2JEEA

Xray structure of e. coli yiiu
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
78
structure length
78
Chain Sequence
MSLEVFEKLEAKVQQAIDTITLLQMEIEELKEKNNSLSQEVQNAQHQREELERENNHLKEQQNGWQERLQALLGRMEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel Coiled-Coil Cell Division Factor Zapb Stimulates Z Ring Assembly and Cell Division.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle
molecule keywords CELL DIVISION PROTEIN ZAPB
total genus 30
structure length 78
sequence length 78
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06005 ZapB Cell division protein ZapB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2jeeA00
3BATA 3N7NA 3HRNA 4O9BA 4N3YB 1WT6A 4ZKPA 1X79B 3C9IA 3N4XA 4ZKUA 5BVZA 2POHA 3VP9A 2FXMA 5BU8B 1NKNA 3VP8A 5KTBA 1IC2A 3BASA 3U1AA 3U59A 3U1CA 2JEEA 4N78D 3P8CD 4GIFA 3OJAB 5BU5A 4I1LA
chains in the Genus database with same CATH superfamily
1KB9H 1OZHA 3V4QA 5GTIE 3L71D 2OYHB 1FC2C 1P84I 1SQPK 5AVVB 1MUUA 1NU1E 1RH5B 2GA1A 1KILB 2V7QH 1U7MA 2PFXA 3B5ND 3B71A 1DD4A 1RY3A 1LWUA 2IYPA 2OARA 2YMKA 4O9BA 4EI2A 1FS0E 4ZKPA 2WITA 1IFNA 2YKPA 4EDFA 2FYUD 2R5DA 2QJKC 1GMJA 5M1BA 3H25A 4OGQB 1GZLA 1LTTC 2QM8A 5CBNA 1FAVA 1PL5A 2I8DA 2KK7A 4I7ZC 2POHA 5KAIH 2WPQA 1KQFB 2E5TA 3PTZA 3RL0C 4PJ0H 3WU2H 1FU1A 5AW4B 5CCHA 3ZDMA 5TISH 3Q5SA 1NTMJ 2R44A 1BGYJ 3E7KA 1VQ9P 4BXLA 2WZ7A 2QE7H 4K35A 1QEXA 1SQVG 3CCVP 4N78E 5KAFH 1FDMA 3FWLA 4N78D 1NHLA 1WMKA 1BCCE 1RF0C 1JY3N 2BEZF 2R3CA 1P84H 2ZT9D 2H88C 1IO4A 1LWUC 2V7QJ 4HJGH 1GL2A 4M3LA 1URQA 5DJUB 1YIJP 3IAOA 2O01N 4HKZH 4WB4A 3BCCG 3I5CA 2AEMA 3H1LE 3M9QA 3H1KE 1RQVA 1WT6A 3VMXA 1RE4A 1ZR2A 3EQ2A 3HUSC 2Q9IA 1HUCA 3VTPC 2C9LY 1AQ5A 2KIKA 3M06A 5GTIH 1PPJG 3KQGA 3TF5A 1M1KQ 1SFCB 1KTMA 1SQVD 2JWAA 3V2QA 4Y28J 4EIJA 2WSEJ 1Y47A 4PV1B 1BE3E 4HH2A 1Q90D 1URQB 1L0LE 1BE3D 1ZV8A 2Y0CA 3VN0A 3CCJP 2NZ2A 4HYTB 1DH3A 1Q86Q 4R4LA 2IZ0A 3AE2C 1YJ9P 3W68A 2XZRA 1DX7A 2JDIH 3H1LG 1EZVE 3BCCD 4I1LA 1QL2A 1PP9E 3Q3DA 1T2KD 2M8RA 1P84D 3P8MC 1R5SA 3L70E 1S9KD 3HTKA 1RE4C 5KLVG 3SWFA 3TGUJ 1LT9A 1NH4A 3F89A 2KSEA 4B86A 1U57A 4ASVA 2D2CD 5AW7B 4U3FG 4ZKUA 2M3EA 3L72E 2WQYC 3RBXA 3A3YB 5CBOA 1N7SB 2G3AA 1JY2N 3HD7B 1QGKB 1HVVA 2AXTE 3M0AA 3L70J 1LTBC 1LTSC 1SQXD 1SQQK 3CCRP 5APUA 5KLIB 1NU1D 2HFED 3BRVB 3O6QA 3S9OA 3AECC 4XA4A 1T8ZA 1FZAA 1SQQJ 3L74G 2OYIC 2E42A 2PP6A 2HODB 2Z5IA 4PD4H 5AW2B 5KLVK 2RMZA 1VQ5P 1N86A 3OAKA 3SWYA 4C7RA 1EZVG 3Q1MA 1KC8Q 5L8RJ 3FXEA 4GOEA 1H8AA 1IFPA 1IFDA 2W6BA 1KB9D 2HODA 1JUNA 2KP8A 2XKMA 3P7KA 5B5EE 1HGZA 4C7NB 2VRSA 1AV1A 5APXA 3HE5B 2XV5A 3L75G 1ZOYC 2QJYC 3EFGA 1NTZD 1NTKJ 1QX8A 2N9YB 2W83C 3H1ID 3L71G 1R5LA 1S3JA 3O8ZA 4H0LB 4IL6X 5KJ7D 1S5LX 3CI9A 1N7SC 1VQMP 1VQ6P 1AVYA 1IZNB 3AEFC 1YTZI 1NU1K 5AVZB 1IFMA 2FYUG 1JEKA 2GUVA 2KYVA 4K3AA 1PGQA 3H1LD 3L35A 4GKGA 4PD4D 1VQPP 1MFTA 3V6IA 1CI6B 1GD2E 1H0TA 1CZQA 2IYOA 2K37A 1BCCG 1IFIA 5AVRB 2HPCB 1ZN5A 1A02J 3P32A 3H1HE 1M1JB 5E79H 3RK3E 2Y9ZA 2K88A 1SQVK 2L5GB 4I7ZB 1JNMA 3MUDA 3AE8C 5CMZA 2M0BA 3CXHI 3SWKA 1YQ3C 2PGDA 1GK4A 1NAYA 4GODA 1YHQP 2Z4EA 1ZW0A 1OW6A 3USSA 1BGYD 1L4AA 4DCKA 3GF7A 1N7SA 1VQNP 3G71P 1SQXG 1WRGA 3H1IJ 1PGJA 2E75D 1NTMG 5KAFE 3B5NA 3CX5D 3PP5A 3L74D 2A06E 1SS1A 3H1JG 3H1IE 3RK2B 1P84E 1OX3A 2GUSA 2O01J 2IDBA 1VDFA 1LP1B 2IZ1A 2KS1A 2IBZI 1NTKG 5C39A 3VP8A 4HB1A 3I55P 3Q5PA 3MUDC 1HBWA 1JY3O 4H44B 2ITAA 3LIEA 5AW5B 3H32A 5AW6B 3L73D 1J1EC 1PV3A 1ZRTE 1BE3G 4H13D 3WU2E 3L73E 1L0LG 1RHZB 1S5LE 1NTZG 2ZJSE 5H2FH 3RK3B 1RF1B 3TGUD 2YXRB 2XNXA 3M0DC 1YITP 4ZMDA 2QG4A 2KOGA 4IFFA 1D7MA 2R5BA 4H13B 1MV8A 3KPEA 1LTJA 2A06G 3L36A 3MGNA 4RESB 2FYUK 2WTYA 3MHVA 1YJWP 2KXPB 1W2BO 2Y0EA 3H1JD 1YYCA 3AE4C 1N73B 3L70G 4AUWA 2W8ZA 2K9JA 3G9RA 3II6A 2M5AB 4I6MC 1OWAA 4LGDE 2ZXXA 2ZT9B 4WVZA 4DZOA 5AW3B 1NU1J 3S1KA 3CWBD 3V4WA 2RN0A 1E5WA 3MZWB 3RK2D 3VP9A 3CWBE 3G4SP 