2JEEA

Xray structure of e. coli yiiu
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
78
structure length
78
Chain Sequence
MSLEVFEKLEAKVQQAIDTITLLQMEIEELKEKNNSLSQEVQNAQHQREELERENNHLKEQQNGWQERLQALLGRMEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN ZAPB
publication title Novel Coiled-Coil Cell Division Factor Zapb Stimulates Z Ring Assembly and Cell Division.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle
total genus 30
structure length 78
sequence length 78
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06005 ZapB Cell division protein ZapB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2jeeA00
4I1LA 1X79B 3P8CD 3N7NA 1IC2A 1NKNA 4GIFA 3U1CA 2POHA 3U1AA 4ZKUA 3U59A 3VP9A 3HRNA 3BASA 5KTBA 4O9BA 5BU8B 3BATA 5BVZA 3N4XA 5BU5A 3OJAB 3C9IA 4N78D 4ZKPA 3VP8A 1WT6A 2FXMA 4N3YB 2JEEA
chains in the Genus database with same CATH superfamily
2ZT9B 2HPCA 3ZDMA 1PGJA 1ZR4A 2ZYAA 3WU2H 2PAJA 1GL2C 2FXPA 2WVRA 1JMMA 2WSSH 1L0LE 2P58A 5K5GB 1VDFA 1QLED 2WPRA 4PJ0H 1WT6A 3B71A 1SFCB 1FZCC 1DH3A 1S5LH 1GL2D 2YIUC 1P84I 3M9HA 1JY3N 3H1HE 3VMAA 1TU3F 1LTGC 1EDLA 1JY3P 2WITA 1KILA 3RL0D 3A2AA 1NU1E 1L0NJ 1KYOI 3IN6A 1SQVD 2FYUJ 2YNYA 3V6IA 4IFDK 3PJSK 1YJWP 2KIKA 2YXQB 4A7PA 1IFMA 4C46A 4GT1A 1KZUB 2RH0A 5B66H 4WY4C 2YKPA 2NPSB 3TGUG 1M1KQ 1H0TB 1A02J 4PD4I 1RHZB 2FY8A 1NHLA 2QM7A 1HGZA 2C9LY 3LW5H 1S5LX 2ZYDA 3CC2P 2QJKB 3FXEA 5KKZB 2BEQD 1AQTA 5H2FH 2GUSA 4QMAA 5CCHD 1UIXA 1YBKA 4L76A 4C7NB 2FFDB 1KFMA 4K3AA 1PP9J 1ZN5A 1RQUA 1PFIA 3L4FA 3B4SA 2OGUA 5CJ0A 3AE3C 3CC7P 2GA1A 1Q2NA 1S9KE 1NTKJ 1GU5A 3GF7A 5AW0B 3CXHH 4IOIH 5KLVG 1IZNB 2C9NY 5KLIC 2B87B 3CLQA 1IFPA 3N4XA 1OW6A 4JBZA 1ZXGA 2Q6QA 4U3FE 1LTTC 4TT3H 3SFDC 1OFCX 1LTSC 2IBZG 1KQGB 3CCVP 3MIWA 1IFIA 1ZMEC 1RQVA 1QL2A 4BRYB 1KB9H 5APSA 3CWBJ 3GHGA 3L71J 1L0ND 1SQXE 3CC4P 3MZWB 1KB9I 3LW5J 2FYUD 1R5SA 3H1LG 4R4LA 2XZRA 2XU6A 1PV3A 1JTHA 2JEEA 3IFMA 1KN7A 3JC22 2V4HA 1N2DC 2OYHA 2BCCJ 5E79H 1MV8A 1FDIA 1VL2A 1OVUA 1JMBA 1L4AA 2JDIH 5AVVB 3BATA 5AVUB 2KI7B 4EDFA 1W2BO 3EFFK 4OGQC 2YXRB 1EZVG 3O8ZA 1PP9D 1X0TA 1J1DC 1SQQK 2W83C 2KNCA 1LJ2A 2FYUE 1N73C 1BE3G 1R5LA 3M0DC 4H0LB 1NTKD 1JY2O 3D6YA 2Q7CA 2D2CB 2ZYGA 1HH0A 4OGQD 3KDPB 2KLVA 1LWUB 1URQB 2O3JA 3CX5I 2KP8A 2IYPA 1A02F 1PPJG 1NTZJ 1VF5C 2E76C 1NAFA 2R32A 1GW3A 2JWAA 1L2PA 2HPCB 4UB6E 1YTZI 1Y9BA 1T2KC 2OTJP 1PP9E 3CCJP 3M0AA 1P84E 1VQ4P 4EOTA 1VF5D 3G3ZA 2XNXA 2CPBA 1DX7A 1RE3A 3JSVC 2QJPB 4BWNA 1KILE 1FU1A 3CWBD 1S5LE 1NU1K 1NTKE 5CCGC 3I56P 5KAFE 3L70J 1VQ7P 5GTHH 1KYOE 3HRNA 2PFXA 4I6MC 1Q81Q 1IFJA 2WQYC 4JYBA 1GTWA 1KILB 2A45G 2B9BA 2FYNC 3H1KD 4UB8E 1MKMA 2BCCD 1AFOA 3L75E 4PD4E 1YQ3C 5TISH 3OA7A 1KQSO 3MD0A 1N7SC 3GMAA 2WMMA 5APYA 1BSHA 5APQA 3CMEP 3CXHD 2H7HA 3CWBE 2L91A 1USEA 1ZRTD 3L72J 3L71E 4N6JA 3GLMA 1G1JA 2WZ7A 1CSBA 1HVVA 1FJKA 3H1IG 4L75A 2M3EA 1GL2A 3L74J 4PV1C 2QVAA 1M56D 3HE5A 3T97A 1L4AC 3C8VA 1KB9D 2W6BA 3U1CA 1AV1A 1H88A 3MUDC 1FZCA 3P32A 1NTZD 1YQ4C 2Q3EA 2Y9YA 5TJHA 2N1TC 3CCRP 3ABVC 1LT9C 1X79B 2N9YB 1L4AD 3N7NA 1D7MA 2MKVA 3KZIH 1S3JA 3WUTA 5AVXB 3WUUA 1KD1Q 4AQRD 2LR2A 1IFDA 2XNDH 3M9QA 5BU5A 1H8AA 1HBWA 1BSNA 1Y8AA 2R3CA 2N1TD 4DCKA 3RK3C 1PL5A 1SQXK 5KLVK 3L73G 4RKUJ 3O6QA 4DZOA 3L70D 2IX7C 2B89A 5L8RJ 3PLNA 3HUSC 4JF7A 4WY4A 1KB9E 1K9MQ 3BCCG 3FWNA 2ZT9C 1N86A 4ASWA 3RK3D 1LP1B 1BGYG 4Y28J 2P2UA 1EXIA 1T3UA 3Q1MA 1RF1C 4D6TG 1CI6A 1FZFA 2RMZA 1LTAC 2E74D 3QWOC 1BCCG 2CPSA 4C7RA 3FXDA 1JTHB 2ITAA 3TNUA 1HJBA 1RY3A 2XKMA 1SQQG 4H13C 2OYHB 1FOSE 2MJZA 3L72D 3KYQA 1OXZA 1DEEG 1JCCA 1FOSF 3KXDA 3S1KA 3D70A 3L70E 4ZKUA 2WSEH 4KJMA 1EQ7A 5AW4B 3TGUJ 2IFMA 2E75C 2P1JA 3L74D 3R2PA 1L0LG 1FZGA 4H13D 3K5BA 3II6A 2KNCB 5AVYB 3F5HA 3M91A 3CX5E 2E75D 2LKMA 3H1HG 1LTJB 3L36A 3WMM0 1NH4A 2H89C 2YO2A 4JPZB 2YKOA 1K04A 2POHA 1J1EB 5KJ7C 1NU1G 3AEGC 1EDIA 3L74E 3RGUA 1WMKA 1KTMA 