2JEEA

Xray structure of e. coli yiiu
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
78
structure length
78
Chain Sequence
MSLEVFEKLEAKVQQAIDTITLLQMEIEELKEKNNSLSQEVQNAQHQREELERENNHLKEQQNGWQERLQALLGRMEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel Coiled-Coil Cell Division Factor Zapb Stimulates Z Ring Assembly and Cell Division.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle
molecule keywords CELL DIVISION PROTEIN ZAPB
total genus 30
structure length 78
sequence length 78
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06005 ZapB Cell division protein ZapB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2jeeA00
4ZKUA 5BU5A 1WT6A 3U1AA 4N3YB 3VP9A 4N78D 3C9IA 1IC2A 4I1LA 3OJAB 4O9BA 2FXMA 5BU8B 3U1CA 2JEEA 5BVZA 3BATA 3U59A 3N7NA 3N4XA 3VP8A 3HRNA 4GIFA 3P8CD 3BASA 1X79B 2POHA 5KTBA 1NKNA 4ZKPA
chains in the Genus database with same CATH superfamily
3HE4A 1X0TA 2IDBA 2ZXXA 3M0DA 2YMYA 5GTHH 5M1BA 1YI2P 3II6A 3KHUA 3L4FA 1VQ7P 1Y8AA 2KP8A 2OGUA 4OVNF 1SLQA 3AEBC 4WY4B 3Q5RA 2A45I 5APTA 2M5AB 4EDFA 1M1JA 2K3RA 3JCUE 1HGVA 2KI7B 3WUTA 3CXHD 1RF1C 2P10A 2IBZG 4DT0A 1AVYA 4JQ0D 2N9BA 3RK3E 1N73B 3FWLA 1NH4A 4K3AA 5KKZB 2E5YA 1VF5B 1L0LE 2I1JA 2JEEA 2C9LY 2WQYC 1LT9C 3VMAA 2NPSD 4LC1A 1LT1A 2E76D 2K9JA 1KFMA 3P8CE 4OGQB 2K88A 5AVUB 1RF1B 1YHQP 1EDKA 2O1JA 3L75E 3IFMA 1JTHB 3USSA 5CBOA 3L70E 2WSEH 1MFTA 1SQBJ 3G71P 2OYIC 4LGDE 3RK3B 1NKNA 1PPJD 2D2CC 3E1RA 4C7RA 1ZR2A 5AW2B 3AE8C 3AEDC 4PD4D 2Y0CA 2HPCA 3PLNA 1KB9I 4H0LC 3E7KA 3TGUG 4A7PA 3H1HJ 1T3UA 1FDIA 1KB9H 3V4QA 1PPJE 4B86A 2C0WA 1MZ9A 1LGHB 1PZQA 1EZVI 3IN6A 3Q3DA 1GL2D 5CMZA 1KILB 3SFDC 5KAFH 1J1DC 1GU4A 1SQXG 1FE6A 3S4RA 1D7MA 3A3YB 1OW8A 2WSFH 4RKUJ 1JUNA 1KN7A 1OVUA 2E74D 1RE4C 3GMAA 1NTKD 3H6PA 1NTME 1AVOA 1GMJA 3PH0A 4DJGA 2W90A 3BATA 1URQD 3HUSA 2E75D 2FKWB 2B89A 2OYOA 3L35A 2WTYA 1S5LH 2V7QJ 1UIXA 2Z4EA 2KLUA 3AEAC 3IAOA 5E79E 2QG4A 4HH2A 3TNUA 1VQ9P 2I1KA 4L75A 5GTIE 3MD0A 2QM8A 3A7OA 4U3FD 2OQQA 1KILC 2Q3IA 3VP9A 3CLQA 1NU1E 2FYZA 1SQBG 3AE1C 3QWOC 4BXLA 4Y99B 3KZIH 3M9BA 3H1JJ 4PV1C 1BSHA 2WPRA 5KJ7D 1NGMB 1IK7A 1HJ0A 3AE3C 3LW5J 5AVWB 3SSUA 3CCVP 2I8DA 3B5NC 4Z1MH 2B87B 2N9YB 3L73J 4JBZA 3H1JE 1SQXE 2A06D 2D2CB 2KOGA 1GW4A 3H1JG 3L74G 2BCCD 1NTZD 2WPQA 2IYPA 3M0DC 2GA1A 2IFNA 5B5EH 5AVRB 1SQXJ 1M56D 2XZRA 3MTUE 4WBAA 1FZAA 2YXQB 1LTJB 1PGJA 1G1IA 1HH0A 1VQ8P 1FZCC 4ASWA 1FDMA 3CL3D 3AE6C 1L4AB 2FFDB 2WSCJ 3M9QA 1FOSF 3OA7A 5CHXA 2HFED 3ABVC 1JY3N 4H44C 1URQB 4UB8H 5APUA 2V4HA 2M0BA 2XV5A 2OYHA 1DEEG 4IL6X 1X8YA 1GZLA 1L2PA 1AFOA 4YPCA 3CCJP 1S5LX 1SQVD 2OARA 1N7SB 3Q2YA 1EDLA 3P8MC 4UB6H 1Q90D 1VDFA 1JMMA 1NTMD 1LTIC 2HODA 1L0LK 5BU8B 2QJYB 2OYHB 3KXDA 2GM4A 2JP3A 1BGYJ 1QGKB 2IBZE 5H2FH 5KAIE 3T97A 3Q5PA 4H13D 1A02J 3CCLP 3CCRP 1EZVD 1QEXA 2O1KA 3L71E 3V2RA 4BRYA 1URQC 3L73G 3VOPA 1KFNA 3L73E 4WWIA 4NPEA 2WVRA 1SQQD 3GF7A 4GKGA 1XTGB 3L72J 3F89A 1PL5A 3L71J 5KTBA 3CX5D 3RK3C 1YIJP 2FFDC 5AVQB 1HUCA 3H1ID 4WB4A 1KYOE 1MV8A 3O6QB 5KLVK 1JMBA 2R32A 1M8OB 2IFMA 2KK7A 3L73D 5AW4B 3RK2C 5EFWB 4DZOA 4EYYQ 4YXWH 1K73Q 2KNCA 1SFCA 1R5LA 1HJBA 1SQQK 1YTZI 1ZP0C 3L70D 1OVVA 1VF5D 1VQMP 3MGNA 3H32A 1P84E 4H0LD 1VQLP 1IC2A 3H1IG 1SFCB 1EDIA 1WRGA 1LP1B 2P58A 3D6ZA 2WPVB 1HWTC 3RBXA 1L0LD 3AEEC 2FY8A 2JDIH 1NTMK 1EXIA 3CMEP 1P84D 2QJKC 1ZLLA 4AUWA 1JTHA 1JY3O 2Z5IA 4OH8B 4PJ0E 4WY4C 1JY2O 3M9HA 3MIWA 4IOIH 1FJPA 3HRNA 1VL2A 2OYHC 3S9OA 4UB8E 2QIWA 2IYOA 4H44D 5AW3B 1PP9J 1SQPG 2BEQD 2J58A 1YBKA 2MJZA 1GL2B 2W83C 1M1KQ 1WMKA 3AE9C 1SP4A 1K04A 2P1JA 2XNXA 1AQTA 1M57D 1JCCA 2AXTH 2ZT9B 3A0HE 4W80A 3WU2E 2OTKE 4JF7A 3RL0C 4IL6E 2WZ7A 3GHGA 1YQ4C 2ZFCA 3CI9A 1OVRA 1Q7YQ 4D6TJ 1Q81Q 3L72D 2ZAEB 4IFMA 1E79H 1NWQA 1N2DC 1KILE 5APXA 2DW3A 3FGAD 2O01N 1SVFA 1LTBC 3H1IJ 1N86A 3PP5A 5KJ7C 4H0LB 4PV1D 4D6TG 2QA4P 1H0TB 1EXJA 3AECC 4ZNCA 2BASA 