IL6H 3L35A 1NTKG 1FDMA 1KILE 2YKQA 2AXTE 2RH0A 1PL5A 3PP5A 1HJ0A 1NKNA 2L91A 2QSIA 1EDIA 3M91A 5CCHC 1A02J 1PGJA 3AEAC 1SQQE 4D6TG 3D6ZA 1PPJG 1SQQD 4L74A 1H8AA 1HBWA 3FWLA 2H8PD 4NPDA 1NU1J 1VQ8P 1JCCA 3VMAA 2L5GB 2QJKC 3BCCE 4N6JA 4LC1A 1J1DC 2M0BA 2NZ2A 3P8CE 4ZNCA 3BCCD 3U1AA 4C7NB 3GMAA 2GUVA 2XV5A 3MD0A 3P8CD 4WY4D 3VOPA 3WMM0 1PFIA 5APYA 1LT9C 3AEBC 3TGUG 2M3BA 2MKVA 1PZQA 1FJKA 2NPSD 2A06E 2IZ0A 1DEEG 3A0HH 1LTJA 1NVOA 1PIXA 1GK6A 1JB0J 2OYHA 2WT7A 2A06D 1KILA 3JC22 3V5BA 2JP3A 1Y9BA 2XNDH 3AE5C 2V7QJ 1VDFA 3AECC 4L75A 4U3FD 3JCUE 4OH8B 2QJKB 2KOGA 3HD7A 2IFNA 1J1DB 3MZWB 1G1JA 2K9JA 2Z4EA 2HR3A 2M5AA 2E42A 2POHA 1LT9B 1AVOA 5BVZA 2KI7B 3L70J 3RK3E 2M3EA 1YTZT 3KDPB 5KTBA 1T2KD 3A0HE 3H1HG 1LJ2A 1NH4A 1PP9D 1NTMJ 3W68A 1SQVK 3OA7A 3K5BA 1JO5A 2HG5D 4H0LD 2J59M 5AVSB 3L74G 4GIFA 1TU3F 4XE5B 2JKVA 1KQSO 4H13C 1OZHA 2E75D 4EI2A 2WVRA 2KP8A 4Y99C 3H1JD 2AEMA 3CCJP 3L75G 3L73E 2H89C 2QE7H 1M56D 2WSCJ 1BE3G 2QEXP 1NGMB 2YXQB 3MP7B 3VMXA 1RQUA 3L73D 1A02F 3MTUE 2XNXA 4WBAA 3MGNA 3V2QA 4YPCA 1WRGA 1NTZD 1VQ9P 4H13B 1LT1A 2FXOA 1KB9H 3TYYA 3L37A 1GL2A 5DJUB 3A5TA 1KYOI 2W8ZA 3T97A 1PGPA 4Y99B 1SQQK 4W80A 2Q5UA 1N8RQ 1LTJC 3H1LE 1OVRA 2OYHC 1JY2N 3D71A 1OXZA 1KILC 1SQXJ 2FYUE 3H1LD 1ZMEC 2WSFJ 3KXDA 3H1IJ 1JY2O 4H44C 4JYCA 3HD7C 2ZT9B 4ZKUA 2K1AA 4LGDE 2WITA 3A7OA 1ZRTD 1LP1A 5E79H 1GW3A 2KZJA 1IC2A 1BDCA 1YHQP 4AQRD 1ZN5A 1IFPA 2IDBA 1VQOP 1LTJB 2OYHB 2WT7B 3GLMA 1KB9D 5AVRB 1KILB 3L72G 3U59A 1CW5A 1R5SA 1IZNB 3GG2A 4DOJA 3GHGA 2H7HA 2JDIH 1CSBA 2BCCG 1GMJA 2JJLA 4H44B 3HD7B 2KUBA 1Z56A 2K9JB 1SS1A 4RESB 1SQVG 2M5AB 2PAJA 1JM0A 2ZAEB 3TSIA 4BWNA 1S72P 1GU4A 2QVAA 2KK7A 2W83C 5E79E 4I7ZB 3CMAP 1SQPJ 5CCGA 1S5LH 1QL1A 3O8ZA 5CHXA 3Q2YA 3KZIE 1NOHA 2OYIA 2FXPA 3CCLP 4PJ0H 3IFMA 1KZUB 2IYOA 1NTKJ 2FKWB 3AEFC 3SWFA 3RK3C 5CCHD 4RKUJ 2A45H 4O9BA 1JNMA 3D70A 1VQLP 1BSNA 3HE5A 1MZ9A 3AE2C 3CCVP 5KLIC 4EDFA 1GL2C 3CX5H 1HH0A 2XDJA 4ASWA 2LKMA 1OMIA 3SWYA 4L73A 3QWOC 1SQQG 4JF7A 5AW9B 2D2CC 2NRGA 5KLVE 3FXDA 2QJPC 4PJ0E 1NTZK 2JEEA 1ZV8A 1QL2A 3RK3B 2OTLP 2WPRA 1HTLC 3LW5H 1MV8A 5AW3B 3BCCG 3VMYA 3CL3D 2DW3A 1URQA 5KLIB 1GL2B 2ZVNB 2R5BA 1DX7A 3T97B 2WSEJ 2B89A 2HODA 4K3AA 2E76D 3CX5E 1JMBA 4B86A 2FYUK 3CX5D 2A06G 2WMMA 2D2CB 3GHGC 1NYHA 2QJPB 4U3FG 2Q1KA 3MUDA 1J1EB 2FFDA 5KJ7A 2JR8A 1YYCA 5AW4B 1EZVE 2QG4A 1RE4A 1LP1B 2P10A 1EZVD 2Y9ZA 3AEDC 1EXJA 4CPGA 1Y8AA 1YJWP 