3CPWO 3V4QA 2W8ZA 2OYIC 1IK7A 1YJNP 4LC1A 1DIPA 3CCUP 3V2RA 4ZKPA 4GKGA 1MFZA 2WSEJ 4H44C 3RK2C 4XFJA 3H25A 1OVRA 2NZ2A 2V7QH 1JEKA 1SQPJ 1BDDA 2K37A 3HD7B 1N73A 4RESB 2Z5HA 3H1LJ 3USSA 2LXBA 2Y9ZA 2KS1B 2JKVA 4H44D 3M0DA 3RK2D 1KFNA 2JR8A 3TGUD 1FJPA 4M3LA 2IDBA 2Y0CA 1NGMB 2KB7P 3G9RA 1QVFO 4WY4D 1GD2E 4U3FG 2VRSA 3PTZA 1LTBC 3TF5A 1DD4A 1GL2B 5AW6B 3AE6C 1SQVE 1Q86Q 2A45H 5KAIE 3PP5A 5AVQB 2E5TA 2XDJA 1VQKP 3P8MC 2ZFCA 5AVTB 3B5NC 4OWFA 1BE3J 3A0BE 3RL0B 1FZCB 1JY3O 1IK9A 5CCGA 1DD3A 1SQXG 1NTMK 2YIUB 3TGUE 3Q3DA 3BRVB 4WVZA 3D6ZA 1M57D 4BXLA 5KLVD 1JM0A 3R4YA 3CXHI 3GF3A 2ZJSE 3Q5SA 1QVGO 5AW8B 3TYYA 2SPZA 2IBZD 2K9JA 1YTZT 4H0LC 3A0HH 1Q90D 5CMZA 3RBXA 1LNQA 1KORA 1N7SA 3VOPA 1KQLA 1URQC 1BDCA 2Q9IA 2HG5D 4WY4B 1LTIC 1Q82Q 5AW5B 3S4RA 1S2EA 3HE4B 3IF4A 4LGDE 2Z4EA 1SQPD 1SQBK 3H1LD 2R44A 1OIPA 3H1KJ 1NOHA 3TSIA 1FZEA 3EWKA 1YJ9P 2P67A 1OVVA 3AE4C 1FZBA 2IPPA 2QJYC 2O01H 2BASA 3MUDA 2AXTE 4JYCA 3VYIA 4I7ZB 1G1IA 1NVOA 4NPDA 2N1TA 1GZLA 1L0NE 4YXWH 2NRGA 3AE1C 3KQGA 1LT9A 5GTIH 2C0WA 3AE5C 1EZVD 1SQPE 5KLIB 2E5YA 2WSCH 1E5WA 1PIXA 3H1IJ 2WSFH 1BE3D 1MZ9A 1Y47A 2A06G 2KZIA 2R3SA 3JCUH 1L0LK 2AEJA 3HTKB 2OQQA 2LXCB 2WTYA 4Y99B 3HUSA 2ZXEB 1XTGB 1FC2C 1T3JA 3WU2E 1PPJD 5B5EH 3P8CD 1OMIA 2J5UA 3E1RA 5AW1B 1T6AA 4PJ0E 3L75G 1RE4C 5BU8B 1RF1A 3M9BA 1U57A 2E76D 3VP8A 3NXSA 2IZ0A 1PZQA 1T2KD 3MP7B 3L71G 3L73J 4GDOA 1VQOP 3V2NA 2N9BA 1FBMA 1OW7A 2WPSA 3FWLA 1ZLLA 3AE9C 1HJ0A 2M8RA 1MUUA 2O1KA 3G4SP 3BCCJ 3KPEA 5CCGD 4OGQB 2P7JA 2J59M 2W90A 4U7JA 3I55P 5AVRB 1J1DB 3AEFC 1NO4A 2WSCJ 1FDOA 1N73B 1M7LA 5B66E 2PP6A 4D6TJ 2FXOA 1NWQA 2G3AA 3SWKA 5APWA 1NAYA 1H0TA 3MHVA 1SQQJ 4DOJA 3AEDC 1EXJA 2PGDA 1SQVK 3Q5PA 3OW2O 3ITKA 5H2FE 1N7SD 1VF5B 2E76B 4L73A 5KJ7A 3H1ID 2KK7A 1NTMG 4C7NA 1ZR2A 2YMKA 3H1KE 2QRXA 1M8OB 3VMXA 1IJDB 2K3RA 2BCCE 4WBAA 2QA4P 1NKZB 3MTUE 3CCLP 2OYIA 3LIEA 2E43A 4PV1D 1VQ9P 2HLOA 3EQ2A 3CXHE 1ZRTE 3H1HJ 5CBNA 4DJGA 1E79H 4I2LC 1QX8A 1M1JC 1X22A 1JO5A 2B87A 2FXMA 4KHXA 1NU1J 5AVWB 2FYNB 1SQBG 3H1JG 3CD6P 3CCSP 4LLHA 1S4XA 4WB4A 3L73D 3PRJA 4K35A 4BRYA 1H89A 2G8YA 1NTZE 4N78D 1JB0J 3GHGB 1GW4A 3I5CA 1T8ZA 3BCCD 1J1EC 2K1AA 5AW9B 4GOFA 2RN0A 4HH2A 3OAKA 2OTLP 1VPCA 4D6TD 1K05A 1SFCC 2ZT9D 1JNMA 1USDA 4W7ZA 1BCCD 5E79E 1FZAA 1CZQA 1L0NK 4Z1MH 1L4AB 1SQQD 2AEFA 3AE8C 3QH9A 3LIDA 2FYUK 2O01N 3B5NA 3VP9A 3V5BA 2IBZI 1S1CX 4O9BA 3L73E 2KYVA 1M90Q 2J58A 1HWTC 3Q2YA 1KC8Q 1VQNP 2N1TB 3A3YB 4W80A 3L74G 3RK3E 1LT9B 1NJIQ 2DW3A 1L0LD 3IAOA 2C0XA 1HUCA 4ZMDA 3P7KA 4U3FJ 1G2CA 3RL0g 2NPSC 2HODA 4B86A 1U7MA 4D6TE 1YI2P 3RK3B 2OTKE 1Z56A 3L72E 3H1HD 3CCQP 2PRRA 1SQQE 2OYOA 1LWUA 1URQA 2QJKC 2AEMA 2Q5UA 5KKZC 1AVOA 1VQ5P 2E74B 4XA4A 1QL1A 1KV4A 2FFDC 1NU1D 1NTKK 1SQXJ 5KLVJ 1HGVA 4UB6H 2YMYA 4MN4C 1RF1B 3E7KA 5KJ7D 3WUVA 3GW6A 1P84H 1EZVI 3EFGA 3RL0C 2KUBA 2I1KA 3BVHA 4H13B 5GTHE 1YYCA 3CL3D 2CK3H 5KAFH 1YHQP 1KYOH 2OARA 2I1JA 4AUWA 2AXCA 1KMIZ 5BVZA 3G71P 1YIJP 2E75B 1DEBA 1SQVG 2KLUA 1AQ5A 1N7LA 5TISE 2I8DA 1HTLC 4HKZH 4UB8H 1NYHA 1VQMP 4PD4H 2Q3IA 1RF0C 1S9KD 1GK4A 5CCHC 2JWDA 2GM4A 2H88C 1AVYA 2QG4A 3M06A 5EFWB 3V4WA 4YPCA 4OH8B 5APUA 2QIWA 4U3FD 1K8AQ 3HE5B 2M0BA 3T97B 3AEEC 1RE4A 4GOEA 4IFFA 1JOCA 1OX3A 2KZJA 4EYYQ 4NPEA 1AJYA 2M5AA 2OYIB 2A45I 3PHLA 2W27A 4AYCA 2JP3A 2ZVOB 1IFNA 3BRTB 4IL6H 4I7ZC 4XE5B 1LT1A 2Z5IA 5M1BA 1SQXD 3KZIE 1VQPP 1GU4A 3SWYA 3B5ND 2H8PD 4H44B 2V7QJ 3RK2B 2FBWC 1NTZK 2KSJA 3OJAB 1VQ6P 1HF9A 3L37A 2D2CC 4KT0J 3O6QB 1EC5A 1JY2N 3L75J 3A7OA 1LWUC 4EI2A 1SLQA 2WT7A 3B8EB 3F89A 4Y99C 3A5TA 1JY2P 5DJTB 1L0NG 4H0LD 1SP4A 2FYUG 2D2CD 1FE6A 1CW5A 2JO1A 3Q5RA 5KLVE 4DT0A 1SQPG 1LP1A 2KOGA 1URQD 4IL6X 1CI6B 4RO0A 1ZW0A 1PGQA 2QJPC 3TNUB 1ZOYC 2IBZE 4JQ0D 3B5NB 3SWFA 2Y0DA 3D71A 5DJUB 3VN0A 1KILC 1PP9G 3NMDA 4N3YB 1SVFA 1M1JA 1GK6A 2K88A 1N8RQ 3RBZA 1XTCC 3H1LE 1P84D 2L5GB 4OVNF 5CBOA 1NTKG 3MGNA 3GG2A 