1NTMG

Crystal structure of mitochondrial cytochrome bc1 complex at 2.4 angstrom
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
total genus 17
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1ntmG00
3TGUG 1NTMG 1BGYG 1KYOH 3H1LG 3L73G 3CXHH 1NTZG 1KB9H 1PPJG 1SQQG 1EZVG 1P84H 3H1IG 3L70G 3L72G 3L74G 3L71G 3H1HG 3BCCG 4U3FG 1SQPG 1BE3G 1BCCG 1SQBG 2A06G 3CWBG 1L0NG 5KLVG 2FYUG 4PD4H 3CX5H 1NTKG 3L75G 1SQXG 3H1JG 1NU1G 2IBZG 2BCCG 1L0LG 1SQVG 3H1KG 4D6TG 1PP9G
chains in the Genus database with same CATH superfamily
3M9QA 3T97A 1OVVA 3L73J 1SQPD 5CJ4A 1VDFA 2BEZF 1OVUA 2AEJA 3KZIE 3MTUE 3MUDA 1OMIA 1N7SC 5E79H 1EC5A 1JTHA 2P67A 3HE4B 3S9OA 3M91A 1GTWA 2GUVA 4AUWA 2PAJA 2KIKA 1WRGA 1ZRTD 3CX5D 3G71P 2YXQB 1T2KC 3CC2P 3RGUA 1YJWP 1EXIA 1KORA 2YIUC 1NJIQ 2WT7A 3RBZA 2HODB 3H1HD 3H1LG 2E75C 5K5GB 3G6EP 1FZEA 2QJYC 1PFIA 2V7QJ 2RKLA 2O3JA 4IFFA 3EWKA 1QGKB 5AVZB 3C9IA 3H32A 1IFNA 3L75J 3W68A 1SVFA 4ASWA 3OAKA 3I55P 2A45I 3U59A 4H44C 1YJ9P 2E74B 2R32A 3KDPB 3B5NA 4NPDA 1URQC 3CCRP 1BCCJ 1NTMK 3HD7B 3M9BA 1NTZE 2Z5HA 2OQQA 4YPCA 1AVOA 2GA1A 3CXHE 5CBNA 1ZXGA 1OZHA 3U1CA 5DJTB 1PGJA 3VOPA 2MJZA 2NPSD 3H1IJ 5AVWB 3GHGC 1OVRA 1SQBG 2JWDA 2KS1A 2O01H 2OYIA 4WB4A 1W2EA 1NHLA 3L70D 1JMBA 1A02F 2LKMA 2KNCB 4W7ZA 5KLVK 4H13C 2XZRA 2GUSA 3L75D 3CD6P 1ZV8A 1SQVK 2B88A 2IBZE 2RN0A 4ZNCA 2JDIH 2KLVA 2ZVNB 5GTHE 3D6YA 2BEQD 3EFFK 1KFMA 1HTLC 5CCGC 1L0LG 4A7PA 1FAVA 3A5TA 1BCCD 2OYHB 4R4LA 3LIEA 1NU1D 2VRSA 5B66E 2IYPA 2OARA 3JCUE 4LC1A 2FXMA 3ZDMA 1MZ9A 2P58A 4L76A 4I7ZC 3H1ID 3VTPC 1MUUA 1KYOH 2WPSA 5APSA 1ZW0A 1ZR2A 1SFCD 3HTKA 4HJGH 3D70A 1SQXE 4OH8B 2W6JH 2XU6A 1QLED 1SFCA 2IBZG 2FFDA 3CCSP 1N73B 5AVQB 5APXA 4UB8H 3H1JE 2N1TD 2KB7P 4U3FG 4C7RA 3TGUE 5AW1B 1JUNA 2W83C 3R4YA 2UWJE 2ZFCA 4EIJA 5AW7B 5CCHC 2N1TA 1WMKA 1YJNP 4GT1A 1NKZB 4ZKUA 3CCEP 1VQMP 2RH0A 1L0NJ 1FJPA 1GU4A 3S1KA 3II6A 2YXRB 2M3EA 4Y99C 4PV1D 3CMAP 5CMZA 3CWBE 2D2CB 2QVAA 3CC4P 1NOHA 3CLQA 3FX0A 1NGMB 3WMM0 3AEFC 1OXZA 3H1JG 3PP5A 1NVOA 2Z5IA 2YKOA 4DCKA 3TGUG 3HD7D 4RESB 4L75A 2DW3A 1S4XA 1J1EB 1DEBA 2XKMA 3AEGC 1KQFB 1FZBA 3EFGA 1L0ND 1FU1A 1QL1A 5KLVE 2IZ1A 1OFCX 2E74C 1JY2P 1SQVE 3P8CE 3CWBG 5E79E 3CCLP 2MKVA 4IFDK 4WY4C 1TU3F 2KUBA 3O6QB 1EQ7A 3CXHD 1L4AA 2C9LY 3FXDA 1W5CE 5AW0B 2O1KA 1CI6B 3V2QA 1GL2A 1AVYA 4BXLA 1DD3A 4PD4D 2ZT9B 5C39A 1GK6A 2YIUB 1FZGA 1JCCA 4EYYQ 3T97B 3H1KG 1IFPA 3L72E 4GOEA 3L74E 1RQVA 2YKQA 5KJ7D 1S9KE 1KMIZ 4DJGA 1ZLLA 2WPRA 3V6IA 3L71J 2B87B 2JKVA 4EI2A 1VQ6P 3B8EB 2XNXA 1JTHB 1AJYA 3RK2D 1H8AA 4YTPC 2L5GB 3EQ2A 2QRXA 5GTIE 2WVRA 4CPGA 1EXJA 1KB9H 1N86A 3IF4A 2Y0DA 3A0BH 2OYHC 3WUUA 1E5WA 3KYQA 5H2FE 2WT7B 3Q5PA 1SS1A 1IK7A 1SQBK 2A06E 3GHGB 1VQ7P 1LGHB 3CXHI 3H32B 3L72G 1EDLA 1LT9A 2I1JA 1UIIA 3JSVC 1KQSO 4B86A 2Q3EA 3IAOA 3L71D 4PD4I 3RK3E 3VP9A 1NTMJ 