2Z4EA

Crystal structure of d-dimer from human fibrin complexed with gly-his-arg-pro-tyr-amide
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
67
structure length
67
Chain Sequence
VIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibrinogen alpha chain
publication title Probing the beta-chain hole of fibrinogen with synthetic peptides that differ at their amino termini
pubmed doi rcsb
molecule tags Blood clotting
total genus 22
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2z4eA00
2HODB 3GHGB 1N73A 1FZCB 1LWUC 1T3UA 1M1JA 3H32A 3HUSC 1RF0A 1RE3A 1JY2O 1JY3O 2FFDC 2OYIB 2FFDB 1RE4A 2OYHB 1LTJB 1FZCC 1LWUA 3GHGC 3HUSA 1LT9B 1RF1B 2XNXA 2OYIC 1JY2P 1FZBA 2A45I 3BVHA 2HPCA 2HODA 3GHGA 1FZCA 1JY3P 1W2EA 1LTJC 1FZGA 2OYHC 1FZEA 1LT9C 2OYIA 2Z4EA 1RF1C 2FFDA 2Q9IA 1JY2N 1JY3N 2OYHA 1N73B 3E1IA 1LTJA 2A45G 3H32B 1M1JB 1LT9A 1FZFA 1RF1A 2A45H 1N86A 1FZAA 1N73C 1LWUB 1M1JC 2HLOA 3HUSB 2H43A 1RF0C 1RE3C 2HPCB 1RE4C
chains in the Genus database with same CATH superfamily
1T3UA 1NKZB 3H1LE 1PGQA 3Q1MA 2G8YA 5M1BA 4PD4E 1FZCC 5KJ7D 2JO1A 2M8RA 1KILD 1AVYA 1SQQE 2FYUE 2ZVOB 1FS0E 5GTIE 3KHUA 1FDMA 1NTKJ 3AE8C 1S5LX 4YPCA 5CBOA 3CWBE 1PGOA 2OTLP 3FWLA 1IK9A 2WPRA 3V4WA 3R2PA 1JY3P 1EC5A 1GZLA 1LP1B 2KYVA 1WMKA 4PJ0H 2K9YA 4BRYA 1RE3C 3IN6A 3SWYA 4IFDK 3VP8A 3CXHE 3AE4C 5AW5B 1VQOP 1N8RQ 1FZBA 1SQPE 4L76A 3MHVA 1X8YA 2CPSA 3M91A 3Q2YA 2ZFCA 4WY4B 1VQNP 3PJSK 1RF0C 1D7MA 1GTWA 1BE3E 5APUA 2ZVNB 2QJYB 4PV1B 4DOJA 4PD4D 2KSEA 1HGVA 1L2PA 1P84I 1SQQD 3H1HJ 2FYUD 1T2KC 1FBMA 1CI6A 4JYCA 1JY2O 2E74D 3T97B 1DD4A 3E1RA 3CWBD 1GL2D 1JEKA 1JOCA 1ZN5A 2R44A 1JY2N 1PPJD 1X0TA 1NU1G 1NTZK 5CCGD 3A3YB 1KORA 2MKVA 1PP9G 1X22A 4EYYQ 2JKVA 1L0LG 3P8MC 1SQPD 5AVYB 1Y47A 1S5LH 1SFCA 2ITAA 4H44D 2QSIA 3B5ND 1VF5D 1GMJA 3N4XA 1KILA 1BE3D 4JPZB 2Q3IA 3CX5E 3RK3D 4UB6E 3Q5PA 3E1IA 1JTHB 2E42A 2P1JA 1N73C 1KZUB 1MZ9A 2E76B 1MV8A 1M7LA 2J59M 3MD0A 1BCCJ 5BVZA 2IZ1A 3M9HA 1JO5A 1PPJG 3MGNA 2HG5D 1M1JB 4NPFX 1E79H 1KTMA 3L74D 3RL0C 4ZNCA 1KYOH 1LJ2A 1KQGB 1OIPA 2H88C 3A2AA 2Q7CA 3AE9C 1YI2P 1PZQA 2N1TB 2J58A 1BSNA 5KAFE 3RBZA 1MKMA 1ZRTD 3V4QA 3TGUJ 2E43A 2A06E 1L4AB 4PV1D 1VL2A 2KLUA 2YXQB 1FZCA 3CCRP 1EZVD 2P7JA 1S2EA 1SQVE 4XE5B 3V5BA 3D70A 1SQXD 1LGHB 3CX5D 1U7JA 3L72D 3L73E 1Q2NA 2B87A 3JCUE 1N2DC 4YXDC 1GL2A 2O01N 4H0LC 2HFED 5CCHA 4Y28J 3M0DC 2FBWC 1OW8A 2FFDC 2HPCA 1GW4A 1MFZA 1NVOA 2RH0A 2Q6QA 1NHLA 2KS1A 2KSJA 1GK4A 1IC2A 1IFMA 3O8ZA 1KYOI 1YITP 5KKZC 2M0BA 1AVOA 2PGDA 3H1JJ 3L35A 3L75G 3VN0A 3B5NA 4BRYB 2ZYAA 1G1IA 2CPBA 3HD7C 2IDBA 2FYNC 1DH3A 3AEAC 1KN7A 1K9MQ 2A06D 2WITA 1NTKG 4UB8H 4H13C 1EZVG 4JBZA 3G4SP 2XV5A 1FZEA 1SQVD 1H89A 1BGYE 2FXPA 2E76D 3EQ2A 2QJPB 1L0NE 1FU1A 2DW3A 3H1ID 5TISH 3TDKA 3P8CE 1QGKB 2OYIC 4XA4A 3WMM0 3KZIH 1LT9C 3II6A 3MUDC 1CI6B 3N7NA 3PH0A 3L70D 2WQYC 1XTGB 2LKMA 1OVUA 3A0HH 1FE6A 3Q5SA 2WWWA 3H1KE 4D6TE 1JCCA 2ZT9C 1QL2A 5AVTB 3G3ZA 1VQ8P 3IF4A 2N1TD 1T8ZA 1LTJA 1FJKA 3VMXA 5APTA 4DJGA 3RL0g 1HF9A 1SQBE 5AVWB 3H1HG 1SFCB 3CCJP 3LIDA 2KXPB 4A7PA 3EWKA 3BCCJ 1BSHA 1OXZA 3AECC 3FXEA 3WU2E 1HUCA 1KILB 3CL3D 1BGYD 3U1AA 2WSSH 4LC1A 1NTMD 3PP5A 3P8CD 3AE6C 1Q86Q 1YJWP 2Q9IA 2RN0A 2ZXEB 4W7YA 3ABVC 2NZ2A 1NOHA 3NTNA 3WUVA 3F89A 1K73Q 3SWKA 3PHLA 1G2CA 5KLIB 3H1KD 4D6TD 2OYHC 5H2FE 5B66E 1XTCC 3VYIA 2PFXA 3V2RA 1N86A 2GA1A 1VPCA 2QRXA 2AEFA 3PTZA 3A5TA 1VQLP 3CXHH 3SWFA 4C46A 3BRTB 2CK3H 1VQ7P 1KILE 3RGUA 4ZKUA 5KJ7C 5GTHE 2C9NY 2NPSA 1SLQA 1BCCG 4PD4I 1FZCB 1MFTA 3P32A 1LWUA 3EFGA 2B87B 1JY2P 2KI7B 1K04A 1GL2B 3SFEC 2P58A 1J1DC 3QWOC 1NU1E 3BATA 4Y99C 2LR2A 4OGQB 3RK2C 3V2NA 4IL6X 2H8PD 2YO2A 4OWFA 2HPCB 2R3SA 1PP9E 1PGPA 2K1AA 1JMMA 2KS1B 2IBZD 3KPEA 2Z5IA 3FXDA 3TGUG 3CCSP 2WPVB 1SQQK 4H44B 3CXHI 5AW0B 2IPPA 3B5NB 1JM0A 1T6AA 1Q90D 4I6MC 1SFCD 3D71A 2Q3EA 2WPQA 3RK3B 4U3FJ 3KDPB 4DZOA 1P84H 5L8RJ 1URQD 2WMMA 4JQ0D 1OW6A 1QX8A 1NTZJ 1USDA 1IFNA 2LXBA 2E74C 1VQ5P 