1NTMJ 3BASA 1G2CB 3H32A 2A06D 1KILD 2HODB 2R5BA 3CX5H 3AECC 4W7YA 1LTJA 1OW8A 4GODA 1KYOD 4GIFA 3UIAA 2GUVA 1GDTA 3CCMP 3SFEC 5AW2B 3C1LA 1EZVE 3TK1A 3H6PA 3L75D 4PD4D 3FGAD 2ZVNB 1PGPA 1R8EA 1SFCA 4HYTB 1BE3E 2O01J 3CWBG 1IO4A 5APTA 3C9IA 1SQBJ 2IYOA 3H1JJ 2W6JH 2A06E 2UWJE 2QJYB 3L71D 3VMYA 1PPJE 4R4MA 2QEXP 3P8CE 1FAVA 2YKQA 3H1KG 3CI9A 1BGYJ 5APXA 2B88A 2BCCG 2WSFJ 3V2PA 2IFNA 3NFQA 3HD7A 2FKWB 4IFMA 4ASVA 4TLFA 3VTPC 1BCCJ 2BEZF 2P10A 2NPSA 1J2JB 2HYNA 2KS1A 3TDKA 2W6AA 1MFTA 1EDJA 2WPVB 1Q7YQ 3GHGC 1ZV8A 1KQFB 1WRGA 2QSIA 2IZ1A 1QGKB 2RKLA 2FFDA 3KHUA 1L0LJ 1FS0E 1NTMD 1W5CE 1GMJA 2OYHC 5AVZB 1K73Q 3VMZA 5KAIH 2QE7H 4I1LA 4YXDC 2ZXXA 1NTZG 5APVA 2M5AB 4ZNCA 4WWIA 1X9VA 3A0BH 3U59A 4L74A 3CMAP 4IL6E 3S9OA 1YITP 2JJLA 5CJ4A 1JUNA 5CHXA 2K9YA 3H1IE 5AW7B 3L35A 2K9JB 2H43A 3AEAC 3A0HE 4NPFX 2HFED 1NTME 2Y0EA 1LTJC 3W67A 1SQBD 3H1JD 3L70G 1ZP0C 2FYZA 3AE2C 1N7SB 3PH0A 2WT7B 1RF0A 2HR3A 4CPGA 5CCHA 1VQLP 5AW3B 3W68A 3E1IA 1W2EA 2E74C 1BGYD 4HJGH 3HE4A 2YO3A 2Q1KA 2KSEA 1U7JA 4PV1B 3AE7C 2O1JA 1RE3C 3CX5D 1FDMA 1SQVJ 2QM8A 3V2QA 4EIJA 1PGOA 5AVSB 5KTBA 3L72G 1SQPK 2R5DA 1VQ8P 3NTNA 1OZHA 4HB1A 1SQBE 3H1JE 4RJTA 4N78E 1SFCD 2AXTH 1NKNA 1EDKA 3BCCE 2WPQA 2KXPB 5GTIE 3U1AA 2M3BA 3HD7C 1RH5B 1OWAA 2WWWA 1BGYE 1S72P 1M1JB 3IR9A 4YTPC 1X8YA 1UIIA 3JCUE 1QEXA 1IC2A 1LGHB 1BCCE 3CCEP 5C39A 3FX0A 1AA0A 3H32B 3SSUA 3AEBC 2E42A 1SS1A 3HUSB 3HTKA 3HD7D 2XV5A 2ZAEB 3G6EP 5B5EE 1JCDA 2NPSD
chains in the Genus database with same CATH topology
2HPCA 1LT9C 1X79B 3P8CD 1L4AD 1ZR4A 3N7NA 1GU4A 3SWYA 2PAJA 2H8PD 3B5ND 1GL2C 5AVXB 4AQRD 3RK2B 5AW1B 1JMMA 1IFDA 3M9QA 1VDFA 1NTZK 1RE4C 2KSJA 5BU8B 2WPRA 1RF1A 3M9BA 5BU5A 1H8AA 3OJAB 1HBWA 3VP8A 1WT6A 3NXSA 2R3CA 3L37A 2N1TD 3RK3C 1SQXK 5KLVK 1SFCB 1JY2N 3A7OA 1FZCC 1LWUC 4DZOA 1DH3A 1SLQA 2IX7C 2WT7A 3B8EB 1GL2D 3HUSC 4JF7A 4WY4A 3M9HA 1T2KD 1JY3N 4Y99C 3A5TA 1JY2P 3V2NA 2N9BA 1FBMA 2WPSA 1LTGC 1ZLLA 1N86A 2M8RA 1SP4A 1JY3P 1MUUA 3RK3D 2WITA 1KILA 1CW5A 3RL0D 3A2AA 2O1KA 2P2UA 3KPEA 2KOGA 5CCGD 1URQD 1T3UA 1RF1C 1CI6B 2P7JA 2J59M 5AVRB 1CI6A 1FZFA 2YNYA 1J1DB 1LTAC 1NO4A 2CPSA 3TNUB 4C7RA 1N73B 4IFDK 1JTHB 3TNUA 1HJBA 1RY3A 1M7LA 2XKMA 2PP6A 1IFMA 2OYHB 4C46A 1FOSE 4GT1A 1KZUB 1NWQA 4WY4C 2MJZA 2YKPA 2NPSB 3KYQA 1OXZA 1A02J 1JCCA 1FOSF 5APWA 3B5NB 1NHLA 2QM7A 1HGZA 4DOJA 4ZKUA 2WSEH 1SQVK 1EQ7A 5AW4B 3SWFA 2IFMA 3VN0A 2C9LY 3LW5H 1KILC 2P1JA 1N7SD 5KJ7A 3NMDA 3R2PA 4N3YB 2GUSA 1SVFA 1FZGA 5CCHD 1M1JA 1GK6A 4C7NB 2FFDB 1XTCC 4C7NA 1ZR2A 1KFMA 3II6A 2L5GB 3VMXA 1IJDB 1ZN5A 4WBAA 1PFIA 5AVYB 3L4FA 1NKZB 3M91A 3MGNA 3MTUE 3BASA 1G2CB 5CJ0A 3H32A 2OYIA 1KILD 2HODB 2R5BA 2LKMA 3LIEA 2E43A 1LTJB 4W7YA 1S9KE 2HLOA 3L36A 1LTJA 3EQ2A 3WMM0 1GU5A 1NH4A 4GIFA 2YO2A 3UIAA 5AW0B 2YKOA 2POHA 2GUVA 1J1EB 5KJ7C 1GDTA 4I2LC 1M1JC 2C9NY 1JO5A 3CLQA 3N4XA 5AW2B 2FXMA 4KHXA 1LTTC 3TK1A 3H6PA 1LTSC 3MIWA 5AVWB 3V4QA 1IFIA 1SFCA 2OYIC 4HYTB 1QL2A 4LC1A 4LLHA 4WB4A 1IO4A 5APTA 1H89A 3C9IA 4N78D 3V2RA 4ZKPA 4GKGA 1MFZA 3GHGB 1GW4A 5APSA 3GHGA 3VMYA 3I5CA 1T8ZA 1J1EC 3RK2C 3P8CE 1FAVA 5AW9B 4HH2A 2YKQA 3CI9A 3OAKA 5APXA 1VPCA 2IFNA 3V2PA 2XZRA 3HD7B 3NFQA 1SFCC 1N73A 4RESB 2XU6A 1JNMA 2JEEA 3IFMA 1JTHA 3HD7A 4W7ZA 2Z5HA 1N2DC 2FKWB 4IFMA 2OYHA 3VTPC 1FZAA 1CZQA 1L0NK 2NPSA 3M0DA 3RK2D 1J2JB 1KFNA 2HYNA 1L4AB 1MV8A 2W6AA 3LIDA 1L4AA 2FYUK 3B5NA 1FJPA 3VP9A 3V5BA 5AVVB 4M3LA 3GHGC 4O9BA 1ZV8A 3BATA 2KYVA 1WRGA 5AVUB 2J58A 1HWTC 2KB7P 2N1TB 4WY4D 3A3YB 1GD2E 4W80A 3O8ZA 1LT9B 2VRSA 2FFDA 1J1DC 1LTBC 1SQQK 2C0XA 1HUCA 1GL2B 1N73C 5AW6B 3P7KA 2OYHC 5AVZB 1G2CA 2A45H 3PP5A 2NPSC 3M0DC 5AVQB 2HODA 3VMZA 4B86A 2XDJA 3P8MC 1JY2O 2ZFCA 4I1LA 2Q7CA 5AVTB 3B5NC 5APVA 3RK3B 1HH0A 3KDPB 3RL0B 1Z56A 2KLVA 1FZCB 1LWUB 1URQB 1JY3O 1X9VA 3U59A 1IK9A 1LWUA 1URQA 5CCGA 2KP8A 2Q5UA 1A02F 1NTMK 1NAFA 2R32A 3BRVB 1GW3A 4XA4A 1QL1A 