2WPVB 4XFJA 4U3FD 3CCEP 2Q3EA 3L73G 4MN4C 2LXBA 2JEEA 1S9KE 2Q1KA 2NRGA 1SQQG 3L74J 4AQRD 4UB8H 2RH0A 2OYHA 2YNYA 3M0DA 3RL0D 2P1JA 3L73J 1KORA 2J59M 5KKZC 1IK7A 1IJDB 4BRYB 1JTHA 2ZYDA 4GOFA 2XU6A 3HRNA 2E43A 1KFNA 1OVUA 1KILE 1YJNP 3L71E 1HTLC 2FYUJ 1W5CE 3CWBG 1GK6A 4XE5B 1X79B 2YO2A 3C9IA 4WY4D 4JPZB 1QLED 1X0TA 1FJPA 3A0BE 1FDOA 5GTHH 2JWDA 2FYUE 1SQXK 2FXPA 4H44D 5K5GB 1GDTA 2M3BA 1PZQA 2E76D 2SPZA 2WWWA 2QM7A 3MIWA 5APTA 1L0LD 1IC2A 2WT7A 1AQTA 1W2EA 3CLQA 3U59A 4UB6E 2RKLA 2JO1A 1IK9A 4L75A 4D6TJ 3CXHE 1KYOH 1BDDA 2HLOA 1JOCA 3BRTB 4JYCA 2G8YA 5AW8B 3VOPA 2A06D 3L37A 4OH8B 2FBWC 1LGHB 3I56P 2C9NY 3GHGA 4Y99C 1EDKA 2D2CC 4KT0J 2HYNA 3A0BH 1L4AC 3L70D 3CMEP 1KV4A 3KYQA 4W80A 2YXQB 4JBZA 4PJ0E 1M90Q 1OVRA 2KB7P 3V2PA 3CC7P 1X8YA 1E79H 2W27A 1M1JC 1EDJA 3EFFK 4PD4E 4N3YB 2CPBA 4TLFA 1M56D 2NPSB 2B89A 1KFMA 3JCUE 1ZRTD 3AEAC 3NTNA 2A45H 1KYOI 4IFMA 1Z56A 4DOJA 1NWQA 3HD7D 5APWA 2MKVA 2ZAEB 1PGOA 3TGUE 1KQGB 1NTMD 1SQBK 3KZIE 3OA7A 2NPSD 2QRXA 3UIAA 2FFDB 3HUSB 3CCUP 4LC1A 3AE6C 3GHGC 3H1JE 5APSA 1JTHB 1ZR4A 1H0TB 1L2PA 2YKQA 1HH0A 1NKZB 1KMIZ 1BE3J 3OW2O 2E5YA 2C0XA 4PV1C 2H89C 5KJ7C 4W7YA 5APVA 2ZFCA 1MKMA 2A45I 3BCCE 3H1KG 1N7LA 5AW0B 4H0LC 3TGUG 1NTZE 3CC4P 3HE5A 1EXJA 4OGQC 3CCQP 3GW6A 3N4XA 3PLNA 1VQ8P 2WSEH 5BVZA 1NTMK 1SQBD 2BCCD 2AXCA 1NTZJ 2IBZD 1K04A 3FX0A 3HE4A 5AVWB 1HF9A 1SQXJ 2P58A 4YXDC 4IFDK 1EZVD 2OTKE 4WY4B 1T6AA 4L73A 5BU8B 3CCLP 3BCCJ 4KHXA 1SP4A 3SSUA 1SQBJ 2BCCJ 3U1CA 2OYOA 2QJPB 1FDIA 1N8RQ 3L4FA 4LLHA 1N7SD 2WSCJ 2WSFJ 3B4SA 2V4HA 1PP9G 2IPPA 3OJAB 1GW3A 2OYHC 1SQQD 1LT9C 1SQQE 1DIPA 1QVFO 1SVFA 3RL0B 1GTWA 1BGYE 3A0HE 1JY2P 4UB6H 3PHLA 4U3FJ 4IL6H 2WT7B 1KYOE 1SQBG 2BCCG 2IBZG 2WPRA 3V2RA 2B9BA 2WSSH 3CXHD 1OMIA 2BEQD 3R2PA 1HWTC 3A5TA 1TU3F 1BCCD 3C1LA 1GU4A 3CCMP 3CC2P 3LIDA 4BRYA 1L0ND 2FXMA 4JF7A 2WMMA 3H6PA 5B66E 1URQD 3BASA 4AYCA 1Q7YQ 1FE6A 2E75C 3MTUE 3P8CE 3QH9A 3KDPB 1VQKP 1J1EB 3H1KD 2L91A 1BGYG 1USDA 1KILD 3L72D 2OYIB 3SFDC 2N1TC 2WPSA 2XDJA 1JB0J 3H1HJ 5APQA 2E76C 1YQ4C 2QJKB 3RK3D 2OQQA 1L0LK 1OW7A 3CL3D 5KLIC 1FZCB 1EDIA 3M9BA 1SFCC 4KJMA 1U7JA 3E1IA 2K9JB 3TNUB 3RK2C 1KQSO 1S1CX 4NPFX 1FZFA 2WVRA 1CSBA 2KS1B 2Z5HA 3ABVC 5AW1B 1JMMA 1OVVA 1T3UA 1YTZT 1GL2C 3B8EB 5B66H 1Q82Q 1NTKD 1BDCA 3HE4B 5E79E 1L0NG 5AVSB 3JSVC 3RGUA 4I2LC 1JO5A 2FYNC 2E74C 2IFMA 2Q3IA 3M9HA 5DJTB 1AJYA 3T97A 2YIUB 4R4MA 1NJIQ 4IOIH 3LW5J 4BWNA 3CPWO 1PPJE 2J58A 2QIWA 3D6YA 1PP9D 1L0NJ 3WMM0 3WUUA 5KTBA 2E75B 2FYZA 3AEBC 3H32B 2QJYB 3PRJA 5KLVJ 1VF5C 3MD0A 1AVOA 3VMYA 1PIXA 2R3SA 1BCCJ 2ZVNB 3GF3A 1FZBA 2BASA 3A0HH 5KJ7A 2O01H 2Q5UA 4D6TE 1FZEA 1H88A 4EOTA 1AFOA 2AEJA 4OGQD 4A7PA 3D71A 3TYYA 1EQ7A 4WY4C 2IFNA 1LJ2A 2KI7B 1J1DB 2B88A 1NYHA 3BVHA 1X9VA 3B5NB 1GU5A 4L74A 4H44C 1EC5A 2KLUA 1SQXE 1A02F 2AXTH 1NTME 1JCCA 2P67A 3H1HD 2KNCA 2IX7C 2YO3A 1G2CA 3AEDC 2ZVOB 3R4YA 3TDKA 1S2EA 3TK1A 1SLQA 1VQLP 2LR2A 1K9MQ 2FXOA 1NTZK 1RE3A 1FBMA 2OGUA 4NPEA 1OIPA 4NPDA 1ZMEC 5CCGD 1NTKE 4JYBA 3L72G 1HJBA 1SQPE 1KB9E 1DEBA 3NXSA 4JQ0D 1KYOD 2YMYA 1XTCC 4H0LD 1OW8A 1K05A 1L4AD 3AE9C 1G1IA 2KZJA 2PAJA 3E1RA 3SFEC 1AA0A 5CCGA 1VQ4P 2A45G 2K3RA 4WBAA 1PPJD 2XNDH 2LXCB 5APYA 1LTIC 5B5EH 1M7LA 2P7JA 2FFDA 1USEA 1M8OB 2FKWB 3L74E 1K73Q 3EWKA 1NGMB 1FZCC 1JMBA 3CD6P 1GW4A 3H1JJ 5BU5A 2OYIA 1EXIA 4Z1MH 5GTHE 5TJHA 3RBZA 3GG2A 4WWIA 1HGVA 2JR8A 3M91A 3N7NA 1SQBE 2BCCE 2IBZE 3HD7C 1UIIA 3O6QB 3IN6A 2QSIA 1M57D 3VMAA 4DJGA 1X22A 1PFIA 2LKMA 2NPSC 5AVQB 3KHUA 1G1JA 1RE3C 2Q7CA 2E74B 2FY8A 3CMAP 1S72P 5CCHD 1YI2P 2JJLA 3K5BA 1KD1Q 1FZGA 1LT9B 3JC22 3NMDA 4RJTA 5KLVD 2CK3H 1NO4A 3HTKB 5CJ0A 1NVOA 3L71J 1R8EA 2N1TD 3AE1C 3ITKA 3L75J 2ZYAA 1N73A 1NKNA 2D2CB 2R32A 4W7ZA 3H1LJ 3TSIA 3W67A 2FFDC 1PP9J 2QA4P 1KN7A 2QJPC 3QWOC 2H8PD 2N1TA 1FZCA 2O1KA 2UWJE 3AEGC 3FGAD 1JM0A 3LW5H 2YKOA 3H1HG 5TISE 1N73C 1Q81Q 3BATA 3T97B 2JP3A 3CXHH 4UB8E 