2JEEA

Xray structure of e. coli yiiu
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
78
structure length
78
Chain Sequence
MSLEVFEKLEAKVQQAIDTITLLQMEIEELKEKNNSLSQEVQNAQHQREELERENNHLKEQQNGWQERLQALLGRMEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN ZAPB
publication title Novel Coiled-Coil Cell Division Factor Zapb Stimulates Z Ring Assembly and Cell Division.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle
total genus 30
structure length 78
sequence length 78
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06005 ZapB Cell division protein ZapB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2jeeA00
5BVZA 5BU8B 2POHA 3N7NA 4N78D 3BASA 4O9BA 4ZKPA 2JEEA 4N3YB 3N4XA 1NKNA 3P8CD 1IC2A 5BU5A 3BATA 4I1LA 5KTBA 1WT6A 3U1AA 3HRNA 4ZKUA 3C9IA 3U1CA 1X79B 3OJAB 2FXMA 3VP8A 4GIFA 3VP9A 3U59A
chains in the Genus database with same CATH superfamily
3RK3B 2FYUK 3CWBD 3L74D 1IZNB 2P10A 5APTA 3CXHI 1L4AB 4H0LD 3L75D 5CCHC 1RE3C 1WRGA 2IBZI 4I1LA 2YO2A 2KS1A 2M8RA 4DCKA 3SFEC 5KLVJ 4IOIH 5AVZB 2V7QH 1NTKK 1SQVD 3SFDC 1LWUB 3BCCJ 3NFQA 5M1BA 3AE1C 1FU1A 1NKNA 1NU1G 3S9OA 1SS1A 1KFNA 1BCCG 3L73J 4OGQC 5TJHA 2AEMA 4UB8E 5GTIH 2YXQB 3Q5RA 5KLVE 3WMM0 3TNUB 1KQSO 3BCCE 3OW2O 3ZDMA 4HB1A 3NXSA 1FZGA 1JY3P 3C8VA 1KILA 1G1JA 1J1EC 1N7SD 3C9IA 1SQBD 2KLVA 3L73E 1YBKA 2OYIA 4WY4C 2R3CA 1AVYA 3MGNA 4K3AA 3E1IA 2B9BA 4AYCA 2QRXA 1NAFA 2HPCA 1VPCA 3H1KD 1S72P 3OAKA 3U1CA 3M0AA 1FOSE 3FWLA 1S5LE 2BASA 4N78D 1OW7A 2R5BA 1KC8Q 3JC22 4PD4E 3CC2P 3II6A 4BRYA 3B4SA 2QM8A 1VDFA 1BDDA 2K37A 3L71G 1Q82Q 4GOEA 1RF0A 3GF7A 3P7KA 2B88A 1QEXA 4PJ0E 3MP7B 2QJYB 4IL6X 3AE9C 2P1JA 3A0HE 1M1JC 3H1HE 1J1DB 1SQXJ 4WBAA 4EIJA 3W68A 1GW3A 5DJTB 4Z1MH 2IZ0A 2CK3H 2XZRA 2HODA 3FGAD 2WPRA 2KP8A 4H13B 3Q1MA 1EDLA 2Y0CA 1A02J 3E1RA 2MJZA 1SQQG 1BDCA 3VYIA 5CJ0A 2QG4A 1NGMB 2ZT9D 4UB8H 3CMAP 1KFMA 5KTBA 3MIWA 1SQXE 1M1KQ 3RK3C 1SQVK 3UIAA 2O3JA 4Y99B 1FAVA 1KYOE 1L4AC 3BATA 2ZVNB 3SWKA 2BEQD 1NTMG 1FZCB 1BGYJ 4U3FJ 1T6AA 1FZFA 3V2PA 5KLVD 5AW7B 3L36A 2JEEA 4L74A 2P58A 5CJ4A 1URQD 3BCCD 1JMMA 1S5LH 1SQBK 2AXTE 2BCCD 3G71P 1YITP 4PD4H 1BGYE 3RBXA 1IFJA 4JYBA 4U3FE 1RF0C 1EZVD 4GODA 1R5SA 2DW3A 3TF5A 2PGDA 1LTJA 1VQLP 3PHLA 1SP4A 2MKVA 1JMBA 3OJAB 1EZVI 1M7LA 4PJ0H 1T2KD 3A0HH 3WUTA 5TISE 1KILE 4H44B 1X0TA 2D2CD 4PD4D 1OVUA 1NJIQ 1FZEA 2IBZG 4JPZB 3CWBG 3L74G 4KHXA 1U57A 1JOCA 2UWJE 1AJYA 3V6IA 3L70J 4L75A 1N73A 4LLHA 1FDOA 1MV8A 2O1KA 3CI9A 1JCDA 3A2AA 2ZT9B 1FDIA 3F5HA 1KYOH 3PLNA 4L76A 1H0TB 1BE3E 2YKPA 3SSUA 1QX8A 1J1DC 4TLFA 3L70E 2I1JA 1SQXD 1USDA 2NZ2A 1KV4A 2R32A 3E7KA 2KSEA 1KYOD 1PGPA 5AVUB 3SWFA 3CCMP 2IYPA 1L0LJ 1YJNP 4EDFA 2AXTH 2M5AA 1K04A 2WWWA 3TGUJ 1EXJA 2AXCA 1KYOI 1OFCX 1HGZA 2OYOA 2OARA 2K3RA 4D6TG 4O9BA 2OTJP 3M9QA 2CPBA 3FWNA 1KB9E 3H1KG 4I7ZB 2NPSD 2P7JA 1NTZJ 1A02F 3RBZA 1FZCC 1DH3A 1L0LE 3TK1A 3CL3D 5TISH 1G2CB 1FZBA 3IFMA 3KYQA 4M3LA 4U3FD 1VQKP 5KLIB 1EC5A 1ZRTD 1N73C 1GL2A 3IAOA 2H88C 2D2CB 2W90A 3CCJP 1NTZE 1X79B 3HD7D 1MFZA 5KJ7A 3PJSK 3GHGB 1S9KE 5KAFE 1LTSC 4HJGH 1KILD 3CD6P 2G3AA 1ZMEC 3RGUA 1DIPA 2FXPA 3H25A 2J5UA 2E74B 3HTKA 5DJUB 2YIUB 2A06E 4H44C 3MD0A 1D7MA 3NTNA 1RF1A 5CCHA 3H1IE 1EDKA 1G2CA 1ZN5A 1JB0J 3S4RA 3N7NA 1OVVA 3QWOC 2NRGA 1DD3A 3H1LJ 1ZLLA 1UIIA 3M91A 3A5TA 3KQGA 3A0BE 5AVXB 2WTYA 2LXCB 1SQXK 5KLVG 5CCGD 1H8AA 3CCRP 2JO1A 3GHGA 1X9VA 3M9BA 4HH2A 3AECC 3AEBC 2E43A 4WWIA 3L4FA 2KZIA 3H1LE 2BCCG 1FZAA 2K9JA 2KNCB 1EZVG 2QVAA 3L72J 3GF3A 5APQA 3C1LA 1LTIC 2ZYDA 5KJ7C 1CI6B 3RK2D 5AVVB 1HUCA 2LXBA 4RESB 2IFNA 2Q1KA 2Z4EA 3B8EB 1CW5A 4AQRD 2HFED 2FXMA 1L0LD 3USSA 2Q6QA 5KAFH 2N1TA 2Q3EA 4OVNF 3HD7B 2BEZF 2L5GB 1HVVA 3TGUD 3L72E 2Z5HA 1VF5D 1ZXGA 4I7ZC 1GU4A 1JO5A 1KQFB 3D6YA 1Y9BA 1IC2A 1RF1C 1Z56A 1N86A 1VQ6P 3LIEA 1XTCC 3AE5C 1NTZD 2Y0EA 2QJKB 1YQ3C 2R44A 4RO0A 2YXRB 5KLIC 3I56P 3AE8C 1M1JA 3TYYA 