1SLQA 2FXOA 2PFXA 1M7LA 3IR9A 1P84D 3L35A 1EZVG 1A02J 1YHQP 2WMMA 1L0LK 2AXTH 4HH2A 1OWAA 4D6TE 1NTZK 1RE4C 2R3CA 3L73G 2E76D 5B5EE 1EDKA 1KFNA 5APVA 4H0LB 3E7KA 3RK3B 4L74A 4IFMA 2A06G 1RF1A 2FKWB 5TISH 1PP9E 3CPWO 1JM0A 3CMEP 3VN0A 1SQVJ 1PGPA 1Y47A 1KYOE 4ASVA 1IJDB 2WSFJ 2D2CC 1LWUB 3Q1MA 2HPCA 3GG2A 1FDIA 2K9JB 2E43A 3PLNA 1NTMD 4PJ0H 1YTZI 1LT1A 1N7SD 1Q7YQ 2BCCJ 2IFNA 1QL2A 3P7KA 1PGOA 3OJAB 2WSSH 3TSIA 4UB8E 1YQ4C 5APWA 2J5UA 4IL6X 1R8EA 1N7SA 1S3JA 2J59M 3MHVA 2IZ0A 3H1HJ 2QJKB 1P84I 3CI9A 3H1LE 1J1EC 2QM7A 1T2KD 1ZR4A 1G2CA 2FYZA 1DD4A 1JMMA 3HTKB 1BE3E 5KLVD 4I1LA 1SQXK 2E75D 1SQVD 1LTJA 3P8CD 1KILA 2A45H 3HUSA 2C0XA 1AQ5A 3A7OA 2B9BA 1IFDA 1M1JC 4Y99B 4HB1A 5AVRB 5AVYB 5AW9B 1BGYJ 4NPFX 4EDFA 4H44D 3NTNA 2QG4A 2BCCD 3RL0g 1FDMA 2CPBA 1Q2NA 1URQD 2ZT9C 5M1BA 2Q9IA 4R4MA 1YBKA 2WSFH 3QWOC 4JF7A 4UB6H 1FZCA 1PIXA 1SQBE 3NMDA 1Y9BA 3L70J 1VL2A 3MUDC 1GW4A 1BE3G 2P10A 3FGAD 3CX5H 3MGNA 3F89A 3A0HH 1VQ8P 4KJMA 4D6TJ 2ITAA 1FDOA 1W2BO 4BRYA 4C46A 2JP3A 4H13D 1L0LE 2E42A 4WY4B 2FBWC 1BGYD 3VP8A 1PPJE 1NU1J 3V4WA 2WPQA 2P2UA 5CCGD 1M57D 1FOSE 1JY2N 5DJUB 5AVTB 4XFJA 2OTKE 1VQPP 2IPPA 4LGDE 1R5SA 2WWWA 2G3AA 3QH9A 2V4HA 3MIWA 1SQQE 3S4RA 2Q3IA 3G3ZA 2NPSA 1YIJP 3IN6A 1H0TB 3F5HA 3B5NC 4XE5B 4D6TD 1S5LH 1BSHA 4Y28J 1NO4A 2V7QH 1GL2B 1KB9E 4U3FE 1PPJG 1OW7A 3M9HA 1XTCC 1PP9D 2Y9ZA 4H0LC 2HG5D 1U7JA 3RK3C 1S1CX 2OYIC 1RH5B 3WUTA 2QA4P 2IX7C 4C7NA 4O9BA 5CCHD 1SQQG 1VQ5P 5L8RJ 4OWFA 3AE9C 1LWUC 5KLIC 3OW2O 5APYA 2WSEJ 2KZIA 1LP1A 4BWNA 2KSEA 2H89C 4U7JA 3R2PA 3VMXA 1RQUA 1SQBJ 3H1LD 3E1RA 1JY2O 3V5BA 2QJKC 1GDTA 3HE4A 2WTYA 3B71A 1HVVA 2KP8A 3BCCG 1VQOP 5TISE 4RJTA 3Q5RA 2ZVOB 1VF5C 1LTIC 2FXPA 1EDJA 1L0LJ 4I6MC 4IL6H 3TF5A 4WBAA 1GW3A 2FFDC 2WPVB 4DT0A 1QVFO 2O01N 2HODA 1NTZJ 5AVSB 4K3AA 3KZIH 2HYNA 5AW3B 1OX3A 2E74D 4PJ0E 4RO0A 2C9NY 4WY4D 2W90A 1Q82Q 2B89A 1SQBD 5AW5B 1NTKE 3H25A 3E1IA 1PV3A 5BU5A 3CCMP 3H1KE 5BU8B 1RE3C 3HD7A 2Q1KA 1IFIA 4GOFA 1G1IA 1YQ3C 4YXWH 2FYUE 2HPCB 4N6JA 1L0LD 2WITA 4GIFA 3W67A 2GM4A 3I56P 1LTGC 1M1JB 1NTZD 3USSA 3AEDC 2H8PD 1KILE 1RF0A 2WZ7A 1SQPE 3TNUB 1VQ4P 1VQ9P 2NRGA 3D71A 2QJPC 3FWNA 3CCUP 4N3YB 2M3BA 2IYOA 1JO5A 1NTKG 1E79H 1SQXJ 3SFEC 1G1JA 2FY8A 4UB6E 3M0DA 1LTJB 4I2LC 2E5YA 2IBZD 3SWYA 1KILB 2KZJA 1ZRTE 3CX5E 2FYUG 4PD4H 3A0HE 3H1JJ 3H6PA 5KJ7A 2H43A 1EZVE 2A45G 3TGUJ 1L4AC 1HGVA 4U3FD 4OGQC 1GL2C 1SQPG 3GMAA 5GTHH 3P32A 2LXCB 2WSCJ 3L73E 3CCVP 1FZCB 1S5LX 4LLHA 1PZQA 1USEA 1VQKP 1N73A 2K3RA 3MD0A 1JNMA 3D6ZA 3N4XA 1JY3P 1S2EA 2ZYAA 1SQXD 1LNQA 2JR8A 3CWBJ 3LIDA 3MZWB 4JPZB 3PHLA 3NFQA 1PL5A 1PGQA 3SSUA 3AE2C 3RL0C 2ZYGA 1K9MQ 3B5NB 5KAIH 3AEEC 2N9YB 3H1JD 1QVGO 1K05A 3H1HG 2BASA 3TGUD 1IFJA 2D2CD 1WT6A 3L4FA 1FC2C 2IBZI 3GW6A 2R3SA 5AVUB 1YITP 1X9VA 2JO1A 3AE7C 3K5BA 1P84H 3BATA 2K1AA 4JBZA 2KS1B 2W8ZA 1FS0E 