2JEEA

Xray structure of e. coli yiiu
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
78
structure length
78
Chain Sequence
b'MSLEVFEKLEAKVQQAIDTITLLQMEIEELKEKNNSLSQEVQNAQHQREELERENNHLKEQQNGWQERLQALLGRMEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN ZAPB
publication title Novel Coiled-Coil Cell Division Factor Zapb Stimulates Z Ring Assembly and Cell Division.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle
total genus 30
structure length 78
sequence length 78
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06005 ZapB Cell division protein ZapB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2jeeA00
3VP8A 3C9IA 4ZKUA 1X79B 2POHA 1WT6A 3OJAB 4I1LA 3N4XA 3N7NA 4O9BA 1NKNA 2JEEA 3BASA 4N78D 4ZKPA 5BU5A 5BVZA 3P8CD 4GIFA 1IC2A 4N3YB 5KTBA 3VP9A 3U1AA 3U1CA 3HRNA 2FXMA 5BU8B 3U59A 3BATA
chains in the Genus database with same CATH superfamily
4GODA 2I8DA 1PPJE 1NTKK 2BCCJ 1NGMB 4EI2A 1P84I 5AVVB 1FZGA 3O6QA 3B5NA 2C9NY 3WU2E 3L71G 3C1LA 5APTA 4ZKUA 2BCCG 3SFDC 1IZNB 4OGQC 1ZN5A 3RK2C 1SQXD 2HFED 3VMYA 1QL2A 2KP8A 1RQVA 3G9RA 1G1JA 2J59M 3JCUE 2OGUA 3A0BE 3IAOA 5KJ7A 3H1IE 1HGZA 2HG5D 3D71A 1MV8A 3H25A 1KQSO 3RBZA 1M1JB 2OQQA 1LTIC 5AW0B 3CC4P 4RESB 2UWJE 2Q3IA 3HUSA 1VQ8P 3VMXA 1N7SA 2PFXA 1NVOA 1JO5A 4WY4A 5GTHE 1X79B 2QJKC 1T2KC 2Q1KA 2WWWA 2NZ2A 1WMKA 5GTIE 3V6IA 3UIAA 1KB9D 3BATA 3M0AA 2Q9IA 3C9IA 4YXWH 1T3JA 1LWUA 2M0BA 2QM7A 2ZT9B 3TGUD 3R2PA 4WVZA 2OTKE 2RMZA 2IBZE 2NPSB 1VQLP 4NPFX 1KZUB 1NU1J 3AECC 1L0LK 1LTTC 1N73B 1VQKP 3O8ZA 3HD7B 3IF4A 3MTUE 1IO4A 4DJGA 1YHQP 3L74J 2OYHA 4I6MC 1Q2NA 3BVHA 1JTHA 4BXLA 3II6A 1NU1G 1GK4A 2XZRA 1LP1A 1U7JA 1FC2C 3WU2H 1LT1A 2ZVOB 3L74G 4WBAA 1EXJA 1DH3A 2FYNB 2WSCJ 4I7ZB 2K9JA 4AYCA 4IL6X 3VTPC 1KN7A 3JCUH 3A0BH 3L70D 4AQRD 1S9KE 2K37A 1RHZB 1YITP 2IYOA 1PP9D 2OYIB 1NKNA 2FKWB 3FWLA 3M0DC 1OIPA 5KKZC 4XE5B 2GUVA 5APYA 5CHXA 1CW5A 1W2BO 5APXA 1PFIA 3RL0g 1L4AD 3S1KA 5GTHH 5TISE 3CMEP 3P8CE 2CK3H 3CCSP 1R5LA 2ZT9C 1AA0A 1WRGA 5AVUB 3GHGB 1SFCD 4TT3H 5GTIH 1XTCC 1J1EB 2JWDA 4JYBA 1AJYA 3CCQP 1N73C 1KD1Q 1PPJG 3HD7C 1U57A 1OW7A 1QVFO 1YI2P 1JNMA 1NAYA 2QA4P 2P58A 1LNQA 1AQ5A 3GLMA 1VF5D 2M3BA 2Y0DA 2WSSH 4H0LC 2FYNC 2KXPB 2WT7A 1KFNA 3CX5I 3PTZA 5CCGC 1SQQK 4I7ZC 1Y9BA 3VOPA 3EFGA 1JEKA 1Q90D 1YTZI 1OXZA 2Q5UA 4ZKPA 1G1IA 3T97B 1SQBD 3NMDA 1RF1C 1EZVI 2Y9YA 3L73E 1GK6A 1EZVG 5APVA 4U3FE 5H2FE 2L91A 1HVVA 1MKMA 4JPZB 2QIWA 1FDMA 1NTMD 1NOHA 1OW8A 1M1JA 4GIFA 1KTMA 1KORA 4JBZA 2FXMA 1VQ6P 1NYHA 4PD4I 1PV3A 3N4XA 3GHGC 3H32B 4O9BA 2IFMA 3BASA 1HF9A 1SQBE 1KYOE 3L36A 1LT9B 1PGJA 1J1EC 3M0DA 5TISH 3MP7B 3TDKA 1X0TA 2IBZI 1NTZK 2HR3A 2IBZG 1BGYJ 2QSIA 3B8EB 3JSVC 2W83C 5CCHD 1NTME 3PHLA 3S9OA 4RO0A 2KZJA 1SQPE 5CBNA 2CPSA 1U7MA 1BGYG 4MN4C 2NPSA 2AEFA 1L4AB 2FYUE 2IPPA 2N9BA 3V2QA 2JDIH 3CCUP 1N73A 3NXSA 3B71A 1N86A 3GF7A 3HD7A 2QRXA 1URQD 2IZ1A 2LR2A 1VQPP 5AW9B 1SFCB 4C7NB 3B5NC 4DZOA 1VQOP 2BEZF 3AEBC 1L2PA 1SQVJ 2G3AA 4EYYQ 3Q5SA 1QLED 1RE4C 3AEDC 2Q6QA 3KPEA 2KNCA 1CZQA 3CLQA 1M7LA 1TU3F 2M5AB 3HRNA 5CCGA 2R5DA 1DIPA 1S3JA 3AEAC 1SLQA 1SQVG 1JUNA 5H2FH 3NFQA 2D2CD 4HB1A 1VF5B 4L75A 1RY3A 3KYQA 1OX3A 3Q1MA 1M8OB 2OYIA 3HE4B 2AEMA 3MGNA 1RF1A 1HH0A 4PJ0E 1N7SC 3I5CA 2LKMA 3V4QA 3SWYA 1LT9C 2O01J 1MZ9A 4HYTB 2ZYGA 3VP8A 1S1CX 1GW4A 1NTKD 4I1LA 2E74D 5DJTB 3NTNA 1HWTC 3CCJP 3OA7A 3MHVA 3VP9A 1KYOH 2HYNA 1L0ND 3RGUA 2A45H 4BWNA 3CXHI 1NO4A 3WMM0 4YPCA 5KLVE 1E5WA 3GHGA 4L76A 2H88C 4GT1A 2OARA 1IFDA 1NU1K 4RJTA 4BRYB 2JJLA 3V2NA 2R3CA 4H44D 4DCKA 1FS0E 1GL2B 2PP6A 3RK3E 1SFCC 1NTKE 3MIWA 3L73J 4U3FJ 3MD0A 2QJYB 4GOFA 1BDDA 2P67A 1GU5A 4EDFA 2LXBA 3L73G 3ITKA 3PRJA 4U3FG 3G6EP 3N7NA 4NPEA 1KV4A 3BCCE 2A06D 3M9HA 3ABVC 3G3ZA 2BEQD 3BRVB 3L75D 1Z56A 2FFDB 3H1JD 3T97A 1L0NK 1CI6B 5AW3B 4PV1D 1ZR2A 3KXDA 1S4XA 1URQB 1YTZT 1FOSE 1RE4A 3EQ2A 4L73A 4W80A 3GMAA 2GUSA 