1S9KD 1ZP0C 4ZMDA 3R2PA 3V2RA 2KYVA 2KXPB 5AW6B 3I55P 3JSVC 2ZVOB 3VP9A 1NHLA 2IZ1A 4GKGA 2XV5A 2OYHA 3GHGC 1LP1A 3WUUA 3GW6A 1NWQA 2CPSA 3A0BH 4DT0A 4ASVA 1IFPA 3ABVC 1S4XA 3KDPB 2JP3A 1SFCD 2QM7A 3A7OA 3RL0C 1M8OB 3V5BA 1PP9G 2OGUA 4IFDK 1OW8A 2OTKE 3WU2E 4PV1D 1L4AA 4W7ZA 3A3YB 5AW3B 2M0BA 3B5NB 5GTHH 1LTGC 3PTZA 2KUBA 1SQPK 5CMZA 1AVOA 2N1TC 2C9NY 1LWUA 1SLQA 3H1HJ 5AW0B 2E75D 2W27A 1R5LA 1MZ9A 5AVRB 3L35A 3I5CA 2YKOA 3H1LD 3M0DC 2FYUG 2V4HA 3TNUA 1NU1J 2OTLP 5BU5A 2H89C 3MTUE 4C46A 3O6QB 1S3JA 1L0LK 4OWFA 4H0LB 1GW4A 4JYCA 1NTKG 1OW6A 5C39A 1AFOA 1HJ0A 2OYHC 3JCUE 3M9HA 5APXA 2ZXXA 3RL0g 1QLED 1JUNA 5AW5B 1IFIA 2B89A 1N2DC 1NU1E 3NMDA 1OX3A 1BCCE 4L73A 1IJDB 3CCVP 1NTZK 4B86A 2YO3A 1YI2P 1GTWA 1L0NG 2Y0DA 4IFMA 3H1JG 4BXLA 5K5GB 2WITA 2Q5UA 2W6BA 2QJKC 1N7SB 2OQQA 4U7JA 2GA1A 1LWUC 4N6JA 4OH8B 4ZKPA 2Q9IA 1GL2D 2WVRA 3KPEA 2W83C 1AA0A 1Y47A 2ZFCA 1RE4A 1Q81Q 2M3BA 2XKMA 2ITAA 2RN0A 1OWAA 2E76D 2QE7H 3L73D 5BU8B 4DOJA 3IN6A 2FFDB 4W80A 1QGKB 1OZHA 2J58A 3CLQA 5L8RJ 3BVHA 2SPZA 3P8MC 3BASA 4AUWA 3CMEP 1SQQJ 4EI2A 5CCHD 5AVSB 1YTZI 2W6JH 1L2PA 4WVZA 3B5NC 3RK3E 1HGVA 1FZCA 5AVYB 3GG2A 4NPFX 3JCUH 5CHXA 2JJLA 3HE4B 3TGUG 2JKVA 1BE3J 1BSHA 4PD4I 3L75G 2O1JA 2JWAA 1BSNA 1SQQE 4OGQD 3H1HD 1NTMJ 3AEGC 1FS0E 3U1AA 1DEBA 1SQPJ 3B71A 2LKMA 1SQVG 3CCEP 3Q5PA 1HJBA 1LGHB 3H32B 2QJYC 2FFDA 3VMXA 2Y9YA 2WQYC 1M90Q 3D71A 2HR3A 2E42A 3WUVA 1OIPA 3VN0A 2XDJA 4H0LC 1RE4C 1NTME 1NU1D 5KAIE 1NAYA 4WY4D 1OXZA 1SQPE 4H13C 1PPJE 4C7RA 1PZQA 4EYYQ 4HYTB 2WSEJ 1YQ4C 3AEAC 1SQBG 2KIKA 1PGQA 3HE4A 1CZQA 2GM4A 3BRTB 2QJPB 1URQB 5H2FE 4QMAA 1JEKA 1Y8AA 1IFDA 2O01J 4Y99C 1S2EA 4XE5B 1JY2N 2E76B 5AW4B 2WSFJ 2WZ7A 3H6PA 1GK4A 2KI7B 5KKZB 3D70A 4CPGA 1LT9B 2WT7B 2Z5IA 1PGOA 1LT1A 2B87B 3IF4A 1NOHA 3VMYA 5APVA 1N7SC 2E5YA 1H0TA 2ZJSE 3Q5SA 1ZV8A 1BGYD 1JY3N 3CXHE 1GK6A 2ZXEB 2KSJA 2FYNB 2RH0A 4KJMA 2IBZE 3HE5B 3CWBE 3L74E 1YIJP 2AEFA 3CC4P 4JF7A 1YHQP 2FFDC 3CCSP 1SVFA 3H1IJ 1USEA 1QL2A 1JM0A 3RK3D 2IFMA 2WPSA 1MUUA 3AE7C 1URQA 4OGQB 5AVWB 4C7NB 1L4AD 3V4QA 2AEJA 1NVOA 3AEDC 1RQVA 1FJPA 4JQ0D 1LT9A 3N4XA 3GMAA 5KAIH 1P84E 2P2UA 1SQQD 1CSBA 3HRNA 1J1EB 2KK7A 3T97B 3Q3DA 4K35A 4D6TJ 1VQPP 2JWDA 2IPPA 1N7LA 1XTGB 1VQMP 1BE3D 1Q86Q 3PP5A 3HE5A 5H2FH 1NU1K 2ZT9C 3L70D 4IFFA 1NTMD 1SQPD 2XU6A 1RY3A 5GTIE 5B66E 1KB9H 1PPJD 3EWKA 2WSEH 3BCCG 4D6TE 1G1IA 1M56D 3H1KE 1EDJA 1ZR4A 4XA4A 2PRRA 2NPSB 3L73G 3FXEA 2KS1B 4Y28J 3CCLP 2O01H 2I8DA 2L91A 4RKUJ 2WSFH 1Q7YQ 1E5WA 1KB9D 1J2JB 3OA7A 1PL5A 2QJPC 1URQC 1DD4A 3O8ZA 1IK7A 5AW1B 3KHUA 3Q2YA 1KB9I 5KKZC 2WSCJ 4NPDA 1LT9C 3TSIA 1U7MA 3GLMA 1KILB 1FE6A 3M0DA 1JCCA 2OYIB 3EFFK 4WB4A 2IDBA 3H1HG 1VQOP 1P84H 1T2KC 1HF9A 2QIWA 1LNQA 2FYNC 1NH4A 1W5CE 2KNCA 2D2CC 2NPSA 4RJTA 4H13D 2HPCB 1KQLA 3LW5J 1KMIZ 2PAJA 1CI6A 2R5DA 2A06D 3AE6C 1SQQK 3VTPC 4BRYB 2BCCJ 1JY2P 1KD1Q 1P84D 1SQXG 3H1ID 3CCUP 5B66H 1VQ8P 1ZR2A 4GIFA 2E74C 3HD7A 3LIDA 2YIUC 2Q3IA 1K05A 1T3UA 2YKQA 1VQ4P 1L0NK 4YPCA 2HLOA 1P84I 2LR2A 1DX7A 2YNYA 1NTMK 2BCCE 1K8AQ 2HODB 1EZVE 3HUSB 3AE4C 1KTMA 4D6TD 1QVGO 3RK2B 2FKWB 2R3SA 1BGYG 3AEEC 4U3FG 1LTBC 1Q90D 5BVZA 3AE3C 4YXWH 4EOTA 1X8YA 2WPVB 1BCCJ 1VF5B 2NPSC 4ZNCA 1EDIA 3VOPA 4H44D 3V2NA 1GMJA 5E79E 5CCGA 2W8ZA 2WSCH 4JBZA 3QH9A 3MUDA 3L72D 3B5NA 1JTHB 2HG5D 2QA4P 1AQ5A 1NO4A 1WMKA 5APSA 1PP9J 3HUSA 1VQ9P 1GDTA 3HD7C 3FXDA 3MHVA 1OVRA 4YXDC 1PGJA 1KILC 1LTJB 1NKZB 3LW5H 1SFCB 3WU2H 2OYIC 1PP9E 3R4YA 1BE3G 1X22A 2K9YA 2H43A 2YMKA 1LJ2A 1HBWA 2J59M 1HTLC 3L70G 3O6QA 2QEXP 4PV1B 2GUSA 1SQPG 3PRJA 2FYUJ 3L37A 3L71J 2IYOA 2VRSA 1VL2A 2FXOA 5KJ7D 1PPJG 3W67A 1FC2C 5APWA 2A45H 1JTHA 1R8EA 1N73B 2M3EA 2K1AA 1S1CX 3VMZA 2E75B 4MN4C 4ZKUA 3VMAA 5CBOA 1NTKJ 1FJKA 5AW2B 2ZAEB 1GU5A 2JDIH 2FYUE 1KN7A 3L71E 2O01N 4ASWA 1T3JA 1VQ5P 1ZRTE 5CCGC 1TU3F 3EFGA 1YTZT 1KORA 3MUDC 1L0LG 4GOFA 5E79H 1SFCA 1PV3A 1YJ9P 3HUSC 