3D6ZA 1UIXA 5AVYB 4ZNCA 2N9BA 3Q5RA 1L0NE 1LP1A 1SFCA 5AVTB 1OXZA 1VPCA 2P10A 1T2KC 4PV1D 4Y99B 3VMZA 3TNUA 3AE7C 3H1KJ 1J2JB 4OWFA 4D6TD 1LTJB 3VYIA 1SFCD 1Q2NA 4PD4I 3IFMA 1CW5A 1QVGO 3B5NC 3AE5C 3L75D 2ZXEB 3A7OA 3H1IG 1LWUB 2W90A 1GL2D 1BSHA 1RF0A 1GL2B 1VQ7P 4TT3H 5AW9B 2E74D 2AEFA 1HJ0A 1SQVE 1IFJA 1RQUA 2OTJP 4DT0A 3KZIH 1LNQA 2HG5D 4OVNF 3D70A 2OTLP 1LTGC 3CX5H 3FXDA 1M1JA 1VL2A 1KQLA 2HPCA 2M5AA 3HUSA 4U7JA 1ZXGA 1NTKK 3FWNA 4D6TG 2Y9YA 4WY4A 1FOSF 2H7HA 1Y8AA 1MZ9A 5CHXA 1URQC 3L72J 1MFZA 2FYNB 2KLVA 2ZT9C 5EFWB 1LTJC 2DW3A 3MP7B 1L4AB 3G6EP 1KILA 1L0NK 4YXWH 1SQPG 1J1DC 1RF1A 1EDLA 2WSCH 2WSFH 4N6JA 1Y9BA 3RK3C 2K1AA 3GLMA 2O3JA 1EZVI 5H2FE 1S5LH 3V5BA 3RL0g 3JCUH 2C0WA 4RO0A 1FJKA 3A2AA 4IL6E 1JY3P 3AEEC 2N1TB 4EYYQ 2H43A 4GT1A 3CX5I 2KZIA 2MJZA 4C46A 5KLVE 2PRRA 3GHGB 4QMAA 5CCGC 5AVUB 1CI6A 2O1JA 3G3ZA 1SQPJ 3IR9A 3KXDA 2GM4A 1T3JA 3IF4A 4YPCA 2HR3A 4GDOA 1NAFA 5AVXB 1KB9I 1JY2O 1OFCX 1QL1A 1ZLLA 2CPSA 2ZYGA 1LT1A 1JCDA 3AE3C 3PH0A 3WUVA 1KILC 1SQPD 1S4XA 1LTAC 3CWBJ 4YTPC 2I1JA 1N2DC 3HD7A 1VF5D 1K8AQ 2YIUC 1XTGB 1YBKA 3F5HA 1DEEG 2Q6QA 2QVAA 1H89A 1RF1C 2NPSA 3CX5E 1NU1G 1G2CB 3PJSK 5CJ4A 2KUBA 4U3FE 2KNCB 2KSJA 1DD3A 5KKZB 3GMAA 2I1KA 1NOHA 2K9YA 4H13C 2B87A 1VQOP 2Y0DA 4C7NA 3WUTA 1VF5B 1ZP0C 2JKVA 4ASWA 3U1AA 3V2NA 5CCHC 3CCSP 3Q2YA 1PGPA 1SQVJ 2W6AA 3NFQA 4L76A 4RKUJ 1FOSE 5KAIE 2J5UA 4CPGA 2E76B 2W6JH 2P2UA 3P8CD 3S4RA 4GIFA 3C8VA 2QEXP 2B87B 1L0LJ 1BSNA 3L75E 1KZUB
chains in the Genus database with same CATH topology
3V4QA 2OYHB 1GTWA 1SQPK 5AVVB 1MUUA 1JNMA 1KILB 3B5ND 4O9BA 1RY3A 2OARA 1LWUA 4ZKPA 2WITA 1IFNA 2YKPA 1GD2E 2R5DA 1GZLA 1LTTC 2QM8A 1FAVA 2POHA 4AUWA 2WPQA 3RL0C 5CCHA 1FU1A 5AW4B 2WZ7A 4N78E 4N78D 1NHLA 1RF0C 1JY3N 2R3CA 1IO4A 1LWUC 1GL2A 1URQA 4WB4A 3M9QA 3I5CA 1WT6A 3VMXA 1RE4A 1ZR2A 3EQ2A 3HUSC 2Q9IA 1HUCA 3VTPC 2C9LY 1AQ5A 3M06A 3KQGA 1SFCB 3V2QA 4EIJA 4HH2A 1URQB 1ZV8A 3VN0A 4HYTB 1DH3A 1DX7A 2XZRA 4I1LA 1T2KD 1QL2A 2M8RA 3P8MC 1S9KD 3HTKA 1RE4C 3SWFA 1LT9A 1NH4A 4B86A 5AW7B 4ZKUA 3A3YB 1N7SB 1JY2N 3HD7B 3M0AA 1HVVA 1LTBC 1LTSC 1SQQK 5APUA 2HFED 3BRVB 4XA4A 1T8ZA 1FZAA 2OYIC 2E42A 2PP6A 2HODB 2Z5IA 5AW2B 5KLVK 1FDMA 1N86A 3OAKA 3SWYA 4C7RA 1H8AA 2W6BA 1IFDA 2HODA 1JUNA 2KP8A 2XKMA 3P7KA 1HGZA 4C7NB 2VRSA 5APXA 3HE5B 2XV5A 3EFGA 4M3LA 1GU5A 3O8ZA 5KJ7D 3CI9A 1N7SC 1YTZI 1NU1K 5AVZB 1IFMA 2GUVA 2KYVA 3L35A 4GKGA 1CI6B 1CZQA 1IFIA 5AVRB 2HPCB 1ZN5A 1A02J 3P32A 1GDTA 1M1JB 1SQVK 2L5GB 3MUDA 5CMZA 1GK4A 2Z4EA 1L4AA 1N7SA 1WRGA 3B5NA 3PP5A 3RK2B 3VOPA 2GUSA 1VDFA 3VP8A 1JY3O 3LIEA 5AW5B 3H32A 5AW6B 1J1EC 1RF1B 3RK3B 3M0DC 2XNXA 2KOGA 4IFFA 2R5BA 1MV8A 3KPEA 1LTJA 3L36A 3MGNA 4RESB 2WTYA 2FYUK 1N73B 1YYCA 3II6A 4LGDE 4I6MC 1OWAA 4DZOA 5AW3B 3V4WA 3RK2D 1E5WA 3VP9A 2JEEA 1S9KE 4AQRD 2OYHA 2YNYA 3M0DA 3RL0D 2P1JA 2J59M 1IJDB 1JTHA 2XU6A 3HRNA 2E43A 1KFNA 1HTLC 4XE5B 1GK6A 1X79B 2YO2A 3C9IA 4WY4D 1FJPA 1SQXK 2M3BA 2WWWA 3MIWA 5APTA 2QM7A 1IC2A 2WT7A 1W2EA 3CLQA 3U59A 1IK9A 2HLOA 3BRTB 4JYCA 1JOCA 5AW8B 4OH8B 3L37A 1LGHB 2C9NY 3GHGA 4Y99C 2HYNA 1L4AC 3KYQA 4W80A 2KB7P 3V2PA 1X8YA 2W27A 1M1JC 4N3YB 2CPBA 2NPSB 1KFMA 3NTNA 4IFMA 2A45H 1Z56A 4DOJA 1NWQA 3HD7D 5APWA 1SQBK 3OA7A 2NPSD 3UIAA 2FFDB 3HUSB 4LC1A 3GHGC 5APSA 1JTHB 1ZR4A 2YKQA 1HH0A 1NKZB 2C0XA 5KJ7C 4W7YA 5APVA 2ZFCA 2A45I 1N7LA 5AW0B 3HE5A 3N4XA 2WSEH 5BVZA 1NTMK 3HE4A 5AVWB 4IFDK 4WY4B 5BU8B 4KHXA 1SP4A 3U1CA 3L4FA 4LLHA 1N7SD 2IPPA 3OJAB 1GW3A 2OYHC 1LT9C 1SVFA 3RL0B 1JY2P 3V2RA 2WPRA 3R2PA 1HWTC 3A5TA 1GU4A 3LIDA 2FXMA 4JF7A 3H6PA 1URQD 3BASA 4AYCA 3MTUE 3P8CE 3KDPB 1J1EB 1KILD 2OYIB 2N1TC 2WPSA 2XDJA 5APQA 3RK3D 1L0LK 3CL3D 1FZCB 3M9BA 1SFCC 3E1IA 1FZFA 3TNUB 3RK2C 1CSBA 5AW1B 2Z5HA 1JMMA 1T3UA 1YTZT 1GL2C 3B8EB 3HE4B 5AVSB 1JO5A 4I2LC 2IFMA 2Q3IA 3M9HA 3T97A 2J58A 3WMM0 5KTBA 2FYZA 3H32B 3MD0A 3VMYA 1FZBA 2BASA 5KJ7A 