2HPCB 2JJLA 2FFDC 5CJ4A 1JUNA 5CHXA 1NTKK 1YTZI 1HGVA 5AW7B 3L35A 5AW8B 3TYYA 2YMYA 1T2KC 2H43A 1RF1B 3M0AA 1YTZT 5KJ7D 2HFED 4EOTA 1LTJC 3G3ZA 2XNXA 2CPBA 1DX7A 1RE3A 2FYZA 5CMZA 3EFGA 1FU1A 1N7SB 3RL0C 2WT7B 2I1KA 3BVHA 1NU1K 1RF0A 1N7SA 3VOPA 5CCGC 1KQLA 1URQC 1YYCA 2Q9IA 2HG5D 4WY4B 5CCHA 1LTIC 3CL3D 5AW3B 3E1IA 5AW5B 1W2EA 3HE4B 3HRNA 2OARA 4LGDE 2I1JA 4I6MC 2Z4EA 4AUWA 3HE4A 5BVZA 1IFJA 2YO3A 4JYBA 1SQBK 1GTWA 1KILB 1DEBA 2A45G 1AQ5A 1N7LA 1NOHA 3TSIA 1FZEA 1AFOA 1HTLC 2O1JA 2P67A 1RE3C 1FDMA 2QM8A 3V2QA 3OA7A 4EIJA 1FZBA 2Q3IA 3MD0A 5AVSB 5KTBA 1RF0C 1N7SC 2IPPA 1S9KD 1SQPK 2R5DA 2O01H 1GK4A 3NTNA 5APYA 2BASA 5CCHC 2GM4A 5APQA 3MUDA 4N78E 4JYCA 1SFCD 3VYIA 2H7HA 3M06A 1G1IA 3V4WA 4N6JA 1NKNA 2N1TA 1GZLA 2WPQA 1G1JA 2WZ7A 3U1AA 1CSBA 1HVVA 1FJKA 1LT9A 3KQGA 4OH8B 5APUA 2M3BA 2C0WA 3HD7C 1GL2A 1OWAA 2WWWA 1M1JB 3IR9A 3HE5B 2WSCH 1E5WA 1RE4A 3HE5A 2WSFH 1X8YA 4IFFA 3T97A 1L4AC 1JOCA 1MZ9A 1IC2A 1LGHB 2W6BA 3U1CA 1L0LK 3H32B 1H88A 2OYIB 3HTKB 2A45I 1FZCA 3P32A 2E42A 2W27A 2WTYA 3HUSB 4AYCA 3HTKA 3HD7D 4Y99B 3HUSA 1IFNA 2XV5A 3BRTB 2ZXEB 4XE5B 2N1TC 2Z5IA 1JCDA 1XTGB 1T3JA 2NPSD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I1L A;  1X79 B;  3P8C D;  3N7N A;  1IC2 A;  1NKN A;  4GIF A;  3U1C A;  2POH A;  3U1A A;  4ZKU A;  3U59 A;  3VP9 A;  3HRN A;  3BAS A;  5KTB A;  4O9B A;  5BU8 B;  3BAT A;  5BVZ A;  3N4X A;  5BU5 A;  3OJA B;  3C9I A;  4N78 D;  4ZKP A;  3VP8 A;  1WT6 A;  2FXM A;  4N3Y B;  2JEE A; 
#chains in the Genus database with same CATH topology
 2ZT9 B;  2HPC A;  3ZDM A;  1PGJ A;  1ZR4 A;  2ZYA A;  3WU2 H;  2PAJ A;  1GL2 C;  2FXP A;  2WVR A;  1JMM A;  2WSS H;  1L0L E;  2P58 A;  5K5G B;  1VDF A;  1QLE D;  2WPR A;  4PJ0 H;  1WT6 A;  3B71 A;  1SFC B;  1FZC C;  1DH3 A;  1S5L H;  1GL2 D;  2YIU C;  1P84 I;  3M9H A;  1JY3 N;  3H1H E;  3VMA A;  1TU3 F;  1LTG C;  1EDL A;  1JY3 P;  2WIT A;  1KIL A;  3RL0 D;  3A2A A;  1NU1 E;  1L0N J;  1KYO I;  3IN6 A;  1SQV D;  2FYU J;  2YNY A;  3V6I A;  4IFD K;  3PJS K;  1YJW P;  2KIK A;  2YXQ B;  4A7P A;  1IFM A;  4C46 A;  4GT1 A;  1KZU B;  2RH0 A;  5B66 H;  4WY4 C;  2YKP A;  2NPS B;  3TGU G;  1M1K Q;  1H0T B;  1A02 J;  4PD4 I;  1RHZ B;  2FY8 A;  1NHL A;  2QM7 A;  1HGZ A;  2C9L Y;  3LW5 H;  1S5L X;  2ZYD A;  3CC2 P;  2QJK B;  3FXE A;  5KKZ B;  2BEQ D;  1AQT A;  5H2F H;  2GUS A;  4QMA A;  5CCH D;  1UIX A;  1YBK A;  4L76 A;  4C7N B;  2FFD B;  1KFM A;  4K3A A;  1PP9 J;  1ZN5 A;  1RQU A;  1PFI A;  3L4F A;  3B4S A;  2OGU A;  5CJ0 A;  3AE3 C;  3CC7 P;  2GA1 A;  1Q2N A;  1S9K E;  1NTK J;  1GU5 A;  3GF7 A;  5AW0 B;  3CXH H;  4IOI H;  5KLV G;  1IZN B;  2C9N Y;  5KLI C;  2B87 B;  3CLQ A;  1IFP A;  3N4X A;  1OW6 A;  4JBZ A;  1ZXG A;  2Q6Q A;  4U3F E;  1LTT C;  4TT3 H;  3SFD C;  1OFC X;  1LTS C;  2IBZ G;  1KQG B;  3CCV P;  3MIW A;  1IFI A;  1ZME C;  1RQV A;  1QL2 A;  4BRY B;  1KB9 H;  5APS A;  3CWB J;  3GHG A;  3L71 J;  1L0N D;  1SQX E;  3CC4 P;  3MZW B;  1KB9 I;  3LW5 J;  2FYU D;  1R5S A;  3H1L G;  4R4L A;  2XZR A;  2XU6 A;  1PV3 A;  1JTH A;  2JEE A;  3IFM A;  1KN7 A;  3JC2 2;  2V4H A;  1N2D C;  2OYH A;  2BCC J;  5E79 H;  1MV8 A;  1FDI A;  1VL2 A;  1OVU A;  1JMB A;  1L4A A;  2JDI H;  5AVV B;  3BAT A;  5AVU B;  2KI7 B;  4EDF A;  1W2B O;  3EFF K;  4OGQ C;  2YXR B;  1EZV G;  3O8Z A;  1PP9 D;  1X0T A;  1J1D C;  1SQQ K;  2W83 C;  2KNC A;  1LJ2 A;  2FYU E;  1N73 C;  1BE3 G;  1R5L A;  3M0D C;  4H0L B;  1NTK D;  1JY2 O;  3D6Y A;  2Q7C A;  2D2C B;  2ZYG A;  1HH0 A;  4OGQ D;  3KDP B;  2KLV A;  1LWU B;  1URQ B;  2O3J A;  3CX5 I;  2KP8 A;  2IYP A;  1A02 F;  1PPJ G;  1NTZ J;  1VF5 C;  2E76 C;  1NAF A;  2R32 A;  1GW3 A;  2JWA A;  1L2P A;  2HPC B;  4UB6 E;  1YTZ I;  1Y9B A;  1T2K C;  2OTJ P;  1PP9 E;  3CCJ P;  3M0A A;  1P84 E;  1VQ4 P;  4EOT A;  1VF5 D;  3G3Z A;  2XNX A;  2CPB A;  1DX7 A;  1RE3 A;  