2JEEA

Xray structure of e. coli yiiu
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
78
structure length
78
Chain Sequence
MSLEVFEKLEAKVQQAIDTITLLQMEIEELKEKNNSLSQEVQNAQHQREELERENNHLKEQQNGWQERLQALLGRMEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords CELL DIVISION PROTEIN ZAPB
publication title Novel Coiled-Coil Cell Division Factor Zapb Stimulates Z Ring Assembly and Cell Division.
pubmed doi rcsb
source organism Escherichia coli
total genus 30
structure length 78
sequence length 78
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06005 ZapB Cell division protein ZapB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2jeeA00
5BVZA 3HRNA 1WT6A 1IC2A 5BU5A 4ZKPA 2JEEA 3VP8A 5BU8B 3C9IA 1NKNA 3U59A 2FXMA 4ZKUA 3P8CD 3N4XA 3N7NA 3BATA 1X79B 4I1LA 3VP9A 4O9BA 3BASA 4N78D 5KTBA 3OJAB 3U1AA 4GIFA 2POHA 4N3YB 3U1CA
chains in the Genus database with same CATH superfamily
2JDIH 3M0AA 3JCUE 1X0TA 1EQ7A 1JY3P 2YKPA 2WQYC 1S9KE 1JY3N 2HPCB 3F89A 1YITP 1H89A 3VP9A 1LT9A 1SS1A 3SFDC 3RL0B 4KHXA 1IK7A 3AEEC 2Q3EA 3A0BH 1BCCE 1JY2P 1LP1A 2R5BA 2FYZA 3A0HE 3FWNA 2B9BA 4DT0A 2D2CD 2O1JA 4KJMA 3H1LJ 1PPJG 1SQVE 1URQA 1VF5B 1RQVA 1M1KQ 5KJ7D 3H1KJ 3H32A 1UIXA 1JCDA 5AVTB 2LR2A 1OX3A 5CCGA 3NMDA 2D2CC 1W2EA 1SQXG 3PHLA 4WY4D 4I2LC 2QJYC 1JEKA 1DD3A 3RK2D 3MUDC 1AJYA 2I8DA 2KUBA 5KJ7C 2QIWA 5CCHA 5CMZA 1NTKD 2E75B 5AW1B 1NTZD 1NTME 1LTAC 4K35A 2E42A 3A3YB 3HD7A 2FFDA 3P8MC 2ZT9B 1EZVG 4WY4C 1JY3O 3L71E 1IFIA 1FS0E 2W90A 3RBXA 1QX8A 2KZJA 1N73C 1LNQA 2OGUA 2FYUG 2ZAEB 5KAIH 1ZP0C 3H1JE 1EXIA 1YHQP 3L72D 1BSHA 4BRYA 5B5EE 3EQ2A 2JO1A 3II6A 2K1AA 1OFCX 2YKQA 3AEAC 3B8EB 4H44C 1AVOA 2QRXA 1PPJE 3USSA 1SQPG 2R44A 5AVXB 4L75A 1GL2B 4C46A 4L73A 1Q90D 4GKGA 5DJTB 4C7NB 5APQA 3AE5C 2R32A 3BRTB 1ZN5A 2UWJE 1L0LK 2XNXA 4PD4I 2ZFCA 5BVZA 1BGYG 1Y47A 2K9JB 3CCJP 1BSNA 1IZNB 4PD4D 2V7QJ 1MKMA 3N4XA 2WITA 2KYVA 5CJ4A 1FAVA 4AUWA 1SFCD 2D2CB 1QGKB 1NU1J 1SP4A 2NPSD 1EZVE 3L72G 4N6JA 1AVYA 1FDMA 2C0XA 1LT1A 2FYUE 4OWFA 2Q5UA 2JR8A 3VTPC 4Y28J 2PP6A 2YIUC 2V4HA 1ZXGA 2WT7A 1SFCC 3O6QB 2N1TA 5APUA 3A5TA 2NPSC 1QEXA 4WY4B 4IFFA 3FWLA 3L36A 3IF4A 3Q2YA 3KDPB 1M90Q 1SQVJ 2BASA 4Y99B 3T97A 1S72P 1N73B 1RF0A 1SQPE 4GODA 1USDA 3CCUP 1FZCC 1M1JA 4R4LA 2C9NY 2FY8A 1Q2NA 5AW7B 2AXTH 2O1KA 2RMZA 1VQ6P 1AQ5A 4OGQB 5GTHE 4H44B 5B66H 1FC2C 3Q5PA 3R2PA 3E1IA 1BGYE 1JNMA 4C7RA 3V6IA 4JF7A 5B5EH 3H1ID 1OMIA 1SVFA 4W80A 2OTJP 2HYNA 3IFMA 3HTKB 2KS1B 3CWBE 1YIJP 1L4AA 3BCCJ 3L71J 2GM4A 1VDFA 5E79H 3E7KA 3L72E 2QVAA 4W7YA 4BWNA 3HE4A 2Z4EA 3LIEA 1JMMA 3AE4C 3CC7P 4DOJA 1NWQA 2B87B 2ZYGA 1D7MA 4U7JA 1Q82Q 1L2PA 3P8CE 2HODB 3L75D 3AECC 2ZXEB 2SPZA 3SWKA 1N7SA 3TGUD 4QMAA 3AE9C 1VQ9P 1T6AA 2HLOA 2YIUB 1U7MA 1SFCB 3H1LE 3PH0A 1HGVA 2YMKA 3I5CA 1X22A 3R4YA 2Q9IA 2NPSB 4UB8H 1H0TA 3VMAA 1S4XA 3I55P 2QJPC 1SQXJ 1K73Q 2O01H 3RL0D 1G2CA 1L0LG 1R5SA 1JTHA 2IYOA 1FZCA 4YXWH 4N78D 2A45G 3H1HD 1E79H 2LXCB 4JBZA 4XE5B 2Q6QA 3TDKA 1VF5D 1KB9E 1VQ4P 3M0DC 4JYCA 3RL0C 5L8RJ 1ZV8A 2I1JA 3GW6A 2FYUJ 2ZJSE 1FJPA 2MJZA 3B5ND 1QLED 2E43A 1LTGC 1XTCC 3AEFC 1LTIC 1L0NK 1VF5C 1S5LH 2E76D 4KT0J 4UB6H 1YTZI 3IAOA 3CX5E 1NGMB 1SQPJ 3B5NC 2L5GB 2YMYA 1MFZA 2G3AA 3CCRP 1EDJA 3L74G 1T2KD 3F5HA 1YQ3C 2E76C 3CL3D 4WWIA 1J2JB 3KYQA 2CPSA 3CXHH 2WSEJ 1FBMA 3AEGC 2XNDH 3HE5A 3S9OA 1PZQA 3A2AA 1T2KC 1BGYJ 5CJ0A 1NTKK 2IBZI 1LTJC 1L0LE 2WPVB 1NTZK 1CI6B 1HUCA 4H0LB 1RE4A 2BCCD 3GLMA 1USEA 2IBZD 1Y9BA 1PP9D 3AE8C 4TLFA 4IL6H 1GL2D 3L72J 1AV1A 3CCSP 4PV1D 2B89A 5KAFH 4BXLA 2M8RA 1Y8AA 1DEEG 2R5DA 4EIJA 2W6AA 1SQQG 4L74A 3MZWB 3L70D 2J58A 1FOSE 4M3LA 2FKWB 1JUNA 1KORA 3V2NA 2OYOA 2YNYA 1LTSC 2HPCA 5DJUB 1GL2C 1KILE 2P2UA 2A06D 2ITAA 4PV1C 2XDJA 4I6MC 1KYOI 2JJLA 2OYHC 1YJ9P 1HJ0A 1L0ND 1N8RQ 3GMAA 1M57D 1GK6A 3L74E 1KYOD 1RHZB 4YXDC 3NXSA 4D6TD 1QL1A 1KB9H 1HGZA 3M9HA 1SQBG 2IPPA 3L73G 5TISH 