1N7SA 4DJGA 5B5EE 1L0NJ 1FBMA 1NTKE 1T8ZA 5AVTB 3MZWB 1VQ7P 4I2LC 2FY8A 2A45I 1E79H 3M06A 3V2QA 3CPWO 3H1JJ 3F89A 3KZIE 3RK2C 2C0XA 1IFNA 1NTZG 2PFXA 2M5AB 1IO4A 2Y9ZA 4LGDE 1FOSF 4R4LA 2RMZA 2KB7P 3ITKA 1L0NE 2E5TA 1YJWP 3RL0D 1K73Q 1LTAC 1VF5C 2E74D 4UB6E 1KZUB 2P67A 3H1JE 4LC1A 5EFWB 4A7PA 1BCCD 2XNXA 3IR9A 2G8YA 2A06G 4GT1A 4YTPC 2WSSH 2W6AA 3AEFC 3H1IG 3CX5E 1KQGB 1GL2B 2N1TD 3G3ZA 1EXIA 2C0WA 4BWNA 1H89A 2N9YB 1N8RQ 1W2EA 3P32A 1PP9D 3TDKA 1MFTA 2GUVA 3SWYA 1LTTC 4DZOA 2YMYA 3G6EP 1LTJC 3CWBJ 3L74J 1GD2E 1RH5B 1NYHA 1SFCC 1QL1A 5KLVK 3H32A 5CBNA 3HTKB 3L75J 2HYNA 3P8CE 1AQTA 4N3YB 2ZYAA 1PIXA 4HKZH 2KLUA 4PV1C 1RHZB 3H1LG 1RF1B 1S5LX 3G9RA 2FBWC 5B5EH 3AE2C 1SQVJ 1VQNP 2H8PD 3TGUE 2FYUD 3KXDA 3L71D 3KZIH 3L75E 1JY2O 1HWTC 2E75C 1DEEG 4W7YA 4IL6E 1EQ7A 4NPEA 4I6MC 1SQVE 2V7QJ 4TT3H 2JR8A 3L72G 1NTKD 1JY3O 4UB6H 1HH0A 2WT7A 4R4MA 1SQBJ 2B87A 2C9LY 2ZYGA 3RL0B 1K9MQ 1FDMA 2Q7CA 2K9JB 2QSIA 5AW9B 2WMMA 1U7JA 3PH0A 2H7HA 4WY4B 3CX5H 1UIXA 3CC7P 1GZLA 1QVFO 1M57D 3H1KJ 1L0ND 1RE3A 5APUA 5AW8B 5APYA 1W2BO 1SQBE 3H1JD 2N9BA 3U59A 3G4SP 2N1TB 2POHA 2KOGA 1MKMA 4XFJA 1OMIA 1ZW0A 3CX5D 3FX0A 2XNDH 4C7NA 1PFIA 4N78E 2IX7C 3CXHH 1IK9A 1JNMA 2RKLA 3B5ND 3CX5I 1M1JB 1GL2C 1IFMA 3T97A 2K88A 3VP8A 5GTHE 3V4WA 2I1KA 1YYCA 2WPQA 4WY4A 1H88A 1AV1A 4KT0J 3K5BA 1ZOYC 3BRVB 2PP6A 2OYHB 1LP1B 2E76C 4IL6H 3S1KA 1Q2NA 2A45G 4GDOA 2KZJA 3P8CD 3CXHD 3D6ZA 1WT6A 5AVQB 3EQ2A 2FYZA 1RQUA 3CCQP 2IBZD
chains in the Genus database with same CATH topology
3RK3B 2FYUK 5KJ7A 5CCGA 5APTA 3GHGB 2O1JA 1S9KE 2WSCH 1LTSC 1KILD 1L4AB 3MUDA 3B5NA 1JTHB 2HG5D 5CCHC 1RE3C 1WRGA 4I1LA 1AQ5A 3U1AA 1NO4A 1DEBA 5APSA 2YO2A 2LKMA 2M8RA 5AVZB 3HUSA 1GDTA 3HTKA 1NTKK 1HJBA 1LGHB 3HD7C 3H32B 2FFDA 3VMXA 1LWUB 3MD0A 3NFQA 1FU1A 1NKNA 3NTNA 1RF1A 2E42A 5CCHA 1KFNA 1KILC 3VN0A 2XDJA 1RE4C 1G2CA 1LTJB 1ZN5A 1NKZB 3LW5H 4WY4D 1OXZA 1SFCB 2OYIC 3WMM0 3N7NA 4C7RA 3TNUB 2H43A 4HYTB 1HBWA 2J59M 1HTLC 1ZLLA 3M91A 3A5TA 3NXSA 3KQGA 1JY3P 1FZGA 1KILA 5AVXB 1G1JA 2GUSA 1J1EC 1N7SD 2WTYA 3C9IA 3HE4A 3L37A 1SQXK 1CZQA 2GM4A 2KLVA 3BRTB 2VRSA 1URQB 5KJ7D 5CCGD 2OYIA 1H8AA 3GHGA 5APWA 4WY4C 1IFDA 2R3CA 4Y99C 1X9VA 3M9BA 3MGNA 2A45H 4HH2A 3E1IA 4XE5B 1JY2N 5AW4B 1JTHA 2WZ7A 3H6PA 4AYCA 1GK4A 1N73B 2E43A 1LT9B 2WT7B 3L4FA 3VMZA 2Z5IA 1NAFA 2HPCA 1VPCA 1FZAA 4ZKUA 3OAKA 3U1CA 1FJKA 5AW2B 3M0AA 1NOHA 3VMYA 5APVA 1FOSE 1N7SC 1GU5A 5APQA 2BASA 1LTIC 1T3JA 4N78D 1ZV8A 5KJ7C 1JY3N 5CCGC 1CI6B 2R5BA 3EFGA 3RK2D 1YTZT 5AVVB 1HUCA 3II6A 4RESB 2IFNA 1GK6A 2QM8A 2ZXEB 2Z4EA 1VDFA 2KSJA 3B8EB 1CW5A 4AQRD 2HFED 1SFCA 3HE5B 2FXMA 3HUSC 1N7SA 2N1TA 1FBMA 1RF0A 1T8ZA 3P7KA 5AVTB 4JF7A 4I2LC 3HD7B 2L5GB 1HVVA 2FFDC 2Z5HA 2A45I 2P1JA 1M1JC 1GU4A 1SVFA 3M06A 3V2QA 1JO5A 1IC2A 1RF1C 1J1DB 3RK2C 1QL2A 2C0XA 4WBAA 4EIJA 1IFNA 3RK3D 2IFMA 1GW3A 2WPSA 1MUUA 1Z56A 1N86A 1URQA 1IO4A 2XZRA 1XTCC 3LIEA 2HODA 2WPRA 2KP8A 5AVWB 4C7NB 4LGDE 1L4AD 1FOSF 3V4QA 2KB7P 1A02J 2MJZA 1FJPA 1M1JA 3TYYA 1LT9A 3N4XA 3VYIA 1S9KD 5CJ0A 3R2PA 3RL0D 3V2RA 2KYVA 1LTAC 2P2UA 5AW6B 1KFMA 5KTBA 3MIWA 1CSBA 1KZUB 2P67A 5CHXA 3HRNA 4LC1A 1J1EB 3VP9A 3RK3C 2XNXA 3IR9A 1SQVK 1NHLA 3UIAA 4GKGA 2XV5A 4GT1A 3GHGC 2OYHA 4Y99B 2IPPA 1FAVA 1N7LA 1XTGB 1L4AC 2W6AA 1NWQA 2CPSA 3BATA 3KDPB 1SFCD 2QM7A 3A7OA 1GL2B 3PP5A 3HE5A 3RL0C 1NU1K 4IFFA 1FZCB 2N1TD 3G3ZA 3V5BA 2C0WA 1H89A 1FZFA 2XU6A 1RY3A 4IFDK 1W2EA 3V2PA 3P32A 5AW7B 2GUVA 1L4AA 3L36A 2WSEH 2JEEA 3SWYA 4W7ZA 1G1IA 5CJ4A 3A3YB 1LTTC 5AW3B 4DZOA 1URQD 3B5NB 2YMYA 1LTGC 1JMMA 1LTJC 1GD2E 1SQBK 4XA4A 1ZR4A 2NPSB 1SFCC 1QL1A 1SQPK 5CMZA 5KLVK 3H32A 2N1TC 1IFJA 2O01H 4JYBA 3HTKB 1RF0C 1LWUA 1SLQA 2C9NY 2HYNA 5AW0B 2WSFH 3P8CE 4N3YB 2W27A 1MZ9A 5AVRB 1RF1B 3L35A 1E5WA 1J2JB 3OA7A 3I5CA 1LTJA 1SP4A 2YKOA 3M0DC 1URQC 3OJAB 1M7LA 3O8ZA 1T2KD 5AW1B 2H8PD 3TNUA 1JY2O 1LT9C 1HWTC 5BU5A 4W7YA 