1H88A 1DX7A 1PPJE 1SQPK 1YIJP 2KB7P 1LT9A 3H1JG 2W90A 4K35A 1PIXA 3L37A 1GD2E 1JCDA 1NU1D 1E5WA 2AEJA 1OFCX 3GLMA 1NO4A 2E5YA 4TT3H 3SSUA 5CCGC 1LTBC 1PP9D 4HH2A 2IBZG 3CI9A 1J1EB 1S9KE 1L0LD 4C7NA 2ZAEB 2XU6A 1OMIA 4ZKPA 1EDLA 2ZXXA 3HTKA 1M56D 5APXA 2E75B 3RBXA 1VF5C 1LTJB 3RK3E 2HODA 1HVVA 4IL6H 1S1CX 4AYCA 1FDIA 4OVNF 1JB0J 4YXWH 4BWNA 1HH0A 4JF7A 1CZQA 3CCVP 2KIKA 3AE3C 3CX5I 2FXMA 4R4MA 4GKGA 2WPSA 2FY8A 5CCHD 3CMEP 4OGQD 2YKPA 1U7MA 3HE4A 1VQ4P 3L74E 3JCUH 5BU5A 1LTAC 3TSIA 3HE5A 3L75E 1FZGA 3CC2P 1AV1A 4EI2A 1S9KD 3VMZA 2YO3A 1LTSC 5B5EE 2H7HA 4WY4C 1EDKA 1ZRTE 1Q81Q 1G2CB 3RL0B 3BCCG 1WRGA 2W6AA 1JNMA 4KHXA 1M90Q 2NRGA 2PP6A 5AW7B 1NTKE 1EZVE 1GK6A 1SQXE 3L72E 1URQA 1VDFA 5DJTB 2QM7A 3AEBC 2QIWA 5KLVJ 1EQ7A 1K05A 1GDTA 3H1LG 1RE4A 2D2CB 3HUSA 2L91A 1M8OB 2O1JA 1LTIC 2NPSB 1W2BO 1A02J 2JWAA 2KLVA 1LWUB 5AW9B 1IZNB 1U57A 1LTTC 5APYA 3KYQA 2M3EA 1JY3O 1X9VA 1N7SC 1L0NJ 3L75D 1NGMB 1JY3N 3OA7A 5KKZB 3L71J 1KB9D 2Y0EA 2E75D 3C1LA 2FXOA 2R5DA 3GHGC 2YIUC 2KP8A 2OTKE 1NTKD 3W68A 1NTZD 2FYNB 3O6QA 3NFQA 2MJZA 4WWIA 1BDCA 5AVQB 3H1IE 4H13B 2PAJA 3CC7P 2UWJE 3AE1C 3AEEC 4GIFA 2A45I 2O1KA 4RO0A 3WU2H 3L70E 4NPEA 5KLVK 1IK7A 1K8AQ 4GODA 1M1JC 2YKQA 1EXJA 5C39A 1RE3A 3W67A 1QVGO 2C0WA 1LT9B 3JC22 1HBWA 2M5AA 4M3LA 3AE7C 1J2JB 2WVRA 3RL0D 4AQRD 1R8EA 1AFOA 3H32A 4GOFA 1RF0A 3AEDC 1L0NK 5E79H 4C7NB 3CLQA 3H1HD 1L4AC 2JR8A 4U3FG 3CC4P 4BXLA 3V2PA 2JJLA 3HTKB 1OVRA 4QMAA 2JDIH 2Y0DA 5B66H 2HR3A 1FDOA 1NTZG 1VQKP 3A0BE 1KQLA 2HODB 5EFWB 1YYCA 2BCCJ 2D2CD 3GG2A 1NTME 3IFMA 2ZJSE 2NPSD 3KXDA 1Y8AA 1LNQA 3AEGC 1AJYA 1AQTA 3TNUA 4EDFA 4HYTB 3TK1A 1NYHA 1R5LA 1FOSF 4O9BA 3NXSA 1SQBK 5KAIH 2XNXA 3BVHA 3HE4B 1BDDA 5AW2B 2B88A 3U1CA 1WT6A 3HE5B 2Y9YA 2BEZF 1FAVA 1FJPA 1QLED 2O01H 2KK7A 1IFPA 3HD7D 3D6ZA 1YTZI 2JEEA 3AEFC 2O01J 5APWA 2QJKB 1IJDB 2RMZA 1N73A 1YQ3C 3Q3DA 1BCCD 2IFNA 4H13D 3BRVB 1CW5A 1DD3A 1URQB 2W6BA 2AXTE 3CCLP 1NH4A 1ZR2A 2XDJA 4PD4H 3CD6P 3I56P 1YBKA 3LW5H 1HWTC 3L73G 3H1JE 3H1LJ 5GTIH 2FKWB 3HUSB 3LW5J 1KQSO 1LT1A 4LLHA 1GU5A 1SQQJ 2FYUJ 2IYPA 2Q1KA 1KYOD 2IBZE 1J1DB 1N7SA 1X79B 3RK2B 2Z4EA 1RQVA 2P2UA 3CWBJ 3TGUD 4TLFA 1ZOYC 1NAYA 2GM4A 2N9BA 5AW3B 1OZHA 2HYNA 1JUNA 4GDOA 2R32A 4UB8E 1ZR4A 1LTGC 3GHGA 3Q5RA 1VQMP 2JWDA 5KTBA 3C9IA 5KLVG 4I7ZB 3H25A 5AVRB 3NMDA 4N78E 2GUSA 1KILC 2WT7A 1SQPJ 4GOEA 5APVA 1KMIZ 2LXCB 2OGUA 4W80A 1AA0A 2Q5UA 3O6QB 3M0DA 4WB4A 2FFDA 1BE3J 1OVVA 1KV4A 1M1KQ 3K5BA 1VQ6P 3H1JD 2QG4A 2QA4P 3CCEP 2XNDH 1L0NG 1Y9BA 1CSBA 1FC2C 3L71G 3LIEA 2I1KA 1L0LE 1RF1C 4RESB 2FYUK 3HRNA 4L75A 3BCCE 1NKNA 2V4HA 3VMYA 2M5AB 3P7KA 3HD7A 1NAFA 3VP9A 1HJ0A 3L74J 3CPWO 1VQ9P 4K3AA 2JP3A 1OWAA 2ZYDA 2IFMA 3H32B 1EXIA 4B86A 1S72P 1MUUA 2AEMA 5B5EH 3IR9A 5AVZB 4N78D 1PV3A 1SQBG 4RJTA 3H6PA 3F5HA 2W27A 3E7KA 2WSCH 2K88A 2SPZA 3OJAB 2OYIA 3B4SA 3CX5H 3S1KA 1ZMEC 1RHZB 2W6JH 1GL2C 4UB6H 3OW2O 3MUDA 2WSCJ 4IFFA 1PGJA 1SQXJ 5CCHC 3L72J 2KZJA 4OGQC 5K5GB 1RQUA 1TU3F 3TNUB 1AQ5A 3GMAA 3B71A 3I55P 1QVFO 1YQ4C 3RK2D 3S9OA 4YTPC 1GU4A 1HJBA 2R3CA 4H44C 3BCCD 2YXRB 1Z56A 1NWQA 3B5NC 3PLNA 3USSA 1KB9I 2BCCG 5APQA 1DEEG 3RK3C 2KNCA 2OTJP 2RKLA 5KAFH 2B89A 1H0TA 1EZVI 3ZDMA 3L4FA 4XFJA 3ITKA 3H1LD 1PL5A 2M3BA 2I1JA 3MZWB 1N73B 1ZV8A 4LGDE 2YMKA 1SQVJ 1Q82Q 1IFDA 3L73J 3PRJA 4IOIH 2P10A 3H1IJ 1NTKK 4N6JA 2OYHA 1J1EC 1SQXK 4HB1A 1KB9E 3MP7B 1N7SB 1RY3A 3CCQP 1N7LA 3L70J 3CXHD 2OARA 4U3FE 2E75C 2QJYC 1LTJC 1USEA 4PV1C 1NTZE 1S4XA 5KJ7A 1P84E 1VQPP 1S3JA 2YIUB 3GHGB 2KUBA 3TYYA 4EOTA 3CCMP 1YJ9P 4W7ZA 2WT7B 1SQQG 3AE5C 1T2KD 1A02F 2FYUG 4PJ0E 2A45H 2QVAA 4MN4C 4Z1MH 4H0LB 1IFJA 3VOPA 2K9JA 3QH9A 3A0BH 5AW8B 2N9YB 2FFDB 3CWBG 4DCKA 1BGYJ 1YHQP 2VRSA 2QEXP 2Z5HA 3M06A 1NTMJ 4L73A 5AW1B 1RF1A 1SQVK 4RKUJ 2C0XA 1DIPA 1IFIA 2YNYA 5CHXA 2IX7C 1EDJA 3H1HE 3CCUP 2BEQD 4DT0A 1H8AA 4IL6E 2KOGA 1SQPG 4U3FD 3VTPC 4WY4D 3WUTA 5CJ4A 2H89C 3HD7B 3H1KJ 4D6TJ 1SS1A 3CMAP 1KFNA 3AE2C 5BU8B 1P84D 1JMBA 