1HH0A 1CW5A 1VQPP 1P84E 3B5NB 2QM7A 4DCKA 4EYYQ 2IZ1A 1IFMA 4HYTB 1PP9G 3SWYA 3D70A 2K3RA 5H2FE 3VMZA 2CK3H 2M5AB 5AW9B 2E76B 1WT6A 1NKNA 2LKMA 4U3FG 2W8ZA 2FXMA 2C9LY 2WWWA 1RF1C 1KN7A 2BEQD 3MIWA 4RO0A 1LTJB 1YJWP 1J1EC 1ZLLA 3BCCE 1SQQE 4OGQD 3KZIE 4I7ZB 3VMYA 2WPSA 4Y99C 2Z5IA 1A02J 4H44D 4GOEA 1MFTA 3NTNA 2PAJA 3GF7A 3BATA 1L0NG 5K5GB 1BE3D 2H8PD 5KTBA 3CXHI 3QH9A 1XTGB 1ZRTE 4OGQC 1ZR2A 1J1DB 1PGPA 2RH0A 3CXHD 2J59M 2AEFA 3M9BA 1LJ2A 5KLVK 1KV4A 2P10A 3G71P 1NAYA 5AVVB 1EC5A 1SQBE 2V7QH 1M7LA 3L73E 4PV1B 3S4RA 4C7NA 3RK3D 1QVFO 2OYHB 2BEZF 1L0LJ 4IFMA 3BASA 1VQ8P 3I56P 1NTKG 3JCUH 4YPCA 1NTZG 1SQXE 4GOFA 1KTMA 3CMEP 3VN0A 3E1RA 3RK3C 1LTBC 2K9JA 2WPRA 4U3FE 1IK9A 2WVRA 2IZ0A 3A0HH 2C0WA 1RE3C 3SSUA 3MTUE 3GHGC 3GF3A 3K5BA 3H1KD 1LWUC 1BE3G 2XZRA 1GK4A 3V4WA 3MUDA 2J5UA 1QVGO 2WZ7A 3GG2A 5KJ7A 1RQUA 5CHXA 3KQGA 2JKVA 2QSIA 3NFQA 1RF1B 3O6QA 3PP5A 1FU1A 1NYHA 3A7OA 1S2EA 1J1EB 3L74J 4IOIH 5H2FH 4WY4A 3WU2E 3N7NA 4LLHA 1KFNA 2GUSA 2XKMA 1N73A 3WUTA 1VQOP 4ZKPA 3CCLP 3V2QA 1RH5B 5KLVD 1JB0J 5AVRB 2HR3A 1AQTA 1K04A 4PJ0E 2WSFJ 5AW0B 1OVUA 1M1JB 1NTKE 3CCMP 1NTZE 3EFFK 1VQ5P 2KOGA 1EXJA 4OVNF 1R8EA 1AA0A 5C39A 3V5BA 2MKVA 5TJHA 1KC8Q 2IYPA 3HTKA 1T8ZA 2KS1A 3VOPA 2W83C 1SQQJ 3B4SA 2E74D 2KLUA 1VQ7P 3CMAP 2YO3A 5AW8B 2WTYA 2FYNB 1AFOA 1NTMK 1L4AB 3RK3B 5CBNA 5APWA 2IDBA 2KP8A 5AVSB 4H0LD 1PGQA 3VMXA 5BU8B 2JWDA 2OTLP 2K88A 2P67A 2HODA 3HE4B 1RE3A 3S1KA 1FZGA 1JOCA 3TNUB 2E74C 3GHGB 1LWUB 1VQLP 1DIPA 1KFMA 2WSCJ 2W6JH 1HJBA 2Q3IA 3FX0A 5KLVG 1VQKP 2R3SA 2IFMA 1NU1D 4GT1A 1SQBJ 1N7LA 3L73J 2ZYAA 2P1JA 4H0LC 2HFED 2I1KA 1SFCA 1FE6A 2YXRB 1NJIQ 1N7SB 4HH2A 1OW7A 1S9KD 5GTIE 2NPSA 1PP9J 1NHLA 4NPDA 2VRSA 3U1CA 2OYIC 1BCCD 3H1IG 4PD4E 3W68A 4AQRD 3G4SP 2Y0DA 1HF9A 4U3FJ 4LGDE 4HB1A 1SQVD 1KZUB 3P32A 2NRGA 4B86A 1Q86Q 3HUSC 4TT3H 3A0BE 3WUVA 1NO4A 1JM0A 3D6YA 4RJTA 4EI2A 5KKZC 1L0NJ 3L75G 1URQD 2KXPB 5CBOA 2KSJA 1GDTA 1LT9C 1GU5A 3AE7C 3TGUG 5GTHH 2E5YA 2WPQA 1FDOA 2WSEH 1MUUA 1NTMD 3PTZA 2FYUK 1URQC 5KLVE 1NH4A 1H8AA 3L71D 1Q81Q 1OXZA 2G8YA 3OJAB 3H1JD 1BCCG 5CCGC 3G9RA 4DZOA 2E74B 1NTKJ 1NTZJ 3C9IA 1N2DC 3H1IE 2QG4A 3H1HG 3D71A 1K8AQ 1HBWA 1W5CE 1FZBA 5KAIE 3LW5J 4I7ZC 2AXCA 2KNCB 4RESB 1PPJD 2GUVA 3HE5B 1PV3A 3H6PA 2FFDC 1U57A 1BE3J 2OYIB 4WVZA 4XA4A 1FJKA 3L75E 1J1DC 3HRNA 1IFPA 1NTMG 1OZHA 5GTIH 1KILB 3TGUE 3SWFA 1OW6A 1NVOA 3HUSB 5AVUB 1Z56A 2DW3A 4O9BA 3M0DA 1EZVI 2WSSH 2JWAA 2E5TA 2HG5D 2H7HA 5KKZB 3CLQA 2H89C 1ZMEC 4R4MA 3H1JG 1EZVD 3FGAD 5APVA 2FBWC 1LGHB 1LT9B 2PFXA 2FYUD 4GDOA 1LP1B 2POHA 1JY2N 1KD1Q 1VQNP 2BCCG 2KLVA 1QL2A 4N78E 2QJKC 1URQB 3H1HE 3ZDMA 3B5NA 2IBZG 2Y9YA 1IFDA 1UIIA 3G6EP 3C8VA 3H32B 2M5AA 1IC2A 1SQPD 3JC22 2N1TD 2K9YA 4HJGH 1X8YA 3L70G 1S3JA 3CX5H 2QA4P 1OW8A 1S5LX 1CZQA 3JSVC 3LIDA 1LTJA 3AEDC 2RKLA 2A06G 2N1TC 1BGYD 3HD7B 1X79B 2AXTE 2FFDB 3BRVB 3CI9A 3RL0g 3RK2C 4D6TG 4L76A 3CC4P 3CWBD 5KLVJ 2P58A 5B66E 1RF0C 1GW4A 2ZVNB 1M1JC 2A45H 1JY2O 5KLIC 3TYYA 4BRYB 4Z1MH 1IFJA 1GL2A 3TF5A 2OTKE 1L4AD 1KQSO 1HVVA 1VPCA 3H1IJ 1PL5A 2OYHA 2BCCE 3P8CD 5E79E 3CC2P 2IBZE 4LC1A 3UIAA 4ASVA 1EDLA 1PP9E 1GTWA 4IL6X 1U7JA 1YI2P 3TK1A 1IFNA 3WMM0 5APSA 2FYNC 1WRGA 1N86A 1L4AC 1VL2A 1Q7YQ 1M8OB 3H1LD 3MP7B 3L70E 1JCCA 2QJKB 1W2BO 1N7SD 4XFJA 3L75J 2GA1A 4IFDK 3L4FA 1A02F 1GU4A 1H88A 2A06E 1SLQA 2M3EA 1ZW0A 3TGUJ 2QM8A 1YBKA 2KZIA 1T3JA 3AE6C 3CWBG 1L0NE 1KB9I 3RBZA 1KYOE 4UB8E 1RF1A 3W67A 1P84H 3L35A 2Y0EA 1N7SC 2QJYB 4D6TE 5APXA 4ZMDA 3O8ZA 1NU1K 2WSFH 1KB9D 4JPZB 1G1JA 4AYCA 1ZOYC 2QEXP 2WT7B 2N1TB 1BCCJ 2XV5A 2AEMA 1WMKA 2KK7A 1K05A 3CCVP 3RK2B 2H43A 3H1HJ 3T97B 3CX5I 1DD4A 3KZIH 3OAKA 3PLNA 5APYA 5AW6B 3CCEP 3D6ZA 5KLIB 1SQVK 3Q3DA 3H1LG 3CX5D 2P7JA 1CSBA 2FXOA 4W7ZA 1RY3A 2O3JA 1YQ4C 1S5LE 2LXBA 2NZ2A 3H1KG 3C1LA 4UB6E 2H88C 1KMIZ 2PGDA 3KPEA 3OA7A 1YYCA 2KIKA 2YXQB 5AVWB 1JMBA 3BVHA 1FOSF 3Q5RA 1HWTC 