2O01H 2Q5UA 1FZEA 1H88A 4EOTA 1AFOA 3TYYA 1EQ7A 4WY4C 2IFNA 1J1DB 3BVHA 1X9VA 3B5NB 1A02F 2P67A 1JCCA 2IX7C 2YO3A 1G2CA 3TK1A 1SLQA 1NTZK 1RE3A 1FBMA 5CCGD 4JYBA 1HJBA 3NXSA 1DEBA 2YMYA 1XTCC 3VYIA 1L4AD 1G1IA 2PAJA 5CCGA 2A45G 4WBAA 5APYA 1LTIC 2FFDA 1M7LA 2P7JA 2FKWB 1FZCC 1GW4A 5BU5A 2OYIA 1HGVA 3M91A 3N7NA 3HD7C 1PFIA 2LKMA 2NPSC 5AVQB 2Q7CA 1G1JA 1RE3C 5CCHD 2JJLA 1FZGA 1LT9B 3NMDA 1NO4A 3HTKB 5CJ0A 2N1TD 1N73A 1NKNA 2R32A 3TSIA 4W7ZA 2FFDC 2H8PD 2N1TA 1FZCA 2O1KA 3LW5H 2YKOA 3BATA 5AVYB 2N9BA 5AVTB 1SFCA 1OXZA 1VPCA 1T2KC 4Y99B 3VMZA 3TNUA 1J2JB 1LTJB 1SFCD 1CW5A 3IFMA 3B5NC 2ZXEB 3A7OA 1LWUB 1GL2D 1RF0A 1GL2B 5AW9B 1IFJA 2HG5D 1LTGC 1M1JA 1KQLA 2HPCA 3HUSA 2H7HA 1NTKK 4WY4A 1FOSF 1MZ9A 5CHXA 1URQC 1MFZA 2KLVA 1LTJC 1L4AB 1KILA 1L0NK 1J1DC 1RF1A 2WSCH 2WSFH 4N6JA 3RK3C 3V5BA 2C0WA 1FJKA 3A2AA 1JY3P 2N1TB 2H43A 4GT1A 4C46A 2MJZA 5CCGC 3GHGB 1CI6A 2O1JA 3G3ZA 3IR9A 2GM4A 1T3JA 1NAFA 5AVXB 2CPSA 1JY2O 1QL1A 1ZLLA 1JCDA 1KILC 1LTAC 2I1JA 1N2DC 3HD7A 1XTGB 1H89A 1RF1C 1N73C 2NPSA 1G2CB 5CJ4A 2KSJA 2I1KA 1NOHA 4C7NA 3U1AA 3V2NA 5CCHC 2W6AA 3NFQA 1FOSE 3P8CD 2P2UA 4GIFA 2WT7B 1HBWA 5AVUB 1KZUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BAT A;  3N7N A;  3HRN A;  4O9B A;  4N3Y B;  1WT6 A;  4ZKP A;  1X79 B;  3C9I A;  3N4X A;  4ZKU A;  5BVZ A;  2POH A;  3VP9 A;  2FXM A;  5BU8 B;  1NKN A;  3VP8 A;  5KTB A;  1IC2 A;  3BAS A;  3U1A A;  3U59 A;  3U1C A;  2JEE A;  4N78 D;  3P8C D;  4GIF A;  3OJA B;  5BU5 A;  4I1L A; 
#chains in the Genus database with same CATH topology
 1KB9 H;  1OZH A;  3V4Q A;  5GTI E;  3L71 D;  2OYH B;  1FC2 C;  1P84 I;  1SQP K;  5AVV B;  1MUU A;  1NU1 E;  1RH5 B;  2GA1 A;  1KIL B;  2V7Q H;  1U7M A;  2PFX A;  3B5N D;  3B71 A;  1DD4 A;  1RY3 A;  1LWU A;  2IYP A;  2OAR A;  2YMK A;  4O9B A;  4EI2 A;  1FS0 E;  4ZKP A;  2WIT A;  1IFN A;  2YKP A;  4EDF A;  2FYU D;  2R5D A;  2QJK C;  1GMJ A;  5M1B A;  3H25 A;  4OGQ B;  1GZL A;  1LTT C;  2QM8 A;  5CBN A;  1FAV A;  1PL5 A;  2I8D A;  2KK7 A;  4I7Z C;  2POH A;  5KAI H;  2WPQ A;  1KQF B;  2E5T A;  3PTZ A;  3RL0 C;  4PJ0 H;  3WU2 H;  1FU1 A;  5AW4 B;  5CCH A;  3ZDM A;  5TIS H;  3Q5S A;  1NTM J;  2R44 A;  1BGY J;  3E7K A;  1VQ9 P;  4BXL A;  2WZ7 A;  2QE7 H;  4K35 A;  1QEX A;  1SQV G;  3CCV P;  4N78 E;  5KAF H;  1FDM A;  3FWL A;  4N78 D;  1NHL A;  1WMK A;  1BCC E;  1RF0 C;  1JY3 N;  2BEZ F;  2R3C A;  1P84 H;  2ZT9 D;  2H88 C;  1IO4 A;  1LWU C;  2V7Q J;  4HJG H;  1GL2 A;  4M3L A;  1URQ A;  5DJU B;  1YIJ P;  3IAO A;  2O01 N;  4HKZ H;  4WB4 A;  3BCC G;  3I5C A;  2AEM A;  3H1L E;  3M9Q A;  3H1K E;  1RQV A;  1WT6 A;  3VMX A;  1RE4 A;  1ZR2 A;  3EQ2 A;  3HUS C;  2Q9I A;  1HUC A;  3VTP C;  2C9L Y;  1AQ5 A;  2KIK A;  3M06 A;  5GTI H;  1PPJ G;  3KQG A;  3TF5 A;  1M1K Q;  1SFC B;  1KTM A;  1SQV D;  2JWA A;  3V2Q A;  4Y28 J;  4EIJ A;  2WSE J;  1Y47 A;  4PV1 B;  1BE3 E;  4HH2 A;  1Q90 D;  1URQ B;  1L0L E;  1BE3 D;  1ZV8 A;  2Y0C A;  3VN0 A;  3CCJ P;  2NZ2 A;  4HYT B;  1DH3 A;  1Q86 Q;  4R4L A;  2IZ0 A;  3AE2 C;  1YJ9 P;  3W68 A;  2XZR A;  1DX7 A;  2JDI H;  3H1L G;  1EZV E;  3BCC D;  4I1L A;  1QL2 A;  1PP9 E;  3Q3D A;  1T2K D;  2M8R A;  1P84 D;  3P8M C;  1R5S A;  3L70 E;  1S9K D;  3HTK A;  1RE4 C;  5KLV G;  3SWF A;  3TGU J;  1LT9 A;  1NH4 A;  3F89 A;  2KSE A;  4B86 A;  1U57 A;  4ASV A;  2D2C D;  5AW7 B;  4U3F G;  4ZKU A;  2M3E A;  3L72 E;  2WQY C;  3RBX A;  3A3Y B;  5CBO A;  1N7S B;  2G3A A;  1JY2 N;  3HD7 B;  1QGK B;  1HVV A;  2AXT E;  3M0A A;  3L70 J;  1LTB C;  1LTS C;  1SQX D;  1SQQ K;  3CCR P;  5APU A;  5KLI B;  1NU1 D;  2HFE D;  3BRV B;  3O6Q A;  3S9O A;  3AEC C;  4XA4 A;  1T8Z A;  1FZA A;  1SQQ J;  3L74 G;  2OYI C;  2E42 A;  2PP6 A;  2HOD B;  2Z5I A;  4PD4 H;  5AW2 B;  5KLV K;  2RMZ A;  1VQ5 P;  1N86 A;  3OAK A;  3SWY A;  4C7R A;  1EZV G;  3Q1M A;  1KC8 Q;  5L8R J;  