2OYIB 5KLVJ 3CCQP 1KN7A 2KSJA 2IFMA 1SQQK 2LXBA 3CWBD 1BCCE 5BVZA 1FOSF 1DIPA 1X79B 5KAFH 5KLIB 1OW8A 2QM8A 3V2NA 3HE5A 1KQLA 3H1IE 2ZYDA 2M8RA 2Y0EA 3L70G 3L72J 3L74J 1JOCA 2ZJSE 3M06A 1FBMA 1SP4A 1RF1C 3L75G 4GDOA 4QMAA 2SPZA 2FYNB 1CSBA 2ZT9D 1HGZA 1N2DC 1CI6A 3U1AA 4YXDC 3C1LA 3G4SP 1VF5B 1BCCG 1SFCB 1M1KQ 2FFDB 1NU1G 4IL6E 1LTTC 3KXDA 4NPEA 1HH0A 3TYYA 3V2PA 2HFED 4JQ0D 1AA0A 1K8AQ 2K9YA 3H1IG 1N7LA 1X8YA 4WVZA 1ZP0C 3FWLA 1USDA 2B87A 4ZKPA 1NKNA 5APTA 2N1TB 1AQTA 2W6AA 3L72D 2G8YA 2O01J 3L74D 2Y9YA 1S9KD 5AVVB 5AW4B 2JWAA 1MKMA 1URQA 1LTJC 1RY3A 4N78E 1YTZT 1KILC 5KKZC 3HUSC 1EZVD 4WWIA 4JYBA 1LTBC 1QX8A 4L73A 1S72P 2W6BA 1QEXA 3GHGA 3B5ND 3L73D 4PV1B 2PP6A 5GTIH 1PP9J 1IO4A 2A06D 2QJPB 1FZCC 1L0NE 1NTKK 1OW6A 1ZN5A 2AXCA 4K35A 3SWFA 2QEXP 1T8ZA 3L36A 4EOTA 2YMKA 3SWKA 5H2FH 5CCGA 4H0LD 2KLUA 1AFOA 3RK3D 1M90Q 4RKUJ 1MFZA 1CZQA 2FYUK 3C8VA 1M8OB 3OA7A 4HKZH 1NYHA 4PD4E 3P8MC 1ZMEC 3LW5J 1GMJA 2M5AA 3O8ZA 2XDJA 1L4AB 3TDKA 3CX5I 4OGQB 3SFDC 4TT3H 3G9RA 5CJ0A 1SQPK 3H1LJ 1EZVI 3V4QA 1JCDA 3A0BE 3GLMA 1NAFA 1HWTC 1LWUA 1BE3J 2OTLP 2XV5A 1L0NG 2K9JA 1L2PA 2HLOA 2XNDH 2CPSA 4M3LA 1KYOD 3AE5C 2R44A 1XTGB 2Y0CA 2NPSC 3I5CA 1NTZG 3BCCE 1HF9A 5B5EH 3KPEA 3A2AA 3CL3D 1T3UA 1D7MA 3RL0B 3IFMA 5CCHA 1JY3N 2WQYC 1MFTA 1DEEG 1VF5D 5KAIE 3AE3C 3RK2B 2W27A 2P1JA 2AXTE 2K37A 1OIPA 1KV4A 2AEMA 1MV8A 3AEAC 1LJ2A 1J1DB 3GF7A 2JJLA 3VYIA 1T3JA 3L71E 2P7JA 3KHUA 1LTAC 1BE3D 2FYNC 1VQLP 1P84E 1IZNB 3LW5H 2HR3A 1LT9B 4MN4C 1Y8AA 2KI7B 3WU2H 3VMAA 1Q90D 2Q6QA 1BSNA 1T6AA 2C0WA 2JEEA 2OTJP 1SFCC 1KC8Q 2OGUA 1KYOI 5KAFE 1FE6A 4ZMDA 1EDIA 3AEBC 1RE3A 1FJKA 2R5DA 1Q86Q 1SQXG 2QIWA 1DH3A 4AQRD 5AVXB 3CC7P 5APQA 1NAYA 2N1TC 2N9BA 1SQQJ 3BASA 3AECC 1HJBA 3ITKA 3L71G 3BVHA 1RF1B 1N8RQ 2WSEH 4N78D 2R5BA 2E76B 1NTME 3MP7B 4WY4A 1YYCA 1J2JB 1NH4A 3BRTB 2IDBA 2K88A 1NU1K 2POHA 3Q3DA 1CW5A 1JY3O 3HRNA 3N7NA 2Q7CA 2I8DA 4U3FJ 2KXPB 2YO2A 2PRRA 3HE5B 2QSIA 1PPJD 1BDDA 4PV1C 1ZOYC 1UIXA 2KNCA 1HJ0A 3B4SA 2H7HA 1L4AD 1N7SB 3AE1C 1JEKA 1H0TA 4OGQD 2YKPA 3BCCJ 1GL2D 2AEFA 1KD1Q 2YNYA 3TK1A 5AW2B 1SQQD 3HD7C 2NZ2A 1G2CB 3Q2YA 1X0TA 1KTMA 2KYVA 3VMYA 1NTMG 4AYCA 3CXHH 1VPCA 3UIAA 2OYHA 2BCCE 4IOIH 5KKZB 3HUSB 4KT0J 1X22A 5AW6B 2E75B 2RMZA 2L91A 1RF0C 1KB9D 2QJYB 3RL0D 3H1HE 1U57A 1M56D 2KK7A 1K04A 4TLFA 1AV1A 1RHZB 3FXEA 2ZXXA 3ABVC 5EFWB 5KLVG 4H44B 4JYCA 5APUA 2CK3H 1SQVG 1LTSC 2KOGA 2O1JA 3BCCD 2Q5UA 1DX7A 3Q5SA 2ZXEB 2H88C 3L37A 1URQB 3M0DC 3PJSK 5CBOA 5B66H 1GK4A 1VQNP 1BGYE 3NXSA 1KZUB 3JCUH 2YMYA 1RE4A 5KJ7C 2BCCG 1Z56A 1HUCA 1GZLA 4Z1MH 4BRYB 5KTBA 2ZAEB 3WUVA 4W7YA 3L74G 1KQGB 3RK2C 1S5LE 1IC2A 3CCJP 2M0BA 1NTKJ 1FZFA 3M0AA 1J1DC 4GODA 2Z4EA 3H1KJ 4H13B 3PH0A 1H89A 3L70E 3V2RA 4KHXA 2YO3A 1L0NK 1N73C 5CHXA 3L75E 1U7MA 1KB9I 2FYUJ 1LT9C 1HBWA 3AE4C 3PRJA 1NWQA 1GU5A 2NPSB 2QE7H 1BGYG 1Q81Q 1FZAA 3AE6C 1BDCA 2PGDA 2WSCH 1NU1E 4DOJA 4XA4A 2M5AB 1SQPJ 1GD2E 4I7ZB 4OVNF 1IK9A 1IFMA 3JC22 2I1KA 3PTZA 3RBXA 1NTKD 2J58A 2LR2A 3GF3A 1K73Q 3AE8C 3H1KD 4W80A 3KQGA 2E5TA 1M1JA 4C7NB 2E76C 1YI2P 4D6TG 3VMZA 3O6QA 4DZOA 1JB0J 2FYUD 2OYOA 5TJHA 3A3YB 3TNUA 4GKGA 1R5LA 5AW8B 3WU2E 4HYTB 1H88A 3BRVB 1LP1B 1KILD 1PP9G