2WSCH 1BDDA 1BE3E 1NTMJ 2K37A 2B88A 2A45I 4EOTA 4MN4C 1S1CX 1L0LD 1NOHA 2M0BA 1YJNP 1PFIA 3V2PA 2ZXXA 3EWKA 2B87A 3L37A 1LTTC 1OVVA 3CXHE 2OARA 3B71A 1YTZT 2QE7H 4H13D 1SQQK 2KB7P 3H1JJ 3TNUA 2N9BA 4ZNCA 1OVRA 4I1LA 1ZR4A 3GHGA 2YO2A 5AW3B 2Y9ZA 1NKZB 1LWUA 2CPBA 2R3CA 2XU6A 1TU3F 3RK3E 2KSEA 2AEJA 1PGJA 3FXEA 4RKUJ 5M1BA 3OW2O 4OH8B 3ABVC 3CCQP 2BCCJ 3RGUA 4H13C 1BDCA 4IL6E 1MV8A 1IJDB 5AVZB 1IO4A 1MZ9A 1KILD 1JO5A 1GMJA 5KAFE 3KXDA 2M3BA 4NPEA 1RE4C 4YTPC 3KHUA 2KI7B 3CPWO 1EDKA 2L91A 1DH3A 2ZYDA 4ASWA 3Q5SA 1SQBK 4K3AA 3L74D 1DX7A 1KYOH 1H0TB 3MD0A 3L70J 3VYIA 2YKOA 4WBAA 3H1KE 4N3YB 1KILC 5EFWB 1GW3A 1P84I 1G2CB 3WU2H 1FZFA 2WMMA 4HKZH 3IN6A 1SQXK 1JTHB 2RN0A 1FZCB 2W6BA 3IR9A 3V2RA 3SFEC 1OWAA 3Q1MA 5AW5B 1P84D 1T3UA 2Y0CA 3M91A 3AE2C 4DJGA 1R5LA 2O01N 3TSIA 2JEEA 1X9VA 1M56D 5TISE 4D6TJ 2O01J 4PJ0H 4ZKUA 2N9YB 5AVYB 1KQFB 5CCGD 3AE1C 5AVQB 2IFNA 1NU1G 3U1AA 1HTLC 3EFGA 2JP3A 2ZVOB 5BU5A 3VP8A 1PGOA 3U59A 3BCCD 1SQQD 3V4QA 3LW5H 2PRRA 5CCHD 2W27A 3WUUA 1GZLA 2E75D 5APTA 3MGNA 1G1IA 4A7PA 4NPFX 1GD2E 4EDFA 3HD7D 3CD6P 3QWOC 1FZEA 2ZT9D 1SQPK 1E5WA 5AW4B 1SQVG 1ZRTD 5CCHC 1CI6A 2Q1KA 1KQGB 3PRJA 2E75C 2KNCA 5AW2B 2Q7CA 2Z5HA 4H13B 3M06A 3HD7C 1FZAA 3P7KA 1SQBD 3L73D 4CPGA 2ZT9C 1NAFA 3MHVA 1OIPA 4WB4A 2OYIA 1EDIA 3AEBC 2IX7C 4GIFA 1K9MQ 2FXPA 3CWBJ 2OQQA 3H25A 3M9QA 1KQLA 1SQXD 2QJPB 3AE3C 1KILA 1PIXA 4JYBA 1DEBA 3ITKA 3HUSA 3FXDA 4U3FD 4JQ0D 3PJSK 3G3ZA 1FDIA 1NU1E 3BCCG 1VQMP 4PD4H 3L71G
chains in the Genus database with same CATH topology
4XE5B 1IFJA 3M0AA 1GL2A 3M0DC 4JYCA 1L4AD 1HVVA 2KOGA 1EQ7A 3RL0C 1JY3P 1VPCA 2YKPA 1S9KE 1JY3N 2HPCB 2OYHA 1ZV8A 2I1JA 3P8CD 1H89A 3VP9A 4LC1A 1FJPA 3UIAA 1LT9A 3V5BA 3RL0B 2MJZA 1GTWA 3B5ND 4KHXA 1JY2P 3HTKA 1T8ZA 2R5BA 2FYZA 3TK1A 2E43A 1LTGC 3VOPA 1XTCC 1LTIC 1IFNA 1L0NK 3WMM0 2O1JA 5APSA 1WRGA 1N86A 1L4AC 1URQA 2YO3A 5AW8B 2WTYA 1YTZI 1AFOA 1NTMK 1L4AB 3RK3B 5KJ7D 1JCCA 5APWA 3B5NC 2L5GB 2YMYA 1N7SD 3H32A 2KP8A 5AVSB 1MFZA 5BU8B 3VMXA 1T2KD 4IFDK 3L4FA 1A02F 1JCDA 5AVTB 1GU4A 1H88A 2P67A 2HODA 3HE4B 5CCGA 3NMDA 1RE3A 1SLQA 1FZGA 1JOCA 3TNUB 3GHGB 2QM8A 1LWUB 3CL3D 1W2EA 1T3JA 1KFMA 1J2JB 4I2LC 4WY4D 3KYQA 1HJBA 2CPSA 2Q3IA 3RK2D 1FBMA 5KJ7C 2IFMA 1RF1A 3HE5A 5CCHA 3L35A 5CMZA 4GT1A 1N7SC 1N7LA 5AW1B 2P1JA 5APXA 3A2AA 3O8ZA 1NU1K 2HFED 1T2KC 5CJ0A 2I1KA 1NTKK 2WSFH 1SFCA 1LTJC 1LTAC 1G1JA 1NTZK 4AYCA 1CI6B 1HUCA 1N7SB 4HH2A 2E42A 1S9KD 1RE4A 3A3YB 3HD7A 2NPSA 2WT7B 2FFDA 1NHLA 3P8MC 2N1TB 4WY4C 2VRSA 3U1CA 1JY3O 1IFIA 2OYIC 2XV5A 1N73C 1GL2D 4AQRD 3RK2B 2H43A 2M8RA 4LGDE 2R5DA 4EIJA 1KZUB 3P32A 4B86A 3OAKA 2W6AA 5APYA 5AW6B 1SQVK 2J58A 3EQ2A 3HUSC 1FOSE 4M3LA 2FKWB 2P7JA 1JUNA 1NO4A 1CSBA 3II6A 3V2NA 2YKQA 2YNYA 4W7ZA 1LTSC 1RY3A 3B8EB 2HPCA 1GL2C 2P2UA 2XDJA 4I6MC 5AVXB 1URQD 2JJLA 2OYHC 1GL2B 4C46A 4GKGA 2KSJA 1GDTA 3KPEA 3OA7A 4C7NB 5APQA 1YYCA 1LT9C 5AVWB 3BVHA 1GU5A 1FOSF 1HWTC 1GK6A 2WSCH 3NXSA 2R32A 3BRTB 2WPQA 2WSEH 2A45I 1MUUA 4EOTA 1ZN5A 1QL1A 1NOHA 1HGZA 3V2PA 1PFIA 3M9HA 1L0LK 2FYUK 2XNXA 2IPPA 2ZFCA 5BVZA 1URQC 3L37A 1HH0A 1LTTC 1NH4A 1CW5A 1H8AA 2OARA 1YTZT 3B5NB 2QM7A 1SQQK 2KB7P 1OXZA 3N4XA 2WITA 1IFMA 2KYVA 2N9BA 1FAVA 4HYTB 3TNUA 5CJ4A 4AUWA 4I1LA 1ZR4A 3GHGA 2YO2A 5AW3B 1SFCD 1NKZB 1LWUA 3OJAB 3SWYA 5CCGC 3VMZA 2CPBA 4DZOA 2R3CA 2XU6A 5AW9B 1SP4A 2NPSD 1WT6A 3C9IA 1NKNA 1N2DC 4N6JA 2LKMA 1FDMA 2C0XA 2FXMA 2C9LY 2WWWA 4OH8B 2Q5UA 1RF1C 1HBWA 3VTPC 1FZBA 1MV8A 1IJDB 5AVZB 2PP6A 3MIWA 1IO4A 1MZ9A 1KILD 1LTJB 1SFCC 2WT7A 1J1EC 4RESB 1JO5A 2GUVA 3HE5B 1ZLLA 2M3BA 2N1TA 5APUA 3A5TA 1RE4C 3H6PA 2NPSC 2FFDC 3VMYA 2WPSA 4Y99C 2Z5IA 1DH3A 1A02J 4WY4B 4IFFA 3NTNA 2PAJA 2OYIB 3L36A 1SQBK 3BATA 1DX7A 3KDPB 2BASA 4Y99B 2H8PD 5KTBA 4XA4A 3T97A 3MD0A 3VYIA 2YKOA 1N73B 1RF0A 4WBAA 1FJKA 4N3YB 1J1DC 1FZCC 1KILC 1M1JA 2C9NY 3HRNA 1GW3A 1G2CB 1FZFA 1XTGB 5AW7B 1JTHB 1SQXK 