1BE3G 2E76C 2J5UA 1UIXA 3UIAA 1KFMA 4HJGH 3MIWA 2D2CC 2FYZA 1SQBJ 3GF7A 2NPSC 2XZRA 2Y0CA 2WZ7A 3D6YA 3V2QA 1LWUC 2OYIB 2AXTH 3L36A 5CCGA 1S5LE 2XKMA 1OX3A 2ZYGA 3R4YA 3L74G 3G71P 1N7SD 2N1TC 4CPGA 5TJHA 2W83C 2ZT9B 2WSEH 3WUUA 1NTMK 5KLVE 5CJ0A 4ASVA 4NPDA 2WSEJ 2K37A 5H2FH 5DJUB 3FWNA 1BCCE 4GT1A 2G3AA 5AVUB 1ZXGA 2IYOA 3A7OA 4L74A 2KNCB 1SQXG 2BASA 1ZW0A 3L72G 3C8VA 3GF3A 1H0TB 3L73D 4H0LD 1GW3A 5AVXB 2OQQA 2QE7H 5GTHH 4KJMA 4JYBA 1LP1A 1KYOE 1QEXA 3L71E 5AVVB 1YJNP 1SP4A 3B8EB 1KC8Q 1IO4A 3VMAA 5AW4B 2P67A 2IZ0A 3TGUE 4WBAA 3TF5A 1M57D 2AXCA 3JSVC 4WY4A 2IBZI 2GUVA 2I8DA 2OYHB 1NU1J 2B9BA 5AVSB 2W8ZA 5APSA 2WSFH 4AUWA 2L5GB 1DEBA 5KLVD 3KQGA 1PP9J 4IFMA 1G1JA 2HLOA 2WSFJ 1L0LJ 1L4AD 2PRRA 2A06G 2QJPC 4ASWA 4HKZH 1RH5B 2KZIA 1SQVG 2OYOA 3T97A 1FZAA 4I2LC 2QM8A 4U7JA 1HGZA 3H1IG 2V7QH 1L0ND 1ZP0C 2C9LY 4EIJA 3L71D 2V7QJ 1OW7A 2K9JB 1KD1Q 2WTYA 4Y99B 1T3JA 4R4LA 3L70G 3G9RA 3MTUE 1ZLLA 2R5BA 2H43A 2ZT9D 1Q7YQ 3SFDC 5E79E 5AW6B 1RF1B 3IAOA 1SFCC 2BCCE 4ZMDA 1NJIQ 3OAKA 1R5SA 1PFIA 1NU1K 5TISE 1JTHA 3M0AA 3BASA 2QJKC 1SQBD 2K3RA 3M9BA 3M9QA 1URQC 3KZIE 1YTZT 3EFFK 1FOSE 1KQFB 2A45G 1L0LK 2YKOA 3G6EP 1BGYG 3A0HE 2E5TA 4I1LA 4KT0J 1RE4C 1M1JA 3HUSC 5KAIE 1NTMG 3I5CA 2E74B 3GW6A 1QL1A 3S4RA 5CMZA 2Y9ZA 5KLIC 1FZFA 4WVZA 2O3JA 3FX0A 4N3YB 1W5CE 4C7RA 2N1TA 3H1KG 4D6TG 1SVFA 2YMYA 4OH8B 1W2EA 1EDIA 5CBNA 1L4AA 1UIIA 2BCCD 4I7ZC 2POHA 3L75J 3FGAD 1KB9H 1HTLC 3V6IA 3U59A 1VF5B
chains in the Genus database with same CATH topology
1T3UA 1NKZB 1RE3A 1RY3A 1N7LA 2OARA 1FZCC 2C0WA 4LC1A 1LT9B 5KJ7D 1HBWA 2M8RA 3PP5A 3P8CD 1LTJC 1KILD 4M3LA 2Q9IA 1J2JB 2ZXEB 3RL0D 4W7YA 1FDMA 5KJ7A 4AQRD 1NOHA 1AFOA 3NTNA 3GHGB 3H32A 1RF0A 1L0NK 3TYYA 1IK9A 4EOTA 4C7NB 3CLQA 1G2CA 2WPRA 3V4WA 1L4AC 3R2PA 3V2PA 2JJLA 2OYHC 1JY3P 3HTKB 4W7ZA 2WT7B 1GZLA 1T2KD 1A02F 1XTCC 3VYIA 1HTLC 3V2RA 2KYVA 2A45H 1N86A 1IFJA 1VPCA 3VOPA 1RE3C 3SWYA 1KQLA 2HODB 3A5TA 4IFDK 3VP8A 1YYCA 5AW8B 2FFDB 5AW5B 3SWFA 4C46A 3BRTB 3IFMA 2NPSD 2VRSA 1FZBA 1X8YA 2Z5HA 2CPSA 3M91A 3TNUA 4ZKUA 2ZFCA 4WY4B 5KJ7C 3M06A 4HYTB 3TK1A 1RF1A 5AW1B 1SQVK 2C0XA 2NPSA 2C9NY 1IFIA 1RF0C 1SLQA 2YNYA 1GTWA 5CHXA 1FOSF 1FZCB 2IX7C 5APUA 3P32A 4O9BA 3NXSA 1LWUA 1SQBK 3EFGA 2XNXA 4DOJA 1JY2P 1H8AA 3BVHA 3HE4B 2KOGA 3VTPC 4WY4D 5AW2B 1GL2B 1HGVA 1J1DC 3U1CA 1WT6A 5CJ4A 3HD7B 3BATA 3HE5B 4Y99C 3RK2C 3V2NA 1T2KC 1KFNA 2H8PD 1FBMA 2YO2A 5BU8B 1CI6A 2HPCB 4JYCA 1FAVA 1JY2O 1FJPA 3UIAA 1GL2D 1JMMA 1KFMA 1JOCA 1ZN5A 3KPEA 3MIWA 2FYZA 2O01H 2Z5IA 3HD7D 1JY2N 2NPSC 2XZRA 1SQQK 1YTZI 2WZ7A 2JEEA 1NTZK 5AW0B 5APWA 1IJDB 5CCGD 3A3YB 2IPPA 3B5NB 1N73A 2IFNA 3V2QA 1LWUC 3BRVB 4I6MC 1CW5A 1SFCD 2OYIB 1URQB 2W6BA 1NH4A 1ZR2A 2XDJA 2WPQA 3L36A 5CCGA 3LW5H 3P8MC 5AVYB 1HWTC 3RK3B 1SFCA 2XKMA 3KDPB 2FKWB 3B5ND 3HUSB 1N7SD 4LLHA 4DZOA 2N1TC 1GU5A 3N4XA 1URQD 1KILA 2WSEH 1IFNA 1J1DB 2Q3IA 1N7SA 1NTMK 1X79B 1H88A 3RK3D 1DX7A 5CJ0A 3RK2B 2Z4EA 1SQPK 2KB7P 3E1IA 2P2UA 1JTHB 2E42A 1LT9A 2P1JA 1GD2E 3L37A 1N73C 1KZUB 1JCDA 1MZ9A 1E5WA 4GT1A 5AVUB 2GM4A 2N9BA 5AW3B 2HYNA 1JUNA 1NO4A 2R32A 1MV8A 1M7LA 5CCGC 1ZR4A 2J59M 1LTBC 3MD0A 4HH2A 1LTGC 3A7OA 5BVZA 3CI9A 3GHGA 1J1EB 2BASA 5KTBA 3M9HA 3C9IA 1S9KE 1JO5A 3MGNA 2HG5D 4C7NA 1M1JB 2XU6A 5AVRB 1GW3A 5AVXB 3NMDA 4N78E 4ZKPA 2GUSA 1KILC 3HTKA 2WT7A 4JYBA 5APXA 5APVA 3RL0C 4W80A 1LTJB 2Q5UA 5AVVB 1SP4A 3B8EB 2HODA 1HVVA 1IO4A 3A2AA 3M0DA 5AW4B 2P67A 2Q7CA 4WB4A 2FFDA 4WBAA 4AYCA 2N1TB 2J58A 1HH0A 4JF7A 1CZQA 4WY4A 3V4QA 2E43A 2GUVA 1L4AB 1CSBA 2OYHB 2FXMA 5AVSB 4GKGA 2WPSA 3LIEA 5APSA 1FZCA 2I1KA 2P7JA 2WSFH 4XE5B 3V5BA 1RF1C 1LGHB 4RESB 4AUWA 2L5GB 1DEBA 3KQGA 5CCHD 2YKPA 4IFMA 1N2DC 2FYUK 3HE4A 3HRNA 1G1JA 2HLOA 1GL2A 1L4AD 2HFED 1NKNA 3VMYA 5BU5A 3P7KA 3HD7A 1LTAC 1NAFA 3HE5A 3TSIA 3VP9A 5CCHA 3M0DC 2FFDC 2HPCA 1GW4A 1FZGA 1OWAA 3T97A 1MFZA 2IFMA 3H32B 1S9KD 3VMZA 1NHLA 2YO3A 1LTSC 2KSJA 4B86A 1MUUA 2H7HA 1FZAA 1GK4A 1IC2A 