4BRYA 4PV1C 1NU1E 5CCGC 4HB1A 5APXA 3B8EB 3H1HJ 3AE1C 5AW5B 5AW7B 4EOTA 2OYIC 5M1BA 2YMKA 3GHGB 4PD4I 3RGUA 1FDIA 2FY8A 4H13D 1PP9G 2CPSA 2AEJA 2AXTH 4UB6E 1FZFA 4DT0A 2CPBA 2N1TA 2ZXEB 2PRRA 5B66E 1RY3A 2Y0EA 1OIPA 2BEQD 3L75J 4N78D 2P7JA 1BE3J 1PGOA 1L0ND 5TISE 1SFCB 3M9HA 2OYIB 5BU5A 4R4LA 5APQA 1RE3A 1KN7A 3GW6A 3L73G 3NTNA 1GW4A 3L70E 2QM7A 3NFQA 4QMAA 2ZFCA 1OW7A 1NTZG 1YQ4C 3HE5B 1GDTA 1URQC 3V4WA 5C39A 2IBZI 1KILD 3B71A 4RO0A 3D6YA 5APUA 1SQBJ 1N7LA 1NTME 4H44D 3HE4A 3HD7D 1EDLA 1P84I 2ZYAA 3JCUH 3H1LG 5KLVK 1LTGC 2E5YA 1QLED 2KB7P 5AW6B 2FYUG 1AV1A 4LLHA 3MUDC 1RH5B 3N4XA 1MFTA 2FFDC 2WSSH 5KJ7C 1UIIA 3II6A 1X79B 3H1KJ 4N3YB 1RE4C 4DZOA 2WSFH 1URQB 3P7KA 2OTKE 1BGYJ 1BCCJ 3IN6A 2HODB 1W2BO 1FDOA 2IYPA 3R4YA 2W90A 2I8DA 5APTA 3OW2O 1FZCA 2MJZA 1M8OB 1S3JA 1DH3A 3RBXA 2UWJE 2K3RA 1N2DC 2FFDB 3GF3A 3CCUP 1IFDA 3R2PA 1FC2C 2N1TC 1HGVA 1SQXE 2K88A 4BRYB 1NU1K 3H1IE 3I55P 4OGQD 3PJSK 1AJYA 1FZEA 3H1ID 1JOCA 3RK3D 1LTBC 1HUCA 1RE3C 4GOEA 3PLNA 1GL2D 3CD6P 1R5LA 3CWBJ 2XZRA 2N1TB 3CCSP 1E5WA 2O01N 1JY3P 1KYOE 2BASA 1L0NK 2ZVOB 2D2CD 4K35A 1OVVA 2Q3IA 2PGDA 1G2CA 3TK1A 1GK4A 3L71J 2LXBA 1USEA 3AE3C 4AUWA 2YO3A 5GTIH 1IFJA 4WVZA 3G4SP 5KLVG 1IFIA 1M57D 2YO2A 3EFGA 1SQPE 1DEBA 2ZT9C 2JWDA 2E74C 1D7MA 1NJIQ 1CI6A 1SQPD 1HGZA 3AE8C 5TJHA 3CC4P 1LTTC
chains in the Genus database with same CATH topology
2WPVB 4H0LC 3D6ZA 1OW7A 1MKMA 3AEFC 1YQ4C 3IAOA 3H25A 2ZT9D 4H44C 3AEEC 2E74D 3G9RA 2G8YA 1KQGB 2E75C 2ZT9B 3AE9C 3AE6C 3B71A 4RKUJ 1K04A 2G3AA 2P10A 4OGQD 3D70A 3AEDC 5KKZC 1EXJA 3D6YA 1UIXA 4H0LD 1AJYA 2QJYC 3AE2C 4OGQB 4PV1C 5KLIC 1DD4A 1U57A 2QJKC 4Z1MH 3O6QA 1TU3F 3AE7C 4H44D 1KQFB 4H13C 2NZ2A 1VF5C 2E75D 2JO1A 1Q90D 2QIWA 3AE4C 3AE1C 1OMIA 4R4MA 1IK7A 3GMAA 2IDBA 1DIPA 3Q3DA 5M1BA 4PV1D 2YMKA 3Q5RA 2E76C 3AEBC 3C8VA 2K9YA 1VL2A 4U7JA 4YXDC 3Q5SA 4PV1B 1KTMA 1FDIA 2E74B 3GLMA 2MKVA 3ABVC 4H13D 1VF5D 1K05A 2D2CC 4YTPC 3SFEC 2WQYC 1R8EA 2OQQA 1PIXA 4H0LB 1S1CX 2H88C 2QJPC 1JB0J 1PV3A 3GF7A 1RQVA 2H89C 3EWKA 4Y28J 2BEZF 2WSCJ 1GMJA 3SFDC 1NGMB 4H44B 2JP3A 1Y9BA 2E75B 1KMIZ 1RQUA 1EXIA 1KORA 2YIUC 2D2CD 2J5UA 3AE5C 2V7QJ 4I7ZC 1YQ3C 3AECC 3IN6A 1ZOYC 4IL6X 3AE3C 3Q1MA 2FYNC 2BEQD 4H13B 1VF5B 3T97B 1FDOA 4OGQC 4TT3H 1OW8A 3R4YA 2WSEJ 1KILE 1S5LX 2E76D 5L8RJ 3RL0g 4I7ZB 1WMKA 2E76B 1HF9A 4GDOA 1PL5A 3LW5J 4R4LA 1HJ0A 1OW6A 1ZRTE 3Q2YA 2D2CB 3AEGC 2ZT9C 2QSIA 2FXPA 3GF3A 4KT0J 1NYHA 3RK3E 2O01J 4XFJA 1DD3A 2E74C 3D71A 1ZP0C 2FBWC 3AEAC 3S9OA 3AE8C 3Q5PA 1ZMEC 2WSFJ 3FGAD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MKV A;  2JO1 A;  1Y9B A;  2JP3 A; 