1ZR2A 1J1DB 1FZCB 1KILB 2W6BA 3IR9A 2O1KA 2J59M 3M9BA 3V2RA 3SWFA 5AVUB 3HUSB 5KLVK 1Z56A 1OWAA 5AW5B 1T3UA 4O9BA 1AQ5A 3M0DA 3M91A 2HG5D 2H7HA 5AVVB 3TSIA 1M7LA 3CLQA 2JEEA 3R2PA 3E1IA 4C7NA 3RK3D 1X9VA 1JNMA 4C7RA 2OYHB 5APVA 4ZKUA 4JF7A 5AVYB 1LGHB 1LT9B 5CCGD 4IFMA 5AVQB 3BASA 2IFNA 1SVFA 4W80A 3U1AA 2HYNA 3IFMA 1HTLC 2POHA 3HTKB 3EFGA 1JY2N 1L4AA 5BU5A 2GM4A 3VP8A 1VDFA 3VN0A 3U59A 2KLVA 3V4QA 3LW5H 3RK3C 1LTBC 1QL2A 2WPRA 4N78E 5CCHD 4W7YA 1IK9A 3HE4A 2Z4EA 1URQB 2W27A 3LIEA 3B5NA 1JMMA 1GZLA 5APTA 1IFDA 3MGNA 1G1IA 2C0WA 4DOJA 1NWQA 1GD2E 1RE3C 3H32B 3HD7D 3MTUE 1IC2A 3GHGC 1LWUC 3P8CE 2HODB 1FZEA 2XZRA 2N1TD 1GK4A 1SQPK 3V4WA 1E5WA 5AW4B 3MUDA 1X8YA 2ZXEB 2WZ7A 5KJ7A 5CCHC 5CHXA 3KQGA 1CI6A 1N7SA 3NFQA 1CZQA 3LIDA 5AW2B 1LTJA 2Q7CA 1RF1B 2Z5HA 3M06A 2HLOA 3PP5A 1FU1A 3A7OA 3HD7C 1FZAA 3P7KA 1SFCB 1J1EB 1HGVA 1NAFA 2N1TC 4WY4A 3N7NA 4WB4A 3I5CA 4LLHA 2OYIA 3HD7B 1X79B 1KFNA 2Q9IA 2NPSB 2FFDB 3BRVB 2GUSA 2IX7C 2XKMA 3CI9A 4GIFA 1N73A 2O01H 3RK2C 3M9QA 4ZKPA 3RL0D 1KQLA 3V2QA 1G2CA 1RF0C 1GW4A 1JTHA 5AVRB 1FZCA 1M1JC 1KILA 2A45H 4JYBA 1JY2O 1DEBA 3TYYA 4N78D 2A45G 3HUSA 3G3ZA 5AW0B 1M1JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BVZ A;  3HRN A;  1WT6 A;  1IC2 A;  5BU5 A;  4ZKP A;  2JEE A;  3VP8 A;  5BU8 B;  3C9I A;  1NKN A;  3U59 A;  2FXM A;  4ZKU A;  3P8C D;  3N4X A;  3N7N A;  3BAT A;  1X79 B;  4I1L A;  3VP9 A;  4O9B A;  3BAS A;  4N78 D;  5KTB A;  3OJA B;  3U1A A;  4GIF A;  2POH A;  4N3Y B;  3U1C A; 
#chains in the Genus database with same CATH topology
 2JDI H;  3M0A A;  3JCU E;  1X0T A;  1EQ7 A;  1JY3 P;  2YKP A;  2WQY C;  1S9K E;  1JY3 N;  2HPC B;  3F89 A;  1YIT P;  1H89 A;  3VP9 A;  1LT9 A;  1SS1 A;  3SFD C;  3RL0 B;  4KHX A;  1IK7 A;  3AEE C;  2Q3E A;  3A0B H;  1BCC E;  1JY2 P;  1LP1 A;  2R5B A;  2FYZ A;  3A0H E;  3FWN A;  2B9B A;  4DT0 A;  2D2C D;  2O1J A;  4KJM A;  3H1L J;  1PPJ G;  1SQV E;  1URQ A;  1VF5 B;  1RQV A;  1M1K Q;  5KJ7 D;  3H1K J;  3H32 A;  1UIX A;  1JCD A;  5AVT B;  2LR2 A;  1OX3 A;  5CCG A;  3NMD A;  2D2C C;  1W2E A;  1SQX G;  3PHL A;  4WY4 D;  4I2L C;  2QJY C;  1JEK A;  1DD3 A;  3RK2 D;  3MUD C;  1AJY A;  2I8D A;  2KUB A;  5KJ7 C;  2QIW A;  5CCH A;  5CMZ A;  1NTK D;  2E75 B;  5AW1 B;  1NTZ D;  1NTM E;  1LTA C;  4K35 A;  2E42 A;  3A3Y B;  3HD7 A;  2FFD A;  3P8M C;  2ZT9 B;  1EZV G;  4WY4 C;  1JY3 O;  3L71 E;  1IFI A;  1FS0 E;  2W90 A;  3RBX A;  1QX8 A;  2KZJ A;  1N73 C;  1LNQ A;  2OGU A;  2FYU G;  2ZAE B;  5KAI H;  1ZP0 C;  3H1J E;  1EXI A;  1YHQ P;  3L72 D;  1BSH A;  4BRY A;  5B5E E;  3EQ2 A;  2JO1 A;  3II6 A;  2K1A A;  1OFC X;  2YKQ A;  3AEA C;  3B8E B;  4H44 C;  1AVO A;  2QRX A;  1PPJ E;  3USS A;  1SQP G;  2R44 A;  5AVX B;  4L75 A;  1GL2 B;  4C46 A;  4L73 A;  1Q90 D;  4GKG A;  5DJT B;  4C7N B;  5APQ A;  3AE5 C;  2R32 A;  3BRT B;  1ZN5 A;  2UWJ E;  1L0L K;  2XNX A;  4PD4 I;  2ZFC A;  5BVZ A;  1BGY G;  1Y47 A;  2K9J B;  3CCJ P;  1BSN A;  1IZN B;  4PD4 D;  2V7Q J;  1MKM A;  3N4X A;  2WIT A;  2KYV A;  5CJ4 A;  1FAV A;  4AUW A;  1SFC D;  2D2C B;  1QGK B;  1NU1 J;  1SP4 A;  2NPS D;  1EZV E;  3L72 G;  4N6J A;  1AVY A;  1FDM A;  2C0X A;  1LT1 A;  2FYU E;  4OWF A;  2Q5U A;  2JR8 A;  3VTP C;  4Y28 J;  2PP6 A;  2YIU C;  2V4H A;  1ZXG A;  2WT7 A;  1SFC C;  3O6Q B;  2N1T A;  5APU A;  3A5T A;  2NPS C;  1QEX A;  4WY4 B;  4IFF A;  3FWL A;  3L36 A;  3IF4 A;  3Q2Y A;  3KDP B;  1M90 Q;  1SQV J;  2BAS A;  4Y99 B;  3T97 A;  1S72 P;  1N73 B;  1RF0 A;  1SQP E;  4GOD A;  1USD A;  3CCU P;  1FZC C;  1M1J A;  4R4L A;  2C9N Y;  2FY8 A;  1Q2N A;  5AW7 B;  2AXT H;  2O1K A;  2RMZ A;  1VQ6 P;  1AQ5 A;  4OGQ B;  5GTH E;  4H44 B;  5B66 H;  1FC2 C;  3Q5P A;  3R2P A;  3E1I A;  1BGY E;  1JNM A;  4C7R A;  3V6I A;  4JF7 A;  5B5E H;  3H1I D;  1OMI A;  1SVF A;  4W80 A;  2OTJ P;  2HYN A;  3IFM A;  3HTK B;  2KS1 B;  