4B86A 1KYOI 1BE3D 1IFNA 4GKGA 1QL1A 1BDCA 4PJ0H 1L0LD 1SQPJ 1WT6A 1IFMA 2A06E 1EDLA 2XV5A 1IK9A 3FX0A 2XU6A 2GM4A 2FYUJ 1AV1A 3M06A 2ZXEB 3H32A 3G4SP 1M56D 1SQPG 1LT9A 2D2CB 2WZ7A 4Y28J 3V2RA 1SQXE 2PAJA 2QE7H 3V2PA 2FYUG 3FWNA 1GL2C 2JKVA 3H1LD 2N9YB 1BE3E 1KQLA 1L0LE 2QJYC 5BU8B 3RK3B 2E74B 3PH0A 2KI7B 2HODB 2KS1B 3CWBJ 5DJUB 5BU5A 3CCMP 1R8EA 1JCCA 2KSJA 2IX7C 1EDIA 1IJDB 3LW5H 3TF5A 3GW6A 4W7YA 1Y47A 3D6ZA 4NPDA 1SFCA 1YIJP 4C7NA 2YIUB 3WUTA 3CWBG 2L5GB 2QJPB 4ZMDA 2WSFH 1DEEG 5AVYB 3H1LE 5AW5B 1H88A 2ZYDA 2O1KA 4H44B 5TJHA 3K5BA 3B4SA 1KB9E 1W2EA 2M5AA 4N6JA 1LTSC 3TGUE 2WMMA 1VL2A 3KHUA 1GMJA 4H13D 5KJ7D 1HTLC 5KLVJ 4Z1MH 1M1JC 1T3UA 4OWFA 3H1HJ 4DOJA 2XKMA 1XTGB 3HE4A 1GTWA 1BCCD 5AW8B 2WVRA 1J1DB 2KK7A 3LIDA 2YMKA 5KLVG 2N1TD 3H1HG 2E75D 4W7ZA 4WY4D 1USEA 1ZOYC 3LW5J 1SQQD 2W6BA 2KLUA 1FBMA 2OYOA 1KQFB 3A5TA 3OAKA 3RK3C 2WSFJ 2E74C 1Q81Q 2KUBA 1EDKA 1K9MQ 2QM8A 1BCCE 3BCCJ 3L70E 3A2AA 1EQ7A 3A7OA 3PP5A 1PP9E 2NPSC 4D6TD 4IFMA 1ZLLA 2KYVA 4KT0J 1GL2A 2WPQA 3GF3A 3MZWB 2YIUC 2I1JA 1FOSF 4IOIH 3CC2P 4EIJA 1PGOA 3BCCG 1NJIQ 1CSBA 4AUWA 1SQQE 1SQVK 4R4LA 1S5LE 3F5HA 5CCHA 3H1IJ 3RL0D 4JYCA 1FAVA 3AE8C 1PGPA 2M3EA 3AE1C 2P2UA 3A3YB 1IFJA 1NTZD 3U1AA 1VQNP 2WQYC 2I1KA 3H1IG 4D6TE 1KB9H 3VYIA 1P84D 1CI6A 5AVQB 4GOEA 2W90A 2XNDH 1J1DC 1HJ0A 2H43A 1SQXJ 3EFFK 4K35A 3L71D 1FZBA 2OYIC 1MUUA 2Q7CA 3E7KA 2BCCD 1EC5A 5CBOA 4ZNCA 3RK2D 1GU4A 1MFZA 1L0LJ 3CMAP 3Q5PA 1LGHB 1SQXG 2C0XA 1DEBA 2Y0CA 4GDOA 1NTZE 4C7RA 4EOTA 4LGDE 3U59A 4YXDC 2H8PD 1L0LG 2POHA 4H13B 4RKUJ 1KFMA 2AEJA 1S72P 2V4HA 2YKPA 1Q7YQ 1LTAC 2BCCE 1YJWP 1HUCA 4R4MA 1UIIA 2PRRA 1NWQA 3MUDC 5APUA 3R4YA 3LIEA 1JM0A 2N1TB 4YTPC 5AVWB 2J5UA 5M1BA 1YYCA 2HODA 2O1JA 1FDOA 2KS1A 1K04A 3TGUJ 4WWIA 4XA4A 2R3SA 3TSIA 4IFDK 1FJKA 2P7JA 2QEXP 1KB9I 5B5EE 1JY2P 1S5LH 1YQ4C 1LTBC 1VQ5P 3P8MC 2FBWC 3TGUG 4HKZH 4K3AA 1SVFA 3VN0A 3CI9A 2FY8A 1GDTA 2IZ0A 3BRTB 1NU1D 1SQPK 2V7QH 1JOCA 1FZCB 1N7LA 3L74D 3RL0B 5KLIB 2FYUK 5K5GB 1VQ4P 1S2EA 3L70J 1JY2O 5AVZB 2Z5IA 4JQ0D 2ZFCA 1PP9J 2QVAA 1VQ9P 2YKOA 4H13C 1LP1B 2IYPA 1M1KQ 2VRSA 3CL3D 2C0WA 1SS1A 2YKQA 3CCVP 2KLVA 3L70G 2K9JB 2QG4A 1SQQJ 1HJBA 1PP9G 1NU1E 5AW4B 1QEXA 2RKLA 2N1TC 1PZQA 3PJSK 3L74E 3H1KD 2YXQB 2KIKA 1Q86Q 1SQQG 3SFEC 3EWKA 1SP4A 3CD6P 1L4AC 4N78D 2LXCB 4IFFA 4QMAA 1AVOA 5L8RJ 2ZYAA 1IFIA 1OZHA 5KAFE 2ZVNB 1ZV8A 2KSEA 3MUDA 5APSA 2K3RA 5EFWB 3D6YA 2HPCB 1JY3N 1KILD 3L72D 1PPJD 3SWKA 3HD7D 1YJ9P 5B5EH 1DD4A 1ZW0A 1N8RQ 3H1KE 1VDFA 1L0NE 1JMMA 3AE5C 3VMZA 1JMBA 1GZLA 2E43A 3IR9A 5KLVK 4N78E 1MFTA 3KZIE 3RL0C 2YO3A 5KLIC 4H0LD 3Q3DA 1VF5C 3CX5D 5CCGD 4CPGA 4LC1A 3I56P 3V5BA 1OVRA 1SQBJ 3A0HE 3D70A 1KILE 3L72E 1JY2N 5CMZA 3FXDA 2CPBA 2WT7B 1EZVD 2M8RA 1IK7A 5AVTB 1GW3A 1NTMJ 1VQMP 4OVNF 1AQTA 1SQBG 2KZIA 2A45I 2A45G 2ITAA 4L74A 3M91A 1FJPA 3L75E 3ZDMA 4KJMA 1NAFA 3CX5E 1NTMG 3H1JE 5KTBA 2K9YA 2WPRA 1AVYA 4PD4D 1S5LX 5AW2B 3OJAB 1G2CB 2HLOA 3L37A 4ASWA 5E79E 1EZVE 1DX7A 3AE6C 2J58A 2IBZD 2N1TA 3G71P 3CPWO 3TYYA 5KAFH 1AFOA 2B88A 1QGKB 5KKZB 2WSCH 5CCHC 4UB6E 2B87B 1L4AA 1GD2E 1ZMEC 1BGYD 1PGQA 3W68A 2Y9ZA 1QVGO 4XFJA 3WUUA 4PD4E 1FZAA 5CJ4A 3W67A 1JB0J 2O01N 2FFDC 1SQXK 3SWFA 5AVXB 2OTLP 2R44A 1NKZB 1RF0C 3L4FA 3B5ND 3KZIH 4N3YB 1D7MA 1URQC 2XNXA 2Q3EA 1EXIA 1KILB 3FXEA 1S9KD 2XDJA 1FZCA 1VPCA 3A0HH 2KOGA 3V4WA 1BGYE 3OW2O 2E5YA 1NHLA 3HTKB 2R32A 1SQVD 3P32A 2E76D 5C39A 3WUVA 5CJ0A 1JCDA 3KQGA 3E1IA 2KNCB 5AW6B 4H0LB 3AE2C 3QWOC 2D2CC 2OTJP 3P8CD 1N7SD 1NTKJ 1ZP0C 3CX5H 1PL5A 4PV1B 3KDPB 1X8YA 1LTJB 3CCEP 3H1KJ 5AVSB 1L0NJ 2W6JH 1RF1B 2W8ZA 1NTKG 1QX8A 5E79H 1OVVA 1SQVE 5AW7B 3CXHD 2WPVB 1FU1A 3H1KG 4OH8B 1L0NG 4BRYA 1BSHA 1LJ2A 5B66E 1HGVA 2ZAEB 2HPCA 1ZR4A 3QH9A 2NRGA 4UB6H 4WB4A 3L72J 3M9QA 2QJPC 2G8YA 3E1RA 2YXRB 3VMAA 4PD4H 1Q82Q 4H44C 1K73Q 1X9VA 1Y8AA 1ZRTD 2W27A 1KILC 3L72G 3TNUB 1RQUA 5APQA 1KMIZ 1PIXA 3CXHE 