1NTMG

Crystal structure of mitochondrial cytochrome bc1 complex at 2.4 angstrom
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 17
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1ntmG00
2BCCG 3H1JG 1NU1G 1EZVG 4PD4H 1L0NG 4D6TG 1NTZG 3CWBG 1BE3G 1SQPG 1PPJG 2FYUG 1SQXG 1KB9H 1PP9G 2IBZG 3H1KG 3H1HG 1SQVG 1SQBG 1SQQG 1NTMG 3L71G 2A06G 3BCCG 5KLVG 1L0LG 3TGUG 1NTKG 1P84H 1BGYG 1KYOH 3H1IG 3L74G 1BCCG 4U3FG 3L70G 3L72G 3L75G 3CX5H 3CXHH 3L73G 3H1LG
chains in the Genus database with same CATH superfamily
2O01H 2E76B 5AVUB 4JPZB 2ZAEB 3OA7A 1LJ2A 2K88A 3MIWA 2FYUE 1X8YA 1KB9H 3M9BA 2I8DA 1SQBE 3CD6P 1N7LA 2B87B 3N4XA 3CX5D 1NVOA 1KYOH 1MUUA 4U3FE 1SFCB 4XE5B 1JOCA 4D6TE 1FZEA 1AV1A 3HUSB 1N2DC 3JCUE 5AVVB 2YMKA 5AVWB 1FZCC 1RY3A 2D2CB 2R3SA 1HGZA 1MKMA 3HD7B 3BATA 2YXQB 5AW2B 2B88A 2IDBA 5AVSB 2QVAA 1YQ3C 3LIEA 3Q5PA 1EZVE 5AW5B 4WWIA 1VQLP 2ZXEB 3G71P 3BCCE 1LTTC 3Q2YA 1N73B 1OZHA 1SQXD 1E5WA 3GHGA 5CCGD 3L72G 2WWWA 2YO3A 4C7NA 1NTZJ 1GW4A 3ZDMA 1R8EA 3MTUE 4EI2A 1RF1B 3TGUE 1GK6A 3PRJA 1N7SC 4YXWH 1WMKA 4DZOA 1FZFA 3L73G 3Q3DA 1FDIA 2GUVA 1K9MQ 1VQNP 2L91A 3G3ZA 1SFCA 2ZXXA 2OGUA 1P84I 5DJTB 1BE3J 3GF3A 1G1IA 2FY8A 3M0AA 3HUSA 1Q82Q 3AE4C 4OGQD 2NZ2A 1VQKP 1RE4C 2WSCJ 3CCJP 3VTPC 2Z4EA 3VYIA 1ZV8A 1KILC 1BCCD 2WQYC 2W27A 1QVFO 4I6MC 3EFFK 2W90A 1JY2N 3PLNA 1U57A 1FZCB 1N73A 2R32A 2QJYC 2SPZA 1FS0E 1Y8AA 3LW5J 3II6A 3CC4P 4AYCA 3WUUA 5AVRB 4DJGA 2JWDA 3HE5B 1J1DC 4JF7A 3M91A 2WVRA 1VQ4P 3AE1C 1HJ0A 1LTSC 1NH4A 4R4LA 1VDFA 3H1JG 4BRYB 1S3JA 3TK1A 3CPWO 5AVTB 1JCDA 1P84D 1BDDA 1IFJA 1T3UA 2Q9IA 4H0LC 1T2KD 4I7ZC 4H44C 1EQ7A 3H6PA 4H13D 1VQ7P 2B89A 2KK7A 5AVZB 1GTWA 2ZVNB 1N7SB 4HJGH 2WSSH 5GTHH 2QEXP 1PV3A 2KSJA 1L0LE 5CBNA 1NTKE 2OQQA 2CPSA 3RK3D 3IAOA 3D71A 4IFFA 1KB9D 2KSEA 1EZVG 1YBKA 1FZCA 5EFWB 3L74D 3H1LJ 2IBZG 5CMZA 3AE8C 1HJBA 1KILB 3NTNA 5B66E 1JY3O 1OW7A 5APXA 1KQFB 3HE5A 1W2BO 1CI6B 1SQVD 1BCCE 1OX3A 2XDJA 1CW5A 4Y99C 1OMIA 5TJHA 3T97B 2ITAA 4C7RA 1SLQA 2QJYB 2WPRA 3IF4A 4Y28J 1NTMK 1MZ9A 1GU4A 3BRVB 1PZQA 1USDA 1PGJA 1J1DB 1BGYJ 3FWLA 3AEAC 2YKOA 3AE6C 2WSFH 1ZR4A 4Z1MH 1N7SA 1BDCA 3C1LA 3L71J 2WSEJ 3FGAD 5AW8B 3M9HA 3TSIA 4H0LB 1P84E 4IL6H 1W5CE 4I7ZB 3VMZA 4H44B 1NKNA 1SQXK 1NTMG 4B86A 3VMXA 4EOTA 1RE4A 1FOSE 3MZWB 1KILA 4OWFA 4HKZH 4OGQC 4ZKPA 3T97A 3P8CD 2C0WA 5KLIC 3RK3E 2Q3EA 3CXHI 2AXCA 3H1HJ 2QRXA 1ZR2A 3V5BA 2V7QH 1KORA 3FWNA 2M8RA 1SQXG 4Y99B 2FKWB 1L0NJ 3R2PA 4NPDA 5KTBA 1HTLC 1SQVE 5DJUB 3AEDC 1AVOA 2LKMA 1NJIQ 5CBOA 1FE6A 3P32A 3JC22 2JKVA 1NU1K 3L70J 2QE7H 3L75J 3CMEP 2PGDA 1OW6A 2MJZA 3V6IA 3CCQP 3B71A 1KZUB 1W2EA 1IO4A 3EWKA 2IZ0A 3UIAA 1OVUA 2K9JB 1RQUA 4H13C 2N1TD 4KJMA 3CWBE 5KKZC 3KXDA 5KAIE 3IR9A 2IBZI 2M3BA 2A45I 1LGHB 5KLVJ 1SVFA 2XZRA 3H1IJ 2BCCG 3RK3C 1VQ6P 1NU1G 2KS1B 4TT3H 1KC8Q 2FXMA 5B66H 4OGQB 