3JSV C;  2QJP B;  4BWN A;  1KIL E;  1FU1 A;  3CWB D;  1S5L E;  1NU1 K;  1NTK E;  5CCG C;  3I56 P;  5KAF E;  3L70 J;  1VQ7 P;  5GTH H;  1KYO E;  3HRN A;  2PFX A;  4I6M C;  1Q81 Q;  1IFJ A;  2WQY C;  4JYB A;  1GTW A;  1KIL B;  2A45 G;  2B9B A;  2FYN C;  3H1K D;  4UB8 E;  1MKM A;  2BCC D;  1AFO A;  3L75 E;  4PD4 E;  1YQ3 C;  5TIS H;  3OA7 A;  1KQS O;  3MD0 A;  1N7S C;  3GMA A;  2WMM A;  5APY A;  1BSH A;  5APQ A;  3CME P;  3CXH D;  2H7H A;  3CWB E;  2L91 A;  1USE A;  1ZRT D;  3L72 J;  3L71 E;  4N6J A;  3GLM A;  1G1J A;  2WZ7 A;  1CSB A;  1HVV A;  1FJK A;  3H1I G;  4L75 A;  2M3E A;  1GL2 A;  3L74 J;  4PV1 C;  2QVA A;  1M56 D;  3HE5 A;  3T97 A;  1L4A C;  3C8V A;  1KB9 D;  2W6B A;  3U1C A;  1AV1 A;  1H88 A;  3MUD C;  1FZC A;  3P32 A;  1NTZ D;  1YQ4 C;  2Q3E A;  2Y9Y A;  5TJH A;  2N1T C;  3CCR P;  3ABV C;  1LT9 C;  1X79 B;  2N9Y B;  1L4A D;  3N7N A;  1D7M A;  2MKV A;  3KZI H;  1S3J A;  3WUT A;  5AVX B;  3WUU A;  1KD1 Q;  4AQR D;  2LR2 A;  1IFD A;  2XND H;  3M9Q A;  5BU5 A;  1H8A A;  1HBW A;  1BSN A;  1Y8A A;  2R3C A;  2N1T D;  4DCK A;  3RK3 C;  1PL5 A;  1SQX K;  5KLV K;  3L73 G;  4RKU J;  3O6Q A;  4DZO A;  3L70 D;  2IX7 C;  2B89 A;  5L8R J;  3PLN A;  3HUS C;  4JF7 A;  4WY4 A;  1KB9 E;  1K9M Q;  3BCC G;  3FWN A;  2ZT9 C;  1N86 A;  4ASW A;  3RK3 D;  1LP1 B;  1BGY G;  4Y28 J;  2P2U A;  1EXI A;  1T3U A;  3Q1M A;  1RF1 C;  4D6T G;  1CI6 A;  1FZF A;  2RMZ A;  1LTA C;  2E74 D;  3QWO C;  1BCC G;  2CPS A;  4C7R A;  3FXD A;  1JTH B;  2ITA A;  3TNU A;  1HJB A;  1RY3 A;  2XKM A;  1SQQ G;  4H13 C;  2OYH B;  1FOS E;  2MJZ A;  3L72 D;  3KYQ A;  1OXZ A;  1DEE G;  1JCC A;  1FOS F;  3KXD A;  3S1K A;  3D70 A;  3L70 E;  4ZKU A;  2WSE H;  4KJM A;  1EQ7 A;  5AW4 B;  3TGU J;  2IFM A;  2E75 C;  2P1J A;  3L74 D;  3R2P A;  1L0L G;  1FZG A;  4H13 D;  3K5B A;  3II6 A;  2KNC B;  5AVY B;  3F5H A;  3M91 A;  3CX5 E;  2E75 D;  2LKM A;  3H1H G;  1LTJ B;  3L36 A;  3WMM 0;  1NH4 A;  2H89 C;  2YO2 A;  4JPZ B;  2YKO A;  1K04 A;  2POH A;  1J1E B;  5KJ7 C;  1NU1 G;  3AEG C;  1EDI A;  3L74 E;  3RGU A;  1WMK A;  1KTM A;  3CPW O;  3V4Q A;  2W8Z A;  2OYI C;  1IK7 A;  1YJN P;  4LC1 A;  1DIP A;  3CCU P;  3V2R A;  4ZKP A;  4GKG A;  1MFZ A;  2WSE J;  4H44 C;  3RK2 C;  4XFJ A;  3H25 A;  1OVR A;  2NZ2 A;  2V7Q H;  1JEK A;  1SQP J;  1BDD A;  2K37 A;  3HD7 B;  1N73 A;  4RES B;  2Z5H A;  3H1L J;  3USS A;  2LXB A;  2Y9Z A;  2KS1 B;  2JKV A;  4H44 D;  3M0D A;  3RK2 D;  1KFN A;  2JR8 A;  3TGU D;  1FJP A;  4M3L A;  2IDB A;  2Y0C A;  1NGM B;  2KB7 P;  3G9R A;  1QVF O;  4WY4 D;  1GD2 E;  4U3F G;  2VRS A;  3PTZ A;  1LTB C;  3TF5 A;  1DD4 A;  1GL2 B;  5AW6 B;  3AE6 C;  1SQV E;  1Q86 Q;  2A45 H;  5KAI E;  3PP5 A;  5AVQ B;  2E5T A;  2XDJ A;  1VQK P;  3P8M C;  2ZFC A;  5AVT B;  3B5N C;  4OWF A;  1BE3 J;  3A0B E;  3RL0 B;  1FZC B;  1JY3 O;  1IK9 A;  5CCG A;  1DD3 A;  1SQX G;  1NTM K;  2YIU B;  3TGU E;  3Q3D A;  3BRV B;  4WVZ A;  3D6Z A;  1M57 D;  4BXL A;  5KLV D;  1JM0 A;  3R4Y A;  3CXH I;  3GF3 A;  2ZJS E;  3Q5S A;  1QVG O;  5AW8 B;  3TYY A;  2SPZ A;  2IBZ D;  2K9J A;  1YTZ T;  4H0L C;  3A0H H;  1Q90 D;  5CMZ A;  3RBX A;  1LNQ A;  1KOR A;  1N7S A;  3VOP A;  1KQL A;  1URQ C;  1BDC A;  2Q9I A;  2HG5 D;  4WY4 B;  1LTI C;  1Q82 Q;  5AW5 B;  3S4R A;  1S2E A;  3HE4 B;  3IF4 A;  4LGD E;  2Z4E A;  1SQP D;  1SQB K;  3H1L D;  2R44 A;  1OIP A;  3H1K J;  1NOH A;  3TSI A;  1FZE A;  3EWK A;  1YJ9 P;  2P67 A;  1OVV A;  3AE4 C;  1FZB A;  2IPP A;  2QJY C;  2O01 H;  2BAS A;  3MUD A;  2AXT E;  4JYC A;  3VYI A;  4I7Z B;  1G1I A;  1NVO A;  4NPD A;  2N1T A;  1GZL A;  1L0N E;  4YXW H;  2NRG A;  3AE1 C;  3KQG A;  1LT9 A;  5GTI H;  2C0W A;  3AE5 C;  1EZV D;  1SQP E;  5KLI B;  2E5Y A;  2WSC H;  1E5W A;  1PIX A;  3H1I J;  2WSF H;  1BE3 D;  1MZ9 A;  1Y47 A;  2A06 G;  2KZI A;  2R3S A;  3JCU H;  1L0L K;  2AEJ A;  