3TSIA 3MTUE 4C46A 1FZEA 1EQ7A 1KILB 4KHXA 1L0LK 4I6MC 3M0DA 1GW4A 4JYCA 1JOCA 1JCCA 1AFOA 2OYIB 4WB4A 2OYHC 3M9HA 1T2KC 1JY3O 5APXA 1HH0A 1N73A 4LLHA 2WT7A 1MV8A 1NH4A 1JUNA 2O1KA 3CI9A 1JCDA 5AW5B 3A2AA 1IFIA 2NPSA 1N2DC 2C9LY 3NMDA 3RL0B 2HPCB 1FDMA 2Q7CA 1IJDB 1NTZK 5AW9B 1KQLA 4B86A 2YO3A 2PAJA 1GTWA 2H7HA 1CI6A 4WY4B 4IFMA 2R5DA 1GZLA 2YKPA 1J1DC 1RE3A 1SQQK 5APUA 3VTPC 5AW8B 5APYA 1JY2P 2I1JA 2WITA 2Q5UA 2W6BA 2N9BA 1ZR2A 4GIFA 3U59A 3HD7A 3LIDA 1N7SB 2N1TB 2POHA 2Q3IA 2YKQA 1LWUC 1T3UA 1L0NK 4N6JA 4OH8B 4ZKPA 2R32A 1GL2D 2Q9IA 2HLOA 2KOGA 5AVUB 3SWFA 1DX7A 3KPEA 2YNYA 2ZFCA 1RE4A 1NTMK 2M3BA 2XKMA 2WWWA 4C7NA 2HODB 1OWAA 1PFIA 4N78E 2IX7C 3HUSB 5BU8B 1HGZA 4DOJA 2OARA 1IK9A 1JNMA 3B5ND 4O9BA 3M9QA 2CPBA 2FFDB 4W80A 1M1JB 2NPSD 2P7JA 1GL2C 1A02F 2J58A 3CLQA 3RK2B 1FZCC 1DH3A 2FKWB 1IFMA 3T97A 3TK1A 3VP8A 3CL3D 3V4WA 2I1KA 1G2CB 3BVHA 1YYCA 1LTBC 2WPQA 4WY4A 1FZBA 5BVZA 3IFMA 3KYQA 1H88A 4M3LA 3P8MC 3BASA 4AUWA 3BRVB 2PP6A 2OYHB 5CCHD 2A45G 4EOTA 3P8CD 5AVSB 1YTZI 1N73C 1X8YA 3B5NC 1GL2A 1HGVA 1WT6A 1FZCA 2NPSC 5AVQB 3VOPA 5AVYB 3EQ2A 1X79B 2FYZA 3HD7D 1MFZA 2JJLA 3HE4B 3V2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BVZ A;  5BU8 B;  2POH A;  3N7N A;  4N78 D;  3BAS A;  4O9B A;  4ZKP A;  2JEE A;  4N3Y B;  3N4X A;  1NKN A;  3P8C D;  1IC2 A;  5BU5 A;  3BAT A;  4I1L A;  5KTB A;  1WT6 A;  3U1A A;  3HRN A;  4ZKU A;  3C9I A;  3U1C A;  1X79 B;  3OJA B;  2FXM A;  3VP8 A;  4GIF A;  3VP9 A;  3U59 A; 
#chains in the Genus database with same CATH topology
 3RK3 B;  2FYU K;  3CWB D;  3L74 D;  1IZN B;  2P10 A;  5APT A;  3CXH I;  1L4A B;  4H0L D;  3L75 D;  5CCH C;  1RE3 C;  1WRG A;  2IBZ I;  4I1L A;  2YO2 A;  2KS1 A;  2M8R A;  4DCK A;  3SFE C;  5KLV J;  4IOI H;  5AVZ B;  2V7Q H;  1NTK K;  1SQV D;  3SFD C;  1LWU B;  3BCC J;  3NFQ A;  5M1B A;  3AE1 C;  1FU1 A;  1NKN A;  1NU1 G;  3S9O A;  1SS1 A;  1KFN A;  1BCC G;  3L73 J;  4OGQ C;  5TJH A;  2AEM A;  4UB8 E;  5GTI H;  2YXQ B;  3Q5R A;  5KLV E;  3WMM 0;  3TNU B;  1KQS O;  3BCC E;  3OW2 O;  3ZDM A;  4HB1 A;  3NXS A;  1FZG A;  1JY3 P;  3C8V A;  1KIL A;  1G1J A;  1J1E C;  1N7S D;  3C9I A;  1SQB D;  2KLV A;  3L73 E;  1YBK A;  2OYI A;  4WY4 C;  2R3C A;  1AVY A;  3MGN A;  4K3A A;  3E1I A;  2B9B A;  4AYC A;  2QRX A;  1NAF A;  2HPC A;  1VPC A;  3H1K D;  1S72 P;  3OAK A;  3U1C A;  3M0A A;  1FOS E;  3FWL A;  1S5L E;  2BAS A;  4N78 D;  1OW7 A;  2R5B A;  1KC8 Q;  3JC2 2;  4PD4 E;  3CC2 P;  3II6 A;  4BRY A;  3B4S A;  2QM8 A;  1VDF A;  1BDD A;  2K37 A;  3L71 G;  1Q82 Q;  4GOE A;  1RF0 A;  3GF7 A;  3P7K A;  2B88 A;  1QEX A;  4PJ0 E;  3MP7 B;  2QJY B;  4IL6 X;  3AE9 C;  2P1J A;  3A0H E;  1M1J C;  3H1H E;  1J1D B;  1SQX J;  4WBA A;  4EIJ A;  3W68 A;  1GW3 A;  5DJT B;  4Z1M H;  2IZ0 A;  2CK3 H;  2XZR A;  2HOD A;  3FGA D;  2WPR A;  2KP8 A;  4H13 B;  3Q1M A;  1EDL A;  2Y0C A;  1A02 J;  3E1R A;  2MJZ A;  1SQQ G;  1BDC A;  3VYI A;  5CJ0 A;  2QG4 A;  1NGM B;  2ZT9 D;  4UB8 H;  3CMA P;  1KFM A;  5KTB A;  3MIW A;  1SQX E;  1M1K Q;  3RK3 C;  1SQV K;  3UIA A;  2O3J A;  4Y99 B;  1FAV A;  1KYO E;  1L4A C;  3BAT A;  2ZVN B;  3SWK A;  2BEQ D;  1NTM G;  1FZC B;  1BGY J;  4U3F J;  1T6A A;  1FZF A;  3V2P A;  5KLV D;  5AW7 B;  3L36 A;  2JEE A;  4L74 A;  2P58 A;  5CJ4 A;  1URQ D;  3BCC D;  1JMM A;  1S5L H;  1SQB K;  2AXT E;  2BCC D;  3G71 P;  1YIT P;  4PD4 H;  1BGY E;  3RBX A;  1IFJ A;  4JYB A;  4U3F E;  1RF0 C;  1EZV D;  4GOD A;  1R5S A;  2DW3 A;  3TF5 A;  2PGD A;  1LTJ A;  1VQL P;  3PHL A;  1SP4 A;  2MKV A;  1JMB A;  3OJA B;  1EZV I;  1M7L A;  4PJ0 H;  1T2K D;  3A0H H;  3WUT A;  5TIS E;  1KIL E;  4H44 B;  1X0T A;  2D2C D;  4PD4 D;  1OVU A;  1NJI Q;  1FZE A;  2IBZ G;  4JPZ B;  3CWB G;  3L74 G;  4KHX A;  1U57 A;  1JOC A;  2UWJ E;  1AJY A;  3V6I A;  3L70 J;  4L75 A;  1N73 A;  4LLH A;  1FDO A;  1MV8 A;  