#chains in the Genus database with same CATH topology
 1FZA A;  3H25 A;  3WUV A;  4OVN F;  1NTK E;  2Q3E A;  2O3J A;  1NTM K;  1AQT A;  2A45 G;  3AE6 C;  3HE4 B;  4I6M C;  3OJA B;  1VQ6 P;  1SVF A;  1FZC C;  1VQM P;  1X0T A;  4EYY Q;  2GM4 A;  1T3U A;  2YXR B;  2FYU D;  3V2P A;  5GTI E;  1ZLL A;  4NPF X;  4PV1 D;  1S2E A;  1VQK P;  1IFN A;  2E74 B;  5CCG D;  4MN4 C;  1Q7Y Q;  1EZV G;  1YI2 P;  1LTI C;  2N9Y B;  4UB8 E;  1KOR A;  2YIU C;  3KZI H;  4I7Z C;  2WZ7 A;  1NU1 G;  2P2U A;  1FZC B;  1PP9 J;  2KSJ A;  4A7P A;  2AEF A;  1OW8 A;  5AW8 B;  1BDD A;  1FBM A;  1NWQ A;  4HH2 A;  2LR2 A;  2IFM A;  4XA4 A;  1HF9 A;  1H0T A;  3N7N A;  1L0L J;  2R5D A;  2O01 J;  4XFJ A;  4JPZ B;  3OAK A;  4IFM A;  2KXP B;  3Q5P A;  3H1J J;  2JWA A;  1W5C E;  2Q7C A;  5AVQ B;  2YIU B;  3G71 P;  1MKM A;  3KHU A;  3CXH H;  2C9L Y;  2XU6 A;  3G9R A;  1KQG B;  3C9I A;  1L0N G;  1BSH A;  1Q82 Q;  2G3A A;  4IFF A;  3JSV C;  1SFC A;  3KPE A;  3P32 A;  1U57 A;  2KIK A;  1URQ D;  4WB4 A;  1Q90 D;  4YXW H;  3VYI A;  1NTZ J;  1KFM A;  3Q5R A;  3H1H E;  1KB9 I;  2K9Y A;  5DJT B;  1YBK A;  1K05 A;  2YMY A;  3CI9 A;  3I56 P;  1S1C X;  1G2C B;  1GU5 A;  4D6T J;  2I1K A;  1S9K E;  3A3Y B;  2J5U A;  3MHV A;  5KJ7 D;  3CXH E;  1NTM G;  2YKO A;  1FOS E;  3M0D A;  1SP4 A;  3CXH D;  2YKP A;  2FYN C;  5AW1 B;  3RL0 C;  1SQP K;  5L8R J;  4W7Y A;  5KLV D;  1GZL A;  2J58 A;  1L2P A;  3H32 A;  1J1E C;  3L75 E;  2Q9I A;  1H88 A;  1CI6 B;  3H6P A;  3C1L A;  1BE3 E;  1OW6 A;  1QVG O;  3TGU J;  2KZI A;  1WT6 A;  1DD3 A;  1N7S A;  1Q86 Q;  3PRJ A;  2Y0C A;  2RN0 A;  4PD4 E;  2QA4 P;  1IO4 A;  3EQ2 A;  2KLV A;  5AW0 B;  1OX3 A;  2N1T D;  2I1J A;  5K5G B;  2FYN B;  2PFX A;  3CCM P;  4ZMD A;  4UB6 H;  3O6Q A;  3RL0 B;  3CLQ A;  1Q81 Q;  1SQB E;  4ASV A;  1HWT C;  4KJM A;  5B66 H;  1SQB D;  2WPQ A;  3B5N A;  5CJ0 A;  3C8V A;  2V7Q H;  3FXE A;  3WU2 E;  1ZW0 A;  2WQY C;  2OQQ A;  1T3J A;  5TIS H;  1PV3 A;  3VP8 A;  4Y28 J;  4C7R A;  3SFD C;  1NU1 D;  3H1I G;  1OWA A;  2FYZ A;  1QX8 A;  1EXI A;  3H1K E;  1SFC C;  1YJ9 P;  1EDK A;  2P1J A;  1ZOY C;  3H1K D;  1OFC X;  1YJN P;  3L74 J;  5KAI H;  1BGY E;  3F5H A;  4M3L A;  1BCC E;  2A45 