3HTK B;  2OQQ A;  2LXC B;  2WTY A;  4Y99 B;  3HUS A;  2ZXE B;  1XTG B;  1FC2 C;  1T3J A;  3WU2 E;  1PPJ D;  5B5E H;  3P8C D;  1OMI A;  2J5U A;  3E1R A;  5AW1 B;  1T6A A;  4PJ0 E;  3L75 G;  1RE4 C;  5BU8 B;  1RF1 A;  3M9B A;  1U57 A;  2E76 D;  3VP8 A;  3NXS A;  2IZ0 A;  1PZQ A;  1T2K D;  3MP7 B;  3L71 G;  3L73 J;  4GDO A;  1VQO P;  3V2N A;  2N9B A;  1FBM A;  1OW7 A;  2WPS A;  3FWL A;  1ZLL A;  3AE9 C;  1HJ0 A;  2M8R A;  1MUU A;  2O1K A;  3G4S P;  3BCC J;  3KPE A;  5CCG D;  4OGQ B;  2P7J A;  2J59 M;  2W90 A;  4U7J A;  3I55 P;  5AVR B;  1J1D B;  3AEF C;  1NO4 A;  2WSC J;  1FDO A;  1N73 B;  1M7L A;  5B66 E;  2PP6 A;  4D6T J;  2FXO A;  1NWQ A;  2G3A A;  3SWK A;  5APW A;  1NAY A;  1H0T A;  3MHV A;  1SQQ J;  4DOJ A;  3AED C;  1EXJ A;  2PGD A;  1SQV K;  3Q5P A;  3OW2 O;  3ITK A;  5H2F E;  1N7S D;  1VF5 B;  2E76 B;  4L73 A;  5KJ7 A;  3H1I D;  2KK7 A;  1NTM G;  4C7N A;  1ZR2 A;  2YMK A;  3H1K E;  2QRX A;  1M8O B;  3VMX A;  1IJD B;  2K3R A;  2BCC E;  4WBA A;  2QA4 P;  1NKZ B;  3MTU E;  3CCL P;  2OYI A;  3LIE A;  2E43 A;  4PV1 D;  1VQ9 P;  2HLO A;  3EQ2 A;  3CXH E;  1ZRT E;  3H1H J;  5CBN A;  4DJG A;  1E79 H;  4I2L C;  1QX8 A;  1M1J C;  1X22 A;  1JO5 A;  2B87 A;  2FXM A;  4KHX A;  1NU1 J;  5AVW B;  2FYN B;  1SQB G;  3H1J G;  3CD6 P;  3CCS P;  4LLH A;  1S4X A;  4WB4 A;  3L73 D;  3PRJ A;  4K35 A;  4BRY A;  1H89 A;  2G8Y A;  1NTZ E;  4N78 D;  1JB0 J;  3GHG B;  1GW4 A;  3I5C A;  1T8Z A;  3BCC D;  1J1E C;  2K1A A;  5AW9 B;  4GOF A;  2RN0 A;  4HH2 A;  3OAK A;  2OTL P;  1VPC A;  4D6T D;  1K05 A;  1SFC C;  2ZT9 D;  1JNM A;  1USD A;  4W7Z A;  1BCC D;  5E79 E;  1FZA A;  1CZQ A;  1L0N K;  4Z1M H;  1L4A B;  1SQQ D;  2AEF A;  3AE8 C;  3QH9 A;  3LID A;  2FYU K;  2O01 N;  3B5N A;  3VP9 A;  3V5B A;  2IBZ I;  1S1C X;  4O9B A;  3L73 E;  2KYV A;  1M90 Q;  2J58 A;  1HWT C;  3Q2Y A;  1KC8 Q;  1VQN P;  2N1T B;  3A3Y B;  4W80 A;  3L74 G;  3RK3 E;  1LT9 B;  1NJI Q;  2DW3 A;  1L0L D;  3IAO A;  2C0X A;  1HUC A;  4ZMD A;  3P7K A;  4U3F J;  1G2C A;  3RL0 g;  2NPS C;  2HOD A;  4B86 A;  1U7M A;  4D6T E;  1YI2 P;  3RK3 B;  2OTK E;  1Z56 A;  3L72 E;  3H1H D;  3CCQ P;  2PRR A;  1SQQ E;  2OYO A;  1LWU A;  1URQ A;  2QJK C;  2AEM A;  2Q5U A;  5KKZ C;  1AVO A;  1VQ5 P;  2E74 B;  4XA4 A;  1QL1 A;  1KV4 A;  2FFD C;  1NU1 D;  1NTK K;  1SQX J;  5KLV J;  1HGV A;  4UB6 H;  2YMY A;  4MN4 C;  1RF1 B;  3E7K A;  5KJ7 D;  3WUV A;  3GW6 A;  1P84 H;  1EZV I;  3EFG A;  3RL0 C;  2KUB A;  2I1K A;  3BVH A;  4H13 B;  5GTH E;  1YYC A;  3CL3 D;  2CK3 H;  5KAF H;  1YHQ P;  1KYO H;  2OAR A;  2I1J A;  4AUW A;  2AXC A;  1KMI Z;  5BVZ A;  3G71 P;  1YIJ P;  2E75 B;  1DEB A;  1SQV G;  2KLU A;  1AQ5 A;  1N7L A;  5TIS E;  2I8D A;  1HTL C;  4HKZ H;  4UB8 H;  1NYH A;  1VQM P;  4PD4 H;  2Q3I A;  1RF0 C;  1S9K D;  1GK4 A;  5CCH C;  2JWD A;  2GM4 A;  2H88 C;  1AVY A;  2QG4 A;  3M06 A;  5EFW B;  3V4W A;  4YPC A;  4OH8 B;  5APU A;  2QIW A;  4U3F D;  1K8A Q;  3HE5 B;  2M0B A;  3T97 B;  3AEE C;  1RE4 A;  4GOE A;  4IFF A;  1JOC A;  1OX3 A;  2KZJ A;  4EYY Q;  4NPE A;  1AJY A;  2M5A A;  2OYI B;  2A45 I;  3PHL A;  2W27 A;  4AYC A;  2JP3 A;  2ZVO B;  1IFN A;  3BRT B;  4IL6 H;  4I7Z C;  4XE5 B;  1LT1 A;  2Z5I A;  5M1B A;  1SQX D;  3KZI E;  1VQP P;  1GU4 A;  3SWY A;  3B5N D;  2H8P D;  4H44 B;  2V7Q J;  3RK2 B;  2FBW C;  1NTZ K;  2KSJ A;  3OJA B;  1VQ6 P;  1HF9 A;  3L37 A;  2D2C C;  4KT0 J;  3O6Q B;  1EC5 A;  1JY2 N;  3L75 J;  3A7O A;  1LWU C;  4EI2 A;  1SLQ A;  2WT7 A;  3B8E B;  3F89 A;  4Y99 C;  3A5T A;  1JY2 P;  5DJT B;  1L0N G;  4H0L D;  1SP4 A;  2FYU G;  2D2C D;  1FE6 A;  1CW5 A;  2JO1 A;  3Q5R A;  5KLV E;  4DT0 A;  1SQP G;  1LP1 A;  2KOG A;  1URQ D;  4IL6 X;  1CI6 B;  4RO0 A;  1ZW0 A;  1PGQ A;  2QJP C;  3TNU B;  1ZOY C;  2IBZ E;  4JQ0 D;  3B5N B;  3SWF A;  2Y0D A;  3D71 A;  5DJU B;  3VN0 A;  1KIL