chains in the Genus database with same CATH topology
3TGUG 1NTMG 1BGYG 1KYOH 3H1LG 3L73G 3CXHH 1NTZG 1KB9H 1PPJG 1SQQG 1EZVG 1P84H 3H1IG 3L70G 3L72G 3L74G 3L71G 3H1HG 3BCCG 4U3FG 1SQPG 1BE3G 1BCCG 1SQBG 2A06G 3CWBG 1L0NG 5KLVG 2FYUG 4PD4H 3CX5H 1NTKG 3L75G 1SQXG 3H1JG 1NU1G 2IBZG 2BCCG 1L0LG 1SQVG 3H1KG 4D6TG 1PP9G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TGU G;  1NTM G;  1BGY G;  1KYO H;  3H1L G;  3L73 G;  3CXH H;  1NTZ G;  1KB9 H;  1PPJ G;  1SQQ G;  1EZV G;  1P84 H;  3H1I G;  3L70 G;  3L72 G;  3L74 G;  3L71 G;  3H1H G;  3BCC G;  4U3F G;  1SQP G;  1BE3 G;  1BCC G;  1SQB G;  2A06 G;  3CWB G;  1L0N G;  5KLV G;  2FYU G;  4PD4 H;  3CX5 H;  1NTK G;  3L75 G;  1SQX G;  3H1J G;  1NU1 G;  2IBZ G;  2BCC G;  1L0L G;  1SQV G;  3H1K G;  4D6T G;  1PP9 G; 
#chains in the Genus database with same CATH topology
 3M9Q A;  3T97 A;  1OVV A;  3L73 J;  1SQP D;  5CJ4 A;  1VDF A;  2BEZ F;  1OVU A;  2AEJ A;  3KZI E;  3MTU E;  3MUD A;  1OMI A;  1N7S C;  5E79 H;  1EC5 A;  1JTH A;  2P67 A;  3HE4 B;  3S9O A;  3M91 A;  1GTW A;  2GUV A;  4AUW A;  2PAJ A;  2KIK A;  1WRG A;  1ZRT D;  3CX5 D;  3G71 P;  2YXQ B;  1T2K C;  3CC2 P;  3RGU A;  1YJW P;  1EXI A;  1KOR A;  2YIU C;  1NJI Q;  2WT7 A;  3RBZ A;  2HOD B;  3H1H D;  3H1L G;  2E75 C;  5K5G B;  3G6E P;  1FZE A;  2QJY C;  1PFI A;  2V7Q J;  2RKL A;  2O3J A;  4IFF A;  3EWK A;  1QGK B;  5AVZ B;  3C9I A;  3H32 A;  1IFN A;  3L75 J;  3W68 A;  1SVF A;  4ASW A;  3OAK A;  3I55 P;  2A45 I;  3U59 A;  4H44 C;  1YJ9 P;  2E74 B;  2R32 A;  3KDP B;  3B5N A;  4NPD A;  1URQ C;  3CCR P;  1BCC J;  1NTM K;  3HD7 B;  3M9B A;  1NTZ E;  2Z5H A;  2OQQ A;  4YPC A;  1AVO A;  2GA1 A;  3CXH E;  5CBN A;  1ZXG A;  1OZH A;  3U1C A;  5DJT B;  1PGJ A;  3VOP A;  2MJZ A;  2NPS D;  3H1I J;  5AVW B;  3GHG C;  1OVR A;  1SQB G;  2JWD A;  2KS1 A;  2O01 H;  2OYI A;  4WB4 A;  1W2E A;  1NHL A;  3L70 D;  1JMB A;  1A02 F;  2LKM A;  2KNC B;  4W7Z A;  5KLV K;  4H13 C;  2XZR A;  2GUS A;  3L75 D;  3CD6 P;  1ZV8 A;  1SQV K;  2B88 A;  2IBZ E;  2RN0 A;  4ZNC A;  2JDI H;  2KLV A;  2ZVN B;  5GTH E;  3D6Y A;  2BEQ D;  3EFF K;  1KFM A;  1HTL C;  5CCG C;  1L0L G;  4A7P A;  1FAV A;  3A5T A;  1BCC D;  2OYH B;  4R4L A;  3LIE A;  1NU1 D;  2VRS A;  5B66 E;  2IYP A;  2OAR A;  3JCU E;  4LC1 A;  2FXM A;  3ZDM A;  1MZ9 A;  2P58 A;  4L76 A;  4I7Z C;  3H1I D;  3VTP C;  1MUU A;  1KYO H;  2WPS A;  5APS A;  1ZW0 A;  1ZR2 A;  1SFC D;  3HTK A;  4HJG H;  3D70 A;  1SQX E;  4OH8 B;  2W6J H;  2XU6 A;  1QLE D;  1SFC A;  2IBZ G;  2FFD A;  3CCS P;  1N73 B;  5AVQ B;  5APX A;  4UB8 H;  3H1J E;  2N1T D;  2KB7 P;  4U3F G;  4C7R A;  3TGU E;  5AW1 B;  1JUN A;  2W83 C;  3R4Y A;  2UWJ E;  2ZFC A;  4EIJ A;  5AW7 B;  5CCH C;  2N1T A;  1WMK A;  1YJN P;  4GT1 A;  1NKZ B;  4ZKU A;  3CCE P;  1VQM P;  2RH0 A;  1L0N J;  1FJP A;  1GU4 A;  3S1K A;  3II6 A;  2YXR B;  2M3E A;  4Y99 C;  4PV1 D;  3CMA P;  5CMZ A;  3CWB E;  2D2C B;  2QVA A;  3CC4 P;  1NOH A;  3CLQ A;  3FX0 A;  1NGM B;  3WMM 0;  3AEF C;  1OXZ A;  3H1J G;  3PP5 A;  1NVO A;  2Z5I A;  2YKO A;  4DCK A;  3TGU G;  3HD7 D;  4RES B;  4L75 A;  2DW3 A;  1S4X A;  1J1E B;  1DEB A;  2XKM A;  3AEG C;  1KQF B;  1FZB A;  3EFG A;  1L0N D;  1FU1 A;  1QL1 A;  5KLV E;  2IZ1 A;  1OFC X;  2E74 C;  1JY2 P;  1SQV E;  3P8C E;  3CWB G;  5E79 E;  3CCL P;  2MKV A;  4IFD K;  4WY4 C;  1TU3 F;  2KUB A;  3O6Q B;  1EQ7 A;  3CXH D;  1L4A A;  2C9L Y;  3FXD A;  1W5C E;  5AW0 B;  2O1K A;  1CI6 B;  3V2Q A;  1GL2 A;  1AVY A;  4BXL A;  1DD3 A;  4PD4 D;  2ZT9 B;  5C39 A;  1GK6 A;  2YIU B;  1FZG A;  1JCC A;  4EYY Q;  3T97 B;  3H1K G;  1IFP A;  3L72 E;  4GOE A;  3L74 E;  1RQV A;  2YKQ A;  5KJ7 D;  1S9K E;  1KMI Z;  4DJG A;  1ZLL A;  2WPR A;  3V6I A;  3L71 J;  2B87 B;  2JKV A;  4EI2 A;  1VQ6 P;  3B8E B;  2XNX A;  1JTH B;  1AJY A;  3RK2 D;  1H8A A;  4YTP C;  2L5G B;  3EQ2 A;  2QRX A;  5GTI E;  2WVR A;  4CPG A;  1EXJ A;  1KB9 H;  1N86 A;  3IF4 A;  2Y0D A;  3A0B H;  2OYH C;  3WUU A;  1E5W A;  3KYQ A;  5H2F E;  2WT7 B;  3Q5P A;  1SS1 A;  1IK7 A;  1SQB K;  2A06 E;  3GHG B;  1VQ7 P;  1LGH B;  3CXH I;  3H32 B;  3L72 G;  1EDL A;  1LT9 A;  2I1J A;  1UII A;  3JSV C;  1KQS O;  4B86 A;  2Q3E A;  3IAO A;  3L71 D;  4PD4 I;  3RK3 E;  3VP9 A;  1NTM J;  1SLQ A;  2FXO A;  2PFX A;  1M7L A;  3IR9 A;  1P84 D;  3L35 A;  1EZV G;  1A02 J;  1YHQ P;  2WMM A;  1L0L K;  2AXT H;  4HH2 A;  1OWA A;  4D6T E;  1NTZ K;  1RE4 C;  2R3C A;  3L73 G;  2E76 D;  5B5E E;  1EDK A;  1KFN A;  5APV A;  4H0L B;  3E7K A;  3RK3 B;  4L74 A;  4IFM A;  2A06 G;  1RF1 A;  2FKW B;  5TIS H;  1PP9 E;  3CPW O;  1JM0 A;  3CME P;  3VN0 A;  1SQV J;  1PGP A;  1Y47 A;  1KYO E;  4ASV A;  1IJD B;  2WSF J;  2D2C C;  1LWU B;  3Q1M A;  2HPC A;  3GG2 A;  1FDI A;  2K9J B;  2E43 A;  3PLN A;  1NTM D;  4PJ0 H;  1YTZ I;  1LT1 A;  1N7S D;  1Q7Y Q;  2BCC J;  2IFN A;  1QL2 A;  3P7K A;  1PGO A;  3OJA B;  2WSS H;  3TSI A;  4UB8 E;  1YQ4 C;  5APW A;  2J5U A;  4IL6 X;  1R8E A;  1N7S A;  1S3J A;  2J59 M;  3MHV A;  2IZ0 A;  3H1H J;  2QJK B;  1P84 I;  3CI9 A;  3H1L E;  1J1E C;  2QM7 A;  1T2K D;  1ZR4 A;  1G2C A;  2FYZ A;  1DD4 A;  1JMM A;  3HTK B;  1BE3 E;  5KLV D;  4I1L A;  1SQX K;  2E75 D;  1SQV D;  1LTJ A;  3P8C D;  1KIL A;  2A45 H;  3HUS A;  2C0X A;  1AQ5 A;  3A7O A;  2B9B A;  1IFD A;  1M1J C;  