2Z4EA

Crystal structure of d-dimer from human fibrin complexed with gly-his-arg-pro-tyr-amide
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
67
structure length
67
Chain Sequence
VIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
publication title Probing the beta-chain hole of fibrinogen with synthetic peptides that differ at their amino termini
pubmed doi rcsb
total genus 22
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2z4eA00
1LWUA 1LT9A 3BVHA 3GHGB 1JY3O 1FZCA 1FZEA 1N73C 1T3UA 1W2EA 3HUSC 3GHGC 1RE4A 1RF1B 1JY2P 1FZAA 2FFDB 1LTJA 1RE3A 1RF0A 2A45H 2OYHA 1M1JB 1RF1C 1JY2O 2XNXA 2HPCB 2FFDC 2OYIA 2Q9IA 2A45I 1FZBA 1M1JC 2HODA 1N73A 2OYIC 3H32B 1FZFA 3HUSA 1N86A 3GHGA 1LT9B 1LWUB 1FZCB 1JY3N 3E1IA 1LWUC 1RF1A 2FFDA 1LT9C 2A45G 1FZCC 2HPCA 1FZGA 1M1JA 1RE4C 2OYHB 1LTJB 2OYIB 1JY2N 1LTJC 1RE3C 1JY3P 1RF0C 3H32A 2Z4EA 2OYHC 2H43A 2HLOA 1N73B 2HODB 3HUSB
chains in the Genus database with same CATH superfamily
3USSA 3M0DC 4KHXA 3BVHA 4IFFA 1HF9A 3B5NA 3AEFC 3NTNA 5KAIH 1PZQA 2H88C 1LTJA 1H0TB 1G2CA 1KORA 1J2JB 2P7JA 3CCRP 2FFDA 5KLVG 1BDCA 3AEBC 3VMYA 3Q2YA 1K8AQ 2YMKA 3H1LE 1VQ4P 1VPCA 3W68A 3KZIE 1JCDA 1FJKA 1T3UA 2QJKC 1OIPA 2XDJA 3L75E 2BEZF 5GTIH 1BCCD 1H0TA 2OQQA 1BE3G 4IL6H 1E79H 5AW9B 1EDKA 3V2NA 5H2FH 4D6TD 1GD2E 2HPCB 2N1TD 3RK2D 1N73A 3BCCE 2ZFCA 3FWNA 3LIDA 1X8YA 2E5YA 3TDKA 3NFQA 5APYA 1JY2P 1L4AB 2W6AA 2IFMA 1W5CE 1KYOE 1H89A 1DEBA 4W7YA 3ABVC 2WWWA 3L73G 3KYQA 3H1JD 4HB1A 2OTKE 2KSJA 1S5LH 3R2PA 3M91A 1KD1Q 3CWBD 1EZVG 1IJDB 2Y0DA 1FS0E 1PPJE 5AVYB 4NPFX 5BU5A 1URQB 4ZKUA 3GG2A 2Y9ZA 3JSVC 1N8RQ 3AEAC 3MD0A 1RF1C 1JOCA 2PAJA 3MZWB 1N86A 2M3BA 3G9RA 1SQXG 5KJ7A 1A02F 4A7PA 1Y47A 2L5GB 3TGUG 3G3ZA 1L0NJ 2AXTE 3EFFK 4DCKA 4HJGH 2WT7A 3JCUH 1URQA 5CCGD 2RH0A 1N7SC 3G6EP 3CPWO 1J1DB 2P2UA 1FZGA 2PP6A 3PRJA 3GHGB 4H44D 4BWNA 1M1JB 5B66H 1M7LA 5AW7B 2Q9IA 1EQ7A 1EXIA 3A0BH 1LTAC 3WUTA 1NTZD 5AVUB 3PJSK 