3L35A 3S4RA 1H0TB 3L73D 2W6AA 4U3FD 2YO2A 3C8VA 3L75J 1LTGC 2FFDA 3H1JJ 1M90Q 3AE9C 3GG2A 2K1AA 1RF0A 3HE5B 1YBKA 1URQA 2A06G 3AE3C 3L75G 1EDJA 1W5CE 2IDBA 3H1JG 4OGQD 1BE3J 1ZRTE 3O6QB 4PV1C 4A7PA 3B5NB 2K88A 4HJGH 4Y99B 2R5BA 2JEEA 1J2JB 4M3LA 1LTJC 2FXPA 2KB7P 1KYOD 1NH4A 1DD3A 3H6PA 2JP3A 2AXTE 3CCLP 4HH2A 1BE3G 1P84E 4I2LC 1JY3P 2FYZA 4UB8E 1YQ3C 2MJZA 2ZXXA 3L71E 2E76B 1SQPD 1G2CA 4LLHA 2P10A 3M9BA 1K05A 3AEEC 3H1LJ 2O3JA 1T2KD 1FZFA 2FYUD 3HUSB 1GL2D 1N7SB 1KC8Q 1USDA 5B66H 3AEGC 2E75B 4WY4B 4IL6E 2B87A 3U1CA 2FXOA 1KQGB 1FE6A 3H1LG 2JO1A 1H8AA 1H89A 4DT0A 4ASVA 2PGDA 2WSEH 1JY3O 3SSUA 3CCRP 2MKVA 1SQBK 5KAIE 2O01H 1RE3C 2IFNA 3USSA 1RH5B 2H89C 1VQ7P 3CWBD 3CXHH 1LWUB 5APWA 1OVUA 3AEFC 1A02F 1KILA 1NTMK 1IFPA 1A02J 3Q5RA 4Y99C 1HBWA 3HTKA 1OFCX 2OYHB 1JTHB 2ZJSE 1BCCJ 1YJNP 2JWAA 3P7KA 2C9LY 1OMIA 2BASA 4C46A 3AE4C 5KJ7C 3CWBE 3FGAD 2E76C 2GA1A 3JC22 3TK1A 2AXTH 2B9BA 1BCCG 2E42A 5KLVD 1LTJA 3I55P 1P84H 2Z5HA 3IFMA 3PLNA 4KHXA 1FZEA 3H1HD 2WSEJ 2AXCA 3CC7P 3RBXA 4UB8H 3HUSC 2RN0A 4U7JA 3IN6A 1ZXGA 3RK2B 4OGQB 1N2DC 2E75C 1OW6A 4WY4C 3RK3D 3AE7C 5BVZA 2ZT9D 2DW3A 4D6TJ 1M57D 2WPSA 2E5TA 4IL6H 1T8ZA 2NPSD 3Q2YA 2SPZA 2V7QJ 1BSNA 2RH0A 1UIXA 2YMYA 1LWUC 3H1HE 4D6TG 2P1JA 3BCCD 2H7HA 2WTYA 2B89A 2QJKB 4JF7A 3TNUA 1T6AA 5KAIH 2Z4EA 1X22A 1OWAA 4TLFA 1R5SA 2YNYA 1NTZJ 1H0TA 5AW1B 3F89A 1FZCC 2OYHC 2JR8A 1IC2A 1K8AQ 1RE3A 3H1ID 5AVRB 1E79H 3HE5A 2WITA 1NTZG 3L71J 2Y0EA 1FDIA
chains in the Genus database with same CATH topology
2XDJA 3VYIA 1FZCA 1VPCA 1CI6A 1NTKK 5AVQB 2KOGA 3V4WA 5AVVB 1RE4C 1J1DC 3KPEA 1FZGA 2H43A 1CZQA 3CLQA 3B5NA 1FZBA 2C9NY 1M7LA 1NHLA 3HTKB 2OYIC 1MUUA 2R32A 3HRNA 3P32A 2Q7CA 5CCGA 2R5DA 5APTA 1SLQA 3RK2D 5CJ0A 1JCDA 3KQGA 1JUNA 3E1IA 4ZKUA 3NFQA 1GU4A 3RK2C 1ZN5A 1MFZA 2HFED 5AW6B 3VMYA 1QL2A 2KP8A 1G1JA 1RY3A 2J59M 1LGHB 2C0XA 3KYQA 1DEBA 3P8CD 2OYIA 3HE4B 1N7SD 3MGNA 1RF1A 5KJ7A 4C7RA 1HH0A 1HGZA 4EOTA 2HG5D 1N7SC 3I5CA 2LKMA 3V4QA 3SWYA 3KDPB 1X8YA 1LT9C 4HYTB 1MZ9A 4LGDE 3U59A 1LTJB 1MV8A 3VP8A 2H8PD 2POHA 1M1JB 1GW4A 1KFMA 5AVSB 4I1LA 1RF1B 2YKPA 1LTIC 5AW0B 4RESB 3NTNA 2Q3IA 3HUSA 1LTAC 1HWTC 3VMXA 3OA7A 1N7SA 3VP9A 5AW7B 2HYNA 1JO5A 2A45H 1HUCA 4WY4A 1FU1A 1NO4A 4OH8B 3WMM0 1NWQA 5APUA 1X79B 1E5WA 3GHGA 1T2KC 2WWWA 1HGVA 3LIEA 2N1TB 5AVWB 2HPCA 1ZR4A 1YYCA 2HODA 2O1JA 2OARA 4GT1A 1IFDA 1NU1K 4WB4A 3M9QA 4XA4A 3TSIA 4IFDK 3UIAA 1FJKA 2P7JA 2JJLA 3V2NA 2R3CA 3BATA 3M0AA 1GL2B 2PP6A 2Q9IA 1SFCC 3C9IA 3MIWA 1JY2P 1T3JA 1LWUA 2QM7A 1X9VA 1LTBC 3R2PA 3MD0A 2W27A 1KILC 3P8MC 3TNUB 5APQA 2P67A 2NPSB 1GU5A 3L35A 1SVFA 2W6AA 1KZUB 2YO2A 1L0LK 1LTGC 1LTTC 1N73B 3VN0A 2FFDA 3O8ZA 3HD7B 3CI9A 3MTUE 1IO4A 1GDTA 3N7NA 1RF0A 3M9HA 2OYHA 3G3ZA 3BRVB 4I6MC 3BVHA 3BRTB 1JTHA 3HE5B 1SQPK 1URQA 1Z56A 2FFDB 3II6A 1GK4A 1JOCA 3T97A 1FZCB 1L0NK 1CI6B 1N7LA 2XZRA 5AW3B 3RL0B 1ZR2A 2FYUK 1URQB 4WBAA 1YTZT 1FOSE 3B5NB 1DH3A 1JY2O 1RE4A 5AVZB 3EQ2A 4W80A 2R5BA 2JEEA 1J2JB 4M3LA 2Z5IA 1LTJC 4Y99B 2GUSA 2ZFCA 4AYCA 2KB7P 2YKOA 1NH4A 4B86A 3VTPC 3H6PA 1IFNA 4GKGA 1QL1A 2VRSA 3CL3D 4AQRD 4HH2A 2C0WA 1S9KE 2YKQA 2KLVA 1WT6A 4I2LC 1IFMA 1JY3P 2FYZA 2OYIB 1HJBA 2XV5A 1NKNA 2FKWB 1IK9A 2XU6A 2MJZA 2GM4A 5AW4B 3M06A 1G2CA 2ZXEB 3H32A 3M0DC 3M9BA 4LLHA 4XE5B 2N1TC 2GUVA 5APYA 5CHXA 1LT9A 2WZ7A 1CW5A 1T2KD 3V2RA 1FZFA 5APXA 1PFIA 3HUSB 2PAJA 1L4AD 1GL2D 3V2PA 1N7SB 1SP4A 3P8CE 1L4AC 4N78D 1GL2C 4IFFA 4WY4B 1KQLA 3U1CA 1IFIA 1WRGA 5AVUB 5BU8B 3GHGB 1SFCD 3RK3B 1ZV8A 1H8AA 3MUDA 1H89A 5APSA 2HPCB 1JY3N 1XTCC 1J1EB 2HODB 1KILD 2WSEH 4JYBA 3HD7D 1JY3O 1N73C 5BU5A 3HD7C 1JCCA 2KSJA 1SQBK 2IX7C 1IJDB 3LW5H 2O01H 1RE3C 2IFNA 1VDFA 1JNMA 4W7YA 1JMMA 1LWUB 3VMZA 1SFCA 5APWA 4C7NA 1A02F 2L5GB 1GZLA 2E43A 2WSFH 3IR9A 5KLVK 1AQ5A 1KILA 5AVYB 4N78E 1NTMK 3RL0C 1A02J 2YO3A 5AW5B 1H88A 2M3BA 2O1KA 5CCGD 4LC1A 4Y99C 2WT7A 1KFNA 1HBWA 