C;  1PP9 G;  3NMD A;  4N3Y B;  1SVF A;  1M1J A;  1GK6 A;  2K88 A;  1N8R Q;  3RBZ A;  1XTC C;  3H1L E;  1P84 D;  2L5G B;  4OVN F;  5CBO A;  1NTK G;  3MGN A;  3GG2 A;  1NTM J;  3BAS A;  1G2C B;  3H32 A;  2A06 D;  1KIL D;  2HOD B;  2R5B A;  3CX5 H;  3AEC C;  4W7Y A;  1LTJ A;  1OW8 A;  4GOD A;  1KYO D;  4GIF A;  3UIA A;  2GUV A;  1GDT A;  3CCM P;  3SFE C;  5AW2 B;  3C1L A;  1EZV E;  3TK1 A;  3H6P A;  3L75 D;  4PD4 D;  3FGA D;  2ZVN B;  1PGP A;  1R8E A;  1SFC A;  4HYT B;  1BE3 E;  2O01 J;  3CWB G;  1IO4 A;  5APT A;  3C9I A;  1SQB J;  2IYO A;  3H1J J;  2W6J H;  2A06 E;  2UWJ E;  2QJY B;  3L71 D;  3VMY A;  1PPJ E;  4R4M A;  2QEX P;  3P8C E;  1FAV A;  2YKQ A;  3H1K G;  3CI9 A;  1BGY J;  5APX A;  2B88 A;  2BCC G;  2WSF J;  3V2P A;  2IFN A;  3NFQ A;  3HD7 A;  2FKW B;  4IFM A;  4ASV A;  4TLF A;  3VTP C;  1BCC J;  2BEZ F;  2P10 A;  2NPS A;  1J2J B;  2HYN A;  2KS1 A;  3TDK A;  2W6A A;  1MFT A;  1EDJ A;  2WPV B;  1Q7Y Q;  3GHG C;  1ZV8 A;  1KQF B;  1WRG A;  2QSI A;  2IZ1 A;  1QGK B;  2RKL A;  2FFD A;  3KHU A;  1L0L J;  1FS0 E;  1NTM D;  1W5C E;  1GMJ A;  2OYH C;  5AVZ B;  1K73 Q;  3VMZ A;  5KAI H;  2QE7 H;  4I1L A;  4YXD C;  2ZXX A;  1NTZ G;  5APV A;  2M5A B;  4ZNC A;  4WWI A;  1X9V A;  3A0B H;  3U59 A;  4L74 A;  3CMA P;  4IL6 E;  3S9O A;  1YIT P;  2JJL A;  5CJ4 A;  1JUN A;  5CHX A;  2K9Y A;  3H1I E;  5AW7 B;  3L35 A;  2K9J B;  2H43 A;  3AEA C;  3A0H E;  4NPF X;  2HFE D;  1NTM E;  2Y0E A;  1LTJ C;  3W67 A;  1SQB D;  3H1J D;  3L70 G;  1ZP0 C;  2FYZ A;  3AE2 C;  1N7S B;  3PH0 A;  2WT7 B;  1RF0 A;  2HR3 A;  4CPG A;  5CCH A;  1VQL P;  5AW3 B;  3W68 A;  3E1I A;  1W2E A;  2E74 C;  1BGY D;  4HJG H;  3HE4 A;  2YO3 A;  2Q1K A;  2KSE A;  1U7J A;  4PV1 B;  3AE7 C;  2O1J A;  1RE3 C;  3CX5 D;  1FDM A;  1SQV J;  2QM8 A;  3V2Q A;  4EIJ A;  1PGO A;  5AVS B;  5KTB A;  3L72 G;  1SQP K;  2R5D A;  1VQ8 P;  3NTN A;  1OZH A;  4HB1 A;  1SQB E;  3H1J E;  4RJT A;  4N78 E;  1SFC D;  2AXT H;  1NKN A;  1EDK A;  3BCC E;  2WPQ A;  2KXP B;  5GTI E;  3U1A A;  2M3B A;  3HD7 C;  1RH5 B;  1OWA A;  2WWW A;  1BGY E;  1S72 P;  1M1J B;  3IR9 A;  4YTP C;  1X8Y A;  1UII A;  3JCU E;  1QEX A;  1IC2 A;  1LGH B;  1BCC E;  3CCE P;  5C39 A;  3FX0 A;  1AA0 A;  3H32 B;  3SSU A;  3AEB C;  2E42 A;  1SS1 A;  3HUS B;  3HTK A;  3HD7 D;  2XV5 A;  2ZAE B;  3G6E P;  5B5E E;  1JCD A;  2NPS D; 
#chains in the Genus database with same CATH homology
 2HPC A;  1LT9 C;  1X79 B;  3P8C D;  1L4A D;  1ZR4 A;  3N7N A;  1GU4 A;  3SWY A;  2PAJ A;  2H8P D;  3B5N D;  1GL2 C;  5AVX B;  4AQR D;  3RK2 B;  5AW1 B;  1JMM A;  1IFD A;  3M9Q A;  1VDF A;  1NTZ K;  1RE4 C;  2KSJ A;  5BU8 B;  2WPR A;  1RF1 A;  3M9B A;  5BU5 A;  1H8A A;  3OJA B;  1HBW A;  3VP8 A;  1WT6 A;  3NXS A;  2R3C A;  3L37 A;  2N1T D;  3RK3 C;  1SQX K;  5KLV K;  1SFC B;  1JY2 N;  3A7O A;  1FZC C;  1LWU C;  4DZO A;  1DH3 A;  1SLQ A;  2IX7 C;  2WT7 A;  3B8E B;  1GL2 D;  3HUS C;  4JF7 A;  4WY4 A;  3M9H A;  1T2K D;  1JY3 N;  4Y99 C;  3A5T A;  1JY2 P;  3V2N A;  2N9B A;  1FBM A;  2WPS A;  1LTG C;  1ZLL A;  1N86 A;  2M8R A;  1SP4 A;  1JY3 P;  1MUU A;  3RK3 D;  2WIT A;  1KIL A;  1CW5 A;  3RL0 D;  3A2A A;  2O1K A;  2P2U A;  3KPE A;  2KOG A;  5CCG D;  1URQ D;  1T3U A;  1RF1 C;  1CI6 B;  2P7J A;  2J59 M;  5AVR B;  1CI6 A;  1FZF A;  2YNY A;  1J1D B;  1LTA C;  1NO4 A;  2CPS A;  3TNU B;  4C7R A;  1N73 B;  4IFD K;  1JTH B;  3TNU A;  1HJB A;  1RY3 A;  1M7L A;  2XKM A;  2PP6 A;  1IFM A;  2OYH B;  4C46 A;  1FOS E;  4GT1 A;  1KZU B;  1NWQ A;  4WY4 C;  2MJZ A;  2YKP A;  2NPS B;  3KYQ A;  1OXZ A;  1A02 J;  1JCC A;  1FOS F;  5APW A;  3B5N B;  1NHL A;  2QM7 A;  1HGZ A;  4DOJ A;  4ZKU A;  2WSE H;  1SQV K;  1EQ7 A;  5AW4 B;  3SWF A;  2IFM A;  3VN0 A;  2C9L Y;  3LW5 H;  1KIL C;  2P1J A;  1N7S D;  5KJ7 A;  3NMD A;  3R2P A;  4N3Y B;  2GUS A;  1SVF A;  1FZG A;  