1IFMA 4WY4C 3IR9A 3O8ZA 4I2LC 1G2CB 5AVZB 3RL0B 4N78D 2QM8A 1HGZA 1WRGA 2W6AA 1JNMA 2C9LY 4KHXA 4EIJA 3L35A 3H6PA 2PP6A 5AW7B 3VN0A 2W27A 1GK6A 3B5NA 2WSCH 1G1IA 3OJAB 2OYIA 1URQA 1VDFA 2WTYA 4Y99B 2QM7A 1T3JA 2CPBA 1GL2C 3MUDA 3MTUE 4IFFA 1ZLLA 2R5BA 2H43A 3HD7C 5CCHC 1EQ7A 1GDTA 1DH3A 3TNUB 1AQ5A 1RE4A 5AW6B 2WITA 3HUSA 1RF1B 2O1JA 1LTIC 2NPSB 1SFCC 3RK2D 2XV5A 1FZEA 1A02J 1H89A 2KLVA 3OAKA 3EQ2A 1LWUB 1GU4A 5AW9B 1PFIA 1FU1A 1HJBA 1NU1K 1JTHA 1LTTC 2R3CA 3BASA 3M0AA 3KYQA 5APYA 1Z56A 1NWQA 1JY3O 1X9VA 3B5NC 1N7SC 3M9BA 3P8CE 3M9QA 1URQC 4XA4A 2OYIC 1YTZT 3WMM0 1FOSE 1LT9C 3II6A 1CI6B 1JY3N 2A45G 3OA7A 1L0LK 2YKOA 3N7NA 5APQA 3RK3C 1XTGB 4I1LA 2LKMA 1RE4C 1M1JA 3HUSC 2WWWA 2R5DA 3L4FA 3I5CA 1JCCA 1QL1A 1QL2A 3GHGC 2KP8A 2M3BA 5AVTB 3G3ZA 5CMZA 2I1JA 1N73B 2N1TD 1T8ZA 1LTJA 1FJKA 3VMXA 1FZFA 5APTA 1ZV8A 4N3YB 3NFQA 2MJZA 4LGDE 5AVQB 4C7RA 5AVWB 1IFDA 2N1TA 2PAJA 1SFCB 3LIDA 4GIFA 1SVFA 2A45I 2O1KA 2YMYA 4OH8B 1W2EA 1L4AA 1NTKK 1OXZA 4N6JA 2OYHA 1HUCA 1KILB 3CL3D 1J1EC 1SQXK 5KLVK 2POHA 1M1JC 3U1AA 2YKQA 3U59A 1N7SB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HOD B;  3GHG B;  1N73 A;  1FZC B;  1LWU C;  1T3U A;  1M1J A;  3H32 A;  3HUS C;  1RF0 A;  1RE3 A;  1JY2 O;  1JY3 O;  2FFD C;  2OYI B;  2FFD B;  1RE4 A;  2OYH B;  1LTJ B;  1FZC C;  1LWU A;  3GHG C;  3HUS A;  1LT9 B;  1RF1 B;  2XNX A;  2OYI C;  1JY2 P;  1FZB A;  2A45 I;  3BVH A;  2HPC A;  2HOD A;  3GHG A;  1FZC A;  1JY3 P;  1W2E A;  1LTJ C;  1FZG A;  2OYH C;  1FZE A;  1LT9 C;  2OYI A;  2Z4E A;  1RF1 C;  2FFD A;  2Q9I A;  1JY2 N;  1JY3 N;  2OYH A;  1N73 B;  3E1I A;  1LTJ A;  2A45 G;  3H32 B;  1M1J B;  1LT9 A;  1FZF A;  1RF1 A;  2A45 H;  1N86 A;  1FZA A;  1N73 C;  1LWU B;  1M1J C;  2HLO A;  3HUS B;  2H43 A;  1RF0 C;  1RE3 C;  2HPC B;  1RE4 C; 
#chains in the Genus database with same CATH topology
 1T3U A;  1NKZ B;  3H1L E;  1PGQ A;  3Q1M A;  2G8Y A;  5M1B A;  4PD4 E;  1FZC C;  5KJ7 D;  2JO1 A;  2M8R A;  1KIL D;  1AVY A;  1SQQ E;  2FYU E;  2ZVO B;  1FS0 E;  5GTI E;  3KHU A;  1FDM A;  1NTK J;  3AE8 C;  1S5L X;  4YPC A;  5CBO A;  3CWB E;  1PGO A;  2OTL P;  3FWL A;  1IK9 A;  2WPR A;  3V4W A;  3R2P A;  1JY3 P;  1EC5 A;  1GZL A;  1LP1 B;  2KYV A;  1WMK A;  4PJ0 H;  2K9Y A;  4BRY A;  1RE3 C;  3IN6 A;  3SWY A;  4IFD K;  3VP8 A;  3CXH E;  3AE4 C;  5AW5 B;  1VQO P;  1N8R Q;  1FZB A;  1SQP E;  4L76 A;  3MHV A;  1X8Y A;  2CPS A;  3M91 A;  3Q2Y A;  2ZFC A;  4WY4 B;  1VQN P;  3PJS K;  1RF0 C;  1D7M A;  1GTW A;  1BE3 E;  5APU A;  2ZVN B;  2QJY B;  4PV1 B;  4DOJ A;  4PD4 D;  2KSE A;  1HGV A;  1L2P A;  1P84 I;  1SQQ D;  3H1H J;  2FYU D;  1T2K C;  1FBM A;  1CI6 A;  4JYC A;  1JY2 O;  2E74 D;  3T97 B;  1DD4 A;  3E1R A;  3CWB D;  1GL2 D;  1JEK A;  1JOC A;  1ZN5 A;  2R44 A;  1JY2 N;  1PPJ D;  1X0T A;  1NU1 G;  1NTZ K;  5CCG D;  3A3Y B;  1KOR A;  2MKV A;  1PP9 G;  1X22 A;  4EYY Q;  2JKV A;  1L0L G;  3P8M C;  1SQP D;  5AVY B;  1Y47 A;  1S5L H;  1SFC A;  2ITA A;  4H44 D;  2QSI A;  3B5N D;  1VF5 D;  1GMJ A;  3N4X A;  1KIL A;  1BE3 D;  4JPZ B;  2Q3I A;  3CX5 E;  3RK3 D;  4UB6 E;  3Q5P A;  3E1I A;  1JTH B;  2E42 A;  2P1J A;  1N73 C;  1KZU B;  1MZ9 A;  2E76 B;  1MV8 A;  1M7L A;  2J59 M;  3MD0 A;  1BCC J;  5BVZ A;  2IZ1 A;  3M9H A;  1JO5 A;  1PPJ G;  3MGN A;  2HG5 D;  1M1J B;  4NPF X;  1E79 H;  1KTM A;  3L74 D;  3RL0 C;  4ZNC A;  1KYO H;  1LJ2 A;  1KQG B;  1OIP A;  2H88 C;  3A2A A;  2Q7C A;  3AE9 C;  1YI2 P;  1PZQ A;  2N1T B;  2J58 A;  1BSN A;  5KAF E;  3RBZ A;  1MKM A;  1ZRT D;  3V4Q A;  3TGU J;  2E43 A;  2A06 E;  1L4A B;  4PV1 D;  1VL2 A;  2KLU A;  2YXQ B;  1FZC A;  3CCR P;  1EZV D;  2P7J A;  1S2E A;  1SQV E;  4XE5 B;  3V5B A;  3D70 A;  1SQX D;  1LGH B;  3CX5 D;  1U7J A;  3L72 D;  3L73 E;  1Q2N A;  2B87 A;  3JCU E;  1N2D C;  4YXD C;  1GL2 A;  2O01 N;  4H0L C;  2HFE D;  5CCH A;  4Y28 J;  3M0D C;  2FBW C;  1OW8 A;  2FFD C;  2HPC A;  1GW4 A;  