3V5BA 5CCGC 1SQQK 1W2EA 3HTKA 4N6JA 3EFGA 3VOPA 2OYHB 1YTZI 1JY2N 1LTSC 1OXZA 2Q5UA 1JTHB 5CMZA 3P7KA 2CPBA 2WT7B 4ZKPA 1G1IA 5KJ7D 2C9LY 1HTLC 2M8RA 3NMDA 5AVTB 1M1JC 2BASA 4C46A 1RF1C 5KJ7C 1GW3A 1T3UA 1GK6A 5APVA 4DOJA 2XKMA 1XTGB 1HVVA 3HE4A 1GTWA 2A45I 5AW8B 3TK1A 2A45G 1J1DB 1FDMA 2E42A 1LTJA 3M91A 1FJPA 2Z5HA 3IFMA 3LIDA 4KHXA 1NOHA 1FZEA 1M1JA 4GIFA 1NAFA 2N1TD 3HUSC 5KTBA 3RK2B 1N2DC 4W7ZA 4WY4D 2FXMA 2W6BA 2WPRA 4WY4C 5AW2B 1FBMA 3RK3D 3OJAB 3A5TA 3N4XA 3GHGC 1G2CB 2HLOA 3H32B 3L37A 3OAKA 4O9BA 3RK3C 2IFMA 3BASA 1DX7A 5BVZA 2J58A 3L36A 1LT9B 3M0DA 1J1EC 2N1TA 2WPSA 1NTZK 2QM8A 1T8ZA 2NPSD 3A2AA 1EQ7A 3B8EB 3A7OA 3PP5A 3TYYA 1AFOA 2NPSC 5CCHD 2WSCH 4IFMA 5CCHC 1ZLLA 2KYVA 2YMYA 1LWUC 1L4AA 1GL2A 1GD2E 2WPQA 2P1JA 2H7HA 2WTYA 2I1JA 1FOSF 2CPSA 4EIJA 1CSBA 4AUWA 1SQVK 4JF7A 3TNUA 1FZAA 2Z4EA 2NPSA 1L4AB 1OWAA 5CJ4A 2YNYA 2IPPA 2FFDC 5CCHA 1SQXK 5AW1B 2N9BA 3RL0D 3V2QA 3SWFA 4JYCA 1FAVA 1N73A 3NXSA 1FZCC 1N86A 5AVXB 1NKZB 3HD7A 1RF0C 1URQD 3L4FA 2OYHC 3B5ND 1IC2A 4N3YB 2P2UA 3A3YB 1RE3A 5AW9B 1SFCB 1URQC 1IFJA 4C7NB 3U1AA 3B5NC 2XNXA 4DZOA 5AVRB 3HE5A 2WITA 1KILB 2I1KA 1S9KD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VP8 A;  3C9I A;  4ZKU A;  1X79 B;  2POH A;  1WT6 A;  3OJA B;  4I1L A;  3N4X A;  3N7N A;  4O9B A;  1NKN A;  2JEE A;  3BAS A;  4N78 D;  4ZKP A;  5BU5 A;  5BVZ A;  3P8C D;  4GIF A;  1IC2 A;  4N3Y B;  5KTB A;  3VP9 A;  3U1A A;  3U1C A;  3HRN A;  2FXM A;  5BU8 B;  3U59 A;  3BAT A; 
#chains in the Genus database with same CATH topology
 4GOD A;  2I8D A;  1PPJ E;  1NTK K;  2BCC J;  1NGM B;  4EI2 A;  1P84 I;  5AVV B;  1FZG A;  3O6Q A;  3B5N A;  2C9N Y;  3WU2 E;  3L71 G;  3C1L A;  5APT A;  4ZKU A;  2BCC G;  3SFD C;  1IZN B;  4OGQ C;  1ZN5 A;  3RK2 C;  1SQX D;  2HFE D;  3VMY A;  1QL2 A;  2KP8 A;  1RQV A;  3G9R A;  1G1J A;  2J59 M;  3JCU E;  2OGU A;  3A0B E;  3IAO A;  5KJ7 A;  3H1I E;  1HGZ A;  2HG5 D;  3D71 A;  1MV8 A;  3H25 A;  1KQS O;  3RBZ A;  1M1J B;  2OQQ A;  1LTI C;  5AW0 B;  3CC4 P;  4RES B;  2UWJ E;  2Q3I A;  3HUS A;  1VQ8 P;  3VMX A;  1N7S A;  2PFX A;  1NVO A;  1JO5 A;  4WY4 A;  5GTH E;  1X79 B;  2QJK C;  1T2K C;  2Q1K A;  2WWW A;  2NZ2 A;  1WMK A;  5GTI E;  3V6I A;  3UIA A;  1KB9 D;  3BAT A;  3M0A A;  2Q9I A;  3C9I A;  4YXW H;  1T3J A;  1LWU A;  2M0B A;  2QM7 A;  2ZT9 B;  3TGU D;  3R2P A;  4WVZ A;  2OTK E;  2RMZ A;  2IBZ E;  2NPS B;  1VQL P;  4NPF X;  1KZU B;  1NU1 J;  3AEC C;  1L0L K;  1LTT C;  1N73 B;  1VQK P;  3O8Z A;  3HD7 B;  3IF4 A;  3MTU E;  1IO4 A;  4DJG A;  1YHQ P;  3L74 J;  2OYH A;  4I6M C;  1Q2N A;  3BVH A;  1JTH A;  4BXL A;  3II6 A;  1NU1 G;  1GK4 A;  2XZR A;  1LP1 A;  1U7J A;  1FC2 C;  3WU2 H;  1LT1 A;  2ZVO B;  3L74 G;  4WBA A;  1EXJ A;  1DH3 A;  2FYN B;  2WSC J;  4I7Z B;  2K9J A;  4AYC A;  4IL6 X;  3VTP C;  1KN7 A;  3JCU H;  3A0B H;  3L70 D;  4AQR D;  1S9K E;  2K37 A;  1RHZ B;  1YIT P;  2IYO A;  1PP9 D;  2OYI B;  1NKN A;  2FKW B;  3FWL A;  3M0D C;  1OIP A;  5KKZ C;  4XE5 B;  2GUV A;  5APY A;  5CHX A;  1CW5 A;  1W2B O;  5APX A;  1PFI A;  3RL0 g;  1L4A D;  3S1K A;  5GTH H;  5TIS E;  3CME P;  3P8C E;  2CK3 H;  3CCS P;  1R5L A;  2ZT9 C;  1AA0 A;  1WRG A;  5AVU B;  3GHG B;  1SFC D;  4TT3 H;  5GTI H;  1XTC C;  1J1E B;  2JWD A;  4JYB A;  1AJY A;  3CCQ P;  1N73 C;  1KD1 Q;  1PPJ G;  3HD7 C;  1U57 A;  1OW7 A;  1QVF O;  1YI2 P;  1JNM A;  1NAY A;  2QA4 P;  2P58 A;  1LNQ A;  1AQ5 A;  3GLM A;  1VF5 D;  2M3B A;  2Y0D A;  2WSS H;  4H0L C;  2FYN C;  2KXP B;  2WT7 A;  1KFN A;  3CX5 I;  3PTZ A;  5CCG C;  1SQQ K;  4I7Z C;  1Y9B A;  3VOP A;  3EFG A;  1JEK A;  1Q90 D;  1YTZ I;  1OXZ A;  2Q5U A;  4ZKP A;  1G1I A;  3T97 B;  1SQB D;  3NMD A;  1RF1 C;  1EZV I;  2Y9Y A;  3L73 E;  1GK6 A;  1EZV G;  5APV A;  4U3F E;  5H2F E;  2L91 A;  1HVV A;  1MKM A;  4JPZ B;  2QIW A;  1FDM A;  1NTM D;  1NOH A;  