2O1K A;  3CI9 A;  1JCD A;  3A2A A;  2ZT9 B;  1FDI A;  3F5H A;  1KYO H;  3PLN A;  4L76 A;  1H0T B;  1BE3 E;  2YKP A;  3SSU A;  1QX8 A;  1J1D C;  4TLF A;  3L70 E;  2I1J A;  1SQX D;  1USD A;  2NZ2 A;  1KV4 A;  2R32 A;  3E7K A;  2KSE A;  1KYO D;  1PGP A;  5AVU B;  3SWF A;  3CCM P;  2IYP A;  1L0L J;  1YJN P;  4EDF A;  2AXT H;  2M5A A;  1K04 A;  2WWW A;  3TGU J;  1EXJ A;  2AXC A;  1KYO I;  1OFC X;  1HGZ A;  2OYO A;  2OAR A;  2K3R A;  4D6T G;  4O9B A;  2OTJ P;  3M9Q A;  2CPB A;  3FWN A;  1KB9 E;  3H1K G;  4I7Z B;  2NPS D;  2P7J A;  1NTZ J;  1A02 F;  3RBZ A;  1FZC C;  1DH3 A;  1L0L E;  3TK1 A;  3CL3 D;  5TIS H;  1G2C B;  1FZB A;  3IFM A;  3KYQ A;  4M3L A;  4U3F D;  1VQK P;  5KLI B;  1EC5 A;  1ZRT D;  1N73 C;  1GL2 A;  3IAO A;  2H88 C;  2D2C B;  2W90 A;  3CCJ P;  1NTZ E;  1X79 B;  3HD7 D;  1MFZ A;  5KJ7 A;  3PJS K;  3GHG B;  1S9K E;  5KAF E;  1LTS C;  4HJG H;  1KIL D;  3CD6 P;  2G3A A;  1ZME C;  3RGU A;  1DIP A;  2FXP A;  3H25 A;  2J5U A;  2E74 B;  3HTK A;  5DJU B;  2YIU B;  2A06 E;  4H44 C;  3MD0 A;  1D7M A;  3NTN A;  1RF1 A;  5CCH A;  3H1I E;  1EDK A;  1G2C A;  1ZN5 A;  1JB0 J;  3S4R A;  3N7N A;  1OVV A;  3QWO C;  2NRG A;  1DD3 A;  3H1L J;  1ZLL A;  1UII A;  3M91 A;  3A5T A;  3KQG A;  3A0B E;  5AVX B;  2WTY A;  2LXC B;  1SQX K;  5KLV G;  5CCG D;  1H8A A;  3CCR P;  2JO1 A;  3GHG A;  1X9V A;  3M9B A;  4HH2 A;  3AEC C;  3AEB C;  2E43 A;  4WWI A;  3L4F A;  2KZI A;  3H1L E;  2BCC G;  1FZA A;  2K9J A;  2KNC B;  1EZV G;  2QVA A;  3L72 J;  3GF3 A;  5APQ A;  3C1L A;  1LTI C;  2ZYD A;  5KJ7 C;  1CI6 B;  3RK2 D;  5AVV B;  1HUC A;  2LXB A;  4RES B;  2IFN A;  2Q1K A;  2Z4E A;  3B8E B;  1CW5 A;  4AQR D;  2HFE D;  2FXM A;  1L0L D;  3USS A;  2Q6Q A;  5KAF H;  2N1T A;  2Q3E A;  4OVN F;  3HD7 B;  2BEZ F;  2L5G B;  1HVV A;  3TGU D;  3L72 E;  2Z5H A;  1VF5 D;  1ZXG A;  4I7Z C;  1GU4 A;  1JO5 A;  1KQF B;  3D6Y A;  1Y9B A;  1IC2 A;  1RF1 C;  1Z56 A;  1N86 A;  1VQ6 P;  3LIE A;  1XTC C;  3AE5 C;  1NTZ D;  2Y0E A;  2QJK B;  1YQ3 C;  2R44 A;  4RO0 A;  2YXR B;  5KLI C;  3I56 P;  3AE8 C;  1M1J A;  3TYY A;  1S9K D;  1ZP0 C;  4ZMD A;  3R2P A;  3V2R A;  2KYV A;  2KXP B;  5AW6 B;  3I55 P;  3JSV C;  2ZVO B;  3VP9 A;  1NHL A;  2IZ1 A;  4GKG A;  2XV5 A;  2OYH A;  3GHG C;  1LP1 A;  3WUU A;  3GW6 A;  1NWQ A;  2CPS A;  3A0B H;  4DT0 A;  4ASV A;  1IFP A;  3ABV C;  1S4X A;  3KDP B;  2JP3 A;  1SFC D;  2QM7 A;  3A7O A;  3RL0 C;  1M8O B;  3V5B A;  1PP9 G;  2OGU A;  4IFD K;  1OW8 A;  2OTK E;  3WU2 E;  4PV1 D;  1L4A A;  4W7Z A;  3A3Y B;  5AW3 B;  2M0B A;  3B5N B;  5GTH H;  1LTG C;  3PTZ A;  2KUB A;  1SQP K;  5CMZ A;  1AVO A;  2N1T C;  2C9N Y;  1LWU A;  1SLQ A;  3H1H J;  5AW0 B;  2E75 D;  2W27 A;  1R5L A;  1MZ9 A;  5AVR B;  3L35 A;  3I5C A;  2YKO A;  3H1L D;  3M0D C;  2FYU G;  2V4H A;  3TNU A;  1NU1 J;  2OTL P;  5BU5 A;  2H89 C;  3MTU E;  4C46 A;  3O6Q B;  1S3J A;  1L0L K;  4OWF A;  4H0L B;  1GW4 A;  4JYC A;  1NTK G;  1OW6 A;  5C39 A;  1AFO A;  1HJ0 A;  2OYH C;  3JCU E;  3M9H A;  5APX A;  2ZXX A;  3RL0 g;  1QLE D;  1JUN A;  5AW5 B;  1IFI A;  2B89 A;  1N2D C;  1NU1 E;  3NMD A;  1OX3 A;  1BCC E;  4L73 A;  1IJD B;  3CCV P;  1NTZ K;  4B86 A;  2YO3 A;  1YI2 P;  1GTW A;  1L0N G;  2Y0D A;  4IFM A;  3H1J G;  4BXL A;  5K5G B;  2WIT A;  2Q5U A;  2W6B A;  2QJK C;  1N7S B;  2OQQ A;  4U7J A;  2GA1 A;  1LWU C;  4N6J A;  4OH8 B;  4ZKP A;  2Q9I A;  1GL2 D;  2WVR A;  3KPE A;  2W83 C;  1AA0 A;  1Y47 A;  2ZFC A;  1RE4 A;  1Q81 Q;  2M3B A;  2XKM A;  2ITA A;  2RN0 A;  1OWA A;  2E76 D;  2QE7 H;  3L73 D;  5BU8 B;  4DOJ A;  3IN6 A;  2FFD B;  4W80 A;  1QGK B;  1OZH A;  2J58 A;  3CLQ A;  5L8R J;  3BVH A;  2SPZ A;  3P8M C;  3BAS A;  4AUW A;  3CME P;  1SQQ J;  4EI2 A;  5CCH D;  5AVS B;  1YTZ I;  2W6J H;  1L2P A;  4WVZ A;  3B5N C;  3RK3 E;  1HGV A;  1FZC A;  5AVY B;  3GG2 A;  4NPF X;  3JCU