2M8RA 4JYBA 2WSFH 4DT0A 2Q6QA 2A06E 2E74C 2J58A 4PJ0E 2C9LY 4L74A 1KYOD 1AFOA 5KLIC 1H88A 1M1JA 3L70J 3H1KJ 3H32A 3V4WA 2NPSD 5B5EH 2IDBA 2B88A 2KNCB 3CCSP 1OW8A 3PHLA 1PPJD 1P84I 2LXBA 1L0LE 1FDOA 4H13B 2YIUC 3P7KA 1NVOA 2GM4A 1NAYA 2C9NY 2Q3IA 1BCCG 5L8RJ 3HUSC 3A0HH 3CX5D 2KLVA 2JR8A 1CI6A 2FYUJ 3CL3D 5CJ4A 1KILA 4D6TG 1KFMA 4NPDA 3RL0B 3PH0A 1N7LA 4M3LA 1YYCA 1YHQP 1M57D 2OYHB 1K05A 1SQVE 3WU2E 2IBZE 2Y0CA 1RE4A 3H1HJ 2KZIA 3S1KA 4BRYB 3BRVB 4EIJA 1RE3C 2JP3A 2HODB 1FDMA 2YKPA 2OYHA 3H1JG 4EOTA 1VQ6P 3D71A 2C0XA 4GODA 1JY3N 2W6JH 2WITA 2C0WA 2IZ1A 3JC22 5CCHC 1USDA 4BRYA 4BXLA 2A06D 4PV1C 1FE6A 2FKWB 2KXPB 1T2KC 2QJPC 1SQPJ 2O01N 2E74D 1OFCX 3VOPA 1HBWA 5AW8B 3CXHI 4N78D 1NTMJ 2YMYA 1IK9A 1KB9I 2KS1A 1FZEA 2IPPA 3HD7C 3RK3B 2E76C 4K35A 4WY4B 1GK6A 2K9JA 3CMEP 1L0LD 2O1JA 1RQVA 4UB6H 2BCCJ 2K88A 3P8MC 2POHA 3L74J 2WQYC 1K73Q 1Q81Q 3F89A 4PD4I 1UIIA 2NZ2A 1GL2C 4C7NB 4WVZA 3QWOC 5KLVJ 1NTZG 5APSA 4EI2A 4NPEA 3L72E 2XNXA 3GLMA 2OYIC 2W6BA 4H0LB 2R5BA 4HKZH 3RK3E 3CD6P 1IFNA 1VQOP 1RY3A 3AEGC 2UWJE 2Z5HA 4ZMDA 1TU3F 1FOSF 2XZRA 4L75A 2ZT9B 5TISE 1BE3J 1W2BO 1YQ4C 1FZBA 4LLHA 2E75B 2WMMA 4ZNCA 2ZXXA 1PPJG 4IFMA 3KHUA 1LTSC 5KAFH 2A45G 3N4XA 5AW4B 1OX3A 4U7JA 5CCHD 2IYPA 2PGDA 3FX0A 1T2KD 1NTKE 2ZYDA 1LTTC 1ZMEC 3RK2C 1PGPA 1NHLA 1MFZA 3N7NA 3AE7C 1G1IA 1R8EA 3AE5C 2N1TA 1LT9C 4N6JA 4OVNF 1GW4A 3MTUE 3L73J 1NAFA 1JMBA 3CC7P 2LR2A 3Q5RA 3E7KA 1SFCD 1KV4A 3HD7D 2KIKA 2E76D 1LJ2A 3H1IJ 5KAIE 2WTYA 2ZYAA 3B5NB 1FZCC 1LTJB 3VYIA 3KXDA 1LTGC 5CMZA 1EZVI 1CZQA 2FFDB 1DD3A 1ZRTD 2R3SA 3RBZA 1ZR4A 1WMKA 2O1KA 2P58A 1GL2D 1LWUC 2Q1KA 4U3FD 1SQXJ 1Z56A 3L72D 1ZP0C 2QJKB 2LKMA 5APXA 3MUDC 3KDPB 2A06G 5AVXB 3M0DA 4IL6E 3IF4A 2JWAA 2H8PD 2WPSA 4O9BA 5H2FE 3OW2O 1ZN5A 1JM0A 2Y0EA 1NOHA 1JY3P 1KTMA 1N73B 1KFNA 1JY3O 1VQMP 1S1CX 2XNDH 1L0LK 5CCGC 1BGYJ 2YO2A 1JNMA 2NRGA 1L0LG 1NWQA 3E1IA 2JKVA 2B89A 2FXPA 5CCGA 1IFPA 4Y28J 4UB8H 1Q2NA 4I7ZB 4H44C 