1H8AA 1IFJA 4HKZH 5CCHA 1FJKA 1DEBA 1N7SC 2FBWC 5KLIC 5GTHE 1L0NE 1KILD 3CWBE 3I56P 1FAVA 2MKVA 2WSFJ 3OW2O 1VQPP 2POHA 1SQPE 3SWFA 1MFZA 1PV3A 2WSCH 1KC8Q 1G2CB 1N73C 2YKPA 2PRRA 4BWNA 1IK9A 2NPSA 4N78D 5DJUB 2Q7CA 1PFIA 1PP9G 1OIPA 1SQPJ 2AEJA 1PP9E 2E75B 3C9IA 3TNUB 4H44B 3CX5I 5AW0B 1JNMA 5CCGA 3CD6P 3KDPB 2Q5UA 2HYNA 1NHLA 3L75D 3W67A 1FC2C 3C1LA 1R8EA 1S72P 1JCDA 2FYUD 1L0LG 2N1TB 2W6BA 3HD7C 2E43A 5CCHD 1QVFO 1EC5A 1YTZT 1Z56A 2M5AA 2A45G 1RF0C 2FYNB 5BVZA 2CPSA 2YO2A 3CC4P 3MUDC 3L71G 2B87A 1Y9BA 4D6TE 1JB0J 2FYUG 3VMYA 3WUUA 1KQLA 1FBMA 2H43A 1NYHA 3PTZA 2YNYA 4R4MA 5AVTB 4JYBA 1YJNP 2P7JA 1Y47A 1BCCJ 2YXRB 4Y99C 4PD4H 5KLVG 1QL1A 1YJ9P 2RH0A 2WWWA 3P32A 5TISE 4PD4I 4ZKUA 1WT6A 2HR3A 3G4SP 3CCEP 2XDJA 1SQQE 3HD7D 3FXDA 4YTPC 2RKLA 2NPSC 1TU3F 3CXHE 1ZRTE 5AW9B 4U3FJ 3KQGA 4Y28J 1SQXD 2A06E 3A0BH 4RJTA 4HYTB 3VMZA 4IFDK 2KS1B 1LWUC 1NTMG 4GOEA 5AVZB 3R4YA 4U3FE 4NPFX 1S9KE 1T3JA 2W27A 1LNQA 2H8PD 1KQSO 3GG2A 1LTTC 3G9RA 3KZIE 5B66H 1N7SD 1K9MQ 1VQ6P 1DD3A 2N1TC 3HD7B 5GTIH 3GW6A 2E5TA 1LTAC 3NMDA 1IFPA 1GD2E 2QVAA 3GHGC 3H1KD 2SPZA 4XA4A 3BCCD 3V6IA 4CPGA 1SFCC 2JR8A 3GLMA 3V2PA 2M8RA 1ZOYC 2QE7H 1SFCD 1IZNB 2BCCG 2L5GB 4R4LA 2YMKA 2RN0A 1RQVA 1VPCA 2WT7B 2E76B 2ZYAA 3JC22 2G3AA 1L4AA 4OGQD 3RL0D 1HBWA 3CMAP 4GODA 3JSVC 1J1EB 2OYIB 1PGPA 3B8EB 3TK1A 1NTZK 2WT7A 1ZR4A 1H89A 1SQBE 1NAFA 2IBZD 4WY4A 3VN0A 1FZBA 4BRYB 4ZMDA 2O01H 2LXBA 1SQVJ 2YKOA 3AEFC 5TJHA 1MKMA 5APQA 1BDDA 3P7KA 2BEZF 5AW7B 1Q82Q 3A5TA 2O3JA 1SQBD 1K05A 1SQVE 3CCMP 2IPPA 1J1EC 2IX7C 2HODB 2ZT9D 3AE4C 3N4XA 1BGYD 2P67A 2PP6A 3EQ2A 4WY4D 2CPBA 3KYQA 5AVSB 1KQGB 4EOTA 1QX8A 4WVZA 1IFIA 1LTGC 3QH9A 1RE4A 2YKQA 1JY2N 1AV1A 1RHZB 1JEKA 4U7JA 5AW5B 4UB6E 1L0LJ 3D71A 1LT9B 1FS0E 1VF5C 2E42A 1IFNA 1NTKK 3NTNA 2XKMA 1G2CA 4HJGH 2ITAA 4PV1B 1L4AC 1NU1G 4O9BA 2R44A 1BE3D 1YQ3C 1XTCC 2KIKA 2PFXA 2XNDH 3E1IA 1KZUB 3JCUH 3L70J 2H89C 3AE2C 5CCHC 1N7SA 2JO1A 4RESB 4TLFA 2B9BA 3RK3D 3H1KE 2OYIA 1NU1J 4L73A 1BCCG 1S5LE 1S3JA 2FYUE 3BCCG 2YIUC 2RMZA 1G1JA 1BE3E 3L70G 3R2PA 3CX5H 1BE3G 5CJ4A 5KLIB 1GK4A 1N73A 3B5NB 1NVOA 1LWUA 4MN4C 3Q1MA 3EFGA 3EFFK 3HUSB 2QJKB 1JY3P 2UWJE 3MP7B 4KT0J 3RL0g 4ZKPA 3CC7P 1M1JB 1T6AA 4I7ZC 1KB9D 4C7NB 1PP9D 3VTPC 3PRJA 2N1TA 2H7HA 4EI2A 1CSBA 4TT3H 1E5WA 1T8ZA 1NO4A 2C0XA 1RF0A 3L74D 2PGDA 1USEA 1YITP 3TSIA 1T2KD 3D70A 3OJAB 1KB9E 3MUDA 1W2EA 4L76A 1YJWP 1CW5A 4HB1A 2LKMA 1FZFA 1N7LA 2AXCA 2Z5HA 2A06G 2QJYC 2AXTE 3AEGC 1ZRTD 4LLHA 1X22A 2IZ0A 1OWAA 1EZVE 1HGZA 1SS1A 1U7MA 3A0BE 1OMIA 2YIUB 3H1LD 3L75G 2KSJA 4GDOA 1KILA 3U59A 3N7NA 1OZHA 2QSIA 1GL2A 1KYOI 2BCCJ 2WSSH 4DOJA 5B5EE 4JPZB 4AYCA 3L75J 4XFJA 1GU5A 1KYOH 1S4XA 1OW7A 4L74A 1KQFB 2KUBA 2FYUJ 3H1LE 1NAYA 3H1LG 3IF4A 3L37A 1BE3J 2BCCE 3LIEA 4NPDA 2W6AA 5DJTB 5E79H 5BU5A 1N8RQ 1A02F 5KLVE 2K1AA 3B5NA 1S1CX 5KLVJ 1ZW0A 2A45H 1NU1D 3BRTB 3O8ZA 1L0ND 3CWBD 1VQ5P 1K8AQ 3O6QA 2Q3EA 1NKZB 3TGUD 1FZEA 1ZXGA 2HG5D 3AE5C 1IO4A 4EIJA 3FX0A 3TYYA 1HTLC 1S2EA 1FZCA 1BCCD 4DCKA 1GK6A 1PPJG 2JWAA 4U3FG 3H1IE 5APYA 3H32B 1SQXK 2W8ZA 2LXCB 1NTMJ 3RBZA 5KKZC 2E75C 3M0AA 4JYCA 3RL0B 2CK3H 3F5HA 4RO0A 3S1KA 3VP8A 1LTJC 1PGOA 3WUVA 1PIXA 3RK2D 1IFMA 4C7NA 1DH3A 1X79B 5APWA 2P2UA 3V5BA 3HTKA 5AW6B 1DD4A 1LJ2A 4XE5B 5AVXB 2K9JB 1M90Q 5KAFE 1LWUB 1QLED 3VYIA 1BGYE 1GTWA 3L71D 3LIDA 1OXZA 1NTKG 1Q86Q 2GUVA 1NTKE 1VQ4P 2KB7P 1U7JA 3B71A 3H1LJ 2NPSB 2ZXEB 4H13C 3T97B 1MUUA 4W7YA 2KNCB 4I1LA 1URQA 3MZWB 3L72E 1JO5A 1RY3A 1Q2NA 1NTKJ 3BCCJ 5CBNA 1KV4A 1KYOD 2FXMA 1EQ7A 3WMM0 4AQRD 3HE5B 3L36A 1RF1A 2FYUK 1T2KC 3FWNA 4M3LA 1J1DB 5AVVB 3SFEC 3Q5SA 3BCCE 3PHLA 2M3EA 2NZ2A 3A2AA 3CC2P 2ZT9C 3HE5A 3HE4B 1L0NK 3OAKA 1SQVG 1AQ5A 1EDJA 2JKVA 2XU6A 1NOHA 2FXOA 3P8CD 2IBZI 2ZVNB 4PJ0H 3CCUP 5K5GB 1AA0A 2KXPB 1JY2P 1LT9A 2KSEA 2Y0EA 3SWYA 3TGUJ 3V2NA 1LTJA 3CX5E 5KJ7A 4QMAA 4N78E 3RGUA 3H1JD 1FDOA 1QL2A 3U1CA 2M3BA 