H;  5CHX A;  2JJL A;  3HE4 B;  3TGU G;  2JKV A;  1BE3 J;  1BSH A;  4PD4 I;  3L75 G;  2O1J A;  2JWA A;  1BSN A;  1SQQ E;  4OGQ D;  3H1H D;  1NTM J;  3AEG C;  1FS0 E;  3U1A A;  1DEB A;  1SQP J;  3B71 A;  2LKM A;  1SQV G;  3CCE P;  3Q5P A;  1HJB A;  1LGH B;  3H32 B;  2QJY C;  2FFD A;  3VMX A;  2Y9Y A;  2WQY C;  1M90 Q;  3D71 A;  2HR3 A;  2E42 A;  3WUV A;  1OIP A;  3VN0 A;  2XDJ A;  4H0L C;  1RE4 C;  1NTM E;  1NU1 D;  5KAI E;  1NAY A;  4WY4 D;  1OXZ A;  1SQP E;  4H13 C;  1PPJ E;  4C7R A;  1PZQ A;  4EYY Q;  4HYT B;  2WSE J;  1YQ4 C;  3AEA C;  1SQB G;  2KIK A;  1PGQ A;  3HE4 A;  1CZQ A;  2GM4 A;  3BRT B;  2QJP B;  1URQ B;  5H2F E;  4QMA A;  1JEK A;  1Y8A A;  1IFD A;  2O01 J;  4Y99 C;  1S2E A;  4XE5 B;  1JY2 N;  2E76 B;  5AW4 B;  2WSF J;  2WZ7 A;  3H6P A;  1GK4 A;  2KI7 B;  5KKZ B;  3D70 A;  4CPG A;  1LT9 B;  2WT7 B;  2Z5I A;  1PGO A;  1LT1 A;  2B87 B;  3IF4 A;  1NOH A;  3VMY A;  5APV A;  1N7S C;  2E5Y A;  1H0T A;  2ZJS E;  3Q5S A;  1ZV8 A;  1BGY D;  1JY3 N;  3CXH E;  1GK6 A;  2ZXE B;  2KSJ A;  2FYN B;  2RH0 A;  4KJM A;  2IBZ E;  3HE5 B;  3CWB E;  3L74 E;  1YIJ P;  2AEF A;  3CC4 P;  4JF7 A;  1YHQ P;  2FFD C;  3CCS P;  1SVF A;  3H1I J;  1USE A;  1QL2 A;  1JM0 A;  3RK3 D;  2IFM A;  2WPS A;  1MUU A;  3AE7 C;  1URQ A;  4OGQ B;  5AVW B;  4C7N B;  1L4A D;  3V4Q A;  2AEJ A;  1NVO A;  3AED C;  1RQV A;  1FJP A;  4JQ0 D;  1LT9 A;  3N4X A;  3GMA A;  5KAI H;  1P84 E;  2P2U A;  1SQQ D;  1CSB A;  3HRN A;  1J1E B;  2KK7 A;  3T97 B;  3Q3D A;  4K35 A;  4D6T J;  1VQP P;  2JWD A;  2IPP A;  1N7L A;  1XTG B;  1VQM P;  1BE3 D;  1Q86 Q;  3PP5 A;  3HE5 A;  5H2F H;  1NU1 K;  2ZT9 C;  3L70 D;  4IFF A;  1NTM D;  1SQP D;  2XU6 A;  1RY3 A;  5GTI E;  5B66 E;  1KB9 H;  1PPJ D;  3EWK A;  2WSE H;  3BCC G;  4D6T E;  1G1I A;  1M56 D;  3H1K E;  1EDJ A;  1ZR4 A;  4XA4 A;  2PRR A;  2NPS B;  3L73 G;  3FXE A;  2KS1 B;  4Y28 J;  3CCL P;  2O01 H;  2I8D A;  2L91 A;  4RKU J;  2WSF H;  1Q7Y Q;  1E5W A;  1KB9 D;  1J2J B;  3OA7 A;  1PL5 A;  2QJP C;  1URQ C;  1DD4 A;  3O8Z A;  1IK7 A;  5AW1 B;  3KHU A;  3Q2Y A;  1KB9 I;  5KKZ C;  2WSC J;  4NPD A;  1LT9 C;  3TSI A;  1U7M A;  3GLM A;  1KIL B;  1FE6 A;  3M0D A;  1JCC A;  2OYI B;  3EFF K;  4WB4 A;  2IDB A;  3H1H G;  1VQO P;  1P84 H;  1T2K C;  1HF9 A;  2QIW A;  1LNQ A;  2FYN C;  1NH4 A;  1W5C E;  2KNC A;  2D2C C;  2NPS A;  4RJT A;  4H13 D;  2HPC B;  1KQL A;  3LW5 J;  1KMI Z;  2PAJ A;  1CI6 A;  2R5D A;  2A06 D;  3AE6 C;  1SQQ K;  3VTP C;  4BRY B;  2BCC J;  1JY2 P;  1KD1 Q;  1P84 D;  1SQX G;  3H1I D;  3CCU P;  5B66 H;  1VQ8 P;  1ZR2 A;  4GIF A;  2E74 C;  3HD7 A;  3LID A;  2YIU C;  2Q3I A;  1K05 A;  1T3U A;  2YKQ A;  1VQ4 P;  1L0N K;  4YPC A;  2HLO A;  1P84 I;  2LR2 A;  1DX7 A;  2YNY A;  1NTM K;  2BCC E;  1K8A Q;  2HOD B;  1EZV E;  3HUS B;  3AE4 C;  1KTM A;  4D6T D;  1QVG O;  3RK2 B;  2FKW B;  2R3S A;  1BGY G;  3AEE C;  4U3F G;  1LTB C;  1Q90 D;  5BVZ A;  3AE3 C;  4YXW H;  4EOT A;  1X8Y A;  2WPV B;  1BCC J;  1VF5 B;  2NPS C;  4ZNC A;  1EDI A;  3VOP A;  4H44 D;  3V2N A;  1GMJ A;  5E79 E;  5CCG A;  2W8Z A;  2WSC H;  4JBZ A;  3QH9 A;  3MUD A;  3L72 D;  3B5N A;  1JTH B;  2HG5 D;  2QA4 P;  1AQ5 A;  1NO4 A;  1WMK A;  5APS A;  1PP9 J;  3HUS A;  1VQ9 P;  1GDT A;  3HD7 C;  3FXD A;  3MHV A;  1OVR A;  4YXD C;  1PGJ A;  1KIL C;  1LTJ B;  1NKZ B;  3LW5 H;  1SFC B;  3WU2 H;  2OYI C;  1PP9 E;  3R4Y A;  1BE3 G;  1X22 A;  2K9Y A;  2H43 A;  2YMK A;  1LJ2 A;  1HBW A;  2J59 M;  1HTL C;  3L70 G;  3O6Q A;  2QEX P;  4PV1 B;  2GUS A;  1SQP G;  3PRJ A;  2FYU J;  3L37 A;  3L71 J;  2IYO A;  2VRS A;  1VL2 A;  2FXO A;  5KJ7 D;  1PPJ G;  3W67 A;  1FC2 C;  5APW A;  2A45 H;  1JTH A;  1R8E A;  1N73 B;  2M3E A;  2K1A A;  1S1C X;  3VMZ A;  2E75 B;  4MN4 C;  4ZKU A;  3VMA A;  5CBO A;  1NTK J;  1FJK A;  5AW2 B;  2ZAE B;  1GU5 A;  2JDI H;  2FYU E;  1KN7 A;  3L71 