1MFZ A;  1NVO A;  2RH0 A;  2Q6Q A;  1NHL A;  2KS1 A;  2KSJ A;  1GK4 A;  1IC2 A;  1IFM A;  3O8Z A;  1KYO I;  1YIT P;  5KKZ C;  2M0B A;  1AVO A;  2PGD A;  3H1J J;  3L35 A;  3L75 G;  3VN0 A;  3B5N A;  4BRY B;  2ZYA A;  1G1I A;  2CPB A;  3HD7 C;  2IDB A;  2FYN C;  1DH3 A;  3AEA C;  1KN7 A;  1K9M Q;  2A06 D;  2WIT A;  1NTK G;  4UB8 H;  4H13 C;  1EZV G;  4JBZ A;  3G4S P;  2XV5 A;  1FZE A;  1SQV D;  1H89 A;  1BGY E;  2FXP A;  2E76 D;  3EQ2 A;  2QJP B;  1L0N E;  1FU1 A;  2DW3 A;  3H1I D;  5TIS H;  3TDK A;  3P8C E;  1QGK B;  2OYI C;  4XA4 A;  3WMM 0;  3KZI H;  1LT9 C;  3II6 A;  3MUD C;  1CI6 B;  3N7N A;  3PH0 A;  3L70 D;  2WQY C;  1XTG B;  2LKM A;  1OVU A;  3A0H H;  1FE6 A;  3Q5S A;  2WWW A;  3H1K E;  4D6T E;  1JCC A;  2ZT9 C;  1QL2 A;  5AVT B;  3G3Z A;  1VQ8 P;  3IF4 A;  2N1T D;  1T8Z A;  1LTJ A;  1FJK A;  3VMX A;  5APT A;  4DJG A;  3RL0 g;  1HF9 A;  1SQB E;  5AVW B;  3H1H G;  1SFC B;  3CCJ P;  3LID A;  2KXP B;  4A7P A;  3EWK A;  3BCC J;  1BSH A;  1OXZ A;  3AEC C;  3FXE A;  3WU2 E;  1HUC A;  1KIL B;  3CL3 D;  1BGY D;  3U1A A;  2WSS H;  4LC1 A;  1NTM D;  3PP5 A;  3P8C D;  3AE6 C;  1Q86 Q;  1YJW P;  2Q9I A;  2RN0 A;  2ZXE B;  4W7Y A;  3ABV C;  2NZ2 A;  1NOH A;  3NTN A;  3WUV A;  3F89 A;  1K73 Q;  3SWK A;  3PHL A;  1G2C A;  5KLI B;  3H1K D;  4D6T D;  2OYH C;  5H2F E;  5B66 E;  1XTC C;  3VYI A;  2PFX A;  3V2R A;  1N86 A;  2GA1 A;  1VPC A;  2QRX A;  2AEF A;  3PTZ A;  3A5T A;  1VQL P;  3CXH H;  3SWF A;  4C46 A;  3BRT B;  2CK3 H;  1VQ7 P;  1KIL E;  3RGU A;  4ZKU A;  5KJ7 C;  5GTH E;  2C9N Y;  2NPS A;  1SLQ A;  1BCC G;  4PD4 I;  1FZC B;  1MFT A;  3P32 A;  1LWU A;  3EFG A;  2B87 B;  1JY2 P;  2KI7 B;  1K04 A;  1GL2 B;  3SFE C;  2P58 A;  1J1D C;  3QWO C;  1NU1 E;  3BAT A;  4Y99 C;  2LR2 A;  4OGQ B;  3RK2 C;  3V2N A;  4IL6 X;  2H8P D;  2YO2 A;  4OWF A;  2HPC B;  2R3S A;  1PP9 E;  1PGP A;  2K1A A;  1JMM A;  2KS1 B;  2IBZ D;  3KPE A;  2Z5I A;  3FXD A;  3TGU G;  3CCS P;  2WPV B;  1SQQ K;  4H44 B;  3CXH I;  5AW0 B;  2IPP A;  3B5N B;  1JM0 A;  1T6A A;  1Q90 D;  4I6M C;  1SFC D;  3D71 A;  2Q3E A;  2WPQ A;  3RK3 B;  4U3F J;  3KDP B;  4DZO A;  1P84 H;  5L8R J;  1URQ D;  2WMM A;  4JQ0 D;  1OW6 A;  1QX8 A;  1NTZ J;  1USD A;  1IFN A;  2LXB A;  2E74 C;  1VQ5 P;  1H88 A;  1DX7 A;  1PPJ E;  1SQP K;  1YIJ P;  2KB7 P;  1LT9 A;  3H1J G;  2W90 A;  4K35 A;  1PIX A;  3L37 A;  1GD2 E;  1JCD A;  1NU1 D;  1E5W A;  2AEJ A;  1OFC X;  3GLM A;  1NO4 A;  2E5Y A;  4TT3 H;  3SSU A;  5CCG C;  1LTB C;  1PP9 D;  4HH2 A;  2IBZ G;  3CI9 A;  1J1E B;  1S9K E;  1L0L D;  4C7N A;  2ZAE B;  2XU6 A;  1OMI A;  4ZKP A;  1EDL A;  2ZXX A;  3HTK A;  1M56 D;  5APX A;  2E75 B;  3RBX A;  1VF5 C;  1LTJ B;  3RK3 E;  2HOD A;  1HVV A;  4IL6 H;  1S1C X;  4AYC A;  1FDI A;  4OVN F;  1JB0 J;  4YXW H;  4BWN A;  1HH0 A;  4JF7 A;  1CZQ A;  3CCV P;  2KIK A;  3AE3 C;  3CX5 I;  2FXM A;  4R4M A;  4GKG A;  2WPS A;  2FY8 A;  5CCH D;  3CME P;  4OGQ D;  2YKP A;  1U7M A;  3HE4 A;  1VQ4 P;  3L74 E;  3JCU H;  5BU5 A;  1LTA C;  3TSI A;  3HE5 A;  3L75 E;  1FZG A;  3CC2 P;  1AV1 A;  4EI2 A;  1S9K D;  3VMZ A;  2YO3 A;  1LTS C;  5B5E E;  2H7H A;  4WY4 C;  1EDK A;  1ZRT E;  1Q81 Q;  1G2C B;  3RL0 B;  3BCC G;  1WRG A;  2W6A A;  1JNM A;  4KHX A;  1M90 Q;  2NRG A;  2PP6 A;  5AW7 B;  1NTK E;  1EZV E;  1GK6 A;  1SQX E;  3L72 E;  1URQ A;  1VDF A;  5DJT B;  2QM7 A;  3AEB C;  2QIW A;  5KLV J;  1EQ7 A;  1K05 A;  1GDT A;  3H1L G;  1RE4 A;  2D2C B;  3HUS A;  2L91 A;  1M8O B;  2O1J A;  1LTI C;  2NPS B;  1W2B O;  1A02 J;  2JWA A;  2KLV A;  1LWU B;  5AW9 B;  1IZN B;  1U57 A;  1LTT C;  5APY A;  3KYQ A;  2M3E A;  1JY3 O;  1X9V A;  1N7S C;  1L0N J;  3L75 D;  1NGM B;  1JY3 N;  3OA7 A;  5KKZ B;  3L71 J;  1KB9 D;  2Y0E A;  2E75 D;  3C1L A;  2FXO A;  2R5D A;  3GHG C;  2YIU C;  2KP8 A;  2OTK E;  1NTK D;  3W68 A;  1NTZ D;  2FYN B;  3O6Q A;  3NFQ A;  2MJZ A;  4WWI A;  1BDC A;  5AVQ B;  3H1I