4Y99 B;  4HB1 A;  5AVR B;  5AVY B;  5AW9 B;  1BGY J;  4NPF X;  4EDF A;  4H44 D;  3NTN A;  2QG4 A;  2BCC D;  3RL0 g;  1FDM A;  2CPB A;  1Q2N A;  1URQ D;  2ZT9 C;  5M1B A;  2Q9I A;  4R4M A;  1YBK A;  2WSF H;  3QWO C;  4JF7 A;  4UB6 H;  1FZC A;  1PIX A;  1SQB E;  3NMD A;  1Y9B A;  3L70 J;  1VL2 A;  3MUD C;  1GW4 A;  1BE3 G;  2P10 A;  3FGA D;  3CX5 H;  3MGN A;  3F89 A;  3A0H H;  1VQ8 P;  4KJM A;  4D6T J;  2ITA A;  1FDO A;  1W2B O;  4BRY A;  4C46 A;  2JP3 A;  4H13 D;  1L0L E;  2E42 A;  4WY4 B;  2FBW C;  1BGY D;  3VP8 A;  1PPJ E;  1NU1 J;  3V4W A;  2WPQ A;  2P2U A;  5CCG D;  1M57 D;  1FOS E;  1JY2 N;  5DJU B;  5AVT B;  4XFJ A;  2OTK E;  1VQP P;  2IPP A;  4LGD E;  1R5S A;  2WWW A;  2G3A A;  3QH9 A;  2V4H A;  3MIW A;  1SQQ E;  3S4R A;  2Q3I A;  3G3Z A;  2NPS A;  1YIJ P;  3IN6 A;  1H0T B;  3F5H A;  3B5N C;  4XE5 B;  4D6T D;  1S5L H;  1BSH A;  4Y28 J;  1NO4 A;  2V7Q H;  1GL2 B;  1KB9 E;  4U3F E;  1PPJ G;  1OW7 A;  3M9H A;  1XTC C;  1PP9 D;  2Y9Z A;  4H0L C;  2HG5 D;  1U7J A;  3RK3 C;  1S1C X;  2OYI C;  1RH5 B;  3WUT A;  2QA4 P;  2IX7 C;  4C7N A;  4O9B A;  5CCH D;  1SQQ G;  1VQ5 P;  5L8R J;  4OWF A;  3AE9 C;  1LWU C;  5KLI C;  3OW2 O;  5APY A;  2WSE J;  2KZI A;  1LP1 A;  4BWN A;  2KSE A;  2H89 C;  4U7J A;  3R2P A;  3VMX A;  1RQU A;  1SQB J;  3H1L D;  3E1R A;  1JY2 O;  3V5B A;  2QJK C;  1GDT A;  3HE4 A;  2WTY A;  3B71 A;  1HVV A;  2KP8 A;  3BCC G;  1VQO P;  5TIS E;  4RJT A;  3Q5R A;  2ZVO B;  1VF5 C;  1LTI C;  2FXP A;  1EDJ A;  1L0L J;  4I6M C;  4IL6 H;  3TF5 A;  4WBA A;  1GW3 A;  2FFD C;  2WPV B;  4DT0 A;  1QVF O;  2O01 N;  2HOD A;  1NTZ J;  5AVS B;  4K3A A;  3KZI H;  2HYN A;  5AW3 B;  1OX3 A;  2E74 D;  4PJ0 E;  4RO0 A;  2C9N Y;  4WY4 D;  2W90 A;  1Q82 Q;  2B89 A;  1SQB D;  5AW5 B;  1NTK E;  3H25 A;  3E1I A;  1PV3 A;  5BU5 A;  3CCM P;  3H1K E;  5BU8 B;  1RE3 C;  3HD7 A;  2Q1K A;  1IFI A;  4GOF A;  1G1I A;  1YQ3 C;  4YXW H;  2FYU E;  2HPC B;  4N6J A;  1L0L D;  2WIT A;  4GIF A;  3W67 A;  2GM4 A;  3I56 P;  1LTG C;  1M1J B;  1NTZ D;  3USS A;  3AED C;  2H8P D;  1KIL E;  1RF0 A;  2WZ7 A;  1SQP E;  3TNU B;  1VQ4 P;  1VQ9 P;  2NRG A;  3D71 A;  2QJP C;  3FWN A;  3CCU P;  4N3Y B;  2M3B A;  2IYO A;  1JO5 A;  1NTK G;  1E79 H;  1SQX J;  3SFE C;  1G1J A;  2FY8 A;  4UB6 E;  3M0D A;  1LTJ B;  4I2L C;  2E5Y A;  2IBZ D;  3SWY A;  1KIL B;  2KZJ A;  1ZRT E;  3CX5 E;  2FYU G;  4PD4 H;  3A0H E;  3H1J J;  3H6P A;  5KJ7 A;  2H43 A;  1EZV E;  2A45 G;  3TGU J;  1L4A C;  1HGV A;  4U3F D;  4OGQ C;  1GL2 C;  1SQP G;  3GMA A;  5GTH H;  3P32 A;  2LXC B;  2WSC J;  3L73 E;  3CCV P;  1FZC B;  1S5L X;  4LLH A;  1PZQ A;  1USE A;  1VQK P;  1N73 A;  2K3R A;  3MD0 A;  1JNM A;  3D6Z A;  3N4X A;  1JY3 P;  1S2E A;  2ZYA A;  1SQX D;  1LNQ A;  2JR8 A;  3CWB J;  3LID A;  3MZW B;  4JPZ B;  3PHL A;  3NFQ A;  1PL5 A;  1PGQ A;  3SSU A;  3AE2 C;  3RL0 C;  2ZYG A;  1K9M Q;  3B5N B;  5KAI H;  3AEE C;  2N9Y B;  3H1J D;  1QVG O;  1K05 A;  3H1H G;  2BAS A;  3TGU D;  1IFJ A;  2D2C D;  1WT6 A;  3L4F A;  1FC2 C;  2IBZ I;  3GW6 A;  2R3S A;  5AVU B;  1YIT P;  1X9V A;  2JO1 A;  3AE7 C;  3K5B A;  1P84 H;  3BAT A;  2K1A A;  4JBZ A;  2KS1 B;  2W8Z A;  1FS0 E;  2OYI B;  5KLV J;  3CCQ P;  1KN7 A;  2KSJ A;  2IFM A;  1SQQ K;  2LXB A;  3CWB D;  1BCC E;  5BVZ A;  1FOS F;  1DIP A;  1X79 B;  5KAF H;  5KLI B;  1OW8 A;  2QM8 A;  3V2N A;  3HE5 A;  1KQL A;  3H1I E;  2ZYD A;  2M8R A;  2Y0E A;  3L70 G;  3L72 J;  3L74 J;  1JOC A;  2ZJS E;  3M06 A;  1FBM A;  1SP4 A;  1RF1 C;  3L75 G;  4GDO A;  4QMA A;  2SPZ A;  2FYN B;  1CSB A;  2ZT9 D;  1HGZ A;  1N2D C;  1CI6 A;  3U1A A;  4YXD C;  3C1L A;  3G4S P;  1VF5 B;  1BCC G;  1SFC B;  1M1K Q;  2FFD B;  1NU1 G;  4IL6 E;  1LTT C;  3KXD A;  4NPE A;  1HH0 A;  3TYY A;  3V2P A;  2HFE D;  4JQ0 D;  1AA0 A;  1K8A Q;  2K9Y A;  3H1I G;  1N7L A;  1X8Y A;  4WVZ A;  1ZP0 C;  3FWL A;  1USD A;  2B87 A;  4ZKP A;  1NKN A;  5APT A;  2N1T B;  1AQT A;  2W6A A;  3L72 D;  2G8Y A;  2O01 J;  3L74 D;  2Y9Y A;  1S9K D;  5AVV B;  5AW4 B;  2JWA A;  1MKM A;  1URQ A;  1LTJ C;  1RY3 A;  4N78 E;  1YTZ T;  1KIL C;  5KKZ C;  3HUS C;  1EZV D;  4WWI A;  4JYB A;  1LTB C;  1QX8 A;  4L73 A;  1S72 P;  2W6B A;  1QEX A;  3GHG A;  3B5N D;  3L73 D;  4PV1 B;  2PP6 A;  5GTI H;  1PP9 J;  1IO4 A;  2A06 D;  2QJP B;  1FZC C;  1L0N E;  1NTK K;  1OW6 A;  1ZN5 A;  2AXC A;  4K35 A;  3SWF A;  2QEX P;  1T8Z A;  3L36 A;  4EOT A;  2YMK A;  3SWK A;  5H2F H;  5CCG A;  4H0L D;  2KLU A;  1AFO A;  3RK3 D;  1M90 Q;  4RKU J;  1MFZ A;  1CZQ A;  2FYU K;  3C8V A;  1M8O B;  3OA7 A;  4HKZ H;  1NYH A;  4PD4 E;  3P8M C;  1ZME C;  3LW5 J;  1GMJ A;  2M5A A;  3O8Z A;  2XDJ A;  1L4A B;  3TDK A;  3CX5 I;  4OGQ B;  3SFD C;  4TT3 H;  3G9R A;  5CJ0 A;  1SQP K;  3H1L J;  1EZV I;  3V4Q A;  1JCD A;  3A0B E;  3GLM A;  1NAF A;  1HWT C;  1LWU A;  1BE3 J;  2OTL P;  2XV5 A;  1L0N G;  2K9J A;  1L2P A;  2HLO A;  2XND H;  2CPS A;  4M3L A;  1KYO D;  3AE5 C;  2R44 A;  1XTG B;  2Y0C A;  2NPS C;  3I5C A;  1NTZ G;  3BCC E;  1HF9 A;  5B5E H;  3KPE A;  3A2A A;  3CL3 D;  1T3U A;  1D7M A;  3RL0 B;  3IFM A;  5CCH A;  1JY3 N;  2WQY C;  1MFT A;  1DEE G;  1VF5 D;  5KAI E;  3AE3 C;  3RK2 B;  2W27 A;  2P1J A;  2AXT E;  2K37 A;  1OIP A;  1KV4 A;  2AEM A;  1MV8 A;  3AEA C;  1LJ2 A;  1J1D B;  3GF7 A;  2JJL A;  3VYI A;  1T3J A;  3L71 E;  2P7J A;  3KHU A;  1LTA C;  1BE3 D;  2FYN C;  1VQL P;  1P84 E;  1IZN B;  3LW5 H;  2HR3 A;  1LT9 B;  4MN4 C;  1Y8A A;  2KI7 B;  3WU2 H;  3VMA A;  1Q90 D;  2Q6Q A;  1BSN A;  1T6A A;  2C0W A;  2JEE A;  2OTJ P;  1SFC C;  1KC8 Q;  2OGU A;  1KYO I;  5KAF E;  1FE6 A;  4ZMD A;  1EDI A;  3AEB C;  1RE3 A;  1FJK A;  2R5D