E;  2O01 N;  4ASW A;  1T3J A;  1VQ5 P;  1ZRT E;  5CCG C;  1TU3 F;  3EFG A;  1YTZ T;  1KOR A;  3MUD C;  1L0L G;  4GOF A;  5E79 H;  1SFC A;  1PV3 A;  1YJ9 P;  3HUS C;  1N7S A;  4DJG A;  5B5E E;  1L0N J;  1FBM A;  1NTK E;  1T8Z A;  5AVT B;  3MZW B;  1VQ7 P;  4I2L C;  2FY8 A;  2A45 I;  1E79 H;  3M06 A;  3V2Q A;  3CPW O;  3H1J J;  3F89 A;  3KZI E;  3RK2 C;  2C0X A;  1IFN A;  1NTZ G;  2PFX A;  2M5A B;  1IO4 A;  2Y9Z A;  4LGD E;  1FOS F;  4R4L A;  2RMZ A;  2KB7 P;  3ITK A;  1L0N E;  2E5T A;  1YJW P;  3RL0 D;  1K73 Q;  1LTA C;  1VF5 C;  2E74 D;  4UB6 E;  1KZU B;  2P67 A;  3H1J E;  4LC1 A;  5EFW B;  4A7P A;  1BCC D;  2XNX A;  3IR9 A;  2G8Y A;  2A06 G;  4GT1 A;  4YTP C;  2WSS H;  2W6A A;  3AEF C;  3H1I G;  3CX5 E;  1KQG B;  1GL2 B;  2N1T D;  3G3Z A;  1EXI A;  2C0W A;  4BWN A;  1H89 A;  2N9Y B;  1N8R Q;  1W2E A;  3P32 A;  1PP9 D;  3TDK A;  1MFT A;  2GUV A;  3SWY A;  1LTT C;  4DZO A;  2YMY A;  3G6E P;  1LTJ C;  3CWB J;  3L74 J;  1GD2 E;  1RH5 B;  1NYH A;  1SFC C;  1QL1 A;  5KLV K;  3H32 A;  5CBN A;  3HTK B;  3L75 J;  2HYN A;  3P8C E;  1AQT A;  4N3Y B;  2ZYA A;  1PIX A;  4HKZ H;  2KLU A;  4PV1 C;  1RHZ B;  3H1L G;  1RF1 B;  1S5L X;  3G9R A;  2FBW C;  5B5E H;  3AE2 C;  1SQV J;  1VQN P;  2H8P D;  3TGU E;  2FYU D;  3KXD A;  3L71 D;  3KZI H;  3L75 E;  1JY2 O;  1HWT C;  2E75 C;  1DEE G;  4W7Y A;  4IL6 E;  1EQ7 A;  4NPE A;  4I6M C;  1SQV E;  2V7Q J;  4TT3 H;  2JR8 A;  3L72 G;  1NTK D;  1JY3 O;  4UB6 H;  1HH0 A;  2WT7 A;  4R4M A;  1SQB J;  2B87 A;  2C9L Y;  2ZYG A;  3RL0 B;  1K9M Q;  1FDM A;  2Q7C A;  2K9J B;  2QSI A;  5AW9 B;  2WMM A;  1U7J A;  3PH0 A;  2H7H A;  4WY4 B;  3CX5 H;  1UIX A;  3CC7 P;  1GZL A;  1QVF O;  1M57 D;  3H1K J;  1L0N D;  1RE3 A;  5APU A;  5AW8 B;  5APY A;  1W2B O;  1SQB E;  3H1J D;  2N9B A;  3U59 A;  3G4S P;  2N1T B;  2POH A;  2KOG A;  1MKM A;  4XFJ A;  1OMI A;  1ZW0 A;  3CX5 D;  3FX0 A;  2XND H;  4C7N A;  1PFI A;  4N78 E;  2IX7 C;  3CXH H;  1IK9 A;  1JNM A;  2RKL A;  3B5N D;  3CX5 I;  1M1J B;  1GL2 C;  1IFM A;  3T97 A;  2K88 A;  3VP8 A;  5GTH E;  3V4W A;  2I1K A;  1YYC A;  2WPQ A;  4WY4 A;  1H88 A;  1AV1 A;  4KT0 J;  3K5B A;  1ZOY C;  3BRV B;  2PP6 A;  2OYH B;  1LP1 B;  2E76 C;  4IL6 H;  3S1K A;  1Q2N A;  2A45 G;  4GDO A;  2KZJ A;  3P8C D;  3CXH D;  3D6Z A;  1WT6 A;  5AVQ B;  3EQ2 A;  2FYZ A;  1RQU A;  3CCQ P;  2IBZ D; 
#chains in the Genus database with same CATH homology
 3RK3 B;  2FYU K;  5KJ7 A;  5CCG A;  5APT A;  3GHG B;  2O1J A;  1S9K E;  2WSC H;  1LTS C;  1KIL D;  1L4A B;  3MUD A;  3B5N A;  1JTH B;  2HG5 D;  5CCH C;  1RE3 C;  1WRG A;  4I1L A;  1AQ5 A;  3U1A A;  1NO4 A;  1DEB A;  5APS A;  2YO2 A;  2LKM A;  2M8R A;  5AVZ B;  3HUS A;  1GDT A;  3HTK A;  1NTK K;  1HJB A;  1LGH B;  3HD7 C;  3H32 B;  2FFD A;  3VMX A;  1LWU B;  3MD0 A;  3NFQ A;  1FU1 A;  1NKN A;  3NTN A;  1RF1 A;  2E42 A;  5CCH A;  1KFN A;  1KIL C;  3VN0 A;  2XDJ A;  1RE4 C;  1G2C A;  1LTJ B;  1ZN5 A;  1NKZ B;  3LW5 H;  4WY4 D;  1OXZ A;  1SFC B;  2OYI C;  3WMM 0;  3N7N A;  4C7R A;  3TNU B;  2H43 A;  4HYT B;  1HBW A;  2J59 M;  1HTL C;  1ZLL A;  3M91 A;  3A5T A;  3NXS A;  3KQG A;  1JY3 P;  1FZG A;  1KIL A;  5AVX B;  1G1J A;  2GUS A;  1J1E C;  1N7S D;  2WTY A;  3C9I A;  3HE4 A;  3L37 A;  1SQX K;  1CZQ A;  2GM4 A;  2KLV A;  3BRT B;  2VRS A;  1URQ B;  5KJ7 D;  5CCG D;  2OYI A;  1H8A A;  3GHG A;  5APW A;  4WY4 C;  1IFD A;  2R3C A;  4Y99 C;  1X9V A;  3M9B A;  3MGN A;  2A45 H;  4HH2 A;  3E1I A;  4XE5 B;  1JY2 N;  5AW4 B;  1JTH A;  2WZ7 A;  3H6P A;  4AYC A;  1GK4 A;  1N73 B;  2E43 A;  1LT9 B;  2WT7 B;  3L4F A;  3VMZ A;  2Z5I A;  1NAF A;  2HPC A;  1VPC A;  1FZA A;  4ZKU A;  3OAK A;  3U1C A;  1FJK A;  5AW2 B;  3M0A A;  1NOH A;  3VMY A;  5APV A;  1FOS E;  1N7S C;  1GU5 A;  5APQ A;  2BAS A;  1LTI C;  1T3J A;  4N78 D;  1ZV8 A;  5KJ7 C;  1JY3 N;  5CCG C;  