3FXE A;  4GOE A;  1H8A A;  1IFP A;  1IFD A;  2W6B A;  1KB9 D;  2HOD A;  1JUN A;  2KP8 A;  2XKM A;  3P7K A;  5B5E E;  1HGZ A;  4C7N B;  2VRS A;  1AV1 A;  5APX A;  3HE5 B;  2XV5 A;  3L75 G;  1ZOY C;  2QJY C;  3EFG A;  1NTZ D;  1NTK J;  1QX8 A;  2N9Y B;  2W83 C;  3H1I D;  3L71 G;  1R5L A;  1S3J A;  3O8Z A;  4H0L B;  4IL6 X;  5KJ7 D;  1S5L X;  3CI9 A;  1N7S C;  1VQM P;  1VQ6 P;  1AVY A;  1IZN B;  3AEF C;  1YTZ I;  1NU1 K;  5AVZ B;  1IFM A;  2FYU G;  1JEK A;  2GUV A;  2KYV A;  4K3A A;  1PGQ A;  3H1L D;  3L35 A;  4GKG A;  4PD4 D;  1VQP P;  1MFT A;  3V6I A;  1CI6 B;  1GD2 E;  1H0T A;  1CZQ A;  2IYO A;  2K37 A;  1BCC G;  1IFI A;  5AVR B;  2HPC B;  1ZN5 A;  1A02 J;  3P32 A;  3H1H E;  1M1J B;  5E79 H;  3RK3 E;  2Y9Z A;  2K88 A;  1SQV K;  2L5G B;  4I7Z B;  1JNM A;  3MUD A;  3AE8 C;  5CMZ A;  2M0B A;  3CXH I;  3SWK A;  1YQ3 C;  2PGD A;  1GK4 A;  1NAY A;  4GOD A;  1YHQ P;  2Z4E A;  1ZW0 A;  1OW6 A;  3USS A;  1BGY D;  1L4A A;  4DCK A;  3GF7 A;  1N7S A;  1VQN P;  3G71 P;  1SQX G;  1WRG A;  3H1I J;  1PGJ A;  2E75 D;  1NTM G;  5KAF E;  3B5N A;  3CX5 D;  3PP5 A;  3L74 D;  2A06 E;  1SS1 A;  3H1J G;  3H1I E;  3RK2 B;  1P84 E;  1OX3 A;  2GUS A;  2O01 J;  2IDB A;  1VDF A;  1LP1 B;  2IZ1 A;  2KS1 A;  2IBZ I;  1NTK G;  5C39 A;  3VP8 A;  4HB1 A;  3I55 P;  3Q5P A;  3MUD C;  1HBW A;  1JY3 O;  4H44 B;  2ITA A;  3LIE A;  5AW5 B;  3H32 A;  5AW6 B;  3L73 D;  1J1E C;  1PV3 A;  1ZRT E;  1BE3 G;  4H13 D;  3WU2 E;  3L73 E;  1L0L G;  1RHZ B;  1S5L E;  1NTZ G;  2ZJS E;  5H2F H;  3RK3 B;  1RF1 B;  3TGU D;  2YXR B;  2XNX A;  3M0D C;  1YIT P;  4ZMD A;  2QG4 A;  2KOG A;  4IFF A;  1D7M A;  2R5B A;  4H13 B;  1MV8 A;  3KPE A;  1LTJ A;  2A06 G;  3L36 A;  3MGN A;  4RES B;  2FYU K;  2WTY A;  3MHV A;  1YJW P;  2KXP B;  1W2B O;  2Y0E A;  3H1J D;  1YYC A;  3AE4 C;  1N73 B;  3L70 G;  4AUW A;  2W8Z A;  2K9J A;  3G9R A;  3II6 A;  2M5A B;  4I6M C;  1OWA A;  4LGD E;  2ZXX A;  2ZT9 B;  4WVZ A;  4DZO A;  5AW3 B;  1NU1 J;  3S1K A;  3CWB D;  3V4W A;  2RN0 A;  1E5W A;  3MZW B;  3RK2 D;  3VP9 A;  3CWB E;  3G4S P;  2WPV B;  4XFJ A;  4U3F D;  3CCE P;  2Q3E A;  3L73 G;  4MN4 C;  2LXB A;  2JEE A;  1S9K E;  2Q1K A;  2NRG A;  1SQQ G;  3L74 J;  4AQR D;  4UB8 H;  2RH0 A;  2OYH A;  2YNY A;  3M0D A;  3RL0 D;  2P1J A;  3L73 J;  1KOR A;  2J59 M;  5KKZ C;  1IK7 A;  1IJD B;  4BRY B;  1JTH A;  2ZYD A;  4GOF A;  2XU6 A;  3HRN A;  2E43 A;  1KFN A;  1OVU A;  1KIL E;  1YJN P;  3L71 E;  1HTL C;  2FYU J;  1W5C E;  3CWB G;  1GK6 A;  4XE5 B;  1X79 B;  2YO2 A;  3C9I A;  4WY4 D;  4JPZ B;  1QLE D;  1X0T A;  1FJP A;  3A0B E;  1FDO A;  5GTH H;  2JWD A;  2FYU E;  1SQX K;  2FXP A;  4H44 D;  5K5G B;  1GDT A;  2M3B A;  1PZQ A;  2E76 D;  2SPZ A;  2WWW A;  2QM7 A;  3MIW A;  5APT A;  1L0L D;  1IC2 A;  2WT7 A;  1AQT A;  1W2E A;  3CLQ A;  3U59 A;  4UB6 E;  2RKL A;  2JO1 A;  1IK9 A;  4L75 A;  4D6T J;  3CXH E;  1KYO H;  1BDD A;  2HLO A;  1JOC A;  3BRT B;  4JYC A;  2G8Y A;  5AW8 B;  3VOP A;  2A06 D;  3L37 A;  4OH8 B;  2FBW C;  1LGH B;  3I56 P;  2C9N Y;  3GHG A;  4Y99 C;  1EDK A;  2D2C C;  4KT0 J;  2HYN A;  3A0B H;  1L4A C;  3L70 D;  3CME P;  1KV4 A;  3KYQ A;  4W80 A;  2YXQ B;  4JBZ A;  4PJ0 E;  1M90 Q;  1OVR A;  2KB7 P;  3V2P A;  3CC7 P;  1X8Y A;  1E79 H;  2W27 A;  1M1J C;  1EDJ A;  3EFF K;  4PD4 E;  4N3Y B;  2CPB A;  4TLF A;  1M56 D;  2NPS B;  2B89 A;  1KFM A;  3JCU E;  1ZRT D;  3AEA C;  3NTN A;  2A45 H;  1KYO I;  4IFM A;  1Z56 A;  4DOJ A;  1NWQ A;  3HD7 D;  5APW A;  2MKV A;  2ZAE B;  1PGO A;  3TGU E;  1KQG B;  1NTM D;  1SQB K;  3KZI E;  3OA7 A;  2NPS D;  2QRX A;  3UIA A;  2FFD B;  3HUS B;  3CCU P;  4LC1 A;  3AE6 C;  3GHG C;  3H1J E;  5APS A;  1JTH B;  1ZR4 A;  1H0T B;  1L2P A;  2YKQ A;  1HH0 A;  1NKZ B;  1KMI Z;  1BE3 J;  3OW2 O;  2E5Y A;  2C0X A;  4PV1 C;  2H89 C;  5KJ7 C;  4W7Y A;  5APV A;  2ZFC A;  1MKM A;  