1TU3F 5APYA 5BVZA 1YTZT 3V4QA 4D6TD 5KLIB 1LT9C 2XV5A 3P8CE 5CJ4A 1UIXA 1USEA 1VQMP 3HD7C 1JMMA 1PFIA 1OIPA 1T8ZA 1Y47A 1PP9D 1RQVA 3U1AA 3AE2C 4YTPC 3CCSP 1T3JA 1M1JA 5AW0B 2KP8A 1P84H 4WY4D 1IZNB 1YQ4C 2MKVA 2WITA 4NPEA 3F5HA 2NRGA 4MN4C 3TGUD 1UIIA 1VQ8P 3P8MC 2HFED 3E1IA 2KS1A 4H13B 2RN0A 5KKZB 3L74G 2P2UA 4DCKA 4QMAA 1NTZE 1FU1A 1QEXA 2E75D 4IL6X 3RK3B 3I55P 2ZYDA 4BWNA 1Q90D 2IYOA 5GTHE 3B5ND 4GKGA 2P7JA 2YIUC 3PHLA 3V2PA 1LT9B 1BE3E 1JY2P 2Y0CA 1KQLA 3VMYA 2Z5IA 1EC5A 1XTCC 2O1KA 3A5TA 1S4XA 1URQD 2YNYA 3EFGA 2GA1A 2FYNC 1LTGC 1CZQA 4ZKUA 2AXTE 1JCCA 4IOIH 2WZ7A 3CCUP 1PL5A 1PP9E 2H7HA 4K3AA 1JNMA 1M57D 4R4MA 1M7LA 1RF0C 1LWUC 1AQ5A 5KAIH 1BGYD 1L2PA 4PV1D 4NPFX 2N1TC 3OAKA 2HG5D 1VQOP 3RL0D 1KQGB 1LTJC 1KFNA 3EQ2A 2B87A 4HH2A 3Q5SA 2J58A 3TDKA 3VN0A 3RL0g 2POHA 1L0LD 1VL2A 2Q6QA 1S9KD 1NTKD 2OYHC 3H1JJ 4IL6E 1LT9A 2OYIC 4JYBA 2CK3H 1ZRTD 1ZP0C 1FZAA 1WRGA 3HRNA 3M0DC 2JP3A 3HD7A 4DOJA 1IFDA 2FYUK 1IFNA 2KXPB 2YIUB 1MFZA 1SQBK 5CCHA 1HUCA 1DD4A 5APQA 3CCLP 4L76A 3A0HH 1EDLA 3BVHA 2KUBA 3H1HD 1ZLLA 3NMDA 3H1LE 2IFMA 2M3EA 3MD0A 2GM4A 1DX7A 2FYNB 1AVYA 2Y9YA 1KN7A 3N7NA 2V4HA 1SQQJ 1RF1A 2Q1KA 4WY4C 1MFTA 3L37A 2FFDC 4I1LA 2FYUG 1LWUB 3L70D 4M3LA 2XU6A 1SQBG 3W67A 5AW1B 2N1TB 1BGYE 3KPEA 4U3FG 2AEMA 3CXHH 1LTJB 3QWOC 2IZ1A 3SWYA 4D6TG 5AW7B 4K35A 3L71E 2I1JA 2O1JA 2OYHB 4W80A 2E75C 5AW9B 2P10A 5AW4B 1S9KE 2OYIB 2E42A 1HBWA 1GK4A 5CJ0A 5KLVD 1D7MA 3B5NC 1NYHA 1NAYA 3H1ID 1RE3C 1PPJE 2WMMA 1ZRTE 1PP9G 3CC2P 1K73Q 1BSNA 1YJNP 2KYVA 2R44A 2WSCH 3BCCG 4DT0A 1NTMJ 1H0TB 2M5AB 3KDPB 1ZXGA 1NHLA 4EIJA 1XTGB 2AXTH 3P7KA 2BEZF 1K8AQ 3MUDC 2HYNA 3GMAA 4BRYA 1RH5B 3H1HE 1RF0A 2ZYAA 1LWUA 3LW5H 3Q5RA 2ZT9D 3SWKA 3TGUG 4EYYQ 3AEFC 4JBZA 2L5GB 2N1TA 1FJKA 3M06A 1DEEG 1S5LX 5CCGC 2A45H 3PP5A 3RBZA 1LTJA 1OFCX 4WY4B 1X0TA 4HB1A 1SQXJ 4PV1C 1YJWP 2JJLA 2FFDB 3CWBD 3VOPA 4PD4I 5KAFE 2IPPA 1G2CB 1K04A 3L75E 3L70E 2OYHA 2A06D 3LIDA 2OYIA 2KNCB 1NGMB 2W6AA 2C9LY 3ITKA 1OXZA 2Q3IA 1YJ9P 1M90Q 3M0DA 2E74D 1JM0A 3H1KD 2IFNA 1H0TA 2M5AA 2E75B 1AQTA 1CI6A 4JQ0D 3WU2E 3A0BE 3B5NB 3HTKB 1QGKB 1L0LK 2YXRB 5KLVE 4KT0J 4LLHA 1NTKK 2W8ZA 3H1IE 4CPGA 3O6QB 1OVRA 3D70A 3A2AA 3ABVC 2BCCJ 1NU1J 1GL2D 3CCMP 5APUA 4O9BA 1FDOA 3L4FA 4OVNF 3RGUA 4WY4A 4PD4D 2Y0EA 3RK2D 1VQ5P 1S1CX 2FFDA 3B8EB 2W6BA 4UB8E 1G2CA 1S5LE 1LT1A 1IFPA 1FJPA 4GDOA 3L36A 1L0LG 1NTKG 1BSHA 4PV1B 1T2KC 4RO0A 2OYOA 1HH0A 3RL0B 2KOGA 3CCVP 5BU8B 2H43A 4RJTA 2WSEH 4GT1A 1EZVI 5CHXA 3E1RA 2HODB 1NTZD 2A06E 3CXHD 3B5NA 3HTKA 3NFQA 3FX0A 1BCCG 1RE3A 2BASA 4WBAA 5AW3B 5C39A 5K5GB 1M1KQ 3O6QA 2QJPC 3H1HG 3JSVC 3H1JD 3H1KE 1SQPJ 3AE9C 1BE3D 1DH3A 2LR2A 1H89A 3MUDA 5KJ7D 1GU5A 2H8PD 2ZFCA 1JY2O 2I1KA 3L74J 1KTMA 1JO5A 2LXCB 2PFXA 4W7ZA 3BRTB 4AQRD 3OW2O 1ZMEC 2P1JA 5KLVK 3W68A 1SP4A 5CCGA 1KMIZ 5M1BA 2ZT9C 3A0HE 1FDMA 