1GDTA 3GHGB 3TGUE 1IJDB 1VQOP 1OX3A 2R5DA 1RQUA 1BDCA 1IFDA 4KHXA 5APSA 1YYCA 2E74B 2H88C 1QVGO 5L8RJ 2QJPC 1JM0A 1H88A 2JWDA 1FU1A 4K35A 4GT1A 1LTSC 1M7LA 1P84H 3SWKA 1H0TA 1X9VA 3B5ND 5APVA 4GOFA 2J5UA 3CCQP 1DX7A 1ZN5A 1P84I 3ITKA 2QEXP 5CJ0A 5CCGC 4D6TD 2V7QH 2R5BA 1FZGA 3G6EP 3H25A 1FZCB 3BVHA 2PAJA 3CPWO 1W2BO 2FYNC 1W5CE 2N1TD 2YO3A 3M06A 4N6JA 4PD4E 2HPCB 1EZVG 1PGQA 1RE3C 2G8YA 3G3ZA 3BASA 3UIAA 5H2FE 5KAIH 5TISH 5AVYB 1GW3A 2O01J 1NTZJ 1R5SA 3KPEA 3NXSA 1CI6B 3VMXA 3CXHI 3I55P 2Q9IA 1HF9A 2GUSA 2KZJA 3LW5H 4N3YB 4W7ZA 2KS1A 2Y9YA 5AW1B 3M91A 2K37A 3TF5A 1J2JB 1NTZG 1UIIA 4OWFA 2ZYDA 5C39A 1ZMEC 2QJPB 2QRXA 2C9NY 2NRGA 2E74C 2WITA 1SQQG 2KZIA 1SQPD 1FOSE 2Q6QA 2B88A 1VQNP 2OTJP 2FFDA 2Y0DA 4IL6H 2WPSA 5AW8B 2ZJSE 1S9KD 1GL2C 2QM7A 2VRSA 3L74E 3V4WA 3WU2H 1L4AD 2KLVA 1AJYA 1SQQJ 1ZV8A 1LP1A 1KMIZ 3K5BA 1CZQA 2HLOA 2AEMA 1DIPA 1KORA 4GIFA 1JOCA 2KYVA 2LR2A 2ZYGA 5KLVD 3TDKA 2Q1KA 3IR9A 2WMMA 3FXEA 2D2CD 2Y9ZA 2FXPA 1NJIQ 3C8VA 3HD7A 3EWKA 1RE3A 1SQPK 2R3SA 2ZVOB 2WSEJ 3U1AA 3BRVB 1M1JC 4I7ZB 1BSNA 1KTMA 4IFFA 3ZDMA 1U57A 2E76C 3AE7C 1NU1K 1NTZE 4C46A 3I5CA 1HVVA 1CI6A 1SQBK 2W6JH 3HUSC 1BGYG 4H13B 4I6MC 2AEFA 3D6YA 1OW6A 3CXHH 3RK2B 1BCCE 2J59M 3PJSK 2IZ1A 4KJMA 2L91A 3A0HH 3CCSP 1KD1Q 4YXDC 3H1KJ 3NFQA 3L72G 2JJLA 1L0NG 1USDA 1SQVK 3CWBG 3H1HD 1RH5B 3B4SA 4OGQC 3HTKB 2K9YA 2R3CA 4I2LC 1OFCX 3L74J 3H1KG 5B66E 4ASVA 3V2QA 2OTLP 1L0NJ 3CWBJ 3W68A 5CCGD 1VQKP 3H1HE 3GF3A 3MHVA 3H1HG
chains in the Genus database with same CATH topology
3HE4A 3M0DA 2YMYA 3II6A 3L4FA 2KP8A 2FFDA 1SLQA 4WY4B 2A45I 5APTA 1M1JA 1HGVA 1RF1C 2N9BA 1NH4A 2I1JA 2JEEA 2C9LY 1LT9C 2NPSD 4LC1A 1KFMA 3P8CE 5AVUB 1RF1B 2O1JA 3IFMA 1JTHB 2WSEH 2OYIC 4LGDE 3RK3B 1NKNA 1ZR2A 4C7RA 5AW2B 1T3UA 3V4QA 4B86A 2C0WA 1MZ9A 1LGHB 1GL2D 5CMZA 1KILB 1GU4A 1J1DC 3A3YB 1JUNA 2WSFH 1RE4C 2HPCA 3H6PA 3BATA 1URQD 3HUSA 2FKWB 3L35A 2WTYA 2Z4EA 4HH2A 3TNUA 2I1KA 3MD0A 2QM8A 3A7OA 3VP9A 1KILC 2Q3IA 3CLQA 2FYZA 4Y99B 3M9BA 2WPRA 5KJ7D 5AVWB 3B5NC 2KOGA 3M0DC 1GW4A 2WPQA 2IFNA 5AVRB 2XZRA 3MTUE 4WBAA 1FZAA 1LTJB 1G1IA 1HH0A 1FZCC 3CL3D 2FFDB 1L4AB 1FOSF 3M9QA 3OA7A 5CHXA 2HFED 1JY3N 1URQB 5APUA 2XV5A 1X8YA 1GZLA 1AFOA 2OARA 1N7SB 1VDFA 1JMMA 5BU8B 1LTIC 2HODA 1L0LK 2OYHB 2GM4A 3T97A 1A02J 2O1KA 3V2RA 1URQC 3VOPA 1KFNA 4GKGA 1XTGB 5KTBA 2FFDC 3RK3C 5AVQB 1HUCA 4WB4A 1MV8A 5KLVK 1H88A 2R32A 2IFMA 3RK2C 5AW4B 4DZOA 1SFCA 1HJBA 1SQQK 1YTZI 3MGNA 3H32A 1IC2A 1SFCB 1WRGA 1HWTC 1NTMK 1ZLLA 4AUWA 1JTHA 1JY3O 2Z5IA 4OH8B 4WY4C 1FJPA 1JY2O 3M9HA 3MIWA 3HRNA 5AW3B 2J58A 2MJZA 1GL2B 1SP4A 2P1JA 2XNXA 4W80A 1JCCA 4JF7A 3RL0C 2WZ7A 3GHGA 2ZFCA 3CI9A 4IFMA 1NWQA 1N2DC 5APXA 1N73B 1T2KC 1SVFA 1LTBC 5KJ7C 1N86A 3PP5A 2BASA 1H8AA 1IFJA 5CCHA 1FJKA 1DEBA 1N7SC 1FDMA 1KILD 1FAVA 2POHA 3SWFA 1MFZA 2WSCH 1G2CB 1N73C 2YKPA 1IK9A 2NPSA 4N78D 2Q7CA 1PFIA 3TNUB 3C9IA 5AW0B 5CCGA 3KDPB 2Q5UA 2HYNA 1NHLA 1JNMA 2H43A 2OYHC 1JCDA 2N1TB 3HD7C 2E43A 2W6BA 5CCHD 1YTZT 1Z56A 2A45G 1RF0C 5BVZA 2CPSA 2YO2A 3VMYA 1KQLA 1FBMA 5AVTB 2YNYA 4JYBA 2P7JA 4Y99C 1QL1A 3P32A 2WWWA 4ZKUA 1WT6A 2XDJA 3HD7D 2NPSC 5AW9B 3KQGA 4HYTB 3VMZA 4IFDK 1LWUC 5AVZB 1S9KE 1T3JA 2W27A 2H8PD 1LTTC 1N7SD 2N1TC 3HD7B 1GD2E 3NMDA 1LTAC 3GHGC 4XA4A 1SFCC 3V2PA 2M8RA 1SFCD 2L5GB 1VPCA 2WT7B 1HBWA 3RL0D 1L4AA 1J1EB 2OYIB 3B8EB 3TK1A 1NTZK 2WT7A 1ZR4A 1H89A 1NAFA 4WY4A 3VN0A 1FZBA 2O01H 2YKOA 5APQA 3P7KA 5AW7B 3A5TA 2IPPA 1J1EC 2IX7C 2HODB 3N4XA 4WY4D 2OYHA 2P67A 2PP6A 3EQ2A 2CPBA 3KYQA 5AVSB 4EOTA 1IFIA 1LTGC 1RE4A 2YKQA 1JY2N 5AW5B 1LT9B 2E42A 1IFNA 1NTKK 3NTNA 2XKMA 1G2CA 1L4AC 4O9BA 1AQ5A 3E1IA 1XTCC 1KZUB 5CCHC 1N7SA 3RK3D 4RESB 2OYIA 3R2PA 1G1JA 5CJ4A 1GK4A 1N73A 3B5NB 1LWUA 3EFGA 3HUSB 1JY3P 4ZKPA 1M1JB 4C7NB 3VTPC 2N1TA 2H7HA 1CSBA 1E5WA 1T8ZA 1NO4A 2C0XA 1RF0A 1T2KD 3OJAB 3MUDA 1W2EA 1CW5A 2LKMA 1FZFA 1N7LA 2Z5HA 3U1CA 