E;  4H13 B;  2PAJ A;  3CC7 P;  2UWJ E;  3AE1 C;  3AEE C;  4GIF A;  2A45 I;  2O1K A;  4RO0 A;  3WU2 H;  3L70 E;  4NPE A;  5KLV K;  1IK7 A;  1K8A Q;  4GOD A;  1M1J C;  2YKQ A;  1EXJ A;  5C39 A;  1RE3 A;  3W67 A;  1QVG O;  2C0W A;  1LT9 B;  3JC2 2;  1HBW A;  2M5A A;  4M3L A;  3AE7 C;  1J2J B;  2WVR A;  3RL0 D;  4AQR D;  1R8E A;  1AFO A;  3H32 A;  4GOF A;  1RF0 A;  3AED C;  1L0N K;  5E79 H;  4C7N B;  3CLQ A;  3H1H D;  1L4A C;  2JR8 A;  4U3F G;  3CC4 P;  4BXL A;  3V2P A;  2JJL A;  3HTK B;  1OVR A;  4QMA A;  2JDI H;  2Y0D A;  5B66 H;  2HR3 A;  1FDO A;  1NTZ G;  1VQK P;  3A0B E;  1KQL A;  2HOD B;  5EFW B;  1YYC A;  2BCC J;  2D2C D;  3GG2 A;  1NTM E;  3IFM A;  2ZJS E;  2NPS D;  3KXD A;  1Y8A A;  1LNQ A;  3AEG C;  1AJY A;  1AQT A;  3TNU A;  4EDF A;  4HYT B;  3TK1 A;  1NYH A;  1R5L A;  1FOS F;  4O9B A;  3NXS A;  1SQB K;  5KAI H;  2XNX A;  3BVH A;  3HE4 B;  1BDD A;  5AW2 B;  2B88 A;  3U1C A;  1WT6 A;  3HE5 B;  2Y9Y A;  2BEZ F;  1FAV A;  1FJP A;  1QLE D;  2O01 H;  2KK7 A;  1IFP A;  3HD7 D;  3D6Z A;  1YTZ I;  2JEE A;  3AEF C;  2O01 J;  5APW A;  2QJK B;  1IJD B;  2RMZ A;  1N73 A;  1YQ3 C;  3Q3D A;  1BCC D;  2IFN A;  4H13 D;  3BRV B;  1CW5 A;  1DD3 A;  1URQ B;  2W6B A;  2AXT E;  3CCL P;  1NH4 A;  1ZR2 A;  2XDJ A;  4PD4 H;  3CD6 P;  3I56 P;  1YBK A;  3LW5 H;  1HWT C;  3L73 G;  3H1J E;  3H1L J;  5GTI H;  2FKW B;  3HUS B;  3LW5 J;  1KQS O;  1LT1 A;  4LLH A;  1GU5 A;  1SQQ J;  2FYU J;  2IYP A;  2Q1K A;  1KYO D;  2IBZ E;  1J1D B;  1N7S A;  1X79 B;  3RK2 B;  2Z4E A;  1RQV A;  2P2U A;  3CWB J;  3TGU D;  4TLF A;  1ZOY C;  1NAY A;  2GM4 A;  2N9B A;  5AW3 B;  1OZH A;  2HYN A;  1JUN A;  4GDO A;  2R32 A;  4UB8 E;  1ZR4 A;  1LTG C;  3GHG A;  3Q5R A;  1VQM P;  2JWD A;  5KTB A;  3C9I A;  5KLV G;  4I7Z B;  3H25 A;  5AVR B;  3NMD A;  4N78 E;  2GUS A;  1KIL C;  2WT7 A;  1SQP J;  4GOE A;  5APV A;  1KMI Z;  2LXC B;  2OGU A;  4W80 A;  1AA0 A;  2Q5U A;  3O6Q B;  3M0D A;  4WB4 A;  2FFD A;  1BE3 J;  1OVV A;  1KV4 A;  1M1K Q;  3K5B A;  1VQ6 P;  3H1J D;  2QG4 A;  2QA4 P;  3CCE P;  2XND H;  1L0N G;  1Y9B A;  1CSB A;  1FC2 C;  3L71 G;  3LIE A;  2I1K A;  1L0L E;  1RF1 C;  4RES B;  2FYU K;  3HRN A;  4L75 A;  3BCC E;  1NKN A;  2V4H A;  3VMY A;  2M5A B;  3P7K A;  3HD7 A;  1NAF A;  3VP9 A;  1HJ0 A;  3L74 J;  3CPW O;  1VQ9 P;  4K3A A;  2JP3 A;  1OWA A;  2ZYD A;  2IFM A;  3H32 B;  1EXI A;  4B86 A;  1S72 P;  1MUU A;  2AEM A;  5B5E H;  3IR9 A;  5AVZ B;  4N78 D;  1PV3 A;  1SQB G;  4RJT A;  3H6P A;  3F5H A;  2W27 A;  3E7K A;  2WSC H;  2K88 A;  2SPZ A;  3OJA B;  2OYI A;  3B4S A;  3CX5 H;  3S1K A;  1ZME C;  1RHZ B;  2W6J H;  1GL2 C;  4UB6 H;  3OW2 O;  3MUD A;  2WSC J;  4IFF A;  1PGJ A;  1SQX J;  5CCH C;  3L72 J;  2KZJ A;  4OGQ C;  5K5G B;  1RQU A;  1TU3 F;  3TNU B;  1AQ5 A;  3GMA A;  3B71 A;  3I55 P;  1QVF O;  1YQ4 C;  3RK2 D;  3S9O A;  4YTP C;  1GU4 A;  1HJB A;  2R3C A;  4H44 C;  3BCC D;  2YXR B;  1Z56 A;  1NWQ A;  3B5N C;  3PLN A;  3USS A;  1KB9 I;  2BCC G;  5APQ A;  1DEE G;  3RK3 C;  2KNC A;  2OTJ P;  2RKL A;  5KAF H;  2B89 A;  1H0T A;  1EZV I;  3ZDM A;  3L4F A;  4XFJ A;  3ITK A;  3H1L D;  1PL5 A;  2M3B A;  2I1J A;  3MZW B;  1N73 B;  1ZV8 A;  4LGD E;  2YMK A;  1SQV J;  1Q82 Q;  1IFD A;  3L73 J;  3PRJ A;  4IOI H;  2P10 A;  3H1I J;  1NTK K;  4N6J A;  2OYH A;  1J1E C;  1SQX K;  4HB1 A;  1KB9 E;  3MP7 B;  1N7S B;  1RY3 A;  3CCQ P;  1N7L A;  3L70 J;  3CXH D;  2OAR A;  4U3F E;  2E75 C;  2QJY C;  1LTJ C;  1USE A;  4PV1 C;  1NTZ E;  1S4X A;  5KJ7 A;  1P84 E;  1VQP P;  1S3J A;  2YIU B;  3GHG B;  2KUB A;  3TYY A;  4EOT A;  3CCM P;  1YJ9 P;  4W7Z A;  2WT7 B;  1SQQ G;  3AE5 C;  1T2K D;  1A02 F;  2FYU G;  4PJ0 E;  2A45 H;  2QVA A;  4MN4 C;  4Z1M H;  4H0L B;  1IFJ A;  3VOP A;  2K9J A;  3QH9 A;  3A0B H;  5AW8 B;  2N9Y B;  2FFD B;  3CWB G;  4DCK A;  1BGY J;  1YHQ P;  2VRS A;  2QEX P;  2Z5H A;  3M06 A;  1NTM J;  4L73 A;  5AW1 B;  1RF1 A;  