3L35A 5BU5A 2RH0A 1M56D 3H32B 2KZJA 2K9JA 4PD4E 1LNQA 1SQVK 1JY3N 2XKMA 5KAFH 4KHXA 3CX5I 1WT6A 2Z5HA 2HLOA 1QX8A 2IBZD 3U1CA 2HODA 1SQQD 2PRRA 2ZVOB 2KZIA 1ZOYC 4HYTB 1NOHA 4EDFA 1HGVA 2R5DA 5TISE 1R5SA 2GUSA 2P67A 3S4RA 1L4AD 5KLVG 2NPSD 1S72P 5APSA 3WU2H 2E74C 2KLUA 2YKPA 3A0BH 3L72J 1YITP 2QSIA 3PTZA 2C0XA 1QLED 3MGNA 1CSBA 4N6JA 4RKUJ 3CXHE 1NO4A 5E79E 1SQVG 1T6AA 2KI7B 5B5EE 3VMAA 2QJPB 1NAFA 2J59M 1IK9A 1IFMA 1DEBA 2WPVB 1MV8A 3U59A 2K37A 3SFEC 3SSUA 3H1JE 1DIPA 2Y9ZA 3HE4B 1OW8A 3L73J 4GOEA 2QIWA 1JMBA 3H1LD 1A02F 3H32A 1GL2C 1NKZB 4UB8H 5AVQB 1NTMD 1S5LH 1U7MA 2C9NY 3RK2C 4YPCA 2J5UA 3CWBG 4ZNCA 2ZT9B 2HR3A 1Q7YQ 2IX7C 1VF5D 1KILE 2A06G 1QL2A 2Q7CA 1JTHB 1J2JB 1G1JA 3H1KG 2IBZE 5AW6B 2W83C 1SQQE 4L74A 5H2FE 1PGQA 3S1KA 3GLMA 4C46A 3L71D 2XNXA 3USSA 2JR8A 3D6YA 3MHVA 3HE4A 2E74B 4N78E 4OH8B 2FYUJ 3BASA 1E79H 1A02J 1EXIA 1SQBJ 1PPJD 2HPCB 3R4YA 4U3FJ 1HF9A 1RHZB 4XA4A 5KJ7C 1NTZK 2QJKC 2G8YA 1M8OB 4D6TJ 2W6JH 3GF7A 1GMJA 2O3JA 1JEKA 5GTIE 1GL2B 4PD4H 4YXDC 1KQSO 3CX5E 3Q1MA 4N3YB 1JTHA 1EDIA 3RK2B 2BCCD 1NU1D 3AEBC 1NTME 1OWAA 3B4SA 1PP9J 1L0ND 2OTLP 3BCCJ 4PJ0E 1J1EC 1Q86Q 1KB9I 2ZJSE 1H88A 1LP1B 4IFMA 2FBWC 3TNUB 5TISH 3AEEC 1N8RQ 1NTZG 1KV4A 3L75D 3CCRP 1EXJA 1KYOI 1FZBA 3KYQA 2QM8A 3AE5C 1EDJA 2LXBA 3IFMA 3M9QA 2YKQA 1L4AC 2WSFJ 3TGUJ 3RBXA 1NWQA 2HPCA 2NPSC 1QVGO 4UB6H 5E79H 3OJAB 1BE3G 5B5EH 1GDTA 2VRSA 1SQXE 2OTKE 1FBMA 1SQQK 3G9RA 3FXDA 3K5BA 3V4WA 5L8RJ 4IFDK 4U7JA 2H89C 1AJYA 1VQPP 1GD2E 2E5YA 3PH0A 3PJSK 1GL2A 1KFMA 1GW3A 4A7PA 2E76D 4GODA 2QJKB 1SQPD 2FYZA 4GIFA 3S9OA 1URQC 4RESB 3JCUH 1QL1A 1GZLA 1IFIA 1LP1A 1SFCD 3TNUA 2V7QJ 1KYOD 1AA0A 2A45G 1SQQG 2YO2A 1X79B 2G3AA 2XNDH 1VF5C 1IK7A 4XFJA 3I56P 2AEFA 2JDIH 2D2CD 3CLQA 1SS1A 2BCCE 1NU1E 2KIKA 3HD7D 1L0NE 1J1EB 3O8ZA 1Y9BA 5H2FH 2JEEA 5CCHD 5APTA 2WT7B 4L75A 5AVYB 2K9YA 4W7YA 3RL0C 3SFDC 2E5TA 1ZW0A 3V2NA 2N9BA 3I5CA 1L4AB 2E43A 4ZMDA 1LTIC 2NPSB 1S2EA 3SWFA 2R3CA 4GOFA 1M1JC 1IC2A 5KJ7A 1IJDB 1L0LJ 3CC7P 1NTKJ 3H1LG 1VPCA 1JB0J 3KZIE 4AUWA 3L72D 2BEQD 1FC2C 5GTIH 2PAJA 2RKLA 3F89A 1LTAC 1FOSF 3CX5H 3C9IA 1BCCJ 1YI2P 4ASVA 1Q2NA 4JYCA 1HWTC 1JUNA 1EDKA 1ZN5A 2CPBA 3CCEP 1URQB 1SQPE 2K3RA 3L73D 4PJ0H 1KB9E 4ASWA 1BGYG 3L74E 4LC1A 2WT7A 1JY3P 2FXOA 2PP6A 2R5BA 2YMYA 4BXLA 1AFOA 1N86A 1PGPA 1KYOE 1VF5B 2OARA 1FZGA 2RMZA 3VP9A 3H25A 1L4AA 2KNCA 2Y0DA 3L71G 2UWJE 3V2RA 3CL3D 3A7OA 2NPSA 1VQ9P 2KB7P 1L0NK 3V2QA 3CI9A 1PPJG 2M0BA 2K1AA 1PGOA 3IN6A 2N9YB 5AVXB 1YTZI 2AEJA 1PIXA 1M1JB 3GHGC 2WTYA 2KLVA 1X22A 3TYYA 1URQA 2O01J 1N7SD 2FYUD 2E76C 5APVA 3GG2A 1SQBD 1U7JA 3WMM0 2WPQA 1X9VA 4L73A 5APWA 1R5LA 3L72E 3G4SP 2QM7A 3NXSA 1L0NG 4U3FD 3D6ZA 1YYCA 1YHQP 2DW3A 3AE7C 4WB4A 3WUTA 3WUVA 1LTBC 1SFCC 3KHUA 2WPSA 1SQVJ 2O01N 3VP8A 3FXEA 3L70G 3L75G 1KILD 3HUSC 1HVVA 2JO1A 3QH9A 2JWAA 3L73E 1SQPK 1H8AA 2D2CC 2QA4P 1EZVD 2FXPA 4I2LC 1KD1Q 2P58A 5CCHC 1OVVA 2IYPA 2B9BA 1FAVA 3BCCD 3MP7B 2Q5UA 3A3YB 1N73C 3AE3C 3CWBJ 3KQGA 3TF5A 3H1IG 3G6EP 4N78D 1Z56A 3KZIH 3C8VA 3E7KA 1RF1C 1SQPG 3GW6A 2H88C 4WVZA 4H0LD 4UB6E 1DD3A 3GHGB 4LGDE 4H44D 1K05A 3H1KJ 2ZYGA 4TLFA 3AEGC 3AECC 2QG4A 1YIJP 4C7NB 3CMAP 1Q81Q 2OTJP