I;  1H0T B;  5AVU B;  2IBZ E;  1BCC D;  1WMK A;  2V4H A;  3CX5 I;  3E7K A;  5CBO A;  4GOD A;  2IBZ D;  3FX0 A;  3WUU A;  1N73 A;  1L4A A;  2XKM A;  1P84 E;  1AA0 A;  3FGA D;  1X22 A;  2B87 A;  1OVU A;  5CMZ A;  2ZT9 D;  2E74 D;  1QVF O;  1FJP A;  1EZV I;  3FWN A;  2HYN A;  3VMZ A;  2O1J A;  2LXC B;  2Y0D A;  1FE6 A;  2R3C A;  5KAI E;  1JEK A;  3PH0 A;  1LTS C;  1SQP G;  2WSC H;  1U7M A;  1EC5 A;  3L70 D;  3NMD A;  1NHL A;  4YXD C;  1N7S C;  1VQN P;  1KFN A;  5H2F H;  3M0A A;  1LNQ A;  2Z5H A;  2HFE D;  3E1I A;  2C0X A;  3CWB E;  4IOI H;  1Y47 A;  1JTH A;  1HJB A;  1NTM D;  5B5E E;  3CWB D;  2O1K A;  1YQ3 C;  1FZG A;  1K9M Q;  2GUS A;  4I2L C;  3B4S A;  3P8M C;  3H32 B;  1PGQ A;  3S4R A;  1RF1 A;  3L71 E;  3B5N C;  2R32 A;  1VQ4 P;  1N7S B;  3LW5 J;  3L71 D;  3L4F A;  5APS A;  1USD A;  3L72 J;  2ZXX A;  3V6I A;  1M7L A;  2SPZ A;  1ZP0 C;  3RK2 C;  5H2F E;  3S9O A;  1FZB A;  2BCC J;  4IL6 E;  4OWF A;  3O6Q B;  2G8Y A;  1SQB K;  3KQG A;  5KKZ C;  1SQV J;  1KYO H;  2OTJ P;  3B5N B;  3TDK A;  1VF5 C;  4U3F E;  1IK7 A;  1N73 C;  1L4A C;  1L0N J;  1G1I A;  2E76 C;  1SQX D;  4TLF A;  1KTM A;  4L76 A;  2WPS A;  3ABV C;  3RK2 B;  3TNU A;  5KAF H;  2FXM A;  3SFE C;  3HRN A;  1FOS F;  2O01 H;  3EWK A;  1ZR4 A;  3ZDM A;  3BVH A;  1KC8 Q;  5KKZ B;  3VTP C;  2N9B A;  4IL6 X;  2H43 A;  4W7Z A;  4GKG A;  2E43 A;  4ZKP A;  1VF5 B;  4TT3 H;  1PP9 E;  4WY4 A;  2HLO A;  1N73 B;  2Z5I A;  1L4A B;  1VPC A;  1VQP P;  1EQ7 A;  2E76 B;  3U1C A;  4GDO A;  1KYO D;  2NPS A;  1QGK B;  4AYC A;  2YNY A;  1SQQ J;  3RL0 D;  2B87 B;  1ZR2 A;  1KD1 Q;  1L0L E;  2E5T A;  3V4Q A;  3V2R A;  5KAF E;  2KLU A;  1GTW A;  3BAT A;  1L0L D;  3H1J E;  2CK3 H;  3BCC J;  2W6J H;  4EIJ A;  1NAF A;  1JY2 P;  2KS1 A;  1RF1 C;  2QJY C;  1DD4 A;  1J2J B;  4UB8 H;  1JY3 N;  2JO1 A;  3AE4 C;  2OAR A;  3Q3D A;  2P58 A;  2PP6 A;  1NTZ E;  3VP9 A;  1VL2 A;  3HTK A;  3PHL A;  4WWI A;  1JY3 O;  1NTK D;  1JTH B;  1S4X A;  1AFO A;  4U3F J;  1IJD B;  3GF7 A;  1VQ5 P;  2HPC A;  2WSE H;  4C46 A;  3M9B A;  1H89 A;  4D6T E;  1RF1 B;  1PPJ E;  2QJY B;  1JMM A;  4HYT B;  1RHZ B;  3UIA A;  4D6T D;  1SQB G;  5BU8 B;  4JQ0 D;  1PPJ D;  2KNC A;  1SFC D;  2KYV A;  1JUN A;  3M06 A;  3I5C A;  4IFD K;  1FAV A;  1RF0 A;  3CCR P;  1ZRT E;  1X9V A;  2OGU A;  3AEG C;  3CC2 P;  3USS A;  3TGU E;  1M90 Q;  5GTH H;  3H1K G;  2IZ1 A;  2RKL A;  