3CWB E;  1YIJ P;  1L4A A;  3BCC J;  3L71 J;  2GM4 A;  1VDF A;  5E79 H;  3E7K A;  3L72 E;  2QVA A;  4W7Y A;  4BWN A;  3HE4 A;  2Z4E A;  3LIE A;  1JMM A;  3AE4 C;  3CC7 P;  4DOJ A;  1NWQ A;  2B87 B;  2ZYG A;  1D7M A;  4U7J A;  1Q82 Q;  1L2P A;  3P8C E;  2HOD B;  3L75 D;  3AEC C;  2ZXE B;  2SPZ A;  3SWK A;  1N7S A;  3TGU D;  4QMA A;  3AE9 C;  1VQ9 P;  1T6A A;  2HLO A;  2YIU B;  1U7M A;  1SFC B;  3H1L E;  3PH0 A;  1HGV A;  2YMK A;  3I5C A;  1X22 A;  3R4Y A;  2Q9I A;  2NPS B;  4UB8 H;  1H0T A;  3VMA A;  1S4X A;  3I55 P;  2QJP C;  1SQX J;  1K73 Q;  2O01 H;  3RL0 D;  1G2C A;  1L0L G;  1R5S A;  1JTH A;  2IYO A;  1FZC A;  4YXW H;  4N78 D;  2A45 G;  3H1H D;  1E79 H;  2LXC B;  4JBZ A;  4XE5 B;  2Q6Q A;  3TDK A;  1VF5 D;  1KB9 E;  1VQ4 P;  3M0D C;  4JYC A;  3RL0 C;  5L8R J;  1ZV8 A;  2I1J A;  3GW6 A;  2FYU J;  2ZJS E;  1FJP A;  2MJZ A;  3B5N D;  1QLE D;  2E43 A;  1LTG C;  1XTC C;  3AEF C;  1LTI C;  1L0N K;  1VF5 C;  1S5L H;  2E76 D;  4KT0 J;  4UB6 H;  1YTZ I;  3IAO A;  3CX5 E;  1NGM B;  1SQP J;  3B5N C;  2L5G B;  2YMY A;  1MFZ A;  2G3A A;  3CCR P;  1EDJ A;  3L74 G;  1T2K D;  3F5H A;  1YQ3 C;  2E76 C;  3CL3 D;  4WWI A;  1J2J B;  3KYQ A;  2CPS A;  3CXH H;  2WSE J;  1FBM A;  3AEG C;  2XND H;  3HE5 A;  3S9O A;  1PZQ A;  3A2A A;  1T2K C;  1BGY J;  5CJ0 A;  1NTK K;  2IBZ I;  1LTJ C;  1L0L E;  2WPV B;  1NTZ K;  1CI6 B;  1HUC A;  4H0L B;  1RE4 A;  2BCC D;  3GLM A;  1USE A;  2IBZ D;  1Y9B A;  1PP9 D;  3AE8 C;  4TLF A;  4IL6 H;  1GL2 D;  3L72 J;  1AV1 A;  3CCS P;  4PV1 D;  2B89 A;  5KAF H;  4BXL A;  2M8R A;  1Y8A A;  1DEE G;  2R5D A;  4EIJ A;  2W6A A;  1SQQ G;  4L74 A;  3MZW B;  3L70 D;  2J58 A;  1FOS E;  4M3L A;  2FKW B;  1JUN A;  1KOR A;  3V2N A;  2OYO A;  2YNY A;  1LTS C;  2HPC A;  5DJU B;  1GL2 C;  1KIL E;  2P2U A;  2A06 D;  2ITA A;  4PV1 C;  2XDJ A;  4I6M C;  1KYO I;  2JJL A;  2OYH C;  1YJ9 P;  1HJ0 A;  1L0N D;  1N8R Q;  3GMA A;  1M57 D;  1GK6 A;  3L74 E;  1KYO D;  1RHZ B;  4YXD C;  3NXS A;  4D6T D;  1QL1 A;  1KB9 H;  1HGZ A;  3M9H A;  1SQB G;  2IPP A;  3L73 G;  5TIS H;  1HH0 A;  1CW5 A;  1VQP P;  1P84 E;  3B5N B;  2QM7 A;  4DCK A;  4EYY Q;  2IZ1 A;  1IFM A;  4HYT B;  1PP9 G;  3SWY A;  3D70 A;  2K3R A;  5H2F E;  3VMZ A;  2CK3 H;  2M5A B;  5AW9 B;  2E76 B;  1WT6 A;  1NKN A;  2LKM A;  4U3F G;  2W8Z A;  2FXM A;  2C9L Y;  2WWW A;  1RF1 C;  1KN7 A;  2BEQ D;  3MIW A;  4RO0 A;  1LTJ B;  1YJW P;  1J1E C;  1ZLL A;  3BCC E;  1SQQ E;  4OGQ D;  3KZI E;  4I7Z B;  3VMY A;  2WPS A;  4Y99 C;  2Z5I A;  1A02 J;  4H44 D;  4GOE A;  1MFT A;  3NTN A;  2PAJ A;  3GF7 A;  3BAT A;  1L0N G;  5K5G B;  1BE3 D;  2H8P D;  5KTB A;  3CXH I;  3QH9 A;  1XTG B;  1ZRT E;  4OGQ C;  1ZR2 A;  1J1D B;  1PGP A;  2RH0 A;  3CXH D;  2J59 M;  2AEF A;  3M9B A;  1LJ2 A;  5KLV K;  1KV4 A;  2P10 A;  3G71 P;  1NAY A;  5AVV B;  1EC5 A;  1SQB E;  2V7Q H;  1M7L A;  3L73 E;  4PV1 B;  3S4R A;  4C7N A;  3RK3 D;  1QVF O;  2OYH B;  2BEZ F;  1L0L J;  4IFM A;  3BAS A;  1VQ8 P;  3I56 P;  1NTK G;  3JCU H;  4YPC A;  1NTZ G;  1SQX E;  4GOF A;  1KTM A;  3CME P;  3VN0 A;  3E1R A;  3RK3 C;  1LTB C;  2K9J A;  2WPR A;  4U3F E;  1IK9 A;  2WVR A;  2IZ0 A;  3A0H H;  2C0W A;  1RE3 C;  3SSU A;  3MTU E;  3GHG C;  3GF3 A;  3K5B A;  3H1K D;  1LWU C;  1BE3 G;  2XZR A;  1GK4 A;  3V4W A;  3MUD A;  2J5U A;  1QVG O;  2WZ7 A;  3GG2 A;  5KJ7 A;  1RQU A;  5CHX A;  3KQG A;  2JKV A;  2QSI A;  3NFQ A;  1RF1 B;  3O6Q A;  3PP5 A;  1FU1 A;  1NYH A;  3A7O A;  1S2E A;  1J1E B;  3L74 J;  4IOI H;  5H2F H;  4WY4 A;  3WU2 E;  3N7N A;  4LLH A;  1KFN A;  2GUS A;  2XKM A;  1N73 A;  3WUT A;  1VQO P;  4ZKP A;  3CCL P;  3V2Q A;  1RH5 B;  5KLV D;  1JB0 J;  5AVR B;  2HR3 A;  1AQT A;  1K04 A;  4PJ0 E;  2WSF J;  5AW0 B;  1OVU A;  1M1J B;  1NTK E;  3CCM P;  1NTZ E;  3EFF K;  1VQ5 P;  2KOG A;  1EXJ A;  4OVN F;  1R8E A;  1AA0 A;  5C39 A;  