2A45 I;  3BCC E;  3H1K G;  1N7L A;  5AW0 B;  4H0L C;  3TGU G;  1NTZ E;  3CC4 P;  3HE5 A;  1EXJ A;  4OGQ C;  3CCQ P;  3GW6 A;  3N4X A;  3PLN A;  1VQ8 P;  2WSE H;  5BVZ A;  1NTM K;  1SQB D;  2BCC D;  2AXC A;  1NTZ J;  2IBZ D;  1K04 A;  3FX0 A;  3HE4 A;  5AVW B;  1HF9 A;  1SQX J;  2P58 A;  4YXD C;  4IFD K;  1EZV D;  2OTK E;  4WY4 B;  1T6A A;  4L73 A;  5BU8 B;  3CCL P;  3BCC J;  4KHX A;  1SP4 A;  3SSU A;  1SQB J;  2BCC J;  3U1C A;  2OYO A;  2QJP B;  1FDI A;  1N8R Q;  3L4F A;  4LLH A;  1N7S D;  2WSC J;  2WSF J;  3B4S A;  2V4H A;  1PP9 G;  2IPP A;  3OJA B;  1GW3 A;  2OYH C;  1SQQ D;  1LT9 C;  1SQQ E;  1DIP A;  1QVF O;  1SVF A;  3RL0 B;  1GTW A;  1BGY E;  3A0H E;  1JY2 P;  4UB6 H;  3PHL A;  4U3F J;  4IL6 H;  2WT7 B;  1KYO E;  1SQB G;  2BCC G;  2IBZ G;  2WPR A;  3V2R A;  2B9B A;  2WSS H;  3CXH D;  1OMI A;  2BEQ D;  3R2P A;  1HWT C;  3A5T A;  1TU3 F;  1BCC D;  3C1L A;  1GU4 A;  3CCM P;  3CC2 P;  3LID A;  4BRY A;  1L0N D;  2FXM A;  4JF7 A;  2WMM A;  3H6P A;  5B66 E;  1URQ D;  3BAS A;  4AYC A;  1Q7Y Q;  1FE6 A;  2E75 C;  3MTU E;  3P8C E;  3QH9 A;  3KDP B;  1VQK P;  1J1E B;  3H1K D;  2L91 A;  1BGY G;  1USD A;  1KIL D;  3L72 D;  2OYI B;  3SFD C;  2N1T C;  2WPS A;  2XDJ A;  1JB0 J;  3H1H J;  5APQ A;  2E76 C;  1YQ4 C;  2QJK B;  3RK3 D;  2OQQ A;  1L0L K;  1OW7 A;  3CL3 D;  5KLI C;  1FZC B;  1EDI A;  3M9B A;  1SFC C;  4KJM A;  1U7J A;  3E1I A;  2K9J B;  3TNU B;  3RK2 C;  1KQS O;  1S1C X;  4NPF X;  1FZF A;  2WVR A;  1CSB A;  2KS1 B;  2Z5H A;  3ABV C;  5AW1 B;  1JMM A;  1OVV A;  1T3U A;  1YTZ T;  1GL2 C;  3B8E B;  5B66 H;  1Q82 Q;  1NTK D;  1BDC A;  3HE4 B;  5E79 E;  1L0N G;  5AVS B;  3JSV C;  3RGU A;  4I2L C;  1JO5 A;  2FYN C;  2E74 C;  2IFM A;  2Q3I A;  3M9H A;  5DJT B;  1AJY A;  3T97 A;  2YIU B;  4R4M A;  1NJI Q;  4IOI H;  3LW5 J;  4BWN A;  3CPW O;  1PPJ E;  2J58 A;  2QIW A;  3D6Y A;  1PP9 D;  1L0N J;  3WMM 0;  3WUU A;  5KTB A;  2E75 B;  2FYZ A;  3AEB C;  3H32 B;  2QJY B;  3PRJ A;  5KLV J;  1VF5 C;  3MD0 A;  1AVO A;  3VMY A;  1PIX A;  2R3S A;  1BCC J;  2ZVN B;  3GF3 A;  1FZB A;  2BAS A;  3A0H H;  5KJ7 A;  2O01 H;  2Q5U A;  4D6T E;  1FZE A;  1H88 A;  4EOT A;  1AFO A;  2AEJ A;  4OGQ D;  4A7P A;  3D71 A;  3TYY A;  1EQ7 A;  4WY4 C;  2IFN A;  1LJ2 A;  2KI7 B;  1J1D B;  2B88 A;  1NYH A;  3BVH A;  1X9V A;  3B5N B;  1GU5 A;  4L74 A;  4H44 C;  1EC5 A;  2KLU A;  1SQX E;  1A02 F;  2AXT H;  1NTM E;  1JCC A;  2P67 A;  3H1H D;  2KNC A;  2IX7 C;  2YO3 A;  1G2C A;  3AED C;  2ZVO B;  3R4Y A;  3TDK A;  1S2E A;  3TK1 A;  1SLQ A;  1VQL P;  2LR2 A;  1K9M Q;  2FXO A;  1NTZ K;  1RE3 A;  1FBM A;  2OGU A;  4NPE A;  1OIP A;  4NPD A;  1ZME C;  5CCG D;  1NTK E;  4JYB A;  3L72 G;  1HJB A;  1SQP E;  1KB9 E;  1DEB A;  3NXS A;  4JQ0 D;  1KYO D;  2YMY A;  1XTC C;  4H0L D;  1OW8 A;  1K05 A;  1L4A D;  3AE9 C;  1G1I A;  2KZJ A;  2PAJ A;  3E1R A;  3SFE C;  1AA0 A;  5CCG A;  1VQ4 P;  2A45 G;  2K3R A;  4WBA A;  1PPJ D;  2XND H;  2LXC B;  5APY A;  1LTI C;  5B5E H;  1M7L A;  2P7J A;  2FFD A;  1USE A;  1M8O B;  2FKW B;  3L74 E;  1K73 Q;  3EWK A;  1NGM B;  1FZC C;  1JMB A;  3CD6 P;  1GW4 A;  3H1J J;  5BU5 A;  2OYI A;  1EXI A;  4Z1M H;  5GTH E;  5TJH A;  3RBZ A;  3GG2 A;  4WWI A;  1HGV A;  2JR8 A;  3M91 A;  3N7N A;  1SQB E;  2BCC E;  2IBZ E;  3HD7 C;  1UII A;  3O6Q B;  3IN6 A;  2QSI A;  1M57 D;  3VMA A;  4DJG A;  1X22 A;  1PFI A;  2LKM A;  2NPS C;  5AVQ B;  3KHU A;  1G1J A;  1RE3 C;  2Q7C A;  2E74 B;  2FY8 A;  3CMA P;  1S72 P;  5CCH D;  1YI2 P;  2JJL A;  3K5B A;  1KD1 Q;  1FZG A;  1LT9 B;  3JC2 2;  3NMD A;  4RJT A;  5KLV D;  2CK3 H;  1NO4 A;  3HTK B;  5CJ0 A;  1NVO A;  3L71 J;  1R8E A;  2N1T D;  3AE1 C;  3ITK A;  3L75 J;  2ZYA A;  1N73 A;  1NKN A;  2D2C B;  2R32 A;  4W7Z A;  3H1L J;  3TSI A;  3W67 A;  2FFD C;  1PP9 J;  2QA4 P;  1KN7 A;  2QJP C;  3QWO C;  2H8P D;  2N1T A;  