1OW8 A;  1M1J A;  4GIF A;  1KTM A;  1KOR A;  4JBZ A;  2FXM A;  1VQ6 P;  1NYH A;  4PD4 I;  1PV3 A;  3N4X A;  3GHG C;  3H32 B;  4O9B A;  2IFM A;  3BAS A;  1HF9 A;  1SQB E;  1KYO E;  3L36 A;  1LT9 B;  1PGJ A;  1J1E C;  3M0D A;  5TIS H;  3MP7 B;  3TDK A;  1X0T A;  2IBZ I;  1NTZ K;  2HR3 A;  2IBZ G;  1BGY J;  2QSI A;  3B8E B;  3JSV C;  2W83 C;  5CCH D;  1NTM E;  3PHL A;  3S9O A;  4RO0 A;  2KZJ A;  1SQP E;  5CBN A;  2CPS A;  1U7M A;  1BGY G;  4MN4 C;  2NPS A;  2AEF A;  1L4A B;  2FYU E;  2IPP A;  2N9B A;  3V2Q A;  2JDI H;  3CCU P;  1N73 A;  3NXS A;  3B71 A;  1N86 A;  3GF7 A;  3HD7 A;  2QRX A;  1URQ D;  2IZ1 A;  2LR2 A;  1VQP P;  5AW9 B;  1SFC B;  4C7N B;  3B5N C;  4DZO A;  1VQO P;  2BEZ F;  3AEB C;  1L2P A;  1SQV J;  2G3A A;  4EYY Q;  3Q5S A;  1QLE D;  1RE4 C;  3AED C;  2Q6Q A;  3KPE A;  2KNC A;  1CZQ A;  3CLQ A;  1M7L A;  1TU3 F;  2M5A B;  3HRN A;  5CCG A;  2R5D A;  1DIP A;  1S3J A;  3AEA C;  1SLQ A;  1SQV G;  1JUN A;  5H2F H;  3NFQ A;  2D2C D;  4HB1 A;  1VF5 B;  4L75 A;  1RY3 A;  3KYQ A;  1OX3 A;  3Q1M A;  1M8O B;  2OYI A;  3HE4 B;  2AEM A;  3MGN A;  1RF1 A;  1HH0 A;  4PJ0 E;  1N7S C;  3I5C A;  2LKM A;  3V4Q A;  3SWY A;  1LT9 C;  2O01 J;  1MZ9 A;  4HYT B;  2ZYG A;  3VP8 A;  1S1C X;  1GW4 A;  1NTK D;  4I1L A;  2E74 D;  5DJT B;  3NTN A;  1HWT C;  3CCJ P;  3OA7 A;  3MHV A;  3VP9 A;  1KYO H;  2HYN A;  1L0N D;  3RGU A;  2A45 H;  4BWN A;  3CXH I;  1NO4 A;  3WMM 0;  4YPC A;  5KLV E;  1E5W A;  3GHG A;  4L76 A;  2H88 C;  4GT1 A;  2OAR A;  1IFD A;  1NU1 K;  4RJT A;  4BRY B;  2JJL A;  3V2N A;  2R3C A;  4H44 D;  4DCK A;  1FS0 E;  1GL2 B;  2PP6 A;  3RK3 E;  1SFC C;  1NTK E;  3MIW A;  3L73 J;  4U3F J;  3MD0 A;  2QJY B;  4GOF A;  1BDD A;  2P67 A;  1GU5 A;  4EDF A;  2LXB A;  3L73 G;  3ITK A;  3PRJ A;  4U3F G;  3G6E P;  3N7N A;  4NPE A;  1KV4 A;  3BCC E;  2A06 D;  3M9H A;  3ABV C;  3G3Z A;  2BEQ D;  3BRV B;  3L75 D;  1Z56 A;  2FFD B;  3H1J D;  3T97 A;  1L0N K;  1CI6 B;  5AW3 B;  4PV1 D;  1ZR2 A;  3KXD A;  1S4X A;  1URQ B;  1YTZ T;  1FOS E;  1RE4 A;  3EQ2 A;  4L73 A;  4W80 A;  3GMA A;  2GUS A;  4B86 A;  1KYO I;  1BE3 D;  1IFN A;  4GKG A;  1QL1 A;  1BDC A;  4PJ0 H;  1L0L D;  1SQP J;  1WT6 A;  1IFM A;  2A06 E;  1EDL A;  2XV5 A;  1IK9 A;  3FX0 A;  2XU6 A;  2GM4 A;  2FYU J;  1AV1 A;  3M06 A;  2ZXE B;  3H32 A;  3G4S P;  1M56 D;  1SQP G;  1LT9 A;  2D2C B;  2WZ7 A;  4Y28 J;  3V2R A;  1SQX E;  2PAJ A;  2QE7 H;  3V2P A;  2FYU G;  3FWN A;  1GL2 C;  2JKV A;  3H1L D;  2N9Y B;  1BE3 E;  1KQL A;  1L0L E;  2QJY C;  5BU8 B;  3RK3 B;  2E74 B;  3PH0 A;  2KI7 B;  2HOD B;  2KS1 B;  3CWB J;  5DJU B;  5BU5 A;  3CCM P;  1R8E A;  1JCC A;  2KSJ A;  2IX7 C;  1EDI A;  1IJD B;  3LW5 H;  3TF5 A;  3GW6 A;  4W7Y A;  1Y47 A;  3D6Z A;  4NPD A;  1SFC A;  1YIJ P;  4C7N A;  2YIU B;  3WUT A;  3CWB G;  2L5G B;  2QJP B;  4ZMD A;  2WSF H;  1DEE G;  5AVY B;  3H1L E;  5AW5 B;  1H88 A;  2ZYD A;  2O1K A;  4H44 B;  5TJH A;  3K5B A;  3B4S A;  1KB9 E;  1W2E A;  2M5A A;  4N6J A;  1LTS C;  3TGU E;  2WMM A;  1VL2 A;  3KHU A;  1GMJ A;  4H13 D;  5KJ7 D;  1HTL C;  5KLV J;  4Z1M H;  1M1J C;  1T3U A;  4OWF A;  3H1H J;  4DOJ A;  2XKM A;  1XTG B;  3HE4 A;  1GTW A;  1BCC D;  5AW8 B;  2WVR A;  1J1D B;  2KK7 A;  3LID A;  2YMK A;  5KLV G;  2N1T D;  3H1H G;  2E75 D;  4W7Z A;  4WY4 D;  1USE A;  1ZOY C;  3LW5 J;  1SQQ D;  2W6B A;  2KLU A;  1FBM A;  2OYO A;  1KQF B;  3A5T A;  3OAK A;  3RK3 C;  2WSF J;  2E74 C;  1Q81 Q;  2KUB A;  1EDK A;  1K9M Q;  2QM8 A;  1BCC E;  3BCC J;  3L70 E;  3A2A A;  1EQ7 A;  3A7O A;  3PP5 A;  1PP9 E;  2NPS C;  4D6T D;  4IFM A;  1ZLL A;  2KYV A;  4KT0 J;  1GL2 A;  2WPQ A;  3GF3 A;  3MZW B;  2YIU C;  2I1J A;  1FOS F;  4IOI H;  3CC2 P;  4EIJ A;  1PGO A;  3BCC G;  1NJI Q;  1CSB A;  4AUW A;  1SQQ E;  1SQV K;  4R4L A;  1S5L E;  3F5H A;  5CCH A;  3H1I J;  3RL0 D;  4JYC A;  1FAV