chains in the Genus database with same CATH topology
2BCCG 3H1JG 1NU1G 1EZVG 4PD4H 1L0NG 4D6TG 1NTZG 3CWBG 1BE3G 1SQPG 1PPJG 2FYUG 1SQXG 1KB9H 1PP9G 2IBZG 3H1KG 3H1HG 1SQVG 1SQBG 1SQQG 1NTMG 3L71G 2A06G 3BCCG 5KLVG 1L0LG 3TGUG 1NTKG 1P84H 1BGYG 1KYOH 3H1IG 3L74G 1BCCG 4U3FG 3L70G 3L72G 3L75G 3CX5H 3CXHH 3L73G 3H1LG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCC G;  3H1J G;  1NU1 G;  1EZV G;  4PD4 H;  1L0N G;  4D6T G;  1NTZ G;  3CWB G;  1BE3 G;  1SQP G;  1PPJ G;  2FYU G;  1SQX G;  1KB9 H;  1PP9 G;  2IBZ G;  3H1K G;  3H1H G;  1SQV G;  1SQB G;  1SQQ G;  1NTM G;  3L71 G;  2A06 G;  3BCC G;  5KLV G;  1L0L G;  3TGU G;  1NTK G;  1P84 H;  1BGY G;  1KYO H;  3H1I G;  3L74 G;  1BCC G;  4U3F G;  3L70 G;  3L72 G;  3L75 G;  3CX5 H;  3CXH H;  3L73 G;  3H1L G; 
#chains in the Genus database with same CATH topology
 2O01 H;  2E76 B;  5AVU B;  4JPZ B;  2ZAE B;  3OA7 A;  1LJ2 A;  2K88 A;  3MIW A;  2FYU E;  1X8Y A;  1KB9 H;  3M9B A;  2I8D A;  1SQB E;  3CD6 P;  1N7L A;  2B87 B;  3N4X A;  3CX5 D;  1NVO A;  1KYO H;  1MUU A;  4U3F E;  1SFC B;  4XE5 B;  1JOC A;  4D6T E;  1FZE A;  1AV1 A;  3HUS B;  1N2D C;  3JCU E;  5AVV B;  2YMK A;  5AVW B;  1FZC C;  1RY3 A;  2D2C B;  2R3S A;  1HGZ A;  1MKM A;  3HD7 B;  3BAT A;  2YXQ B;  5AW2 B;  2B88 A;  2IDB A;  5AVS B;  2QVA A;  1YQ3 C;  3LIE A;  3Q5P A;  1EZV E;  5AW5 B;  4WWI A;  1VQL P;  2ZXE B;  3G71 P;  3BCC E;  1LTT C;  3Q2Y A;  1N73 B;  1OZH A;  1SQX D;  1E5W A;  3GHG A;  5CCG D;  3L72 G;  2WWW A;  2YO3 A;  4C7N A;  1NTZ J;  1GW4 A;  3ZDM A;  1R8E A;  3MTU E;  4EI2 A;  1RF1 B;  3TGU E;  1GK6 A;  3PRJ A;  1N7S C;  4YXW H;  1WMK A;  4DZO A;  1FZF A;  3L73 G;  3Q3D A;  1FDI A;  2GUV A;  1K9M Q;  1VQN P;  2L91 A;  3G3Z A;  1SFC A;  2ZXX A;  2OGU A;  1P84 I;  5DJT B;  1BE3 J;  3GF3 A;  1G1I A;  2FY8 A;  3M0A A;  3HUS A;  1Q82 Q;  3AE4 C;  4OGQ D;  2NZ2 A;  1VQK P;  1RE4 C;  2WSC J;  3CCJ P;  3VTP C;  2Z4E A;  3VYI A;  1ZV8 A;  1KIL C;  1BCC D;  2WQY C;  2W27 A;  1QVF O;  4I6M C;  3EFF K;  2W90 A;  1JY2 N;  3PLN A;  1U57 A;  1FZC B;  1N73 A;  2R32 A;  2QJY C;  2SPZ A;  1FS0 E;  1Y8A A;  3LW5 J;  3II6 A;  3CC4 P;  4AYC A;  3WUU A;  5AVR B;  4DJG A;  2JWD A;  3HE5 B;  1J1D C;  4JF7 A;  3M91 A;  2WVR A;  1VQ4 P;  3AE1 C;  1HJ0 A;  1LTS C;  1NH4 A;  4R4L A;  1VDF A;  3H1J G;  4BRY B;  1S3J A;  3TK1 A;  3CPW O;  5AVT B;  1JCD A;  1P84 D;  1BDD A;  1IFJ A;  1T3U A;  2Q9I A;  4H0L C;  1T2K D;  4I7Z C;  4H44 C;  1EQ7 