1FZC A;  2O1K A;  2UWJ E;  3AEG C;  3FGA D;  1JM0 A;  3LW5 H;  2YKO A;  3H1H G;  5TIS E;  1N73 C;  1Q81 Q;  3BAT A;  3T97 B;  2JP3 A;  3CXH H;  4UB8 E;  3D6Z A;  1UIX A;  5AVY B;  4ZNC A;  2N9B A;  3Q5R A;  1L0N E;  1LP1 A;  1SFC A;  5AVT B;  1OXZ A;  1VPC A;  2P10 A;  1T2K C;  4PV1 D;  4Y99 B;  3VMZ A;  3TNU A;  3AE7 C;  3H1K J;  1J2J B;  4OWF A;  4D6T D;  1LTJ B;  3VYI A;  1SFC D;  1Q2N A;  4PD4 I;  3IFM A;  1CW5 A;  1QVG O;  3B5N C;  3AE5 C;  3L75 D;  2ZXE B;  3A7O A;  3H1I G;  1LWU B;  2W90 A;  1GL2 D;  1BSH A;  1RF0 A;  1GL2 B;  1VQ7 P;  4TT3 H;  5AW9 B;  2E74 D;  2AEF A;  1HJ0 A;  1SQV E;  1IFJ A;  1RQU A;  2OTJ P;  4DT0 A;  3KZI H;  1LNQ A;  2HG5 D;  4OVN F;  3D70 A;  2OTL P;  1LTG C;  3CX5 H;  3FXD A;  1M1J A;  1VL2 A;  1KQL A;  2HPC A;  2M5A A;  3HUS A;  4U7J A;  1ZXG A;  1NTK K;  3FWN A;  4D6T G;  2Y9Y A;  4WY4 A;  1FOS F;  2H7H A;  1Y8A A;  1MZ9 A;  5CHX A;  1URQ C;  3L72 J;  1MFZ A;  2FYN B;  2KLV A;  2ZT9 C;  5EFW B;  1LTJ C;  2DW3 A;  3MP7 B;  1L4A B;  3G6E P;  1KIL A;  1L0N K;  4YXW H;  1SQP G;  1J1D C;  1RF1 A;  1EDL A;  2WSC H;  2WSF H;  4N6J A;  1Y9B A;  3RK3 C;  2K1A A;  3GLM A;  2O3J A;  1EZV I;  5H2F E;  1S5L H;  3V5B A;  3RL0 g;  3JCU H;  2C0W A;  4RO0 A;  1FJK A;  3A2A A;  4IL6 E;  1JY3 P;  3AEE C;  2N1T B;  4EYY Q;  2H43 A;  4GT1 A;  3CX5 I;  2KZI A;  2MJZ A;  4C46 A;  5KLV E;  2PRR A;  3GHG B;  4QMA A;  5CCG C;  5AVU B;  1CI6 A;  2O1J A;  3G3Z A;  1SQP J;  3IR9 A;  3KXD A;  2GM4 A;  1T3J A;  3IF4 A;  4YPC A;  2HR3 A;  4GDO A;  1NAF A;  5AVX B;  1KB9 I;  1JY2 O;  1OFC X;  1QL1 A;  1ZLL A;  2CPS A;  2ZYG A;  1LT1 A;  1JCD A;  3AE3 C;  3PH0 A;  3WUV A;  1KIL C;  1SQP D;  1S4X A;  1LTA C;  3CWB J;  4YTP C;  2I1J A;  1N2D C;  3HD7 A;  1VF5 D;  1K8A Q;  2YIU C;  1XTG B;  1YBK A;  3F5H A;  1DEE G;  2Q6Q A;  2QVA A;  1H89 A;  1RF1 C;  2NPS A;  3CX5 E;  1NU1 G;  1G2C B;  3PJS K;  5CJ4 A;  2KUB A;  4U3F E;  2KNC B;  2KSJ A;  1DD3 A;  5KKZ B;  3GMA A;  2I1K A;  1NOH A;  2K9Y A;  4H13 C;  2B87 A;  1VQO P;  2Y0D A;  4C7N A;  3WUT A;  1VF5 B;  1ZP0 C;  2JKV A;  4ASW A;  3U1A A;  3V2N A;  5CCH C;  3CCS P;  3Q2Y A;  1PGP A;  1SQV J;  2W6A A;  3NFQ A;  4L76 A;  4RKU J;  1FOS E;  5KAI E;  2J5U A;  4CPG A;  2E76 B;  2W6J H;  2P2U A;  3P8C D;  3S4R A;  4GIF A;  3C8V A;  2QEX P;  2B87 B;  1L0L J;  1BSN A;  3L75 E;  1KZU B; 
#chains in the Genus database with same CATH homology
 3V4Q A;  2OYH B;  1GTW A;  1SQP K;  5AVV B;  1MUU A;  1JNM A;  1KIL B;  3B5N D;  4O9B A;  1RY3 A;  2OAR A;  1LWU A;  4ZKP A;  2WIT A;  1IFN A;  2YKP A;  1GD2 E;  2R5D A;  1GZL A;  1LTT C;  2QM8 A;  1FAV A;  2POH A;  4AUW A;  2WPQ A;  3RL0 C;  5CCH A;  1FU1 A;  5AW4 B;  2WZ7 A;  4N78 E;  4N78 D;  1NHL A;  1RF0 C;  1JY3 N;  2R3C A;  1IO4 A;  1LWU C;  1GL2 A;  1URQ A;  4WB4 A;  3M9Q A;  3I5C A;  1WT6 A;  3VMX A;  1RE4 A;  1ZR2 A;  3EQ2 A;  3HUS C;  2Q9I A;  1HUC A;  3VTP C;  2C9L Y;  1AQ5 A;  3M06 A;  3KQG A;  1SFC B;  3V2Q A;  4EIJ A;  4HH2 A;  1URQ B;  1ZV8 A;  3VN0 A;  4HYT B;  1DH3 A;  1DX7 A;  2XZR A;  4I1L A;  1T2K D;  1QL2 A;  2M8R A;  3P8M C;  1S9K D;  3HTK A;  1RE4 C;  3SWF A;  1LT9 A;  1NH4 A;  4B86 A;  5AW7 B;  4ZKU A;  3A3Y B;  1N7S B;  1JY2 N;  3HD7 B;  3M0A A;  1HVV A;  1LTB C;  1LTS C;  1SQQ K;  5APU A;  2HFE D;  3BRV B;  4XA4 A;  1T8Z A;  1FZA A;  2OYI C;  2E42 A;  2PP6 A;  2HOD B;  2Z5I A;  5AW2 B;  5KLV K;  1FDM A;  1N86 A;  3OAK A;  3SWY A;  4C7R A;  1H8A A;  2W6B A;  1IFD A;  2HOD A;  1JUN A;  2KP8 A;  2XKM A;  3P7K A;  1HGZ A;  4C7N B;  2VRS A;  5APX A;  3HE5 B;  2XV5 A;  3EFG A;  4M3L A;  1GU5 A;  3O8Z A;  5KJ7 D;  3CI9 A;  1N7S C;  1YTZ I;  1NU1 K;  5AVZ B;  1IFM A;  2GUV A;  2KYV A;  3L35 A;  4GKG A;  1CI6 B;  1CZQ A;  1IFI A;  5AVR B;  2HPC B;  1ZN5 A;  1A02 J;  3P32 A;  1GDT A;  1M1J B;  1SQV K;  2L5G B;  3MUD