1NTKD 3SFEC 1Q86Q 3Q5SA 1KQGB 5CHXA 2KSEA 2KOGA 2WSSH 2YXRB 2AEJA 3L70E 1UIXA 1S5LE 3H25A 1SQVK 1OXZA 1U7JA 4RO0A 1RH5B 2HG5D 4I6MC 1GZLA 2B9BA 1VQ8P 4AYCA 3CCEP 2N9BA 2OARA 1NU1J 1DIPA 2ZVOB 1VQKP 3PTZA 5CJ0A 3AE2C 1USEA 2W27A 2ZAEB 2NPSC 1OVRA 3LW5H 2KZJA 1BCCJ 1M56D 2FYUE 1RF1B 2MKVA 1P84H 1PGOA 1QVFO 4MN4C 1VQLP 3JCUE 1ZV8A 4D6TJ 1PP9J 2WT7B 3M0AA 4WWIA 3EFGA 4IOIH 2W8ZA 2Z4EA 1JO5A 3TK1A 5AW6B 1SQQJ 2QIWA 1L4AC 1VF5B 2B87B 2WSEH 1N7SB 1M1KQ 4DJGA 3AE9C 1Q90D 4Y99C 1YBKA 1RF1A 2E42A 5B66E 3H1LD 2D2CB 3A0BE 3MIWA 2FBWC 5GTHH 1PIXA 1GTWA 4C7RA 1EDLA 3AE4C 1FZAA 5KTBA 3MHVA 3L75D 3BATA 4YPCA 3MGNA 2JDIH 1VDFA 3H1JJ 2QA4P 3OAKA 3PP5A 1WT6A 3CWBJ 2YO3A 5BU8B 2B87A 2AEFA 1N7SA 1YITP 1SQPE 2E74B 3EWKA 3V6IA 2K3RA 2Z5IA 3U1CA 3Q5PA 2I1KA 1NKNA 3BCCD 2M0BA 3H32B 5B5EE 1IK7A 1NTME 2K1AA 3KPEA 4U3FG 3CX5H 2R32A 1SQBE 3L72G 2KUBA 1J1EB 5AW2B 3GF7A 3C8VA 1AA0A 3SWYA 2FXOA 2PFXA 1X79B 5AW1B 2BCCE 2G8YA 2WPVB 3A0HE 3CXHH 3LW5J 3B4SA 4L73A 1L2PA 1J1DC 3A5TA 2H7HA 5EFWB 1KB9H 1IFJA 1CI6B 3WUUA 1H8AA 3HUSB 1KILB 2QM8A 4ASWA 3GHGC 3ITKA 3L71E 1FJPA 5AW3B 3H6PA 3BASA 3VN0A 5KLVE 4GKGA 1XTCC 3TNUA 2P10A 3CLQA 1S9KE 2WSEJ 1NTZJ 4L76A 1GK4A 1IFIA 1NH4A 1S3JA 1NTKK 4PD4H 3S9OA 1SS1A 1QVGO 3AEDC 3L36A 1NTKG 1L4AD 4GT1A 1KC8Q 3HUSA 3SFDC 3K5BA 3B71A 1HJBA 1KMIZ 3GW6A 1EXJA 1S72P 4C46A 3CCMP 5AVQB 1KILE 1OVUA 1KYOI 2R44A 1KQLA 4PV1B 1GW3A 2QJPB 2XU6A 1RE3A 3CC4P 4DOJA 2A45I 2QJYB 3E1RA 1NTMD 3M9BA 3U1AA 2KS1B 3RL0C 4QMAA 3L73E 1SQBD 1OW7A 1YQ3C 4UB6E 2K9JB 2HLOA 3VMZA 3HD7B 3CX5I 5AVSB 3H1IE 2E76B 1MKMA 5CCHA 1S2EA 3P32A 1GMJA 2KB7P 2IX7C 3L35A 2QVAA 1RF0C 3H1LG 2RMZA 3I55P 1M90Q 3P8CE 3L71D 2CPBA 1K04A 1SFCC 1BSHA 3C1LA 3L75G 5AVWB 3HD7A 1SQXE 1S9KD 2I8DA 3VP8A 1PGQA 3M06A 2OYIB 2ZVNB 2JO1A 3M9QA 1PGJA 2GA1A 2DW3A 5AW5B 4Z1MH 3BCCG 2WSCH 2Q7CA 1JY2N 1SQVD 3AE1C 1GL2A 5DJUB 1IC2A 2IBZD 1LP1A 3NMDA 5KAFE 2FYNC 1BGYE 2RN0A 1QLED 2OYIA 3RK3C 3TF5A 