1CI6 B;  2R5B A;  3EFG A;  3RK2 D;  1YTZ T;  5AVV B;  1HUC A;  3II6 A;  4RES B;  2IFN A;  1GK6 A;  2QM8 A;  2ZXE B;  2Z4E A;  1VDF A;  2KSJ A;  3B8E B;  1CW5 A;  4AQR D;  2HFE D;  1SFC A;  3HE5 B;  2FXM A;  3HUS C;  1N7S A;  2N1T A;  1FBM A;  1RF0 A;  1T8Z A;  3P7K A;  5AVT B;  4JF7 A;  4I2L C;  3HD7 B;  2L5G B;  1HVV A;  2FFD C;  2Z5H A;  2A45 I;  2P1J A;  1M1J C;  1GU4 A;  1SVF A;  3M06 A;  3V2Q A;  1JO5 A;  1IC2 A;  1RF1 C;  1J1D B;  3RK2 C;  1QL2 A;  2C0X A;  4WBA A;  4EIJ A;  1IFN A;  3RK3 D;  2IFM A;  1GW3 A;  2WPS A;  1MUU A;  1Z56 A;  1N86 A;  1URQ A;  1IO4 A;  2XZR A;  1XTC C;  3LIE A;  2HOD A;  2WPR A;  2KP8 A;  5AVW B;  4C7N B;  4LGD E;  1L4A D;  1FOS F;  3V4Q A;  2KB7 P;  1A02 J;  2MJZ A;  1FJP A;  1M1J A;  3TYY A;  1LT9 A;  3N4X A;  3VYI A;  1S9K D;  5CJ0 A;  3R2P A;  3RL0 D;  3V2R A;  2KYV A;  1LTA C;  2P2U A;  5AW6 B;  1KFM A;  5KTB A;  3MIW A;  1CSB A;  1KZU B;  2P67 A;  5CHX A;  3HRN A;  4LC1 A;  1J1E B;  3VP9 A;  3RK3 C;  2XNX A;  3IR9 A;  1SQV K;  1NHL A;  3UIA A;  4GKG A;  2XV5 A;  4GT1 A;  3GHG C;  2OYH A;  4Y99 B;  2IPP A;  1FAV A;  1N7L A;  1XTG B;  1L4A C;  2W6A A;  1NWQ A;  2CPS A;  3BAT A;  3KDP B;  1SFC D;  2QM7 A;  3A7O A;  1GL2 B;  3PP5 A;  3HE5 A;  3RL0 C;  1NU1 K;  4IFF A;  1FZC B;  2N1T D;  3G3Z A;  3V5B A;  2C0W A;  1H89 A;  1FZF A;  2XU6 A;  1RY3 A;  4IFD K;  1W2E A;  3V2P A;  3P32 A;  5AW7 B;  2GUV A;  1L4A A;  3L36 A;  2WSE H;  2JEE A;  3SWY A;  4W7Z A;  1G1I A;  5CJ4 A;  3A3Y B;  1LTT C;  5AW3 B;  4DZO A;  1URQ D;  3B5N B;  2YMY A;  1LTG C;  1JMM A;  1LTJ C;  1GD2 E;  1SQB K;  4XA4 A;  1ZR4 A;  2NPS B;  1SFC C;  1QL1 A;  1SQP K;  5CMZ A;  5KLV K;  3H32 A;  2N1T C;  1IFJ A;  2O01 H;  4JYB A;  3HTK B;  1RF0 C;  1LWU A;  1SLQ A;  2C9N Y;  2HYN A;  5AW0 B;  2WSF H;  3P8C E;  4N3Y B;  2W27 A;  1MZ9 A;  5AVR B;  1RF1 B;  3L35 A;  1E5W A;  1J2J B;  3OA7 A;  3I5C A;  1LTJ A;  1SP4 A;  2YKO A;  3M0D C;  1URQ C;  3OJA B;  1M7L A;  3O8Z A;  1T2K D;  5AW1 B;  2H8P D;  3TNU A;  1JY2 O;  1LT9 C;  1HWT C;  5BU5 A;  4W7Y A;  3TSI A;  3MTU E;  4C46 A;  1FZE A;  1EQ7 A;  1KIL B;  4KHX A;  1L0L K;  4I6M C;  3M0D A;  1GW4 A;  4JYC A;  1JOC A;  1JCC A;  1AFO A;  2OYI B;  4WB4 A;  2OYH C;  3M9H A;  1T2K C;  1JY3 O;  5APX A;  1HH0 A;  1N73 A;  4LLH A;  2WT7 A;  1MV8 A;  1NH4 A;  1JUN A;  2O1K A;  3CI9 A;  1JCD A;  5AW5 B;  3A2A A;  1IFI A;  2NPS A;  1N2D C;  2C9L Y;  3NMD A;  3RL0 B;  2HPC B;  1FDM A;  2Q7C A;  1IJD B;  1NTZ K;  5AW9 B;  1KQL A;  4B86 A;  2YO3 A;  2PAJ A;  1GTW A;  2H7H A;  1CI6 A;  4WY4 B;  4IFM A;  2R5D A;  1GZL A;  2YKP A;  1J1D C;  1RE3 A;  1SQQ K;  5APU A;  3VTP C;  5AW8 B;  5APY A;  1JY2 P;  2I1J A;  2WIT A;  2Q5U A;  2W6B A;  2N9B A;  1ZR2 A;  4GIF A;  3U59 A;  3HD7 A;  3LID A;  1N7S B;  2N1T B;  2POH A;  2Q3I A;  2YKQ A;  1LWU C;  1T3U A;  1L0N K;  4N6J A;  4OH8 B;  4ZKP A;  2R32 A;  1GL2 D;  2Q9I A;  2HLO A;  2KOG A;  5AVU B;  3SWF A;  1DX7 A;  3KPE A;  2YNY A;  2ZFC A;  1RE4 A;  1NTM K;  2M3B A;  2XKM A;  2WWW A;  4C7N A;  2HOD B;  1OWA A;  1PFI A;  4N78 E;  2IX7 C;  3HUS B;  5BU8 B;  1HGZ A;  4DOJ A;  2OAR A;  1IK9 A;  1JNM A;  3B5N D;  4O9B A;  3M9Q A;  2CPB A;  2FFD B;  4W80 A;  1M1J B;  2NPS D;  2P7J A;  1GL2 C;  1A02 F;  2J58 A;  3CLQ A;  3RK2 B;  1FZC C;  1DH3 A;  2FKW B;  1IFM A;  3T97 A;  3TK1 A;  3VP8 A;  3CL3 D;  3V4W A;  2I1K A;  1G2C B;  3BVH A;  1YYC A;  1LTB C;  2WPQ A;  4WY4 A;  1FZB A;  5BVZ A;  3IFM A;  3KYQ A;  1H88 A;  4M3L A;  3P8M C;  3BAS A;  4AUW A;  3BRV B;  2PP6 A;  2OYH B;  5CCH D;  2A45 G;  4EOT A;  3P8C D;  5AVS B;  1YTZ I;  1N73 C;  1X8Y A;  3B5N C;  1GL2 A;  1HGV A;  1WT6 A;  1FZC A;  2NPS C;  5AVQ B;  3VOP A;  5AVY B;  3EQ2 A;  1X79 B;  2FYZ A;  3HD7 D;  1MFZ A;  2JJL A;  3HE4 B;  3V2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...