A;  5CMZ A;  1GK4 A;  2Z4E A;  1L4A A;  1N7S A;  1WRG A;  3B5N A;  3PP5 A;  3RK2 B;  3VOP A;  2GUS A;  1VDF A;  3VP8 A;  1JY3 O;  3LIE A;  5AW5 B;  3H32 A;  5AW6 B;  1J1E C;  1RF1 B;  3RK3 B;  3M0D C;  2XNX A;  2KOG A;  4IFF A;  2R5B A;  1MV8 A;  3KPE A;  1LTJ A;  3L36 A;  3MGN A;  4RES B;  2WTY A;  2FYU K;  1N73 B;  1YYC A;  3II6 A;  4LGD E;  4I6M C;  1OWA A;  4DZO A;  5AW3 B;  3V4W A;  3RK2 D;  1E5W A;  3VP9 A;  2JEE A;  1S9K E;  4AQR D;  2OYH A;  2YNY A;  3M0D A;  3RL0 D;  2P1J A;  2J59 M;  1IJD B;  1JTH A;  2XU6 A;  3HRN A;  2E43 A;  1KFN A;  1HTL C;  4XE5 B;  1GK6 A;  1X79 B;  2YO2 A;  3C9I A;  4WY4 D;  1FJP A;  1SQX K;  2M3B A;  2WWW A;  3MIW A;  5APT A;  2QM7 A;  1IC2 A;  2WT7 A;  1W2E A;  3CLQ A;  3U59 A;  1IK9 A;  2HLO A;  3BRT B;  4JYC A;  1JOC A;  5AW8 B;  4OH8 B;  3L37 A;  1LGH B;  2C9N Y;  3GHG A;  4Y99 C;  2HYN A;  1L4A C;  3KYQ A;  4W80 A;  2KB7 P;  3V2P A;  1X8Y A;  2W27 A;  1M1J C;  4N3Y B;  2CPB A;  2NPS B;  1KFM A;  3NTN A;  4IFM A;  2A45 H;  1Z56 A;  4DOJ A;  1NWQ A;  3HD7 D;  5APW A;  1SQB K;  3OA7 A;  2NPS D;  3UIA A;  2FFD B;  3HUS B;  4LC1 A;  3GHG C;  5APS A;  1JTH B;  1ZR4 A;  2YKQ A;  1HH0 A;  1NKZ B;  2C0X A;  5KJ7 C;  4W7Y A;  5APV A;  2ZFC A;  2A45 I;  1N7L A;  5AW0 B;  3HE5 A;  3N4X A;  2WSE H;  5BVZ A;  1NTM K;  3HE4 A;  5AVW B;  4IFD K;  4WY4 B;  5BU8 B;  4KHX A;  1SP4 A;  3U1C A;  3L4F A;  4LLH A;  1N7S D;  2IPP A;  3OJA B;  1GW3 A;  2OYH C;  1LT9 C;  1SVF A;  3RL0 B;  1JY2 P;  3V2R A;  2WPR A;  3R2P A;  1HWT C;  3A5T A;  1GU4 A;  3LID A;  2FXM A;  4JF7 A;  3H6P A;  1URQ D;  3BAS A;  4AYC A;  3MTU E;  3P8C E;  3KDP B;  1J1E B;  1KIL D;  2OYI B;  2N1T C;  2WPS A;  2XDJ A;  5APQ A;  3RK3 D;  1L0L K;  3CL3 D;  1FZC B;  3M9B A;  1SFC C;  3E1I A;  1FZF A;  3TNU B;  3RK2 C;  1CSB A;  5AW1 B;  2Z5H A;  1JMM A;  1T3U A;  1YTZ T;  1GL2 C;  3B8E B;  3HE4 B;  5AVS B;  1JO5 A;  4I2L C;  2IFM A;  2Q3I A;  3M9H A;  3T97 A;  2J58 A;  3WMM 0;  5KTB A;  2FYZ A;  3H32 B;  3MD0 A;  3VMY A;  1FZB A;  2BAS A;  5KJ7 A;  2O01 H;  2Q5U A;  1FZE A;  1H88 A;  4EOT A;  1AFO A;  3TYY A;  1EQ7 A;  4WY4 C;  2IFN A;  1J1D B;  3BVH A;  1X9V A;  3B5N B;  1A02 F;  2P67 A;  1JCC A;  2IX7 C;  2YO3 A;  1G2C A;  3TK1 A;  1SLQ A;  1NTZ K;  1RE3 A;  1FBM A;  5CCG D;  4JYB A;  1HJB A;  3NXS A;  1DEB A;  2YMY A;  1XTC C;  3VYI A;  1L4A D;  1G1I A;  2PAJ A;  5CCG A;  2A45 G;  4WBA A;  5APY A;  1LTI C;  2FFD A;  1M7L A;  2P7J A;  2FKW B;  1FZC C;  1GW4 A;  5BU5 A;  2OYI A;  1HGV A;  3M91 A;  3N7N A;  3HD7 C;  1PFI A;  2LKM A;  2NPS C;  5AVQ B;  2Q7C A;  1G1J A;  1RE3 C;  5CCH D;  2JJL A;  1FZG A;  1LT9 B;  3NMD A;  1NO4 A;  3HTK B;  5CJ0 A;  2N1T D;  1N73 A;  1NKN A;  2R32 A;  3TSI A;  4W7Z A;  2FFD C;  2H8P D;  2N1T A;  1FZC A;  2O1K A;  3LW5 H;  2YKO A;  3BAT A;  5AVY B;  2N9B A;  5AVT B;  1SFC A;  1OXZ A;  1VPC A;  1T2K C;  4Y99 B;  3VMZ A;  3TNU A;  1J2J B;  1LTJ B;  1SFC D;  1CW5 A;  3IFM A;  3B5N C;  2ZXE B;  3A7O A;  1LWU B;  1GL2 D;  1RF0 A;  1GL2 B;  5AW9 B;  1IFJ A;  2HG5 D;  1LTG C;  1M1J A;  1KQL A;  2HPC A;  3HUS A;  2H7H A;  1NTK K;  4WY4 A;  1FOS F;  1MZ9 A;  5CHX A;  1URQ C;  1MFZ A;  2KLV A;  1LTJ C;  1L4A B;  1KIL A;  1L0N K;  1J1D C;  1RF1 A;  2WSC H;  2WSF H;  4N6J A;  3RK3 C;  3V5B A;  2C0W A;  1FJK A;  3A2A A;  1JY3 P;  2N1T B;  2H43 A;  4GT1 A;  4C46 A;  2MJZ A;  5CCG C;  3GHG B;  1CI6 A;  2O1J A;  3G3Z A;  3IR9 A;  2GM4 A;  1T3J A;  1NAF A;  5AVX B;  2CPS A;  1JY2 O;  1QL1 A;  1ZLL A;  1JCD A;  1KIL C;  1LTA C;  2I1J A;  1N2D C;  3HD7 A;  1XTG B;  1H89 A;  1RF1 C;  1N73 C;  2NPS A;  1G2C B;  5CJ4 A;  2KSJ A;  2I1K A;  1NOH A;  4C7N A;  3U1A A;  3V2N A;  5CCH C;  2W6A A;  3NFQ A;  1FOS E;  3P8C D;  2P2U A;  4GIF A;  2WT7 B;  1HBW A;  5AVU B;  1KZU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...