4LLHA 1OWAA 3P8MC 1HGZA 3TSIA 2KSJA 1KILA 3U59A 3N7NA 1GL2A 4DOJA 4AYCA 1GU5A 3LIEA 3L37A 1A02F 2W6AA 5BU5A 3B5NA 2A45H 3BRTB 3O8ZA 1NKZB 1FZEA 2HG5D 1IO4A 4EIJA 3TYYA 1HTLC 1FZCA 1GK6A 5APYA 3H32B 1SQXK 3M0AA 4JYCA 3RL0B 3VP8A 1LTJC 3RK2D 1IFMA 4C7NA 1DH3A 1X79B 5APWA 2P2UA 3V5BA 3HTKA 5AW6B 4XE5B 5AVXB 1LWUB 3VYIA 1GTWA 3LIDA 1OXZA 2GUVA 2KB7P 2NPSB 2ZXEB 1MUUA 4W7YA 4I1LA 1URQA 1JO5A 1RY3A 2FXMA 1EQ7A 3WMM0 4AQRD 3HE5B 3L36A 1RF1A 2FYUK 4M3LA 1J1DB 5AVVB 3A2AA 3HE5A 3HE4B 1L0NK 3OAKA 2XU6A 1NOHA 3P8CD 1JY2P 1LT9A 3SWYA 5KJ7A 3V2NA 1LTJA 4N78E 1QL2A 2M3BA 1GDTA 3GHGB 1IJDB 2R5DA 1IFDA 4KHXA 5APSA 1YYCA 1FU1A 4GT1A 1LTSC 1M7LA 1X9VA 3B5ND 5APVA 1DX7A 1ZN5A 5CJ0A 5CCGC 1FZGA 2R5BA 1FZCB 3BVHA 2PAJA 2N1TD 3M06A 2YO3A 4N6JA 2HPCB 3G3ZA 1RE3C 3UIAA 3BASA 5AVYB 1GW3A 3KPEA 3VMXA 3NXSA 2Q9IA 1CI6B 2GUSA 3LW5H 4N3YB 4W7ZA 5AW1B 3M91A 1J2JB 2C9NY 2WITA 1FOSE 2WPSA 5AW8B 1S9KD 1GL2C 2QM7A 2VRSA 3V4WA 1L4AD 2KLVA 1ZV8A 1CZQA 2HLOA 4GIFA 1JOCA 2KYVA 3IR9A 3HD7A 1RE3A 1SQPK 3U1AA 3BRVB 1M1JC 4IFFA 1NU1K 4C46A 3I5CA 1HVVA 1CI6A 1SQBK 3HUSC 4I6MC 3RK2B 2J59M 3NFQA 2JJLA 1SQVK 3HTKB 2R3CA 4I2LC 3V2QA 5CCGD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZKU A;  5BU5 A;  1WT6 A;  3U1A A;  4N3Y B;  3VP9 A;  4N78 D;  3C9I A;  1IC2 A;  4I1L A;  3OJA B;  4O9B A;  2FXM A;  5BU8 B;  3U1C A;  2JEE A;  5BVZ A;  3BAT A;  3U59 A;  3N7N A;  3N4X A;  3VP8 A;  3HRN A;  4GIF A;  3P8C D;  3BAS A;  1X79 B;  2POH A;  5KTB A;  1NKN A;  4ZKP A; 
#chains in the Genus database with same CATH topology
 3HE4 A;  1X0T A;  2IDB A;  2ZXX A;  3M0D A;  2YMY A;  5GTH H;  5M1B A;  1YI2 P;  3II6 A;  3KHU A;  3L4F A;  1VQ7 P;  1Y8A A;  2KP8 A;  2OGU A;  4OVN F;  1SLQ A;  3AEB C;  4WY4 B;  3Q5R A;  2A45 I;  5APT A;  2M5A B;  4EDF A;  1M1J A;  2K3R A;  3JCU E;  1HGV A;  2KI7 B;  3WUT A;  3CXH D;  1RF1 C;  2P10 A;  2IBZ G;  4DT0 A;  1AVY A;  4JQ0 D;  2N9B A;  3RK3 E;  1N73 B;  3FWL A;  1NH4 A;  4K3A A;  5KKZ B;  2E5Y A;  1VF5 B;  1L0L E;  2I1J A;  2JEE A;  2C9L Y;  2WQY C;  1LT9 C;  3VMA A;  2NPS D;  4LC1 A;  1LT1 A;  2E76 D;  2K9J A;  1KFM A;  3P8C E;  4OGQ B;  2K88 A;  5AVU B;  1RF1 B;  1YHQ P;  1EDK A;  2O1J A;  3L75 E;  3IFM A;  1JTH B;  3USS A;  5CBO A;  3L70 E;  2WSE H;  1MFT A;  1SQB J;  3G71 P;  2OYI C;  4LGD E;  3RK3 B;  1NKN A;  1PPJ D;  2D2C C;  3E1R A;  4C7R A;  1ZR2 A;  5AW2 B;  3AE8 C;  3AED C;  4PD4 D;  2Y0C A;  2HPC A;  3PLN A;  1KB9 I;  4H0L C;  3E7K A;  3TGU G;  4A7P A;  3H1H J;  1T3U A;  1FDI A;  1KB9 H;  3V4Q A;  1PPJ E;  4B86 A;  2C0W A;  1MZ9 A;  1LGH B;  1PZQ A;  1EZV I;  3IN6 A;  3Q3D A;  1GL2 D;  5CMZ A;  1KIL B;  3SFD C;  5KAF H;  1J1D C;  1GU4 A;  1SQX G;  1FE6 A;  3S4R A;  1D7M A;  3A3Y B;  1OW8 A;  2WSF H;  4RKU J;  1JUN A;  1KN7 A;  1OVU A;  2E74 D;  1RE4 C;  3GMA A;  1NTK D;  3H6P A;  1NTM E;  1AVO A;  1GMJ A;  3PH0 A;  4DJG A;  2W90 A;  3BAT A;  1URQ D;  3HUS A;  2E75 D;  2FKW B;  2B89 A;  2OYO A;  3L35 A;  2WTY A;  1S5L H;  2V7Q J;  1UIX A;  2Z4E A;  2KLU A;  3AEA C;  3IAO A;  5E79 E;  2QG4 A;  4HH2 A;  3TNU A;  1VQ9 P;  2I1K A;  4L75 A;  5GTI E;  3MD0 A;  2QM8 A;  3A7O A;  4U3F D;  2OQQ A;  1KIL C;  2Q3I A;  3VP9 A;  3CLQ A;  1NU1 E;  2FYZ A;  1SQB G;  3AE1 C;  3QWO C;  4BXL A;  4Y99 B;  3KZI H;  3M9B A;  3H1J J;  4PV1 C;  1BSH A;  2WPR A;  5KJ7 D;  1NGM B;  1IK7 A;  1HJ0 A;  3AE3 C;  3LW5 J;  5AVW B;  3SSU A;  3CCV P;  2I8D A;  3B5N C;  4Z1M H;  2B87 B;  2N9Y B;  3L73 J;  4JBZ A;  3H1J E;  1SQX E;  2A06 D;  2D2C B;  2KOG A;  1GW4 A;  3H1J G;  3L74 G;  2BCC D;  1NTZ D;  2WPQ A;  2IYP A;  3M0D C;  2GA1 A;  2IFN A;  5B5E H;  5AVR B;  1SQX J;  1M56 D;  2XZR A;  3MTU E;  4WBA A;  1FZA A;  2YXQ B;  1LTJ B;  1PGJ A;  1G1I A;  1HH0 A;  1VQ8 P;  1FZC C;  4ASW A;  1FDM A;  3CL3 D;  3AE6 C;  1L4A B;  2FFD B;  2WSC J;  3M9Q A;  1FOS F;  