4WY4C 1Y8AA 5CBOA 3OA7A 3C9IA 5E79H 1L0LJ 1HGVA 3BRTB 3OJAB 3VP9A 2FYUK 3CCJP 2N1TB 3RK2B 1CW5A 1N2DC 3PLNA 1LT9B 3RL0D 4I2LC 2YKQA 2YXQB 2H89C 1NO4A 3H1ID 4XE5B 1NU1E 5APVA 2KK7A 4H0LC 3U59A 3II6A 3HTKB 1ZW0A 1VQ7P 2HR3A 3CCQP 1AVOA 1DEEG 4WBAA 1FZCB 1T8ZA 2OGUA 2E5TA 1BCCE 5KKZB 2IBZI 1T3JA 2J59M 1OWAA 1LNQA 1LT9A 1OZHA 1FOSE 2HFED 1ZOYC 4D6TE 2YNYA 1PP9E 3CCLP 4R4LA 3HE5A 3D6ZA 2AEMA 4JQ0D 4W80A 1QL1A 1SQPK 2O3JA 1SQQE 2ZXEB 3HTKA 3LIEA 3I56P 1FZCA 5M1BA 3W67A 4OGQC 1S4XA 2WSCJ 1NTMK 3I5CA 1RQUA 1GU4A 2Y9YA 2O01J 1NTMG 3TSIA 1SQBK 1L0NE 2H43A 1LWUA 1SQBG 3CMAP 3TGUJ 1BGYD 1W2EA 5GTIE 3A2AA 3AE6C 2I1JA 4UB8E 3G4SP 3RK3D 2KYVA 2P67A 3CWBE 3S4RA 2V7QH 3O6QA 4WY4D 3MUDA 4EDFA 1LTBC 3CC2P 1KN7A 3B5NC 3SWKA 2JWDA 5BVZA 1LTJC 3V5BA 4JF7A 2VRSA 4H44B 2J5UA 2L91A 3A7OA 4GOEA 1QGKB 2JEEA 1EDIA 1SP4A 2FFDC 3L71G 5KLVK 1FZFA 5DJTB 3FXDA 1NYHA 2G3AA 3V2QA 1NU1D 1VQ5P 3GMAA 4U3FJ 3GF3A 1KZUB 3L72J 1JTHA 2SPZA 2HYNA 4H0LD 3V4QA 4LGDE 1P84E 2XKMA 1DX7A 3H1KE 1HH0A 2NPSB 1WRGA 4WB4A 2AXCA 1ZXGA 2WPRA 2IFNA 1N73C 1SQVG 4OWFA 1MV8A 2IBZG 2ZT9D 1PP9D 1JCCA 1R5LA 1LTIC 2CK3H 4W7ZA 2E75D 1LGHB 3KZIH 2FYZA 1NTZE 1SQQD 4B86A 1DH3A 4I7ZC 1AQ5A 1JY2O 2NPSA 4OGQD 1NTKJ 4Y99B 5GTHE 1AV1A 1R5SA 1G1JA 1ZLLA 3IAOA 1L0ND 5APWA 5AW0B 2HPCA 2W83C 4YTPC 2JJLA 3F5HA 2V7QJ 3H1HE 3H1IG 1EDJA 4CPGA 2QEXP 4XA4A 3FWLA 1L4AA 3V2RA 3B5ND 1QEXA 4RKUJ 5AVVB 1SLQA 1M8OB 1Q82Q 2ZJSE 1KQFB 3CX5E 1KYOH 2K9YA 4K3AA 2GUSA 5KJ7C 1SQXK 1QX8A 3R4YA 5AVZB 1FBMA 1VQNP 2BEQD 3B8EB 3SWFA 1LT1A 1URQC 2XV5A 3CXHE 2CPSA 4AUWA 1KB9E 2A45H 3UIAA 1IFMA 4JYCA 1VF5C 1VQ9P 3FXEA 1P84D 2M5AB 3L70D 1AJYA 3AEEC 3H1KD 2LXCB 5KLIB 3V2PA 3IFMA 1CSBA 2OTLP 2D2CC 1EC5A 3G71P 4IL6X 1VQPP 2KI7B 3H1LJ 1YI2P 4KJMA 3TNUB 1Q7YQ 1BGYG 2K37A 1U7MA 2QG4A 2YIUB 4PD4E 2AXTH 3L75J 4HYTB 3L74E 3ZDMA 2N9YB 4R4MA 2M5AA 2FYUD 3CCUP 2W90A 1X22A 2PRRA 1GU5A 1M1JC 3GHGA 2IZ0A 1HJ0A 3BCCJ 4N78E 1NU1K 2IYOA 3H1HD 1S5LX 