A;  1Q86 Q;  1SQX G;  2QIW A;  1DH3 A;  4AQR D;  5AVX B;  3CC7 P;  5APQ A;  1NAY A;  2N1T C;  2N9B A;  1SQQ J;  3BAS A;  3AEC C;  1HJB A;  3ITK A;  3L71 G;  3BVH A;  1RF1 B;  1N8R Q;  2WSE H;  4N78 D;  2R5B A;  2E76 B;  1NTM E;  3MP7 B;  4WY4 A;  1YYC A;  1J2J B;  1NH4 A;  3BRT B;  2IDB A;  2K88 A;  1NU1 K;  2POH A;  3Q3D A;  1CW5 A;  1JY3 O;  3HRN A;  3N7N A;  2Q7C A;  2I8D A;  4U3F J;  2KXP B;  2YO2 A;  2PRR A;  3HE5 B;  2QSI A;  1PPJ D;  1BDD A;  4PV1 C;  1ZOY C;  1UIX A;  2KNC A;  1HJ0 A;  3B4S A;  2H7H A;  1L4A D;  1N7S B;  3AE1 C;  1JEK A;  1H0T A;  4OGQ D;  2YKP A;  3BCC J;  1GL2 D;  2AEF A;  1KD1 Q;  2YNY A;  3TK1 A;  5AW2 B;  1SQQ D;  3HD7 C;  2NZ2 A;  1G2C B;  3Q2Y A;  1X0T A;  1KTM A;  2KYV A;  3VMY A;  1NTM G;  4AYC A;  3CXH H;  1VPC A;  3UIA A;  2OYH A;  2BCC E;  4IOI H;  5KKZ B;  3HUS B;  4KT0 J;  1X22 A;  5AW6 B;  2E75 B;  2RMZ A;  2L91 A;  1RF0 C;  1KB9 D;  2QJY B;  3RL0 D;  3H1H E;  1U57 A;  1M56 D;  2KK7 A;  1K04 A;  4TLF A;  1AV1 A;  1RHZ B;  3FXE A;  2ZXX A;  3ABV C;  5EFW B;  5KLV G;  4H44 B;  4JYC A;  5APU A;  2CK3 H;  1SQV G;  1LTS C;  2KOG A;  2O1J A;  3BCC D;  2Q5U A;  1DX7 A;  3Q5S A;  2ZXE B;  2H88 C;  3L37 A;  1URQ B;  3M0D C;  3PJS K;  5CBO A;  5B66 H;  1GK4 A;  1VQN P;  1BGY E;  3NXS A;  1KZU B;  3JCU H;  2YMY A;  1RE4 A;  5KJ7 C;  2BCC G;  1Z56 A;  1HUC A;  1GZL A;  4Z1M H;  4BRY B;  5KTB A;  2ZAE B;  3WUV A;  4W7Y A;  3L74 G;  1KQG B;  3RK2 C;  1S5L E;  1IC2 A;  3CCJ P;  2M0B A;  1NTK J;  1FZF A;  3M0A A;  1J1D C;  4GOD A;  2Z4E A;  3H1K J;  4H13 B;  3PH0 A;  1H89 A;  3L70 E;  3V2R A;  4KHX A;  2YO3 A;  1L0N K;  1N73 C;  5CHX A;  3L75 E;  1U7M A;  1KB9 I;  2FYU J;  1LT9 C;  1HBW A;  3AE4 C;  3PRJ A;  1NWQ A;  1GU5 A;  2NPS B;  2QE7 H;  1BGY G;  1Q81 Q;  1FZA A;  3AE6 C;  1BDC A;  2PGD A;  2WSC H;  1NU1 E;  4DOJ A;  4XA4 A;  2M5A B;  1SQP J;  1GD2 E;  4I7Z B;  4OVN F;  1IK9 A;  1IFM A;  3JC2 2;  2I1K A;  3PTZ A;  3RBX A;  1NTK D;  2J58 A;  2LR2 A;  3GF3 A;  1K73 Q;  3AE8 C;  3H1K D;  4W80 A;  3KQG A;  2E5T A;  1M1J A;  4C7N B;  2E76 C;  1YI2 P;  4D6T G;  3VMZ A;  3O6Q A;  4DZO A;  1JB0 J;  2FYU D;  2OYO A;  5TJH A;  3A3Y B;  3TNU A;  4GKG A;  1R5L A;  5AW8 B;  3WU2 E;  4HYT B;  1H88 A;  3BRV B;  1LP1 B;  1KIL D;  1PP9 G; 
#chains in the Genus database with same CATH homology
 3TGU G;  1NTM G;  1BGY G;  1KYO H;  3H1L G;  3L73 G;  3CXH H;  1NTZ G;  1KB9 H;  1PPJ G;  1SQQ G;  1EZV G;  1P84 H;  3H1I G;  3L70 G;  3L72 G;  3L74 G;  3L71 G;  3H1H G;  3BCC G;  4U3F G;  1SQP G;  1BE3 G;  1BCC G;  1SQB G;  2A06 G;  3CWB G;  1L0N G;  5KLV G;  2FYU G;  4PD4 H;  3CX5 H;  1NTK G;  3L75 G;  1SQX G;  3H1J G;  1NU1 G;  2IBZ G;  2BCC G;  1L0L G;  1SQV G;  3H1K G;  4D6T G;  1PP9 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...