3OA7 A;  5CHX A;  2HFE D;  3ABV C;  1JY3 N;  4H44 C;  1URQ B;  4UB8 H;  5APU A;  2V4H A;  2M0B A;  2XV5 A;  2OYH A;  1DEE G;  4IL6 X;  1X8Y A;  1GZL A;  1L2P A;  1AFO A;  4YPC A;  3CCJ P;  1S5L X;  1SQV D;  2OAR A;  1N7S B;  3Q2Y A;  1EDL A;  3P8M C;  4UB6 H;  1Q90 D;  1VDF A;  1JMM A;  1NTM D;  1LTI C;  2HOD A;  1L0L K;  5BU8 B;  2QJY B;  2OYH B;  3KXD A;  2GM4 A;  2JP3 A;  1BGY J;  1QGK B;  2IBZ E;  5H2F H;  5KAI E;  3T97 A;  3Q5P A;  4H13 D;  1A02 J;  3CCL P;  3CCR P;  1EZV D;  1QEX A;  2O1K A;  3L71 E;  3V2R A;  4BRY A;  1URQ C;  3L73 G;  3VOP A;  1KFN A;  3L73 E;  4WWI A;  4NPE A;  2WVR A;  1SQQ D;  3GF7 A;  4GKG A;  1XTG B;  3L72 J;  3F89 A;  1PL5 A;  3L71 J;  5KTB A;  3CX5 D;  3RK3 C;  1YIJ P;  2FFD C;  5AVQ B;  1HUC A;  3H1I D;  4WB4 A;  1KYO E;  1MV8 A;  3O6Q B;  5KLV K;  1JMB A;  2R32 A;  1M8O B;  2IFM A;  2KK7 A;  3L73 D;  5AW4 B;  3RK2 C;  5EFW B;  4DZO A;  4EYY Q;  4YXW H;  1K73 Q;  2KNC A;  1SFC A;  1R5L A;  1HJB A;  1SQQ K;  1YTZ I;  1ZP0 C;  3L70 D;  1OVV A;  1VF5 D;  1VQM P;  3MGN A;  3H32 A;  1P84 E;  4H0L D;  1VQL P;  1IC2 A;  3H1I G;  1SFC B;  1EDI A;  1WRG A;  1LP1 B;  2P58 A;  3D6Z A;  2WPV B;  1HWT C;  3RBX A;  1L0L D;  3AEE C;  2FY8 A;  2JDI H;  1NTM K;  1EXI A;  3CME P;  1P84 D;  2QJK C;  1ZLL A;  4AUW A;  1JTH A;  1JY3 O;  2Z5I A;  4OH8 B;  4PJ0 E;  4WY4 C;  1JY2 O;  3M9H A;  3MIW A;  4IOI H;  1FJP A;  3HRN A;  1VL2 A;  2OYH C;  3S9O A;  4UB8 E;  2QIW A;  2IYO A;  4H44 D;  5AW3 B;  1PP9 J;  1SQP G;  2BEQ D;  2J58 A;  1YBK A;  2MJZ A;  1GL2 B;  2W83 C;  1M1K Q;  1WMK A;  3AE9 C;  1SP4 A;  1K04 A;  2P1J A;  2XNX A;  1AQT A;  1M57 D;  1JCC A;  2AXT H;  2ZT9 B;  3A0H E;  4W80 A;  3WU2 E;  2OTK E;  4JF7 A;  3RL0 C;  4IL6 E;  2WZ7 A;  3GHG A;  1YQ4 C;  2ZFC A;  3CI9 A;  1OVR A;  1Q7Y Q;  4D6T J;  1Q81 Q;  3L72 D;  2ZAE B;  4IFM A;  1E79 H;  1NWQ A;  1N2D C;  1KIL E;  5APX A;  2DW3 A;  3FGA D;  2O01 N;  1SVF A;  1LTB C;  3H1I J;  1N86 A;  3PP5 A;  5KJ7 C;  4H0L B;  4PV1 D;  4D6T G;  2QA4 P;  1H0T B;  1EXJ A;  3AEC C;  4ZNC A;  2BAS A;  1H8A A;  1IFJ A;  4HKZ H;  5CCH A;  1FJK A;  1DEB A;  1N7S C;  2FBW C;  5KLI C;  5GTH E;  1L0N E;  1KIL D;  3CWB E;  3I56 P;  1FAV A;  2MKV A;  2WSF J;  3OW2 O;  1VQP P;  2POH A;  1SQP E;  3SWF A;  1MFZ A;  1PV3 A;  2WSC H;  1KC8 Q;  1G2C B;  1N73 C;  2YKP A;  2PRR A;  4BWN A;  1IK9 A;  2NPS A;  4N78 D;  5DJU B;  2Q7C A;  1PFI A;  1PP9 G;  1OIP A;  1SQP J;  2AEJ A;  1PP9 E;  2E75 B;  3C9I A;  3TNU B;  4H44 B;  3CX5 I;  5AW0 B;  1JNM A;  5CCG A;  3CD6 P;  3KDP B;  2Q5U A;  2HYN A;  1NHL A;  3L75 D;  3W67 A;  1FC2 C;  3C1L A;  1R8E A;  1S72 P;  1JCD A;  2FYU D;  1L0L G;  2N1T B;  2W6B A;  3HD7 C;  2E43 A;  5CCH D;  1QVF O;  1EC5 A;  1YTZ T;  1Z56 A;  2M5A A;  2A45 G;  1RF0 C;  2FYN B;  5BVZ A;  2CPS A;  2YO2 A;  3CC4 P;  3MUD C;  3L71 G;  2B87 A;  1Y9B A;  4D6T E;  1JB0 J;  2FYU G;  3VMY A;  3WUU A;  1KQL A;  1FBM A;  2H43 A;  1NYH A;  3PTZ A;  2YNY A;  4R4M A;  5AVT B;  4JYB A;  1YJN P;  2P7J A;  1Y47 A;  1BCC J;  2YXR B;  4Y99 C;  4PD4 H;  5KLV G;  1QL1 A;  1YJ9 P;  2RH0 A;  2WWW A;  3P32 A;  5TIS E;  4PD4 I;  4ZKU A;  1WT6 A;  2HR3 A;  3G4S P;  3CCE P;  2XDJ A;  1SQQ E;  3HD7 D;  3FXD A;  4YTP C;  2RKL A;  2NPS C;  1TU3 F;  3CXH E;  1ZRT E;  5AW9 B;  4U3F J;  3KQG A;  4Y28 J;  1SQX D;  2A06 E;  3A0B H;  4RJT A;  4HYT B;  3VMZ A;  4IFD K;  2KS1 B;  1LWU C;  1NTM G;  4GOE A;  5AVZ B;  3R4Y A;  4U3F E;  4NPF X;  1S9K E;  1T3J A;  2W27 A;  1LNQ A;  2H8P D;  1KQS O;  3GG2 A;  1LTT C;  3G9R A;  3KZI E;  5B66 H;  1N7S D;  1K9M Q;  1VQ6 P;  1DD3 A;  2N1T C;  3HD7 B;  5GTI H;  3GW6 A;  2E5T A;  1LTA C;  3NMD A;  1IFP A;  1GD2 E;  2QVA A;  3GHG C;  3H1K D;  2SPZ A;  4XA4 A;  3BCC D;  3V6I A;  4CPG A;  1SFC C;  2JR8 A;  3GLM A;  3V2P A;  2M8R A;  1ZOY C;  2QE7 H;  1SFC D;  