1SQV K;  4RKU J;  2C0X A;  1DIP A;  1IFI A;  2YNY A;  5CHX A;  2IX7 C;  1EDJ A;  3H1H E;  3CCU P;  2BEQ D;  4DT0 A;  1H8A A;  4IL6 E;  2KOG A;  1SQP G;  4U3F D;  3VTP C;  4WY4 D;  3WUT A;  5CJ4 A;  2H89 C;  3HD7 B;  3H1K J;  4D6T J;  1SS1 A;  3CMA P;  1KFN A;  3AE2 C;  5BU8 B;  1P84 D;  1JMB A;  1BE3 G;  2E76 C;  2J5U A;  1UIX A;  3UIA A;  1KFM A;  4HJG H;  3MIW A;  2D2C C;  2FYZ A;  1SQB J;  3GF7 A;  2NPS C;  2XZR A;  2Y0C A;  2WZ7 A;  3D6Y A;  3V2Q A;  1LWU C;  2OYI B;  2AXT H;  3L36 A;  5CCG A;  1S5L E;  2XKM A;  1OX3 A;  2ZYG A;  3R4Y A;  3L74 G;  3G71 P;  1N7S D;  2N1T C;  4CPG A;  5TJH A;  2W83 C;  2ZT9 B;  2WSE H;  3WUU A;  1NTM K;  5KLV E;  5CJ0 A;  4ASV A;  4NPD A;  2WSE J;  2K37 A;  5H2F H;  5DJU B;  3FWN A;  1BCC E;  4GT1 A;  2G3A A;  5AVU B;  1ZXG A;  2IYO A;  3A7O A;  4L74 A;  2KNC B;  1SQX G;  2BAS A;  1ZW0 A;  3L72 G;  3C8V A;  3GF3 A;  1H0T B;  3L73 D;  4H0L D;  1GW3 A;  5AVX B;  2OQQ A;  2QE7 H;  5GTH H;  4KJM A;  4JYB A;  1LP1 A;  1KYO E;  1QEX A;  3L71 E;  5AVV B;  1YJN P;  1SP4 A;  3B8E B;  1KC8 Q;  1IO4 A;  3VMA A;  5AW4 B;  2P67 A;  2IZ0 A;  3TGU E;  4WBA A;  3TF5 A;  1M57 D;  2AXC A;  3JSV C;  4WY4 A;  2IBZ I;  2GUV A;  2I8D A;  2OYH B;  1NU1 J;  2B9B A;  5AVS B;  2W8Z A;  5APS A;  2WSF H;  4AUW A;  2L5G B;  1DEB A;  5KLV D;  3KQG A;  1PP9 J;  4IFM A;  1G1J A;  2HLO A;  2WSF J;  1L0L J;  1L4A D;  2PRR A;  2A06 G;  2QJP C;  4ASW A;  4HKZ H;  1RH5 B;  2KZI A;  1SQV G;  2OYO A;  3T97 A;  1FZA A;  4I2L C;  2QM8 A;  4U7J A;  1HGZ A;  3H1I G;  2V7Q H;  1L0N D;  1ZP0 C;  2C9L Y;  4EIJ A;  3L71 D;  2V7Q J;  1OW7 A;  2K9J B;  1KD1 Q;  2WTY A;  4Y99 B;  1T3J A;  4R4L A;  3L70 G;  3G9R A;  3MTU E;  1ZLL A;  2R5B A;  2H43 A;  2ZT9 D;  1Q7Y Q;  3SFD C;  5E79 E;  5AW6 B;  1RF1 B;  3IAO A;  1SFC C;  2BCC E;  4ZMD A;  1NJI Q;  3OAK A;  1R5S A;  1PFI A;  1NU1 K;  5TIS E;  1JTH A;  3M0A A;  3BAS A;  2QJK C;  1SQB D;  2K3R A;  3M9B A;  3M9Q A;  1URQ C;  3KZI E;  1YTZ T;  3EFF K;  1FOS E;  1KQF B;  2A45 G;  1L0L K;  2YKO A;  3G6E P;  1BGY G;  3A0H E;  2E5T A;  4I1L A;  4KT0 J;  1RE4 C;  1M1J A;  3HUS C;  5KAI E;  1NTM G;  3I5C A;  2E74 B;  3GW6 A;  1QL1 A;  3S4R A;  5CMZ A;  2Y9Z A;  5KLI C;  1FZF A;  4WVZ A;  2O3J A;  3FX0 A;  4N3Y B;  1W5C E;  4C7R A;  2N1T A;  3H1K G;  4D6T G;  1SVF A;  2YMY A;  4OH8 B;  1W2E A;  1EDI A;  5CBN A;  1L4A A;  1UII A;  2BCC D;  4I7Z C;  2POH A;  3L75 J;  3FGA D;  1KB9 H;  1HTL C;  3V6I A;  3U59 A;  1VF5 B; 
#chains in the Genus database with same CATH homology
 1T3U A;  1NKZ B;  1RE3 A;  1RY3 A;  1N7L A;  2OAR A;  1FZC C;  2C0W A;  4LC1 A;  1LT9 B;  5KJ7 D;  1HBW A;  2M8R A;  3PP5 A;  3P8C D;  1LTJ C;  1KIL D;  4M3L A;  2Q9I A;  1J2J B;  2ZXE B;  3RL0 D;  4W7Y A;  1FDM A;  5KJ7 A;  4AQR D;  1NOH A;  1AFO A;  3NTN A;  3GHG B;  3H32 A;  1RF0 A;  1L0N K;  3TYY A;  1IK9 A;  4EOT A;  4C7N B;  3CLQ A;  1G2C A;  2WPR A;  3V4W A;  1L4A C;  3R2P A;  3V2P A;  2JJL A;  2OYH C;  1JY3 P;  3HTK B;  4W7Z A;  2WT7 B;  1GZL A;  1T2K D;  1A02 F;  1XTC C;  3VYI A;  1HTL C;  3V2R A;  2KYV A;  2A45 H;  1N86 A;  1IFJ A;  1VPC A;  3VOP A;  1RE3 C;  3SWY A;  1KQL A;  2HOD B;  3A5T A;  4IFD K;  3VP8 A;  1YYC A;  5AW8 B;  2FFD B;  5AW5 B;  3SWF A;  4C46 A;  3BRT B;  3IFM A;  2NPS D;  2VRS A;  1FZB A;  1X8Y A;  2Z5H A;  2CPS A;  3M91 A;  3TNU A;  4ZKU A;  2ZFC A;  4WY4 B;  5KJ7 C;  3M06 A;  4HYT B;  3TK1 A;  1RF1 A;  5AW1 B;  1SQV K;  2C0X A;  2NPS A;  2C9N Y;  1IFI A;  1RF0 C;  1SLQ A;  2YNY A;  1GTW A;  5CHX A;  1FOS F;  1FZC B;  2IX7 C;  5APU A;  3P32 A;  4O9B A;  3NXS A;  1LWU A;  1SQB K;  3EFG A;  2XNX A;  4DOJ A;  1JY2 P;  1H8A A;  3BVH A;  3HE4 B;  2KOG A;  3VTP C;  4WY4 D;  5AW2 B;  1GL2 B;  1HGV A;  1J1D C;  3U1C A;  1WT6 A;  5CJ4 A;  3HD7 B;  3BAT A;  3HE5 B;  4Y99 C;  3RK2 C;  3V2N A;  1T2K C;  1KFN A;  2H8P D;  1FBM A;  2YO2 A;  5BU8 B;  1CI6 A;  2HPC