3V5B A;  2MKV A;  5TJH A;  1KC8 Q;  2IYP A;  3HTK A;  1T8Z A;  2KS1 A;  3VOP A;  2W83 C;  1SQQ J;  3B4S A;  2E74 D;  2KLU A;  1VQ7 P;  3CMA P;  2YO3 A;  5AW8 B;  2WTY A;  2FYN B;  1AFO A;  1NTM K;  1L4A B;  3RK3 B;  5CBN A;  5APW A;  2IDB A;  2KP8 A;  5AVS B;  4H0L D;  1PGQ A;  3VMX A;  5BU8 B;  2JWD A;  2OTL P;  2K88 A;  2P67 A;  2HOD A;  3HE4 B;  1RE3 A;  3S1K A;  1FZG A;  1JOC A;  3TNU B;  2E74 C;  3GHG B;  1LWU B;  1VQL P;  1DIP A;  1KFM A;  2WSC J;  2W6J H;  1HJB A;  2Q3I A;  3FX0 A;  5KLV G;  1VQK P;  2R3S A;  2IFM A;  1NU1 D;  4GT1 A;  1SQB J;  1N7L A;  3L73 J;  2ZYA A;  2P1J A;  4H0L C;  2HFE D;  2I1K A;  1SFC A;  1FE6 A;  2YXR B;  1NJI Q;  1N7S B;  4HH2 A;  1OW7 A;  1S9K D;  5GTI E;  2NPS A;  1PP9 J;  1NHL A;  4NPD A;  2VRS A;  3U1C A;  2OYI C;  1BCC D;  3H1I G;  4PD4 E;  3W68 A;  4AQR D;  3G4S P;  2Y0D A;  1HF9 A;  4U3F J;  4LGD E;  4HB1 A;  1SQV D;  1KZU B;  3P32 A;  2NRG A;  4B86 A;  1Q86 Q;  3HUS C;  4TT3 H;  3A0B E;  3WUV A;  1NO4 A;  1JM0 A;  3D6Y A;  4RJT A;  4EI2 A;  5KKZ C;  1L0N J;  3L75 G;  1URQ D;  2KXP B;  5CBO A;  2KSJ A;  1GDT A;  1LT9 C;  1GU5 A;  3AE7 C;  3TGU G;  5GTH H;  2E5Y A;  2WPQ A;  1FDO A;  2WSE H;  1MUU A;  1NTM D;  3PTZ A;  2FYU K;  1URQ C;  5KLV E;  1NH4 A;  1H8A A;  3L71 D;  1Q81 Q;  1OXZ A;  2G8Y A;  3OJA B;  3H1J D;  1BCC G;  5CCG C;  3G9R A;  4DZO A;  2E74 B;  1NTK J;  1NTZ J;  3C9I A;  1N2D C;  3H1I E;  2QG4 A;  3H1H G;  3D71 A;  1K8A Q;  1HBW A;  1W5C E;  1FZB A;  5KAI E;  3LW5 J;  4I7Z C;  2AXC A;  2KNC B;  4RES B;  1PPJ D;  2GUV A;  3HE5 B;  1PV3 A;  3H6P A;  2FFD C;  1U57 A;  1BE3 J;  2OYI B;  4WVZ A;  4XA4 A;  1FJK A;  3L75 E;  1J1D C;  3HRN A;  1IFP A;  1NTM G;  1OZH A;  5GTI H;  1KIL B;  3TGU E;  3SWF A;  1OW6 A;  1NVO A;  3HUS B;  5AVU B;  1Z56 A;  2DW3 A;  4O9B A;  3M0D A;  1EZV I;  2WSS H;  2JWA A;  2E5T A;  2HG5 D;  2H7H A;  5KKZ B;  3CLQ A;  2H89 C;  1ZME C;  4R4M A;  3H1J G;  1EZV D;  3FGA D;  5APV A;  2FBW C;  1LGH B;  1LT9 B;  2PFX A;  2FYU D;  4GDO A;  1LP1 B;  2POH A;  1JY2 N;  1KD1 Q;  1VQN P;  2BCC G;  2KLV A;  1QL2 A;  4N78 E;  2QJK C;  1URQ B;  3H1H E;  3ZDM A;  3B5N A;  2IBZ G;  2Y9Y A;  1IFD A;  1UII A;  3G6E P;  3C8V A;  3H32 B;  2M5A A;  1IC2 A;  1SQP D;  3JC2 2;  2N1T D;  2K9Y A;  4HJG H;  1X8Y A;  3L70 G;  1S3J A;  3CX5 H;  2QA4 P;  1OW8 A;  1S5L X;  1CZQ A;  3JSV C;  3LID A;  1LTJ A;  3AED C;  2RKL A;  2A06 G;  2N1T C;  1BGY D;  3HD7 B;  1X79 B;  2AXT E;  2FFD B;  3BRV B;  3CI9 A;  3RL0 g;  3RK2 C;  4D6T G;  4L76 A;  3CC4 P;  3CWB D;  5KLV J;  2P58 A;  5B66 E;  1RF0 C;  1GW4 A;  2ZVN B;  1M1J C;  2A45 H;  1JY2 O;  5KLI C;  3TYY A;  4BRY B;  4Z1M H;  1IFJ A;  1GL2 A;  3TF5 A;  2OTK E;  1L4A D;  1KQS O;  1HVV A;  1VPC A;  3H1I J;  1PL5 A;  2OYH A;  2BCC E;  3P8C D;  5E79 E;  3CC2 P;  2IBZ E;  4LC1 A;  3UIA A;  4ASV A;  1EDL A;  1PP9 E;  1GTW A;  4IL6 X;  1U7J A;  1YI2 P;  3TK1 A;  1IFN A;  3WMM 0;  5APS A;  2FYN C;  1WRG A;  1N86 A;  1L4A C;  1VL2 A;  1Q7Y Q;  1M8O B;  3H1L D;  3MP7 B;  3L70 E;  1JCC A;  2QJK B;  1W2B O;  1N7S D;  4XFJ A;  3L75 J;  2GA1 A;  4IFD K;  3L4F A;  1A02 F;  1GU4 A;  1H88 A;  2A06 E;  1SLQ A;  2M3E A;  1ZW0 A;  3TGU J;  2QM8 A;  1YBK A;  2KZI A;  1T3J A;  3AE6 C;  3CWB G;  1L0N E;  1KB9 I;  3RBZ A;  1KYO E;  4UB8 E;  1RF1 A;  3W67 A;  1P84 H;  3L35 A;  2Y0E A;  1N7S C;  2QJY B;  4D6T E;  5APX A;  4ZMD A;  3O8Z A;  1NU1 K;  2WSF H;  1KB9 D;  4JPZ B;  1G1J A;  4AYC A;  1ZOY C;  2QEX P;  2WT7 B;  2N1T B;  1BCC J;  2XV5 A;  2AEM A;  1WMK A;  2KK7 A;  1K05 A;  3CCV P;  3RK2 B;  2H43 A;  3H1H J;  3T97 B;  3CX5 I;  1DD4 A;  3KZI H;  3OAK A;  3PLN A;  5APY A;  5AW6 B;  3CCE P;  3D6Z A;  5KLI B;  1SQV K;  3Q3D A;  3H1L G;  3CX5 D;  2P7J A;  1CSB A;  2FXO A;  4W7Z A;  1RY3 A;  2O3J A;  1YQ4 C;  1S5L E;  2LXB A;  2NZ2 A;  3H1K G;  