A;  3AE8 C;  1PGP A;  2M3E A;  3AE1 C;  2P2U A;  3A3Y B;  1IFJ A;  1NTZ D;  3U1A A;  1VQN P;  2WQY C;  2I1K A;  3H1I G;  4D6T E;  1KB9 H;  3VYI A;  1P84 D;  1CI6 A;  5AVQ B;  4GOE A;  2W90 A;  2XND H;  1J1D C;  1HJ0 A;  2H43 A;  1SQX J;  3EFF K;  4K35 A;  3L71 D;  1FZB A;  2OYI C;  1MUU A;  2Q7C A;  3E7K A;  2BCC D;  1EC5 A;  5CBO A;  4ZNC A;  3RK2 D;  1GU4 A;  1MFZ A;  1L0L J;  3CMA P;  3Q5P A;  1LGH B;  1SQX G;  2C0X A;  1DEB A;  2Y0C A;  4GDO A;  1NTZ E;  4C7R A;  4EOT A;  4LGD E;  3U59 A;  4YXD C;  2H8P D;  1L0L G;  2POH A;  4H13 B;  4RKU J;  1KFM A;  2AEJ A;  1S72 P;  2V4H A;  2YKP A;  1Q7Y Q;  1LTA C;  2BCC E;  1YJW P;  1HUC A;  4R4M A;  1UII A;  2PRR A;  1NWQ A;  3MUD C;  5APU A;  3R4Y A;  3LIE A;  1JM0 A;  2N1T B;  4YTP C;  5AVW B;  2J5U A;  5M1B A;  1YYC A;  2HOD A;  2O1J A;  1FDO A;  2KS1 A;  1K04 A;  3TGU J;  4WWI A;  4XA4 A;  2R3S A;  3TSI A;  4IFD K;  1FJK A;  2P7J A;  2QEX P;  1KB9 I;  5B5E E;  1JY2 P;  1S5L H;  1YQ4 C;  1LTB C;  1VQ5 P;  3P8M C;  2FBW C;  3TGU G;  4HKZ H;  4K3A A;  1SVF A;  3VN0 A;  3CI9 A;  2FY8 A;  1GDT A;  2IZ0 A;  3BRT B;  1NU1 D;  1SQP K;  2V7Q H;  1JOC A;  1FZC B;  1N7L A;  3L74 D;  3RL0 B;  5KLI B;  2FYU K;  5K5G B;  1VQ4 P;  1S2E A;  3L70 J;  1JY2 O;  5AVZ B;  2Z5I A;  4JQ0 D;  2ZFC A;  1PP9 J;  2QVA A;  1VQ9 P;  2YKO A;  4H13 C;  1LP1 B;  2IYP A;  1M1K Q;  2VRS A;  3CL3 D;  2C0W A;  1SS1 A;  2YKQ A;  3CCV P;  2KLV A;  3L70 G;  2K9J B;  2QG4 A;  1SQQ J;  1HJB A;  1PP9 G;  1NU1 E;  5AW4 B;  1QEX A;  2RKL A;  2N1T C;  1PZQ A;  3PJS K;  3L74 E;  3H1K D;  2YXQ B;  2KIK A;  1Q86 Q;  1SQQ G;  3SFE C;  3EWK A;  1SP4 A;  3CD6 P;  1L4A C;  4N78 D;  2LXC B;  4IFF A;  4QMA A;  1AVO A;  5L8R J;  2ZYA A;  1IFI A;  1OZH A;  5KAF E;  2ZVN B;  1ZV8 A;  2KSE A;  3MUD A;  5APS A;  2K3R A;  5EFW B;  3D6Y A;  2HPC B;  1JY3 N;  1KIL D;  3L72 D;  1PPJ D;  3SWK A;  3HD7 D;  1YJ9 P;  5B5E H;  1DD4 A;  1ZW0 A;  1N8R Q;  3H1K E;  1VDF A;  1L0N E;  1JMM A;  3AE5 C;  3VMZ A;  1JMB A;  1GZL A;  2E43 A;  3IR9 A;  5KLV K;  4N78 E;  1MFT A;  3KZI E;  3RL0 C;  2YO3 A;  5KLI C;  4H0L D;  3Q3D A;  1VF5 C;  3CX5 D;  5CCG D;  4CPG A;  4LC1 A;  3I56 P;  3V5B A;  1OVR A;  1SQB J;  3A0H E;  3D70 A;  1KIL E;  3L72 E;  1JY2 N;  5CMZ A;  3FXD A;  2CPB A;  2WT7 B;  1EZV D;  2M8R A;  1IK7 A;  5AVT B;  1GW3 A;  1NTM J;  1VQM P;  4OVN F;  1AQT A;  1SQB G;  2KZI A;  2A45 I;  2A45 G;  2ITA A;  4L74 A;  3M91 A;  1FJP A;  3L75 E;  3ZDM A;  4KJM A;  1NAF A;  3CX5 E;  1NTM G;  3H1J E;  5KTB A;  2K9Y A;  2WPR A;  1AVY A;  4PD4 D;  1S5L X;  5AW2 B;  3OJA B;  1G2C B;  2HLO A;  3L37 A;  4ASW A;  5E79 E;  1EZV E;  1DX7 A;  3AE6 C;  2J58 A;  2IBZ D;  2N1T A;  3G71 P;  3CPW O;  3TYY A;  5KAF H;  1AFO A;  2B88 A;  1QGK B;  5KKZ B;  2WSC H;  5CCH C;  4UB6 E;  2B87 B;  1L4A A;  1GD2 E;  1ZME C;  1BGY D;  1PGQ A;  3W68 A;  2Y9Z A;  1QVG O;  4XFJ A;  3WUU A;  4PD4 E;  1FZA A;  5CJ4 A;  3W67 A;  1JB0 J;  2O01 N;  2FFD C;  1SQX K;  3SWF A;  5AVX B;  2OTL P;  2R44 A;  1NKZ B;  1RF0 C;  3L4F A;  3B5N D;  3KZI H;  4N3Y B;  1D7M A;  1URQ C;  2XNX A;  2Q3E A;  1EXI A;  1KIL B;  3FXE A;  1S9K D;  2XDJ A;  1FZC A;  1VPC A;  3A0H H;  2KOG A;  3V4W A;  1BGY E;  3OW2 O;  2E5Y A;  1NHL A;  3HTK B;  2R32 A;  1SQV D;  3P32 A;  2E76 D;  5C39 A;  3WUV A;  5CJ0 A;  1JCD A;  3KQG A;  3E1I A;  2KNC B;  5AW6 B;  4H0L B;  3AE2 C;  3QWO C;  2D2C C;  2OTJ P;  3P8C D;  1N7S D;  1NTK J;  1ZP0 C;  3CX5 H;  1PL5 A;  4PV1 B;  3KDP B;  1X8Y A;  1LTJ B;  3CCE P;  3H1K J;  5AVS B;  1L0N J;  2W6J H;  1RF1 B;  2W8Z A;  1NTK G;  1QX8 A;  5E79 H;  1OVV A;  1SQV E;  5AW7 B;  3CXH D;  2WPV B;  1FU1 A;  3H1K G;  4OH8 B;  1L0N G;  4BRY A;  1BSH A;  1LJ2 A;  5B66 E;  1HGV A;  2ZAE B;  2HPC A;  1ZR4 A;  3QH9 A;  2NRG A;  4UB6 H;  4WB4 A;  3L72 J;  3M9Q A;  2QJP C;  2G8Y A;  3E1R