1IZN B;  2BCC G;  2L5G B;  4R4L A;  2YMK A;  2RN0 A;  1RQV A;  1VPC A;  2WT7 B;  2E76 B;  2ZYA A;  3JC2 2;  2G3A A;  1L4A A;  4OGQ D;  3RL0 D;  1HBW A;  3CMA P;  4GOD A;  3JSV C;  1J1E B;  2OYI B;  1PGP A;  3B8E B;  3TK1 A;  1NTZ K;  2WT7 A;  1ZR4 A;  1H89 A;  1SQB E;  1NAF A;  2IBZ D;  4WY4 A;  3VN0 A;  1FZB A;  4BRY B;  4ZMD A;  2O01 H;  2LXB A;  1SQV J;  2YKO A;  3AEF C;  5TJH A;  1MKM A;  5APQ A;  1BDD A;  3P7K A;  2BEZ F;  5AW7 B;  1Q82 Q;  3A5T A;  2O3J A;  1SQB D;  1K05 A;  1SQV E;  3CCM P;  2IPP A;  1J1E C;  2IX7 C;  2HOD B;  2ZT9 D;  3AE4 C;  3N4X A;  1BGY D;  2P67 A;  2PP6 A;  3EQ2 A;  4WY4 D;  2CPB A;  3KYQ A;  5AVS B;  1KQG B;  4EOT A;  1QX8 A;  4WVZ A;  1IFI A;  1LTG C;  3QH9 A;  1RE4 A;  2YKQ A;  1JY2 N;  1AV1 A;  1RHZ B;  1JEK A;  4U7J A;  5AW5 B;  4UB6 E;  1L0L J;  3D71 A;  1LT9 B;  1FS0 E;  1VF5 C;  2E42 A;  1IFN A;  1NTK K;  3NTN A;  2XKM A;  1G2C A;  4HJG H;  2ITA A;  4PV1 B;  1L4A C;  1NU1 G;  4O9B A;  2R44 A;  1BE3 D;  1YQ3 C;  1XTC C;  2KIK A;  2PFX A;  2XND H;  3E1I A;  1KZU B;  3JCU H;  3L70 J;  2H89 C;  3AE2 C;  5CCH C;  1N7S A;  2JO1 A;  4RES B;  4TLF A;  2B9B A;  3RK3 D;  3H1K E;  2OYI A;  1NU1 J;  4L73 A;  1BCC G;  1S5L E;  1S3J A;  2FYU E;  3BCC G;  2YIU C;  2RMZ A;  1G1J A;  1BE3 E;  3L70 G;  3R2P A;  3CX5 H;  1BE3 G;  5CJ4 A;  5KLI B;  1GK4 A;  1N73 A;  3B5N B;  1NVO A;  1LWU A;  4MN4 C;  3Q1M A;  3EFG A;  3EFF K;  3HUS B;  2QJK B;  1JY3 P;  2UWJ E;  3MP7 B;  4KT0 J;  3RL0 g;  4ZKP A;  3CC7 P;  1M1J B;  1T6A A;  4I7Z C;  1KB9 D;  4C7N B;  1PP9 D;  3VTP C;  3PRJ A;  2N1T A;  2H7H A;  4EI2 A;  1CSB A;  4TT3 H;  1E5W A;  1T8Z A;  1NO4 A;  2C0X A;  1RF0 A;  3L74 D;  2PGD A;  1USE A;  1YIT P;  3TSI A;  1T2K D;  3D70 A;  3OJA B;  1KB9 E;  3MUD A;  1W2E A;  4L76 A;  1YJW P;  1CW5 A;  4HB1 A;  2LKM A;  1FZF A;  1N7L A;  2AXC A;  2Z5H A;  2A06 G;  2QJY C;  2AXT E;  3AEG C;  1ZRT D;  4LLH A;  1X22 A;  2IZ0 A;  1OWA A;  1EZV E;  1HGZ A;  1SS1 A;  1U7M A;  3A0B E;  1OMI A;  2YIU B;  3H1L D;  3L75 G;  2KSJ A;  4GDO A;  1KIL A;  3U59 A;  3N7N A;  1OZH A;  2QSI A;  1GL2 A;  1KYO I;  2BCC J;  2WSS H;  4DOJ A;  5B5E E;  4JPZ B;  4AYC A;  3L75 J;  4XFJ A;  1GU5 A;  1KYO H;  1S4X A;  1OW7 A;  4L74 A;  1KQF B;  2KUB A;  2FYU J;  3H1L E;  1NAY A;  3H1L G;  3IF4 A;  3L37 A;  1BE3 J;  2BCC E;  3LIE A;  4NPD A;  2W6A A;  5DJT B;  5E79 H;  5BU5 A;  1N8R Q;  1A02 F;  5KLV E;  2K1A A;  3B5N A;  1S1C X;  5KLV J;  1ZW0 A;  2A45 H;  1NU1 D;  3BRT B;  3O8Z A;  1L0N D;  3CWB D;  1VQ5 P;  1K8A Q;  3O6Q A;  2Q3E A;  1NKZ B;  3TGU D;  1FZE A;  1ZXG A;  2HG5 D;  3AE5 C;  1IO4 A;  4EIJ A;  3FX0 A;  3TYY A;  1HTL C;  1S2E A;  1FZC A;  1BCC D;  4DCK A;  1GK6 A;  1PPJ G;  2JWA A;  4U3F G;  3H1I E;  5APY A;  3H32 B;  1SQX K;  2W8Z A;  2LXC B;  1NTM J;  3RBZ A;  5KKZ C;  2E75 C;  3M0A A;  4JYC A;  3RL0 B;  2CK3 H;  3F5H A;  4RO0 A;  3S1K A;  3VP8 A;  1LTJ C;  1PGO A;  3WUV A;  1PIX A;  3RK2 D;  1IFM A;  4C7N A;  1DH3 A;  1X79 B;  5APW A;  2P2U A;  3V5B A;  3HTK A;  5AW6 B;  1DD4 A;  1LJ2 A;  4XE5 B;  5AVX B;  2K9J B;  1M90 Q;  5KAF E;  1LWU B;  1QLE D;  3VYI A;  1BGY E;  1GTW A;  3L71 D;  3LID A;  1OXZ A;  1NTK G;  1Q86 Q;  2GUV A;  1NTK E;  1VQ4 P;  2KB7 P;  1U7J A;  3B71 A;  3H1L J;  2NPS B;  2ZXE B;  4H13 C;  3T97 B;  1MUU A;  4W7Y A;  2KNC B;  4I1L A;  1URQ A;  3MZW B;  3L72 E;  1JO5 A;  1RY3 A;  1Q2N A;  1NTK J;  3BCC J;  5CBN A;  1KV4 A;  1KYO D;  2FXM A;  1EQ7 A;  3WMM 0;  4AQR D;  3HE5 B;  3L36 A;  1RF1 A;  2FYU K;  1T2K C;  3FWN A;  4M3L A;  1J1D B;  5AVV B;  3SFE C;  3Q5S A;  3BCC E;  3PHL A;  2M3E A;  2NZ2 A;  3A2A A;  3CC2 P;  2ZT9 C;  3HE5 A;  3HE4 B;  1L0N K;  3OAK A;  1SQV G;  1AQ5 A;  1EDJ A;  2JKV A;  2XU6 A;  1NOH A;  2FXO A;  3P8C D;  2IBZ I;  2ZVN B;  4PJ0 H;  3CCU P;  5K5G B;  1AA0 A;  2KXP B;  1JY2 P;  