3C1L A;  4UB6 E;  2H88 C;  1KMI Z;  2PGD A;  3KPE A;  3OA7 A;  1YYC A;  2KIK A;  2YXQ B;  5AVW B;  1JMB A;  3BVH A;  1FOS F;  3Q5R A;  1HWT C;  2WSC H;  1BDD A;  1BE3 E;  1NTM J;  2K37 A;  2B88 A;  2A45 I;  4EOT A;  4MN4 C;  1S1C X;  1L0L D;  1NOH A;  2M0B A;  1YJN P;  1PFI A;  3V2P A;  2ZXX A;  3EWK A;  2B87 A;  3L37 A;  1LTT C;  1OVV A;  3CXH E;  2OAR A;  3B71 A;  1YTZ T;  2QE7 H;  4H13 D;  1SQQ K;  2KB7 P;  3H1J J;  3TNU A;  2N9B A;  4ZNC A;  1OVR A;  4I1L A;  1ZR4 A;  3GHG A;  2YO2 A;  5AW3 B;  2Y9Z A;  1NKZ B;  1LWU A;  2CPB A;  2R3C A;  2XU6 A;  1TU3 F;  3RK3 E;  2KSE A;  2AEJ A;  1PGJ A;  3FXE A;  4RKU J;  5M1B A;  3OW2 O;  4OH8 B;  3ABV C;  3CCQ P;  2BCC J;  3RGU A;  4H13 C;  1BDC A;  4IL6 E;  1MV8 A;  1IJD B;  5AVZ B;  1IO4 A;  1MZ9 A;  1KIL D;  1JO5 A;  1GMJ A;  5KAF E;  3KXD A;  2M3B A;  4NPE A;  1RE4 C;  4YTP C;  3KHU A;  2KI7 B;  3CPW O;  1EDK A;  2L91 A;  1DH3 A;  2ZYD A;  4ASW A;  3Q5S A;  1SQB K;  4K3A A;  3L74 D;  1DX7 A;  1KYO H;  1H0T B;  3MD0 A;  3L70 J;  3VYI A;  2YKO A;  4WBA A;  3H1K E;  4N3Y B;  1KIL C;  5EFW B;  1GW3 A;  1P84 I;  1G2C B;  3WU2 H;  1FZF A;  2WMM A;  4HKZ H;  3IN6 A;  1SQX K;  1JTH B;  2RN0 A;  1FZC B;  2W6B A;  3IR9 A;  3V2R A;  3SFE C;  1OWA A;  3Q1M A;  5AW5 B;  1P84 D;  1T3U A;  2Y0C A;  3M91 A;  3AE2 C;  4DJG A;  1R5L A;  2O01 N;  3TSI A;  2JEE A;  1X9V A;  1M56 D;  5TIS E;  4D6T J;  2O01 J;  4PJ0 H;  4ZKU A;  2N9Y B;  5AVY B;  1KQF B;  5CCG D;  3AE1 C;  5AVQ B;  2IFN A;  1NU1 G;  3U1A A;  1HTL C;  3EFG A;  2JP3 A;  2ZVO B;  5BU5 A;  3VP8 A;  1PGO A;  3U59 A;  3BCC D;  1SQQ D;  3V4Q A;  3LW5 H;  2PRR A;  5CCH D;  2W27 A;  3WUU A;  1GZL A;  2E75 D;  5APT A;  3MGN A;  1G1I A;  4A7P A;  4NPF X;  1GD2 E;  4EDF A;  3HD7 D;  3CD6 P;  3QWO C;  1FZE A;  2ZT9 D;  1SQP K;  1E5W A;  5AW4 B;  1SQV G;  1ZRT D;  5CCH C;  1CI6 A;  2Q1K A;  1KQG B;  3PRJ A;  2E75 C;  2KNC A;  5AW2 B;  2Q7C A;  2Z5H A;  4H13 B;  3M06 A;  3HD7 C;  1FZA A;  3P7K A;  1SQB D;  3L73 D;  4CPG A;  2ZT9 C;  1NAF A;  3MHV A;  1OIP A;  4WB4 A;  2OYI A;  1EDI A;  3AEB C;  2IX7 C;  4GIF A;  1K9M Q;  2FXP A;  3CWB J;  2OQQ A;  3H25 A;  3M9Q A;  1KQL A;  1SQX D;  2QJP B;  3AE3 C;  1KIL A;  1PIX A;  4JYB A;  1DEB A;  3ITK A;  3HUS A;  3FXD A;  4U3F D;  4JQ0 D;  3PJS K;  3G3Z A;  1FDI A;  1NU1 E;  3BCC G;  1VQM P;  4PD4 H;  3L71 G; 
#chains in the Genus database with same CATH homology
 4XE5 B;  1IFJ A;  3M0A A;  1GL2 A;  3M0D C;  4JYC A;  1L4A D;  1HVV A;  2KOG A;  1EQ7 A;  3RL0 C;  1JY3 P;  1VPC A;  2YKP A;  1S9K E;  1JY3 N;  2HPC B;  2OYH A;  1ZV8 A;  2I1J A;  3P8C D;  1H89 A;  3VP9 A;  4LC1 A;  1FJP A;  3UIA A;  1LT9 A;  3V5B A;  3RL0 B;  2MJZ A;  1GTW A;  3B5N D;  4KHX A;  1JY2 P;  3HTK A;  1T8Z A;  2R5B A;  2FYZ A;  3TK1 A;  2E43 A;  1LTG C;  3VOP A;  1XTC C;  1LTI C;  1IFN A;  1L0N K;  3WMM 0;  2O1J A;  5APS A;  1WRG A;  1N86 A;  1L4A C;  1URQ A;  2YO3 A;  5AW8 B;  2WTY A;  1YTZ I;  1AFO A;  1NTM K;  1L4A B;  3RK3 B;  5KJ7 D;  1JCC A;  5APW A;  3B5N C;  2L5G B;  2YMY A;  1N7S D;  3H32 A;  2KP8 A;  5AVS B;  1MFZ A;  5BU8 B;  3VMX A;  1T2K D;  4IFD K;  3L4F A;  1A02 F;  1JCD A;  5AVT B;  1GU4 A;  1H88 A;  2P67 A;  2HOD A;  3HE4 B;  5CCG A;  3NMD A;  1RE3 A;  1SLQ A;  1FZG A;  1JOC A;  3TNU B;  3GHG B;  2QM8 A;  1LWU B;  3CL3 D;  1W2E A;  1T3J A;  1KFM A;  1J2J B;  4I2L C;  4WY4 D;  3KYQ A;  1HJB A;  2CPS A;  2Q3I A;  3RK2 D;  1FBM A;  5KJ7 C;  2IFM A;  1RF1 A;  3HE5 A;  5CCH A;  3L35 A;  5CMZ A;  4GT1 A;  1N7S C;  1N7L A;  5AW1 B;  2P1J A;  5APX A;  3A2A A;  3O8Z A;  1NU1 K;  2HFE D;  1T2K C;  5CJ0 A;  2I1K A;  1NTK K;  2WSF H;  1SFC A;  1LTJ C;  1LTA C;  1G1J A;  1NTZ K;  4AYC A;  1CI6 B;  1HUC A;  1N7S B;  4HH2 A;  2E42 A;  1S9K D;  1RE4 A;  3A3Y B;  3HD7 A;  2NPS A;  2WT7 B;  2FFD A;  1NHL A;  3P8M C;  2N1T