1Q2N A;  3TGU D;  3IAO A;  1KB9 E;  1LWU A;  2IPP A;  2W27 A;  3L36 A;  4I1L A;  1BGY G;  4DJG A;  1BCC G;  2M8R A;  1E79 H;  1SQX K;  1XTC C;  4WY4 C;  4GOF A;  4Z1M H;  2IBZ G;  4HKZ H;  1KQL A;  2K37 A;  3AE7 C;  1KQF B;  2R3S A;  2NPS C;  5AVT B;  1FU1 A;  5APW A;  3TNU B;  1GD2 E;  1IK9 A;  4KHX A;  2ITA A;  3NXS A;  1YIJ P;  1AVY A;  3E1R A;  3A0B H;  4DCK A;  1AQ5 A;  3L73 J;  3HUS A;  1R8E A;  1VQ7 P;  1N7S D;  5GTH E;  1SLQ A;  3CPW O;  4WY4 B;  1FS0 E;  1YIT P;  4JBZ A;  3L70 G;  3CME P;  1T8Z A;  3H1H D;  1M1J A;  4OGQ C;  2NPS B;  3WUT A;  3IF4 A;  4PD4 H;  3ITK A;  3L74 E;  2B88 A;  3A2A A;  4JYB A;  3H1L J;  3SWK A;  1U7J A;  1L0L K;  1T2K C;  3L74 D;  4HJG H;  3V2N A;  2FYU J;  1S9K D;  3KYQ A;  3B5N D;  3CWB G;  4KT0 J;  3LIE A;  4NPE A;  5CJ4 A;  3A0B E;  2FBW C;  2WWW A;  3LID A;  4H0L C;  3CCE P;  2VRS A;  1ZXG A;  2KS1 B;  5AVW B;  4RJT A;  3EFF K;  2E75 C;  1EDJ A;  3RK2 D;  3WU2 H;  1K04 A;  1S5L E;  3CC7 P;  3L75 D;  1NO4 A;  2WTY A;  3L71 G;  4OGQ B;  1BE3 D;  1NTK K;  5APV A;  5AW2 B;  2W6B A;  3HTK B;  1RF0 C;  1YTZ I;  3M9Q A;  2B9B A;  1DIP A;  1IFM A;  5EFW B;  3SSU A;  4U7J A;  2HPC B;  4PD4 D;  4C7N A;  1VF5 D;  4YTP C;  3RBZ A;  2R44 A;  4H0L B;  3BRV B;  1LWU C;  1L4A D;  2H88 C;  3BAS A;  2W6A A;  5CCH A;  3IR9 A;  1K8A Q;  2ZYD A;  2E75 B;  1LGH B;  2KNC B;  1X8Y A;  2C0W A;  1KV4 A;  2ZJS E;  1P84 H;  1MUU A;  3CXH I;  3BRT B;  3Q1M A;  1SQX G;  1S5L X;  2RMZ A;  3RL0 g;  1W2E A;  2KSE A;  3HUS C;  1CZQ A;  1HVV A;  2IX7 C;  1LT9 A;  1LWU B;  1M1K Q;  3L72 E;  5AVZ B;  2WPV B;  5CBN A;  1BGY D;  2GA1 A;  5AVV B;  1NAY A;  3L72 D;  1N86 A;  3AEE C;  2P67 A;  2BCC E;  3AE9 C;  1NKZ B;  1M1J C;  3G6E P;  1XTG B;  1UIX A;  2QRX A;  3G3Z A;  2BCC D;  3CCQ P;  2Q6Q A;  1QEX A;  3TF5 A;  1SQV E;  5B5E H;  2QIW A;  1MFZ A;  1P84 D;  4R4M A;  3HUS B;  1SQV D;  4GT1 A;  3M0D C;  1JCD A;  5KLV J;  2ZYG A;  3Q5S A;  4PV1 B;  3W67 A;  1L0L G;  1K73 Q;  4N78 E;  5AVX B;  1L0N E;  2Y9Y A;  3H1J G;  1RQV A;  2BEZ F;  5AVY B;  1KMI Z;  2C9N Y;  1M1J B;  3PTZ A;  4BXL A;  1T6A A;  1LTA C;  3F89 A;  2OYO A;  2QM8 A;  3VN0 A;  3MIW A;  2AXC A;  3S1K A;  3QH9 A;  4IL6 H;  3L35 A;  1NTK G;  1FDM A;  1KIL E;  2YKQ A;  2AXT E;  2RH0 A;  1PL5 A;  3PP5 A;  1HJ0 A;  1NKN A;  2L91 A;  2QSI A;  1EDI A;  3M91 A;  5CCH C;  1A02 J;  1PGJ A;  3AEA C;  1SQQ E;  4D6T G;  3D6Z A;  1PPJ G;  1SQQ D;  4L74 A;  1H8A A;  1HBW A;  3FWL A;  2H8P D;  4NPD A;  1NU1 J;  1VQ8 P;  1JCC A;  3VMA A;  2L5G B;  2QJK C;  3BCC E;  4N6J A;  4LC1 A;  1J1D C;  2M0B A;  2NZ2 A;  3P8C E;  4ZNC A;  3BCC D;  3U1A A;  4C7N B;  3GMA A;  2GUV A;  2XV5 A;  3MD0 A;  3P8C D;  4WY4 D;  3VOP A;  3WMM 0;  1PFI A;  5APY A;  1LT9 C;  3AEB C;  3TGU G;  2M3B A;  2MKV A;  1PZQ A;  1FJK A;  2NPS D;  2A06 E;  2IZ0 A;  1DEE G;  3A0H H;  1LTJ A;  1NVO A;  1PIX A;  1GK6 A;  1JB0 J;  2OYH A;  2WT7 A;  2A06 D;  1KIL A;  3JC2 2;  3V5B A;  2JP3 A;  1Y9B A;  2XND H;  3AE5 C;  2V7Q J;  1VDF A;  3AEC C;  4L75 A;  4U3F D;  3JCU E;  4OH8 B;  2QJK B;  2KOG A;  3HD7 A;  2IFN A;  1J1D B;  3MZW B;  1G1J A;  2K9J A;  2Z4E A;  2HR3 A;  2M5A A;  2E42 A;  2POH A;  1LT9 B;  1AVO A;  5BVZ A;  2KI7 B;  3L70 J;  3RK3 E;  2M3E A;  1YTZ T;  3KDP B;  5KTB A;  1T2K D;  3A0H E;  3H1H G;  1LJ2 A;  1NH4 A;  1PP9 D;  1NTM J;  3W68 A;  1SQV K;  3OA7 A;  3K5B A;  1JO5 A;  2HG5 D;  4H0L D;  2J59 M;  5AVS B;  3L74 G;  4GIF A;  1TU3 F;  4XE5 B;  2JKV A;  1KQS O;  4H13 C;  1OZH A;  2E75 D;  4EI2 A;  2WVR A;  2KP8 A;  4Y99 C;  3H1J D;  2AEM A;  3CCJ P;  3L75 G;  3L73 E;  2H89 C;  2QE7 H;  1M56 D;  2WSC J;  1BE3 G;  2QEX P;  1NGM B;  2YXQ B;  3MP7 B;  3VMX A;  1RQU A;  3L73 D;  1A02 F;  3MTU E;  2XNX A;  4WBA A;  3MGN A;  3V2Q A;  4YPC A;  1WRG A;  1NTZ D;  1VQ9 P;  4H13 B;  1LT1 A;  2FXO A;  1KB9 H;  3TYY A;  3L37 A;  1GL2 A;  5DJU B;  3A5T A;  1KYO I;  2W8Z A;  3T97 A;  1PGP A;  4Y99 B;  1SQQ K;  4W80 A;  2Q5U A;  1N8R Q;  1LTJ C;  3H1L E;  1OVR A;  2OYH C;  1JY2 N;  3D71 A;  1OXZ A;  1KIL C;  1SQX J;  2FYU E;  3H1L D;  1ZME C;  2WSF J;  3KXD A;  3H1I J;  1JY2 O;  4H44 C;  4JYC A;  3HD7 C;  2ZT9 B;  4ZKU A;  2K1A A;  4LGD E;  2WIT A;  3A7O A;  1ZRT D;  1LP1 A;  5E79 H;  1GW3 A;  2KZJ A;  1IC2 A;  1BDC A;  1YHQ P;  4AQR D;  1ZN5 A;  1IFP A;  2IDB A;  1VQO P;  1LTJ B;  2OYH B;  2WT7 B;  3GLM A;  1KB9 D;  5AVR B;  1KIL B;  3L72 G;  3U59 A;  1CW5 A;  1R5S A;  1IZN B;  3GG2 A;  4DOJ A;  3GHG A;  2H7H A;  2JDI H;  1CSB A;  2BCC G;  1GMJ A;  2JJL A;  4H44 B;  3HD7 B;  2KUB A;  1Z56 A;  2K9J B;  1SS1 A;  4RES B;  1SQV G;  2M5A B;  2PAJ A;  1JM0 A;  2ZAE B;  3TSI A;  4BWN A;  1S72 P;  1GU4 A;  2QVA A;  2KK7 A;  2W83 C;  5E79 E;  4I7Z B;  3CMA P;  1SQP J;  5CCG A;  1S5L H;  1QL1 A;  3O8Z A;  5CHX A;  