1LT9 A;  2KSE A;  2Y0E A;  3SWY A;  3TGU J;  3V2N A;  1LTJ A;  3CX5 E;  5KJ7 A;  4QMA A;  4N78 E;  3RGU A;  3H1J D;  1FDO A;  1QL2 A;  3U1C A;  2M3B A;  1GDT A;  3GHG B;  3TGU E;  1IJD B;  1VQO P;  1OX3 A;  2R5D A;  1RQU A;  1BDC A;  1IFD A;  4KHX A;  5APS A;  1YYC A;  2E74 B;  2H88 C;  1QVG O;  5L8R J;  2QJP C;  1JM0 A;  1H88 A;  2JWD A;  1FU1 A;  4K35 A;  4GT1 A;  1LTS C;  1M7L A;  1P84 H;  3SWK A;  1H0T A;  1X9V A;  3B5N D;  5APV A;  4GOF A;  2J5U A;  3CCQ P;  1DX7 A;  1ZN5 A;  1P84 I;  3ITK A;  2QEX P;  5CJ0 A;  5CCG C;  4D6T D;  2V7Q H;  2R5B A;  1FZG A;  3G6E P;  3H25 A;  1FZC B;  3BVH A;  2PAJ A;  3CPW O;  1W2B O;  2FYN C;  1W5C E;  2N1T D;  2YO3 A;  3M06 A;  4N6J A;  4PD4 E;  2HPC B;  1EZV G;  1PGQ A;  1RE3 C;  2G8Y A;  3G3Z A;  3BAS A;  3UIA A;  5H2F E;  5KAI H;  5TIS H;  5AVY B;  1GW3 A;  2O01 J;  1NTZ J;  1R5S A;  3KPE A;  3NXS A;  1CI6 B;  3VMX A;  3CXH I;  3I55 P;  2Q9I A;  1HF9 A;  2GUS A;  2KZJ A;  3LW5 H;  4N3Y B;  4W7Z A;  2KS1 A;  2Y9Y A;  5AW1 B;  3M91 A;  2K37 A;  3TF5 A;  1J2J B;  1NTZ G;  1UII A;  4OWF A;  2ZYD A;  5C39 A;  1ZME C;  2QJP B;  2QRX A;  2C9N Y;  2NRG A;  2E74 C;  2WIT A;  1SQQ G;  2KZI A;  1SQP D;  1FOS E;  2Q6Q A;  2B88 A;  1VQN P;  2OTJ P;  2FFD A;  2Y0D A;  4IL6 H;  2WPS A;  5AW8 B;  2ZJS E;  1S9K D;  1GL2 C;  2QM7 A;  2VRS A;  3L74 E;  3V4W A;  3WU2 H;  1L4A D;  2KLV A;  1AJY A;  1SQQ J;  1ZV8 A;  1LP1 A;  1KMI Z;  3K5B A;  1CZQ A;  2HLO A;  2AEM A;  1DIP A;  1KOR A;  4GIF A;  1JOC A;  2KYV A;  2LR2 A;  2ZYG A;  5KLV D;  3TDK A;  2Q1K A;  3IR9 A;  2WMM A;  3FXE A;  2D2C D;  2Y9Z A;  2FXP A;  1NJI Q;  3C8V A;  3HD7 A;  3EWK A;  1RE3 A;  1SQP K;  2R3S A;  2ZVO B;  2WSE J;  3U1A A;  3BRV B;  1M1J C;  4I7Z B;  1BSN A;  1KTM A;  4IFF A;  3ZDM A;  1U57 A;  2E76 C;  3AE7 C;  1NU1 K;  1NTZ E;  4C46 A;  3I5C A;  1HVV A;  1CI6 A;  1SQB K;  2W6J H;  3HUS C;  1BGY G;  4H13 B;  4I6M C;  2AEF A;  3D6Y A;  1OW6 A;  3CXH H;  3RK2 B;  1BCC E;  2J59 M;  3PJS K;  2IZ1 A;  4KJM A;  2L91 A;  3A0H H;  3CCS P;  1KD1 Q;  4YXD C;  3H1K J;  3NFQ A;  3L72 G;  2JJL A;  1L0N G;  1USD A;  1SQV K;  3CWB G;  3H1H D;  1RH5 B;  3B4S A;  4OGQ C;  3HTK B;  2K9Y A;  2R3C A;  4I2L C;  1OFC X;  3L74 J;  3H1K G;  5B66 E;  4ASV A;  3V2Q A;  2OTL P;  1L0N J;  3CWB J;  3W68 A;  5CCG D;  1VQK P;  3H1H E;  3GF3 A;  3MHV A;  3H1H G; 
#chains in the Genus database with same CATH homology
 3HE4 A;  3M0D A;  2YMY A;  3II6 A;  3L4F A;  2KP8 A;  2FFD A;  1SLQ A;  4WY4 B;  2A45 I;  5APT A;  1M1J A;  1HGV A;  1RF1 C;  2N9B A;  1NH4 A;  2I1J A;  2JEE A;  2C9L Y;  1LT9 C;  2NPS D;  4LC1 A;  1KFM A;  3P8C E;  5AVU B;  1RF1 B;  2O1J A;  3IFM A;  1JTH B;  2WSE H;  2OYI C;  4LGD E;  3RK3 B;  1NKN A;  1ZR2 A;  4C7R A;  5AW2 B;  1T3U A;  3V4Q A;  4B86 A;  2C0W A;  1MZ9 A;  1LGH B;  1GL2 D;  5CMZ A;  1KIL B;  1GU4 A;  1J1D C;  3A3Y B;  1JUN A;  2WSF H;  1RE4 C;  2HPC A;  3H6P A;  3BAT A;  1URQ D;  3HUS A;  2FKW B;  3L35 A;  2WTY A;  2Z4E A;  4HH2 A;  3TNU A;  2I1K A;  3MD0 A;  2QM8 A;  3A7O A;  3VP9 A;  1KIL C;  2Q3I A;  3CLQ A;  2FYZ A;  4Y99 B;  3M9B A;  2WPR A;  5KJ7 D;  5AVW B;  3B5N C;  2KOG A;  3M0D C;  1GW4 A;  2WPQ A;  2IFN A;  5AVR B;  2XZR A;  3MTU E;  4WBA A;  1FZA A;  1LTJ B;  1G1I A;  1HH0 A;  1FZC C;  3CL3 D;  2FFD B;  1L4A B;  1FOS F;  3M9Q A;  3OA7 A;  5CHX A;  2HFE D;  1JY3 N;  1URQ B;  5APU A;  2XV5 A;  1X8Y A;  1GZL A;  1AFO A;  2OAR A;  1N7S B;  1VDF A;  1JMM A;  5BU8 B;  1LTI C;  2HOD A;  1L0L K;  2OYH B;  2GM4 A;  3T97 A;  1A02 J;  2O1K A;  3V2R A;  1URQ C;  3VOP A;  1KFN A;  4GKG A;  1XTG B;  5KTB A;  2FFD C;  3RK3 C;  5AVQ B;  1HUC A;  4WB4 A;  1MV8 A;  5KLV K;  1H88 A;  2R32 A;  2IFM A;  3RK2 C;  5AW4 B;  4DZO A;  1SFC A;  1HJB A;  1SQQ K;  1YTZ I;  3MGN A;  3H32 A;  1IC2 A;  1SFC B;  1WRG A;  1HWT C;  1NTM K;  1ZLL A;  4AUW A;  1JTH A;  1JY3 O;  2Z5I A;  4OH8 B;  4WY4 C;  1FJP A;  1JY2 O;  3M9H A;  3MIW A;  3HRN A;  5AW3 B;  2J58 A;  2MJZ A;  1GL2 B;  1SP4 A;  2P1J A;  2XNX A;  4W80 A;  1JCC A;  4JF7 A;  3RL0 C;  2WZ7 A;  3GHG A;  2ZFC A;  3CI9 A;  4IFM A;  1NWQ A;  1N2D C;  5APX A;  1N73 B;  1T2K C;  1SVF A;  1LTB C;  5KJ7 C;  1N86 A;  3PP5 A;  2BAS A;  1H8A A;  1IFJ A;  5CCH A;  1FJK A;  1DEB A;  1N7S C;  1FDM A;  1KIL D;  1FAV A;  2POH A;  3SWF A;  1MFZ A;  2WSC H;  1G2C B;  1N73 C;  2YKP A;  1IK9 A;  2NPS A;  4N78 D;  2Q7C A;  1PFI A;  3TNU B;  3C9I A;  5AW0 B;  5CCG A;  3KDP B;  2Q5U A;  2HYN A;  1NHL A;  1JNM A;  2H43 A;  2OYH C;  1JCD A;  2N1T B;  3HD7 C;  2E43 A;  2W6B A;  5CCH D;  1YTZ T;  1Z56 A;  2A45 G;  1RF0 C;  5BVZ A;  2CPS A;  2YO2 A;  3VMY A;  1KQL A;  1FBM A;  5AVT B;  2YNY A;  4JYB A;  2P7J A;  4Y99 C;  1QL1 A;  3P32 A;  2WWW A;  4ZKU A;  1WT6 A;  2XDJ A;  3HD7 D;  2NPS C;  5AW9 B;  3KQG A;  4HYT B;  3VMZ A;  4IFD K;  1LWU C;  5AVZ B;  1S9K E;  1T3J A;  2W27 A;  2H8P D;  1LTT C;  1N7S D;  2N1T C;  3HD7 B;  1GD2 E;  3NMD A;  1LTA C;  3GHG C;  4XA4 A;  1SFC C;  3V2P A;  2M8R A;  1SFC D;  2L5G B;  1VPC A;  2WT7 B;  1HBW A;  3RL0 D;  1L4A A;  1J1E B;  2OYI B;  3B8E B;  3TK1 A;  1NTZ K;  2WT7 A;  1ZR4 A;  1H89 A;  1NAF A;  4WY4 A;  3VN0 A;  1FZB A;  2O01 H;  2YKO A;  5APQ A;  3P7K A;  5AW7 B;  3A5T A;  2IPP A;  1J1E C;  2IX7 C;  2HOD B;  3N4X A;  4WY4 D;  2OYH A;  2P67 A;  2PP6 A;  3EQ2 A;  2CPB A;  3KYQ A;  5AVS B;  4EOT A;  1IFI A;  1LTG C;  1RE4 A;  2YKQ A;  1JY2 N;  5AW5 B;  1LT9 B;  2E42 A;  1IFN A;  1NTK K;  3NTN A;  2XKM A;  1G2C A;  1L4A C;  4O9B A;  1AQ5 A;  3E1I A;  1XTC C;  1KZU B;  5CCH C;  1N7S A;  3RK3 D;  4RES B;  2OYI A;  3R2P A;  1G1J A;  5CJ4 A;  1GK4 A;  1N73 A;  3B5N B;  1LWU A;  3EFG A;  3HUS B;  1JY3 P;  4ZKP A;  1M1J B;  4C7N B;  3VTP C;  2N1T A;  2H7H A;  1CSB A;  1E5W A;  1T8Z A;  1NO4 A;  2C0X A;  1RF0 A;  1T2K D;  3OJA B;  3MUD A;  1W2E A;  1CW5 A;  2LKM A;  1FZF A;  1N7L A;  2Z5H A;  3U1C A;  4LLH A;  1OWA A;  3P8M C;  1HGZ A;  3TSI A;  2KSJ A;  1KIL A;  3U59 A;  3N7N A;  1GL2 A;  4DOJ A;  4AYC A;  1GU5 A;  3LIE A;  3L37 A;  1A02 F;  2W6A A;  5BU5 A;  3B5N A;  2A45 H;  3BRT B;  3O8Z A;  1NKZ B;  1FZE A;  2HG5 D;  1IO4 A;  4EIJ A;  3TYY A;  1HTL C;  1FZC A;  1GK6 A;  5APY A;  3H32 B;  1SQX K;  3M0A A;  4JYC A;  3RL0 B;  3VP8 A;  1LTJ C;  3RK2 D;  1IFM A;  4C7N A;  1DH3 A;  1X79 B;  5APW A;  2P2U A;  3V5B A;  3HTK A;  5AW6 B;  4XE5 B;  5AVX B;  1LWU B;  3VYI A;  1GTW A;  3LID A;  1OXZ A;  2GUV A;  2KB7 P;  2NPS B;  2ZXE B;  1MUU A;  4W7Y A;  4I1L A;  1URQ A;  1JO5 A;  1RY3 A;  2FXM A;  1EQ7 A;  3WMM 0;  4AQR D;  3HE5 B;  3L36 A;  1RF1 A;  2FYU K;  4M3L A;  1J1D B;  5AVV B;  3A2A A;  3HE5 A;  3HE4 B;  1L0N K;  3OAK A;  2XU6 A;  1NOH A;  3P8C D;  1JY2 P;  1LT9 A;  3SWY A;  5KJ7 A;  3V2N A;  1LTJ A;  4N78 E;  1QL2 A;  2M3B A;  1GDT A;  3GHG B;  1IJD B;  2R5D A;  1IFD A;  4KHX A;  5APS A;  1YYC A;  1FU1 A;  4GT1 A;  1LTS C;  1M7L A;  1X9V A;  3B5N D;  5APV A;  1DX7 A;  1ZN5 A;  5CJ0 A;  5CCG C;  1FZG A;  2R5B A;  1FZC B;  3BVH A;  2PAJ A;  2N1T D;  3M06 A;  2YO3 A;  4N6J A;  2HPC B;  3G3Z A;  1RE3 C;  3UIA A;  3BAS A;  5AVY B;  1GW3 A;  3KPE A;  3VMX A;  3NXS A;  2Q9I A;  1CI6 B;  2GUS A;  3LW5 H;  4N3Y B;  4W7Z A;  5AW1 B;  3M91 A;  1J2J B;  2C9N Y;  2WIT A;  1FOS E;  2WPS A;  5AW8 B;  1S9K D;  1GL2 C;  2QM7 A;  2VRS A;  3V4W A;  1L4A D;  2KLV A;  1ZV8 A;  1CZQ A;  2HLO A;  4GIF A;  1JOC A;  2KYV A;  3IR9 A;  3HD7 A;  1RE3 A;  1SQP K;  3U1A A;  3BRV B;  1M1J C;  4IFF A;  1NU1 K;  4C46 A;  3I5C A;  1HVV A;  1CI6 A;  1SQB K;  3HUS C;  4I6M C;  3RK2 B;  2J59 M;  3NFQ A;  2JJL A;  1SQV K;  3HTK B;  2R3C A;  4I2L C;  3V2Q A;  5CCG D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...