A;  2YXR B;  3VMA A;  4PD4 H;  1Q82 Q;  4H44 C;  1K73 Q;  1X9V A;  1Y8A A;  1ZRT D;  2W27 A;  1KIL C;  3L72 G;  3TNU B;  1RQU A;  5APQ A;  1KMI Z;  1PIX A;  3CXH E;  3L35 A;  3S4R A;  1H0T B;  3L73 D;  2W6A A;  4U3F D;  2YO2 A;  3C8V A;  3L75 J;  1LTG C;  2FFD A;  3H1J J;  1M90 Q;  3AE9 C;  3GG2 A;  2K1A A;  1RF0 A;  3HE5 B;  1YBK A;  1URQ A;  2A06 G;  3AE3 C;  3L75 G;  1EDJ A;  1W5C E;  2IDB A;  3H1J G;  4OGQ D;  1BE3 J;  1ZRT E;  3O6Q B;  4PV1 C;  4A7P A;  3B5N B;  2K88 A;  4HJG H;  4Y99 B;  2R5B A;  2JEE A;  1J2J B;  4M3L A;  1LTJ C;  2FXP A;  2KB7 P;  1KYO D;  1NH4 A;  1DD3 A;  3H6P A;  2JP3 A;  2AXT E;  3CCL P;  4HH2 A;  1BE3 G;  1P84 E;  4I2L C;  1JY3 P;  2FYZ A;  4UB8 E;  1YQ3 C;  2MJZ A;  2ZXX A;  3L71 E;  2E76 B;  1SQP D;  1G2C A;  4LLH A;  2P10 A;  3M9B A;  1K05 A;  3AEE C;  3H1L J;  2O3J A;  1T2K D;  1FZF A;  2FYU D;  3HUS B;  1GL2 D;  1N7S B;  1KC8 Q;  1USD A;  5B66 H;  3AEG C;  2E75 B;  4WY4 B;  4IL6 E;  2B87 A;  3U1C A;  2FXO A;  1KQG B;  1FE6 A;  3H1L G;  2JO1 A;  1H8A A;  1H89 A;  4DT0 A;  4ASV A;  2PGD A;  2WSE H;  1JY3 O;  3SSU A;  3CCR P;  2MKV A;  1SQB K;  5KAI E;  2O01 H;  1RE3 C;  2IFN A;  3USS A;  1RH5 B;  2H89 C;  1VQ7 P;  3CWB D;  3CXH H;  1LWU B;  5APW A;  1OVU A;  3AEF C;  1A02 F;  1KIL A;  1NTM K;  1IFP A;  1A02 J;  3Q5R A;  4Y99 C;  1HBW A;  3HTK A;  1OFC X;  2OYH B;  1JTH B;  2ZJS E;  1BCC J;  1YJN P;  2JWA A;  3P7K A;  2C9L Y;  1OMI A;  2BAS A;  4C46 A;  3AE4 C;  5KJ7 C;  3CWB E;  3FGA D;  2E76 C;  2GA1 A;  3JC2 2;  3TK1 A;  2AXT H;  2B9B A;  1BCC G;  2E42 A;  5KLV D;  1LTJ A;  3I55 P;  1P84 H;  2Z5H A;  3IFM A;  3PLN A;  4KHX A;  1FZE A;  3H1H D;  2WSE J;  2AXC A;  3CC7 P;  3RBX A;  4UB8 H;  3HUS C;  2RN0 A;  4U7J A;  3IN6 A;  1ZXG A;  3RK2 B;  4OGQ B;  1N2D C;  2E75 C;  1OW6 A;  4WY4 C;  3RK3 D;  3AE7 C;  5BVZ A;  2ZT9 D;  2DW3 A;  4D6T J;  1M57 D;  2WPS A;  2E5T A;  4IL6 H;  1T8Z A;  2NPS D;  3Q2Y A;  2SPZ A;  2V7Q J;  1BSN A;  2RH0 A;  1UIX A;  2YMY A;  1LWU C;  3H1H E;  4D6T G;  2P1J A;  3BCC D;  2H7H A;  2WTY A;  2B89 A;  2QJK B;  4JF7 A;  3TNU A;  1T6A A;  5KAI H;  2Z4E A;  1X22 A;  1OWA A;  4TLF A;  1R5S A;  2YNY A;  1NTZ J;  1H0T A;  5AW1 B;  3F89 A;  1FZC C;  2OYH C;  2JR8 A;  1IC2 A;  1K8A Q;  1RE3 A;  3H1I D;  5AVR B;  1E79 H;  3HE5 A;  2WIT A;  1NTZ G;  3L71 J;  2Y0E A;  1FDI A; 
#chains in the Genus database with same CATH homology
 2XDJ A;  3VYI A;  1FZC A;  1VPC A;  1CI6 A;  1NTK K;  5AVQ B;  2KOG A;  3V4W A;  5AVV B;  1RE4 C;  1J1D C;  3KPE A;  1FZG A;  2H43 A;  1CZQ A;  3CLQ A;  3B5N A;  1FZB A;  2C9N Y;  1M7L A;  1NHL A;  3HTK B;  2OYI C;  1MUU A;  2R32 A;  3HRN A;  3P32 A;  2Q7C A;  5CCG A;  2R5D A;  5APT A;  1SLQ A;  3RK2 D;  5CJ0 A;  1JCD A;  3KQG A;  1JUN A;  3E1I A;  4ZKU A;  3NFQ A;  1GU4 A;  3RK2 C;  1ZN5 A;  1MFZ A;  2HFE D;  5AW6 B;  3VMY A;  1QL2 A;  2KP8 A;  1G1J A;  1RY3 A;  2J59 M;  1LGH B;  2C0X A;  3KYQ A;  1DEB A;  3P8C D;  2OYI A;  3HE4 B;  1N7S D;  3MGN A;  1RF1 A;  5KJ7 A;  4C7R A;  1HH0 A;  1HGZ A;  4EOT A;  2HG5 D;  1N7S C;  3I5C A;  2LKM A;  3V4Q A;  3SWY A;  3KDP B;  1X8Y A;  1LT9 C;  4HYT B;  1MZ9 A;  4LGD E;  3U59 A;  1LTJ B;  1MV8 A;  3VP8 A;  2H8P D;  2POH A;  1M1J B;  1GW4 A;  1KFM A;  5AVS B;  4I1L A;  1RF1 B;  2YKP A;  1LTI C;  5AW0 B;  4RES B;  3NTN A;  2Q3I A;  3HUS A;  1LTA C;  1HWT C;  3VMX A;  3OA7 A;  1N7S A;  3VP9 A;  5AW7 B;  2HYN A;  1JO5 A;  2A45 H;  1HUC A;  4WY4 A;  1FU1 A;  1NO4 A;  4OH8 B;  3WMM 0;  1NWQ A;  5APU A;  1X79 B;  1E5W A;  3GHG A;  1T2K C;  2WWW A;  1HGV A;  3LIE A;  2N1T B;  5AVW B;  2HPC A;  1ZR4 A;  1YYC A;  2HOD A;  2O1J A;  2OAR A;  4GT1 A;  1IFD A;  1NU1 K;  4WB4 A;  3M9Q A;  4XA4 A;  3TSI A;  4IFD K;  3UIA A;  1FJK A;  2P7J A;  2JJL A;  3V2N A;  2R3C A;  3BAT A;  3M0A A;  1GL2 B;  2PP6 A;  2Q9I A;  