A;  3H6P A;  4H13 D;  1VQ7 P;  2B89 A;  2KK7 A;  5AVZ B;  1GTW A;  2ZVN B;  1N7S B;  4HJG H;  2WSS H;  5GTH H;  2QEX P;  1PV3 A;  2KSJ A;  1L0L E;  5CBN A;  1NTK E;  2OQQ A;  2CPS A;  3RK3 D;  3IAO A;  3D71 A;  4IFF A;  1KB9 D;  2KSE A;  1EZV G;  1YBK A;  1FZC A;  5EFW B;  3L74 D;  3H1L J;  2IBZ G;  5CMZ A;  3AE8 C;  1HJB A;  1KIL B;  3NTN A;  5B66 E;  1JY3 O;  1OW7 A;  5APX A;  1KQF B;  3HE5 A;  1W2B O;  1CI6 B;  1SQV D;  1BCC E;  1OX3 A;  2XDJ A;  1CW5 A;  4Y99 C;  1OMI A;  5TJH A;  3T97 B;  2ITA A;  4C7R A;  1SLQ A;  2QJY B;  2WPR A;  3IF4 A;  4Y28 J;  1NTM K;  1MZ9 A;  1GU4 A;  3BRV B;  1PZQ A;  1USD A;  1PGJ A;  1J1D B;  1BGY J;  3FWL A;  3AEA C;  2YKO A;  3AE6 C;  2WSF H;  1ZR4 A;  4Z1M H;  1N7S A;  1BDC A;  3C1L A;  3L71 J;  2WSE J;  3FGA D;  5AW8 B;  3M9H A;  3TSI A;  4H0L B;  1P84 E;  4IL6 H;  1W5C E;  4I7Z B;  3VMZ A;  4H44 B;  1NKN A;  1SQX K;  1NTM G;  4B86 A;  3VMX A;  4EOT A;  1RE4 A;  1FOS E;  3MZW B;  1KIL A;  4OWF A;  4HKZ H;  4OGQ C;  4ZKP A;  3T97 A;  3P8C D;  2C0W A;  5KLI C;  3RK3 E;  2Q3E A;  3CXH I;  2AXC A;  3H1H J;  2QRX A;  1ZR2 A;  3V5B A;  2V7Q H;  1KOR A;  3FWN A;  2M8R A;  1SQX G;  4Y99 B;  2FKW B;  1L0N J;  3R2P A;  4NPD A;  5KTB A;  1HTL C;  1SQV E;  5DJU B;  3AED C;  1AVO A;  2LKM A;  1NJI Q;  5CBO A;  1FE6 A;  3P32 A;  3JC2 2;  2JKV A;  1NU1 K;  3L70 J;  2QE7 H;  3L75 J;  3CME P;  2PGD A;  1OW6 A;  2MJZ A;  3V6I A;  3CCQ P;  3B71 A;  1KZU B;  1W2E A;  1IO4 A;  3EWK A;  2IZ0 A;  3UIA A;  1OVU A;  2K9J B;  1RQU A;  4H13 C;  2N1T D;  4KJM A;  3CWB E;  5KKZ C;  3KXD A;  5KAI E;  3IR9 A;  2IBZ I;  2M3B A;  2A45 I;  1LGH B;  5KLV J;  1SVF A;  2XZR A;  3H1I J;  2BCC G;  3RK3 C;  1VQ6 P;  1NU1 G;  2KS1 B;  4TT3 H;  1KC8 Q;  2FXM A;  5B66 H;  4OGQ B;  1TU3 F;  5APY A;  5BVZ A;  1YTZ T;  3V4Q A;  4D6T D;  5KLI B;  1LT9 C;  2XV5 A;  3P8C E;  5CJ4 A;  1UIX A;  1USE A;  1VQM P;  3HD7 C;  1JMM A;  1PFI A;  1OIP A;  1T8Z A;  1Y47 A;  1PP9 D;  1RQV A;  3U1A A;  3AE2 C;  4YTP C;  3CCS P;  1T3J A;  1M1J A;  5AW0 B;  2KP8 A;  1P84 H;  4WY4 D;  1IZN B;  1YQ4 C;  2MKV A;  2WIT A;  4NPE A;  3F5H A;  2NRG A;  4MN4 C;  3TGU D;  1UII A;  1VQ8 P;  3P8M C;  2HFE D;  3E1I A;  2KS1 A;  4H13 B;  2RN0 A;  5KKZ B;  3L74 G;  2P2U A;  4DCK A;  4QMA A;  1NTZ E;  1FU1 A;  1QEX A;  2E75 D;  4IL6 X;  3RK3 B;  3I55 P;  2ZYD A;  4BWN A;  1Q90 D;  2IYO A;  5GTH E;  3B5N D;  4GKG A;  2P7J A;  2YIU C;  3PHL A;  3V2P A;  1LT9 B;  1BE3 E;  1JY2 P;  2Y0C A;  1KQL A;  3VMY A;  2Z5I A;  1EC5 A;  1XTC C;  2O1K A;  3A5T A;  1S4X A;  1URQ D;  2YNY A;  3EFG A;  2GA1 A;  2FYN C;  1LTG C;  1CZQ A;  4ZKU A;  2AXT E;  1JCC A;  4IOI H;  2WZ7 A;  3CCU P;  1PL5 A;  1PP9 E;  2H7H A;  4K3A A;  1JNM A;  1M57 D;  4R4M A;  1M7L A;  1RF0 C;  1LWU C;  1AQ5 A;  5KAI H;  1BGY