B;  4JYC A;  1FAV A;  1JY2 O;  1FJP A;  3UIA A;  1GL2 D;  1JMM A;  1KFM A;  1JOC A;  1ZN5 A;  3KPE A;  3MIW A;  2FYZ A;  2O01 H;  2Z5I A;  3HD7 D;  1JY2 N;  2NPS C;  2XZR A;  1SQQ K;  1YTZ I;  2WZ7 A;  2JEE A;  1NTZ K;  5AW0 B;  5APW A;  1IJD B;  5CCG D;  3A3Y B;  2IPP A;  3B5N B;  1N73 A;  2IFN A;  3V2Q A;  1LWU C;  3BRV B;  4I6M C;  1CW5 A;  1SFC D;  2OYI B;  1URQ B;  2W6B A;  1NH4 A;  1ZR2 A;  2XDJ A;  2WPQ A;  3L36 A;  5CCG A;  3LW5 H;  3P8M C;  5AVY B;  1HWT C;  3RK3 B;  1SFC A;  2XKM A;  3KDP B;  2FKW B;  3B5N D;  3HUS B;  1N7S D;  4LLH A;  4DZO A;  2N1T C;  1GU5 A;  3N4X A;  1URQ D;  1KIL A;  2WSE H;  1IFN A;  1J1D B;  2Q3I A;  1N7S A;  1NTM K;  1X79 B;  1H88 A;  3RK3 D;  1DX7 A;  5CJ0 A;  3RK2 B;  2Z4E A;  1SQP K;  2KB7 P;  3E1I A;  2P2U A;  1JTH B;  2E42 A;  1LT9 A;  2P1J A;  1GD2 E;  3L37 A;  1N73 C;  1KZU B;  1JCD A;  1MZ9 A;  1E5W A;  4GT1 A;  5AVU B;  2GM4 A;  2N9B A;  5AW3 B;  2HYN A;  1JUN A;  1NO4 A;  2R32 A;  1MV8 A;  1M7L A;  5CCG C;  1ZR4 A;  2J59 M;  1LTB C;  3MD0 A;  4HH2 A;  1LTG C;  3A7O A;  5BVZ A;  3CI9 A;  3GHG A;  1J1E B;  2BAS A;  5KTB A;  3M9H A;  3C9I A;  1S9K E;  1JO5 A;  3MGN A;  2HG5 D;  4C7N A;  1M1J B;  2XU6 A;  5AVR B;  1GW3 A;  5AVX B;  3NMD A;  4N78 E;  4ZKP A;  2GUS A;  1KIL C;  3HTK A;  2WT7 A;  4JYB A;  5APX A;  5APV A;  3RL0 C;  4W80 A;  1LTJ B;  2Q5U A;  5AVV B;  1SP4 A;  3B8E B;  2HOD A;  1HVV A;  1IO4 A;  3A2A A;  3M0D A;  5AW4 B;  2P67 A;  2Q7C A;  4WB4 A;  2FFD A;  4WBA A;  4AYC A;  2N1T B;  2J58 A;  1HH0 A;  4JF7 A;  1CZQ A;  4WY4 A;  3V4Q A;  2E43 A;  2GUV A;  1L4A B;  1CSB A;  2OYH B;  2FXM A;  5AVS B;  4GKG A;  2WPS A;  3LIE A;  5APS A;  1FZC A;  2I1K A;  2P7J A;  2WSF H;  4XE5 B;  3V5B A;  1RF1 C;  1LGH B;  4RES B;  4AUW A;  2L5G B;  1DEB A;  3KQG A;  5CCH D;  2YKP A;  4IFM A;  1N2D C;  2FYU K;  3HE4 A;  3HRN A;  1G1J A;  2HLO A;  1GL2 A;  1L4A D;  2HFE D;  1NKN A;  3VMY A;  5BU5 A;  3P7K A;  3HD7 A;  1LTA C;  1NAF A;  3HE5 A;  3TSI A;  3VP9 A;  5CCH A;  3M0D C;  2FFD C;  2HPC A;  1GW4 A;  1FZG A;  1OWA A;  3T97 A;  1MFZ A;  2IFM A;  3H32 B;  1S9K D;  3VMZ A;  1NHL A;  2YO3 A;  1LTS C;  2KSJ A;  4B86 A;  1MUU A;  2H7H A;  1FZA A;  1GK4 A;  1IC2 A;  1IFM A;  4WY4 C;  3IR9 A;  3O8Z A;  4I2L C;  1G2C B;  5AVZ B;  3RL0 B;  4N78 D;  2QM8 A;  1HGZ A;  1WRG A;  2W6A A;  1JNM A;  2C9L Y;  4KHX A;  4EIJ A;  3L35 A;  3H6P A;  2PP6 A;  5AW7 B;  3VN0 A;  2W27 A;  1GK6 A;  3B5N A;  2WSC H;  1G1I A;  3OJA B;  2OYI A;  1URQ A;  1VDF A;  2WTY A;  4Y99 B;  2QM7 A;  1T3J A;  2CPB A;  1GL2 C;  3MUD A;  3MTU E;  4IFF A;  1ZLL A;  2R5B A;  2H43 A;  3HD7 C;  5CCH C;  1EQ7 A;  1GDT A;  1DH3 A;  3TNU B;  1AQ5 A;  1RE4 A;  5AW6 B;  2WIT A;  3HUS A;  1RF1 B;  2O1J A;  1LTI C;  2NPS B;  1SFC C;  3RK2 D;  2XV5 A;  1FZE A;  1A02 J;  1H89 A;  2KLV A;  3OAK A;  3EQ2 A;  1LWU B;  1GU4 A;  5AW9 B;  1PFI A;  1FU1 A;  1HJB A;  1NU1 K;  1JTH A;  1LTT C;  2R3C A;  3BAS A;  3M0A A;  3KYQ A;  5APY A;  1Z56 A;  1NWQ A;  1JY3 O;  1X9V A;  3B5N C;  1N7S C;  3M9B A;  3P8C E;  3M9Q A;  1URQ C;  4XA4 A;  2OYI C;  1YTZ T;  3WMM 0;  1FOS E;  1LT9 C;  3II6 A;  1CI6 B;  1JY3 N;  2A45 G;  3OA7 A;  1L0L K;  2YKO A;  3N7N A;  5APQ A;  3RK3 C;  1XTG B;  4I1L A;  2LKM A;  1RE4 C;  1M1J A;  3HUS C;  2WWW A;  2R5D A;  3L4F A;  3I5C A;  1JCC A;  1QL1 A;  1QL2 A;  3GHG C;  2KP8 A;  2M3B A;  5AVT B;  3G3Z A;  5CMZ A;  2I1J A;  1N73 B;  2N1T D;  1T8Z A;  1LTJ A;  1FJK A;  3VMX A;  1FZF A;  5APT A;  1ZV8 A;  4N3Y B;  3NFQ A;  2MJZ A;  4LGD E;  5AVQ B;  4C7R A;  5AVW B;  1IFD A;  2N1T A;  2PAJ A;  1SFC B;  3LID A;  4GIF A;  1SVF A;  2A45 I;  2O1K A;  2YMY A;  4OH8 B;  1W2E A;  1L4A A;  1NTK K;  1OXZ A;  4N6J A;  2OYH A;  1HUC A;  1KIL B;  3CL3 D;  1J1E C;  1SQX K;  5KLV K;  2POH A;  1M1J C;  3U1A A;  2YKQ A;  3U59 A;  1N7S B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...