1SFC C;  3C9I A;  3MIW A;  1JY2 P;  1T3J A;  1LWU A;  2QM7 A;  1X9V A;  1LTB C;  3R2P A;  3MD0 A;  2W27 A;  1KIL C;  3P8M C;  3TNU B;  5APQ A;  2P67 A;  2NPS B;  1GU5 A;  3L35 A;  1SVF A;  2W6A A;  1KZU B;  2YO2 A;  1L0L K;  1LTG C;  1LTT C;  1N73 B;  3VN0 A;  2FFD A;  3O8Z A;  3HD7 B;  3CI9 A;  3MTU E;  1IO4 A;  1GDT A;  3N7N A;  1RF0 A;  3M9H A;  2OYH A;  3G3Z A;  3BRV B;  4I6M C;  3BVH A;  3BRT B;  1JTH A;  3HE5 B;  1SQP K;  1URQ A;  1Z56 A;  2FFD B;  3II6 A;  1GK4 A;  1JOC A;  3T97 A;  1FZC B;  1L0N K;  1CI6 B;  1N7L A;  2XZR A;  5AW3 B;  3RL0 B;  1ZR2 A;  2FYU K;  1URQ B;  4WBA A;  1YTZ T;  1FOS E;  3B5N B;  1DH3 A;  1JY2 O;  1RE4 A;  5AVZ B;  3EQ2 A;  4W80 A;  2R5B A;  2JEE A;  1J2J B;  4M3L A;  2Z5I A;  1LTJ C;  4Y99 B;  2GUS A;  2ZFC A;  4AYC A;  2KB7 P;  2YKO A;  1NH4 A;  4B86 A;  3VTP C;  3H6P A;  1IFN A;  4GKG A;  1QL1 A;  2VRS A;  3CL3 D;  4AQR D;  4HH2 A;  2C0W A;  1S9K E;  2YKQ A;  2KLV A;  1WT6 A;  4I2L C;  1IFM A;  1JY3 P;  2FYZ A;  2OYI B;  1HJB A;  2XV5 A;  1NKN A;  2FKW B;  1IK9 A;  2XU6 A;  2MJZ A;  2GM4 A;  5AW4 B;  3M06 A;  1G2C A;  2ZXE B;  3H32 A;  3M0D C;  3M9B A;  4LLH A;  4XE5 B;  2N1T C;  2GUV A;  5APY A;  5CHX A;  1LT9 A;  2WZ7 A;  1CW5 A;  1T2K D;  3V2R A;  1FZF A;  5APX A;  1PFI A;  3HUS B;  2PAJ A;  1L4A D;  1GL2 D;  3V2P A;  1N7S B;  1SP4 A;  3P8C E;  1L4A C;  4N78 D;  1GL2 C;  4IFF A;  4WY4 B;  1KQL A;  3U1C A;  1IFI A;  1WRG A;  5AVU B;  5BU8 B;  3GHG B;  1SFC D;  3RK3 B;  1ZV8 A;  1H8A A;  3MUD A;  1H89 A;  5APS A;  2HPC B;  1JY3 N;  1XTC C;  1J1E B;  2HOD B;  1KIL D;  2WSE H;  4JYB A;  3HD7 D;  1JY3 O;  1N73 C;  5BU5 A;  3HD7 C;  1JCC A;  2KSJ A;  1SQB K;  2IX7 C;  1IJD B;  3LW5 H;  2O01 H;  1RE3 C;  2IFN A;  1VDF A;  1JNM A;  4W7Y A;  1JMM A;  1LWU B;  3VMZ A;  1SFC A;  5APW A;  4C7N A;  1A02 F;  2L5G B;  1GZL A;  2E43 A;  2WSF H;  3IR9 A;  5KLV K;  1AQ5 A;  1KIL A;  5AVY B;  4N78 E;  1NTM K;  3RL0 C;  1A02 J;  2YO3 A;  5AW5 B;  1H88 A;  2M3B A;  2O1K A;  5CCG D;  4LC1 A;  4Y99 C;  2WT7 A;  1KFN A;  1HBW A;  3V5B A;  5CCG C;  1SQQ K;  1W2E A;  3HTK A;  4N6J A;  3EFG A;  3VOP A;  2OYH B;  1YTZ I;  1JY2 N;  1LTS C;  1OXZ A;  2Q5U A;  1JTH B;  5CMZ A;  3P7K A;  2CPB A;  2WT7 B;  4ZKP A;  1G1I A;  5KJ7 D;  2C9L Y;  1HTL C;  2M8R A;  3NMD A;  5AVT B;  1M1J C;  2BAS A;  4C46 A;  1RF1 C;  5KJ7 C;  1GW3 A;  1T3U A;  1GK6 A;  5APV A;  4DOJ A;  2XKM A;  1XTG B;  1HVV A;  3HE4 A;  1GTW A;  2A45 I;  5AW8 B;  3TK1 A;  2A45 G;  1J1D B;  1FDM A;  2E42 A;  1LTJ A;  3M91 A;  1FJP A;  2Z5H A;  3IFM A;  3LID A;  4KHX A;  1NOH A;  1FZE A;  1M1J A;  4GIF A;  1NAF A;  2N1T D;  3HUS C;  5KTB A;  3RK2 B;  1N2D C;  4W7Z A;  4WY4 D;  2FXM A;  2W6B A;  2WPR A;  4WY4 C;  5AW2 B;  1FBM A;  3RK3 D;  3OJA B;  3A5T A;  3N4X A;  3GHG C;  1G2C B;  2HLO A;  3H32 B;  3L37 A;  3OAK A;  4O9B A;  3RK3 C;  2IFM A;  3BAS A;  1DX7 A;  5BVZ A;  2J58 A;  3L36 A;  1LT9 B;  3M0D A;  1J1E C;  2N1T A;  2WPS A;  1NTZ K;  2QM8 A;  1T8Z A;  2NPS D;  3A2A A;  1EQ7 A;  3B8E B;  3A7O A;  3PP5 A;  3TYY A;  1AFO A;  2NPS C;  5CCH D;  2WSC H;  4IFM A;  5CCH C;  1ZLL A;  2KYV A;  2YMY A;  1LWU C;  1L4A A;  1GL2 A;  1GD2 E;  2WPQ A;  2P1J A;  2H7H A;  2WTY A;  2I1J A;  1FOS F;  2CPS A;  4EIJ A;  1CSB A;  4AUW A;  1SQV K;  4JF7 A;  3TNU A;  1FZA A;  2Z4E A;  2NPS A;  1L4A B;  1OWA A;  5CJ4 A;  2YNY A;  2IPP A;  2FFD C;  5CCH A;  1SQX K;  5AW1 B;  2N9B A;  3RL0 D;  3V2Q A;  3SWF A;  4JYC A;  1FAV A;  1N73 A;  3NXS A;  1FZC C;  1N86 A;  5AVX B;  1NKZ B;  3HD7 A;  1RF0 C;  1URQ D;  3L4F A;  2OYH C;  3B5N D;  1IC2 A;  4N3Y B;  2P2U A;  3A3Y B;  1RE3 A;  5AW9 B;  1SFC B;  1URQ C;  1IFJ A;  4C7N B;  3U1A A;  3B5N C;  2XNX A;  4DZO A;  5AVR B;  3HE5 A;  2WIT A;  1KIL B;  2I1K A;  1S9K D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...