D;  1L2P A;  4PV1 D;  4NPF X;  2N1T C;  3OAK A;  2HG5 D;  1VQO P;  3RL0 D;  1KQG B;  1LTJ C;  1KFN A;  3EQ2 A;  2B87 A;  4HH2 A;  3Q5S A;  2J58 A;  3TDK A;  3VN0 A;  3RL0 g;  2POH A;  1L0L D;  1VL2 A;  2Q6Q A;  1S9K D;  1NTK D;  2OYH C;  3H1J J;  4IL6 E;  1LT9 A;  2OYI C;  4JYB A;  2CK3 H;  1ZRT D;  1ZP0 C;  1FZA A;  1WRG A;  3HRN A;  3M0D C;  2JP3 A;  3HD7 A;  4DOJ A;  1IFD A;  2FYU K;  1IFN A;  2KXP B;  2YIU B;  1MFZ A;  1SQB K;  5CCH A;  1HUC A;  1DD4 A;  5APQ A;  3CCL P;  4L76 A;  3A0H H;  1EDL A;  3BVH A;  2KUB A;  3H1H D;  1ZLL A;  3NMD A;  3H1L E;  2IFM A;  2M3E A;  3MD0 A;  2GM4 A;  1DX7 A;  2FYN B;  1AVY A;  2Y9Y A;  1KN7 A;  3N7N A;  2V4H A;  1SQQ J;  1RF1 A;  2Q1K A;  4WY4 C;  1MFT A;  3L37 A;  2FFD C;  4I1L A;  2FYU G;  1LWU B;  3L70 D;  4M3L A;  2XU6 A;  1SQB G;  3W67 A;  5AW1 B;  2N1T B;  1BGY E;  3KPE A;  4U3F G;  2AEM A;  3CXH H;  1LTJ B;  3QWO C;  2IZ1 A;  3SWY A;  4D6T G;  5AW7 B;  4K35 A;  3L71 E;  2I1J A;  2O1J A;  2OYH B;  4W80 A;  2E75 C;  5AW9 B;  2P10 A;  5AW4 B;  1S9K E;  2OYI B;  2E42 A;  1HBW A;  1GK4 A;  5CJ0 A;  5KLV D;  1D7M A;  3B5N C;  1NYH A;  1NAY A;  3H1I D;  1RE3 C;  1PPJ E;  2WMM A;  1ZRT E;  1PP9 G;  3CC2 P;  1K73 Q;  1BSN A;  1YJN P;  2KYV A;  2R44 A;  2WSC H;  3BCC G;  4DT0 A;  1NTM J;  1H0T B;  2M5A B;  3KDP B;  1ZXG A;  1NHL A;  4EIJ A;  1XTG B;  2AXT H;  3P7K A;  2BEZ F;  1K8A Q;  3MUD C;  2HYN A;  3GMA A;  4BRY A;  1RH5 B;  3H1H E;  1RF0 A;  2ZYA A;  1LWU A;  3LW5 H;  3Q5R A;  2ZT9 D;  3SWK A;  3TGU G;  4EYY Q;  3AEF C;  4JBZ A;  2L5G B;  2N1T A;  1FJK A;  3M06 A;  1DEE G;  1S5L X;  5CCG C;  2A45 H;  3PP5 A;  3RBZ A;  1LTJ A;  1OFC X;  4WY4 B;  1X0T A;  4HB1 A;  1SQX J;  4PV1 C;  1YJW P;  2JJL A;  2FFD B;  3CWB D;  3VOP A;  4PD4 I;  5KAF E;  2IPP A;  1G2C B;  1K04 A;  3L75 E;  3L70 E;  2OYH A;  2A06 D;  3LID A;  2OYI A;  2KNC B;  1NGM B;  2W6A A;  2C9L Y;  3ITK A;  1OXZ A;  2Q3I A;  1YJ9 P;  1M90 Q;  3M0D A;  2E74 D;  1JM0 A;  3H1K D;  2IFN A;  1H0T A;  2M5A A;  2E75 B;  1AQT A;  1CI6 A;  4JQ0 D;  3WU2 E;  3A0B E;  3B5N B;  3HTK B;  1QGK B;  1L0L K;  2YXR B;  5KLV E;  4KT0 J;  4LLH A;  1NTK K;  2W8Z A;  3H1I E;  4CPG A;  3O6Q B;  1OVR A;  3D70 A;  3A2A A;  3ABV C;  2BCC J;  1NU1 J;  1GL2 D;  3CCM P;  5APU A;  4O9B A;  1FDO A;  3L4F A;  4OVN F;  3RGU A;  4WY4 A;  4PD4 D;  2Y0E A;  3RK2 D;  1VQ5 P;  1S1C X;  2FFD A;  3B8E B;  2W6B A;  4UB8 E;  1G2C A;  1S5L E;  1LT1 A;  1IFP A;  1FJP A;  4GDO A;  3L36 A;  1L0L G;  1NTK G;  1BSH A;  4PV1 B;  1T2K C;  4RO0 A;  2OYO A;  1HH0 A;  3RL0 B;  2KOG A;  3CCV P;  5BU8 B;  2H43 A;  4RJT A;  2WSE H;  4GT1 A;  1EZV I;  5CHX A;  3E1R A;  2HOD B;  1NTZ D;  2A06 E;  3CXH D;  3B5N A;  3HTK A;  3NFQ A;  3FX0 A;  1BCC G;  1RE3 A;  2BAS A;  4WBA A;  5AW3 B;  5C39 A;  5K5G