5CCH D;  1M1J A;  1GK6 A;  4C7N B;  2FFD B;  1XTC C;  4C7N A;  1ZR2 A;  1KFM A;  3II6 A;  2L5G B;  3VMX A;  1IJD B;  1ZN5 A;  4WBA A;  1PFI A;  5AVY B;  3L4F A;  1NKZ B;  3M91 A;  3MGN A;  3MTU E;  3BAS A;  1G2C B;  5CJ0 A;  3H32 A;  2OYI A;  1KIL D;  2HOD B;  2R5B A;  2LKM A;  3LIE A;  2E43 A;  1LTJ B;  4W7Y A;  1S9K E;  2HLO A;  3L36 A;  1LTJ A;  3EQ2 A;  3WMM 0;  1GU5 A;  1NH4 A;  4GIF A;  2YO2 A;  3UIA A;  5AW0 B;  2YKO A;  2POH A;  2GUV A;  1J1E B;  5KJ7 C;  1GDT A;  4I2L C;  1M1J C;  2C9N Y;  1JO5 A;  3CLQ A;  3N4X A;  5AW2 B;  2FXM A;  4KHX A;  1LTT C;  3TK1 A;  3H6P A;  1LTS C;  3MIW A;  5AVW B;  3V4Q A;  1IFI A;  1SFC A;  2OYI C;  4HYT B;  1QL2 A;  4LC1 A;  4LLH A;  4WB4 A;  1IO4 A;  5APT A;  1H89 A;  3C9I A;  4N78 D;  3V2R A;  4ZKP A;  4GKG A;  1MFZ A;  3GHG B;  1GW4 A;  5APS A;  3GHG A;  3VMY A;  3I5C A;  1T8Z A;  1J1E C;  3RK2 C;  3P8C E;  1FAV A;  5AW9 B;  4HH2 A;  2YKQ A;  3CI9 A;  3OAK A;  5APX A;  1VPC A;  2IFN A;  3V2P A;  2XZR A;  3HD7 B;  3NFQ A;  1SFC C;  1N73 A;  4RES B;  2XU6 A;  1JNM A;  2JEE A;  3IFM A;  1JTH A;  3HD7 A;  4W7Z A;  2Z5H A;  1N2D C;  2FKW B;  4IFM A;  2OYH A;  3VTP C;  1FZA A;  1CZQ A;  1L0N K;  2NPS A;  3M0D A;  3RK2 D;  1J2J B;  1KFN A;  2HYN A;  1L4A B;  1MV8 A;  2W6A A;  3LID A;  1L4A A;  2FYU K;  3B5N A;  1FJP A;  3VP9 A;  3V5B A;  5AVV B;  4M3L A;  3GHG C;  4O9B A;  1ZV8 A;  3BAT A;  2KYV A;  1WRG A;  5AVU B;  2J58 A;  1HWT C;  2KB7 P;  2N1T B;  4WY4 D;  3A3Y B;  1GD2 E;  4W80 A;  3O8Z A;  1LT9 B;  2VRS A;  2FFD A;  1J1D C;  1LTB C;  1SQQ K;  2C0X A;  1HUC A;  1GL2 B;  1N73 C;  5AW6 B;  3P7K A;  2OYH C;  5AVZ B;  1G2C A;  2A45 H;  3PP5 A;  2NPS C;  3M0D C;  5AVQ B;  2HOD A;  3VMZ A;  4B86 A;  2XDJ A;  3P8M C;  1JY2 O;  2ZFC A;  4I1L A;  2Q7C A;  5AVT B;  3B5N C;  5APV A;  3RK3 B;  1HH0 A;  3KDP B;  3RL0 B;  1Z56 A;  2KLV A;  1FZC B;  1LWU B;  1URQ B;  1JY3 O;  1X9V A;  3U59 A;  1IK9 A;  1LWU A;  1URQ A;  5CCG A;  2KP8 A;  2Q5U A;  1A02 F;  1NTM K;  1NAF A;  2R32 A;  3BRV B;  1GW3 A;  4XA4 A;  1QL1 A;  2HPC B;  2JJL A;  2FFD C;  5CJ4 A;  1JUN A;  5CHX A;  1NTK K;  1YTZ I;  1HGV A;  5AW7 B;  3L35 A;  5AW8 B;  3TYY A;  2YMY A;  1T2K C;  2H43 A;  1RF1 B;  3M0A A;  1YTZ T;  5KJ7 D;  2HFE D;  4EOT A;  1LTJ C;  3G3Z A;  2XNX A;  2CPB A;  1DX7 A;  1RE3 A;  2FYZ A;  5CMZ A;  3EFG A;  1FU1 A;  1N7S B;  3RL0 C;  2WT7 B;  2I1K A;  3BVH A;  1NU1 K;  1RF0 A;  1N7S A;  3VOP A;  5CCG C;  1KQL A;  1URQ C;  1YYC A;  2Q9I A;  2HG5 D;  4WY4 B;  5CCH A;  1LTI C;  3CL3 D;  5AW3 B;  3E1I A;  5AW5 B;  1W2E A;  3HE4 B;  3HRN A;  2OAR A;  4LGD E;  2I1J A;  4I6M C;  2Z4E A;  4AUW A;  3HE4 A;  5BVZ A;  1IFJ A;  2YO3 A;  4JYB A;  1SQB K;  1GTW A;  1KIL B;  1DEB A;  2A45 G;  1AQ5 A;  1N7L A;  1NOH A;  3TSI A;  1FZE A;  1AFO A;  1HTL C;  2O1J A;  2P67 A;  1RE3 C;  1FDM A;  2QM8 A;  3V2Q A;  3OA7 A;  4EIJ A;  1FZB A;  2Q3I A;  3MD0 A;  5AVS B;  5KTB A;  1RF0 C;  1N7S C;  2IPP A;  1S9K D;  1SQP K;  2R5D A;  2O01 H;  1GK4 A;  3NTN A;  5APY A;  2BAS A;  5CCH C;  2GM4 A;  5APQ A;  3MUD A;  4N78 E;  4JYC A;  1SFC D;  3VYI A;  2H7H A;  3M06 A;  1G1I A;  3V4W A;  4N6J A;  1NKN A;  2N1T A;  1GZL A;  2WPQ A;  1G1J A;  2WZ7 A;  3U1A A;  1CSB A;  1HVV A;  1FJK A;  1LT9 A;  3KQG A;  4OH8 B;  5APU A;  2M3B A;  2C0W A;  3HD7 C;  1GL2 A;  1OWA A;  2WWW A;  1M1J B;  3IR9 A;  3HE5 B;  2WSC H;  1E5W A;  1RE4 A;  3HE5 A;  2WSF H;  1X8Y A;  4IFF A;  3T97 A;  1L4A C;  1JOC A;  1MZ9 A;  1IC2 A;  1LGH B;  2W6B A;  3U1C A;  1L0L K;  3H32 B;  1H88 A;  2OYI B;  3HTK B;  2A45 I;  1FZC A;  3P32 A;  2E42 A;  2W27 A;  2WTY A;  3HUS B;  4AYC A;  3HTK A;  3HD7 D;  4Y99 B;  3HUS A;  1IFN A;  2XV5 A;  3BRT B;  2ZXE B;  4XE5 B;  2N1T C;  2Z5I A;  1JCD A;  1XTG B;  1T3J A;  2NPS D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...