B;  4WY4 C;  2VRS A;  3U1C A;  1JY3 O;  1IFI A;  2OYI C;  2XV5 A;  1N73 C;  1GL2 D;  4AQR D;  3RK2 B;  2H43 A;  2M8R A;  4LGD E;  2R5D A;  4EIJ A;  1KZU B;  3P32 A;  4B86 A;  3OAK A;  2W6A A;  5APY A;  5AW6 B;  1SQV K;  2J58 A;  3EQ2 A;  3HUS C;  1FOS E;  4M3L A;  2FKW B;  2P7J A;  1JUN A;  1NO4 A;  1CSB A;  3II6 A;  3V2N A;  2YKQ A;  2YNY A;  4W7Z A;  1LTS C;  1RY3 A;  3B8E B;  2HPC A;  1GL2 C;  2P2U A;  2XDJ A;  4I6M C;  5AVX B;  1URQ D;  2JJL A;  2OYH C;  1GL2 B;  4C46 A;  4GKG A;  2KSJ A;  1GDT A;  3KPE A;  3OA7 A;  4C7N B;  5APQ A;  1YYC A;  1LT9 C;  5AVW B;  3BVH A;  1GU5 A;  1FOS F;  1HWT C;  1GK6 A;  2WSC H;  3NXS A;  2R32 A;  3BRT B;  2WPQ A;  2WSE H;  2A45 I;  1MUU A;  4EOT A;  1ZN5 A;  1QL1 A;  1NOH A;  1HGZ A;  3V2P A;  1PFI A;  3M9H A;  1L0L K;  2FYU K;  2XNX A;  2IPP A;  2ZFC A;  5BVZ A;  1URQ C;  3L37 A;  1HH0 A;  1LTT C;  1NH4 A;  1CW5 A;  1H8A A;  2OAR A;  1YTZ T;  3B5N B;  2QM7 A;  1SQQ K;  2KB7 P;  1OXZ A;  3N4X A;  2WIT A;  1IFM A;  2KYV A;  2N9B A;  1FAV A;  4HYT B;  3TNU A;  5CJ4 A;  4AUW A;  4I1L A;  1ZR4 A;  3GHG A;  2YO2 A;  5AW3 B;  1SFC D;  1NKZ B;  1LWU A;  3OJA B;  3SWY A;  5CCG C;  3VMZ A;  2CPB A;  4DZO A;  2R3C A;  2XU6 A;  5AW9 B;  1SP4 A;  2NPS D;  1WT6 A;  3C9I A;  1NKN A;  1N2D C;  4N6J A;  2LKM A;  1FDM A;  2C0X A;  2FXM A;  2C9L Y;  2WWW A;  4OH8 B;  2Q5U A;  1RF1 C;  1HBW A;  3VTP C;  1FZB A;  1MV8 A;  1IJD B;  5AVZ B;  2PP6 A;  3MIW A;  1IO4 A;  1MZ9 A;  1KIL D;  1LTJ B;  1SFC C;  2WT7 A;  1J1E C;  4RES B;  1JO5 A;  2GUV A;  3HE5 B;  1ZLL A;  2M3B A;  2N1T A;  5APU A;  3A5T A;  1RE4 C;  3H6P A;  2NPS C;  2FFD C;  3VMY A;  2WPS A;  4Y99 C;  2Z5I A;  1DH3 A;  1A02 J;  4WY4 B;  4IFF A;  3NTN A;  2PAJ A;  2OYI B;  3L36 A;  1SQB K;  3BAT A;  1DX7 A;  3KDP B;  2BAS A;  4Y99 B;  2H8P D;  5KTB A;  4XA4 A;  3T97 A;  3MD0 A;  3VYI A;  2YKO A;  1N73 B;  1RF0 A;  4WBA A;  1FJK A;  4N3Y B;  1J1D C;  1FZC C;  1KIL C;  1M1J A;  2C9N Y;  3HRN A;  1GW3 A;  1G2C B;  1FZF A;  1XTG B;  5AW7 B;  1JTH B;  1SQX K;  1ZR2 A;  1J1D B;  1FZC B;  1KIL B;  2W6B A;  3IR9 A;  2O1K A;  2J59 M;  3M9B A;  3V2R A;  3SWF A;  5AVU B;  3HUS B;  5KLV K;  1Z56 A;  1OWA A;  5AW5 B;  1T3U A;  4O9B A;  1AQ5 A;  3M0D A;  3M91 A;  2HG5 D;  2H7H A;  5AVV B;  3TSI A;  1M7L A;  3CLQ A;  2JEE A;  3R2P A;  3E1I A;  4C7N A;  3RK3 D;  1X9V A;  1JNM A;  4C7R A;  2OYH B;  5APV A;  4ZKU A;  4JF7 A;  5AVY B;  1LGH B;  1LT9 B;  5CCG D;  4IFM A;  5AVQ B;  3BAS A;  2IFN A;  1SVF A;  4W80 A;  3U1A A;  2HYN A;  3IFM A;  1HTL C;  2POH A;  3HTK B;  3EFG A;  1JY2 N;  1L4A A;  5BU5 A;  2GM4 A;  3VP8 A;  1VDF A;  3VN0 A;  3U59 A;  2KLV A;  3V4Q A;  3LW5 H;  3RK3 C;  1LTB C;  1QL2 A;  2WPR A;  4N78 E;  5CCH D;  4W7Y A;  1IK9 A;  3HE4 A;  2Z4E A;  1URQ B;  2W27 A;  3LIE A;  3B5N A;  1JMM A;  1GZL A;  5APT A;  1IFD A;  3MGN A;  1G1I A;  2C0W A;  4DOJ A;  1NWQ A;  1GD2 E;  1RE3 C;  3H32 B;  3HD7 D;  3MTU E;  1IC2 A;  3GHG C;  1LWU C;  3P8C E;  2HOD B;  1FZE A;  2XZR A;  2N1T D;  1GK4 A;  1SQP K;  3V4W A;  1E5W A;  5AW4 B;  3MUD A;  1X8Y A;  2ZXE B;  2WZ7 A;  5KJ7 A;  5CCH C;  5CHX A;  3KQG A;  1CI6 A;  1N7S A;  3NFQ A;  1CZQ A;  3LID A;  5AW2 B;  1LTJ A;  2Q7C A;  1RF1 B;  2Z5H A;  3M06 A;  2HLO A;  3PP5 A;  1FU1 A;  3A7O A;  3HD7 C;  1FZA A;  3P7K A;  1SFC B;  1J1E B;  1HGV A;  1NAF A;  2N1T C;  4WY4 A;  3N7N A;  4WB4 A;  3I5C A;  4LLH A;  2OYI A;  3HD7 B;  1X79 B;  1KFN A;  2Q9I A;  2NPS B;  2FFD B;  3BRV B;  2GUS A;  2IX7 C;  2XKM A;  3CI9 A;  4GIF A;  1N73 A;  2O01 H;  3RK2 C;  3M9Q A;  4ZKP A;  3RL0 D;  1KQL A;  3V2Q A;  1G2C A;  1RF0 C;  1GW4 A;  1JTH A;  5AVR B;  1FZC A;  1M1J C;  1KIL A;  2A45 H;  4JYB A;  1JY2 O;  1DEB A;  3TYY A;  4N78 D;  2A45 G;  3HUS A;  3G3Z A;  5AW0 B;  1M1J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...