B;  1M1K Q;  3O6Q A;  2QJP C;  3H1H G;  3JSV C;  3H1J D;  3H1K E;  1SQP J;  3AE9 C;  1BE3 D;  1DH3 A;  2LR2 A;  1H89 A;  3MUD A;  5KJ7 D;  1GU5 A;  2H8P D;  2ZFC A;  1JY2 O;  2I1K A;  3L74 J;  1KTM A;  1JO5 A;  2LXC B;  2PFX A;  4W7Z A;  3BRT B;  4AQR D;  3OW2 O;  1ZME C;  2P1J A;  5KLV K;  3W68 A;  1SP4 A;  5CCG A;  1KMI Z;  5M1B A;  2ZT9 C;  3A0H E;  1FDM A;  3L35 A;  5BU5 A;  2RH0 A;  1M56 D;  3H32 B;  2KZJ A;  2K9J A;  4PD4 E;  1LNQ A;  1SQV K;  1JY3 N;  2XKM A;  5KAF H;  4KHX A;  3CX5 I;  1WT6 A;  2Z5H A;  2HLO A;  1QX8 A;  2IBZ D;  3U1C A;  2HOD A;  1SQQ D;  2PRR A;  2ZVO B;  2KZI A;  1ZOY C;  4HYT B;  1NOH A;  4EDF A;  1HGV A;  2R5D A;  5TIS E;  1R5S A;  2GUS A;  2P67 A;  3S4R A;  1L4A D;  5KLV G;  2NPS D;  1S72 P;  5APS A;  3WU2 H;  2E74 C;  2KLU A;  2YKP A;  3A0B H;  3L72 J;  1YIT P;  2QSI A;  3PTZ A;  2C0X A;  1QLE D;  3MGN A;  1CSB A;  4N6J A;  4RKU J;  3CXH E;  1NO4 A;  5E79 E;  1SQV G;  1T6A A;  2KI7 B;  5B5E E;  3VMA A;  2QJP B;  1NAF A;  2J59 M;  1IK9 A;  1IFM A;  1DEB A;  2WPV B;  1MV8 A;  3U59 A;  2K37 A;  3SFE C;  3SSU A;  3H1J E;  1DIP A;  2Y9Z A;  3HE4 B;  1OW8 A;  3L73 J;  4GOE A;  2QIW A;  1JMB A;  3H1L D;  1A02 F;  3H32 A;  1GL2 C;  1NKZ B;  4UB8 H;  5AVQ B;  1NTM D;  1S5L H;  1U7M A;  2C9N Y;  3RK2 C;  4YPC A;  2J5U A;  3CWB G;  4ZNC A;  2ZT9 B;  2HR3 A;  1Q7Y Q;  2IX7 C;  1VF5 D;  1KIL E;  2A06 G;  1QL2 A;  2Q7C A;  1JTH B;  1J2J B;  1G1J A;  3H1K G;  2IBZ E;  5AW6 B;  2W83 C;  1SQQ E;  4L74 A;  5H2F E;  1PGQ A;  3S1K A;  3GLM A;  4C46 A;  3L71 D;  2XNX A;  3USS A;  2JR8 A;  3D6Y A;  3MHV A;  3HE4 A;  2E74 B;  4N78 E;  4OH8 B;  2FYU J;  3BAS A;  1E79 H;  1A02 J;  1EXI A;  1SQB J;  1PPJ D;  2HPC B;  3R4Y A;  4U3F J;  1HF9 A;  1RHZ B;  4XA4 A;  5KJ7 C;  1NTZ K;  2QJK C;  2G8Y A;  1M8O B;  4D6T J;  2W6J H;  3GF7 A;  1GMJ A;  2O3J A;  1JEK A;  5GTI E;  1GL2 B;  4PD4 H;  4YXD C;  1KQS O;  3CX5 E;  3Q1M A;  4N3Y B;  1JTH A;  1EDI A;  3RK2 B;  2BCC D;  1NU1 D;  3AEB C;  1NTM E;  1OWA A;  3B4S A;  1PP9 J;  1L0N D;  2OTL P;  3BCC J;  4PJ0 E;  1J1E C;  1Q86 Q;  1KB9 I;  2ZJS E;  1H88 A;  1LP1 B;  4IFM A;  2FBW C;  3TNU B;  5TIS H;  3AEE C;  1N8R Q;  1NTZ G;  1KV4 A;  3L75 D;  3CCR P;  1EXJ A;  1KYO I;  1FZB A;  3KYQ A;  2QM8 A;  3AE5 C;  1EDJ A;  2LXB A;  3IFM A;  3M9Q A;  2YKQ A;  1L4A C;  2WSF J;  3TGU J;  3RBX A;  1NWQ A;  2HPC A;  2NPS C;  1QVG O;  4UB6 H;  5E79 H;  3OJA B;  1BE3 G;  5B5E H;  1GDT A;  2VRS A;  1SQX E;  2OTK E;  1FBM A;  1SQQ K;  3G9R A;  3FXD A;  3K5B A;  3V4W A;  5L8R J;  4IFD K;  4U7J A;  2H89 C;  1AJY A;  1VQP P;  1GD2 E;  2E5Y A;  3PH0 A;  3PJS K;  1GL2 A;  1KFM A;  1GW3 A;  4A7P A;  2E76 D;  4GOD A;  2QJK B;  1SQP D;  2FYZ A;  4GIF A;  3S9O A;  1URQ C;  4RES B;  3JCU H;  1QL1 A;  1GZL A;  1IFI A;  1LP1 A;  