3Q2Y A;  3KZI E;  1NOH A;  2OYI A;  2FXP A;  3CCL P;  4PJ0 H;  3IFM A;  1KZU B;  2IYO A;  1NTK J;  2FKW B;  3AEF C;  3SWF A;  3RK3 C;  5CCH D;  4RKU J;  2A45 H;  4O9B A;  1JNM A;  3D70 A;  1VQL P;  1BSN A;  3HE5 A;  1MZ9 A;  3AE2 C;  3CCV P;  5KLI C;  4EDF A;  1GL2 C;  3CX5 H;  1HH0 A;  2XDJ A;  4ASW A;  2LKM A;  1OMI A;  3SWY A;  4L73 A;  3QWO C;  1SQQ G;  4JF7 A;  5AW9 B;  2D2C C;  2NRG A;  5KLV E;  3FXD A;  2QJP C;  4PJ0 E;  1NTZ K;  2JEE A;  1ZV8 A;  1QL2 A;  3RK3 B;  2OTL P;  2WPR A;  1HTL C;  3LW5 H;  1MV8 A;  5AW3 B;  3BCC G;  3VMY A;  3CL3 D;  2DW3 A;  1URQ A;  5KLI B;  1GL2 B;  2ZVN B;  2R5B A;  1DX7 A;  3T97 B;  2WSE J;  2B89 A;  2HOD A;  4K3A A;  2E76 D;  3CX5 E;  1JMB A;  4B86 A;  2FYU K;  3CX5 D;  2A06 G;  2WMM A;  2D2C B;  3GHG C;  1NYH A;  2QJP B;  4U3F G;  2Q1K A;  3MUD A;  1J1E B;  2FFD A;  5KJ7 A;  2JR8 A;  1YYC A;  5AW4 B;  1EZV E;  2QG4 A;  1RE4 A;  1LP1 B;  2P10 A;  1EZV D;  2Y9Z A;  3AED C;  1EXJ A;  4CPG A;  1Y8A A;  1YJW P;  4BRY A;  4PV1 C;  1NU1 E;  5CCG C;  4HB1 A;  5APX A;  3B8E B;  3H1H J;  3AE1 C;  5AW5 B;  5AW7 B;  4EOT A;  2OYI C;  5M1B A;  2YMK A;  3GHG B;  4PD4 I;  3RGU A;  1FDI A;  2FY8 A;  4H13 D;  1PP9 G;  2CPS A;  2AEJ A;  2AXT H;  4UB6 E;  1FZF A;  4DT0 A;  2CPB A;  2N1T A;  2ZXE B;  2PRR A;  5B66 E;  1RY3 A;  2Y0E A;  1OIP A;  2BEQ D;  3L75 J;  4N78 D;  2P7J A;  1BE3 J;  1PGO A;  1L0N D;  5TIS E;  1SFC B;  3M9H A;  2OYI B;  5BU5 A;  4R4L A;  5APQ A;  1RE3 A;  1KN7 A;  3GW6 A;  3L73 G;  3NTN A;  1GW4 A;  3L70 E;  2QM7 A;  3NFQ A;  4QMA A;  2ZFC A;  1OW7 A;  1NTZ G;  1YQ4 C;  3HE5 B;  1GDT A;  1URQ C;  3V4W A;  5C39 A;  2IBZ I;  1KIL D;  3B71 A;  4RO0 A;  3D6Y A;  5APU A;  1SQB J;  1N7L A;  1NTM E;  4H44 D;  3HE4 A;  3HD7 D;  1EDL A;  1P84 I;  2ZYA A;  3JCU H;  3H1L G;  5KLV K;  1LTG C;  2E5Y A;  1QLE D;  2KB7 P;  5AW6 B;  2FYU G;  1AV1 A;  4LLH A;  3MUD C;  1RH5 B;  3N4X A;  1MFT A;  2FFD C;  2WSS H;  5KJ7 C;  1UII A;  3II6 A;  1X79 B;  3H1K J;  4N3Y B;  1RE4 C;  4DZO A;  2WSF H;  1URQ B;  3P7K A;  2OTK E;  1BGY J;  1BCC J;  3IN6 A;  2HOD B;  1W2B O;  1FDO A;  2IYP A;  3R4Y A;  2W90 A;  2I8D A;  5APT A;  3OW2 O;  1FZC A;  2MJZ A;  1M8O B;  1S3J A;  1DH3 A;  3RBX A;  2UWJ E;  2K3R A;  1N2D C;  2FFD B;  3GF3 A;  3CCU P;  1IFD A;  3R2P A;  1FC2 C;  2N1T C;  1HGV A;  1SQX E;  2K88 A;  4BRY B;  1NU1 K;  3H1I E;  3I55 P;  4OGQ D;  3PJS K;  1AJY A;  1FZE A;  3H1I D;  1JOC A;  3RK3 D;  1LTB C;  1HUC A;  1RE3 C;  4GOE A;  3PLN A;  1GL2 D;  3CD6 P;  1R5L A;  3CWB J;  2XZR A;  2N1T B;  3CCS P;  1E5W A;  2O01 N;  1JY3 P;  1KYO E;  2BAS A;  1L0N K;  2ZVO B;  2D2C D;  4K35 A;  1OVV A;  2Q3I A;  2PGD A;  1G2C A;  3TK1 A;  1GK4 A;  3L71 J;  2LXB A;  1USE A;  3AE3 C;  4AUW A;  2YO3 A;  5GTI H;  1IFJ A;  4WVZ A;  3G4S P;  5KLV G;  1IFI A;  1M57 D;  2YO2 A;  3EFG A;  1SQP E;  1DEB A;  2ZT9 C;  2JWD A;  2E74 C;  1D7M A;  1NJI Q;  1CI6 A;  1SQP D;  1HGZ A;  3AE8 C;  5TJH A;  3CC4 P;  1LTT C; 
#chains in the Genus database with same CATH homology
 2WPV B;  4H0L C;  3D6Z A;  1OW7 A;  1MKM A;  3AEF C;  1YQ4 C;  3IAO A;  3H25 A;  2ZT9 D;  4H44 C;  3AEE C;  2E74 D;  3G9R A;  2G8Y A;  1KQG B;  2E75 C;  2ZT9 B;  3AE9 C;  3AE6 C;  3B71 A;  4RKU J;  1K04 A;  2G3A A;  2P10 A;  4OGQ D;  3D70 A;  3AED C;  5KKZ C;  1EXJ A;  3D6Y A;  1UIX A;  4H0L D;  1AJY A;  2QJY C;  3AE2 C;  4OGQ B;  4PV1 C;  5KLI C;  1DD4 A;  1U57 A;  2QJK C;  4Z1M H;  3O6Q A;  1TU3 F;  3AE7 C;  4H44 D;  1KQF B;  4H13 C;  2NZ2 A;  1VF5 C;  2E75 D;  2JO1 A;  1Q90 D;  2QIW A;  3AE4 C;  3AE1 C;  1OMI A;  4R4M A;  1IK7 A;  3GMA A;  2IDB A;  1DIP A;  3Q3D A;  5M1B A;  4PV1 D;  2YMK A;  3Q5R A;  2E76 C;  3AEB C;  3C8V A;  2K9Y A;  1VL2 A;  4U7J A;  4YXD C;  3Q5S A;  4PV1 B;  1KTM A;  1FDI A;  2E74 B;  3GLM A;  2MKV A;  3ABV C;  4H13 D;  1VF5 D;  1K05 A;  2D2C C;  4YTP C;  3SFE C;  2WQY C;  1R8E A;  2OQQ A;  1PIX A;  4H0L B;  1S1C X;  2H88 C;  2QJP C;  1JB0 J;  1PV3 A;  3GF7 A;  1RQV A;  2H89 C;  3EWK A;  4Y28 J;  2BEZ F;  2WSC J;  1GMJ A;  3SFD C;  1NGM B;  4H44 B;  2JP3 A;  1Y9B A;  2E75 B;  1KMI Z;  1RQU A;  1EXI A;  1KOR A;  2YIU C;  2D2C D;  2J5U A;  3AE5 C;  2V7Q J;  4I7Z C;  1YQ3 C;  3AEC C;  3IN6 A;  1ZOY C;  4IL6 X;  3AE3 C;  3Q1M A;  2FYN C;  2BEQ D;  4H13 B;  1VF5 B;  3T97 B;  1FDO A;  4OGQ C;  4TT3 H;  1OW8 A;  3R4Y A;  2WSE J;  1KIL E;  1S5L X;  2E76 D;  5L8R J;  3RL0 g;  4I7Z B;  1WMK A;  2E76 B;  1HF9 A;  4GDO A;  1PL5 A;  3LW5 J;  4R4L A;  1HJ0 A;  1OW6 A;  1ZRT E;  3Q2Y A;  2D2C B;  3AEG C;  2ZT9 C;  2QSI A;  2FXP A;  3GF3 A;  4KT0 J;  1NYH A;  3RK3 E;  2O01 J;  4XFJ A;  1DD3 A;  2E74 C;  3D71 A;  1ZP0 C;  2FBW C;  3AEA C;  3S9O A;  3AE8 C;  3Q5P A;  1ZME C;  2WSF J;  3FGA D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...