1SFC D;  3TNU A;  2V7Q J;  1KYO D;  1AA0 A;  2A45 G;  1SQQ G;  2YO2 A;  1X79 B;  2G3A A;  2XND H;  1VF5 C;  1IK7 A;  4XFJ A;  3I56 P;  2AEF A;  2JDI H;  2D2C D;  3CLQ A;  1SS1 A;  2BCC E;  1NU1 E;  2KIK A;  3HD7 D;  1L0N E;  1J1E B;  3O8Z A;  1Y9B A;  5H2F H;  2JEE A;  5CCH D;  5APT A;  2WT7 B;  4L75 A;  5AVY B;  2K9Y A;  4W7Y A;  3RL0 C;  3SFD C;  2E5T A;  1ZW0 A;  3V2N A;  2N9B A;  3I5C A;  1L4A B;  2E43 A;  4ZMD A;  1LTI C;  2NPS B;  1S2E A;  3SWF A;  2R3C A;  4GOF A;  1M1J C;  1IC2 A;  5KJ7 A;  1IJD B;  1L0L J;  3CC7 P;  1NTK J;  3H1L G;  1VPC A;  1JB0 J;  3KZI E;  4AUW A;  3L72 D;  2BEQ D;  1FC2 C;  5GTI H;  2PAJ A;  2RKL A;  3F89 A;  1LTA C;  1FOS F;  3CX5 H;  3C9I A;  1BCC J;  1YI2 P;  4ASV A;  1Q2N A;  4JYC A;  1HWT C;  1JUN A;  1EDK A;  1ZN5 A;  2CPB A;  3CCE P;  1URQ B;  1SQP E;  2K3R A;  3L73 D;  4PJ0 H;  1KB9 E;  4ASW A;  1BGY G;  3L74 E;  4LC1 A;  2WT7 A;  1JY3 P;  2FXO A;  2PP6 A;  2R5B A;  2YMY A;  4BXL A;  1AFO A;  1N86 A;  1PGP A;  1KYO E;  1VF5 B;  2OAR A;  1FZG A;  2RMZ A;  3VP9 A;  3H25 A;  1L4A A;  2KNC A;  2Y0D A;  3L71 G;  2UWJ E;  3V2R A;  3CL3 D;  3A7O A;  2NPS A;  1VQ9 P;  2KB7 P;  1L0N K;  3V2Q A;  3CI9 A;  1PPJ G;  2M0B A;  2K1A A;  1PGO A;  3IN6 A;  2N9Y B;  5AVX B;  1YTZ I;  2AEJ A;  1PIX A;  1M1J B;  3GHG C;  2WTY A;  2KLV A;  1X22 A;  3TYY A;  1URQ A;  2O01 J;  1N7S D;  2FYU D;  2E76 C;  5APV A;  3GG2 A;  1SQB D;  1U7J A;  3WMM 0;  2WPQ A;  1X9V A;  4L73 A;  5APW A;  1R5L A;  3L72 E;  3G4S P;  2QM7 A;  3NXS A;  1L0N G;  4U3F D;  3D6Z A;  1YYC A;  1YHQ P;  2DW3 A;  3AE7 C;  4WB4 A;  3WUT A;  3WUV A;  1LTB C;  1SFC C;  3KHU A;  2WPS A;  1SQV J;  2O01 N;  3VP8 A;  3FXE A;  3L70 G;  3L75 G;  1KIL D;  3HUS C;  1HVV A;  2JO1 A;  3QH9 A;  2JWA A;  3L73 E;  1SQP K;  1H8A A;  2D2C C;  2QA4 P;  1EZV D;  2FXP A;  4I2L C;  1KD1 Q;  2P58 A;  5CCH C;  1OVV A;  2IYP A;  2B9B A;  1FAV A;  3BCC D;  3MP7 B;  2Q5U A;  3A3Y B;  1N73 C;  3AE3 C;  3CWB J;  3KQG A;  3TF5 A;  3H1I G;  3G6E P;  4N78 D;  1Z56 A;  3KZI H;  3C8V A;  3E7K A;  1RF1 C;  1SQP G;  3GW6 A;  2H88 C;  4WVZ A;  4H0L D;  4UB6 E;  1DD3 A;  3GHG B;  4LGD E;  4H44 D;  1K05 A;  3H1K J;  2ZYG A;  4TLF A;  3AEG C;  3AEC C;  2QG4 A;  1YIJ P;  4C7N B;  3CMA P;  1Q81 Q;  2OTJ P; 
#chains in the Genus database with same CATH homology
 2BCC G;  3H1J G;  1NU1 G;  1EZV G;  4PD4 H;  1L0N G;  4D6T G;  1NTZ G;  3CWB G;  1BE3 G;  1SQP G;  1PPJ G;  2FYU G;  1SQX G;  1KB9 H;  1PP9 G;  2IBZ G;  3H1K G;  3H1H G;  1SQV G;  1SQB G;  1SQQ G;  1NTM G;  3L71 G;  2A06 G;  3BCC G;  5KLV G;  1L0L G;  3TGU G;  1NTK G;  1P84 H;  1BGY G;  1KYO H;  3H1I G;  3L74 G;  1BCC G;  4U3F G;  3L70 G;  3L72 G;  3L75 G;  3CX5 H;  3CXH H;  3L73 G;  3H1L G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...