1NU1G 2R5DA 1J1EC 3WUVA 2QM7A 5APTA 2WZ7A 1HWTC 2V4HA 1BE3E 2P1JA 2OTJP 3D70A 2KLUA 4PJ0H 1KILC 2R3CA 1YJWP 2Q5UA 1PP9G 3AE3C 5KJ7D 1SQQK 2KNCA 3A3YB 4H13C 1RE4C 3Q1MA 3CXHD 1SQQG 1SQPD 1URQD 2FY8A 3WMM0 1FC2C 1FAVA 1JEKA 1KB9D 3TYYA 2BASA 1X9VA 1VF5D 3MP7B 1N7SD 1L0NK 1YIJP 1L0NG 2OYHC 2D2CD 5AVTB 1SFCB 1JUNA 1PL5A 4GOFA 1EZVE 4GDOA 2BCCD 4PD4D 1AVYA 3CWBG 1T6AA 3EQ2A 2RKLA 2WSFJ 4XFJA 4EYYQ 3L74D 3WU2H 4RJTA 1RHZB 2ZYGA 1YTZT 1NKZB 1FDIA 1IZNB 4OH8B 3RL0g 1RF0A 4YXWH 3L4FA 2HODA 1GL2B 5KLVD 2QJYC 1SFCA 1LP1B 1MZ9A 1NJIQ 3TGUE 3FGAD 3AECC 1VL2A 2FYNB 1JB0J 5E79E 4ASVA 1A02J 1SQBJ 3D6YA 4TT3H 4KT0J 3HRNA 4HH2A 3L70G 1BSNA 2WPQA 1OVVA 1BE3D 3H1KG 1X0TA 2O01H 1Y9BA 1KQSO 5K5GB 1KILD 1XTGB 3CCVP 5AVRB 3IR9A 1ZRTE 3L71J 1BDDA 1NTZK 4YXDC 5TJHA 2QE7H 2WVRA 3RGUA 4LC1A 4U3FE 1HVVA 1K9MQ 4WY4A 4ZKPA 3AE8C 3HE4B 4H13D 1HUCA 4N3YB 1HGZA 1D7MA 3IN6A 3KQGA 4IFDK 4I1LA 2FYUG 3SSUA 1ZR2A 5C39A 3NXSA 1HTLC 1PFIA 3L73D 2OYOA 1YJ9P 1DD4A 3HE5B 4C7NA 1SQVJ 1U57A 2QRXA 1EZVD 3H1HG 3HE4A 5CBNA 1PV3A 4JBZA 1SVFA 2Q3EA 3VMAA 1JMMA 3Q3DA 3RBXA 3P8CD 2ITAA 1YTZI 2FXMA 4PV1D 4OGQB 2ZT9C 2YKOA 2N1TC 3L37A 1SQXD 2KP8A 1LWUB 2E75C 1YJNP 3TGUD 5TISH 1GDTA 4AQRD 4TLFA 1E5WA 3T97B 1MUUA 3O6QB 1SQPG 2GUVA 2QSIA 3CI9A 1OW6A 3M9HA 3VMXA 1AQTA 3O8ZA 1MFTA 4DZOA 5APQA 1NGMB 1IFDA 1G2CB 5KKZC 1IO4A 1QL2A 1FU1A 4RESB 4GIFA 1OMIA 3H1JE 2M3EA 3VTPC 3T97A 3QH9A 2MJZA 2E43A 2BCCG 5APUA 1JTHB 4JPZB 3L74G
chains in the Genus database with same CATH topology
4C46A 2W6BA 3M0DC 1SLQA 4KHXA 3BVHA 4IFFA 5AVQB 3B5NA 3NTNA 1LTJA 2R5BA 1G2CA 2GUSA 5KJ7C 1SQXK 5AVZB 1J2JB 1IFNA 1FBMA 2P7JA 1RY3A 2FFDA 3VMYA 1KQLA 2Z5HA 3B8EB 1VPCA 3SWFA 2XV5A 1URQC 1FOSF 1GW3A 2CPSA 2XZRA 4AUWA 1JCDA 1FJKA 1T3UA 2XU6A 1RE3A 2A45H 3UIAA 2XDJA 1IFMA 4DOJA 4JYCA 2A45I 1FZBA 4LLHA 3M9BA 3U1AA 4IFMA 3RL0C 3V2PA 1LTSC 3IFMA 2A45G 1CSBA 3N4XA 5AW4B 2HLOA 5CCHD 3VMZA 3HD7B 5AW9B 5AVSB 3V2NA 3TNUB 1T2KD 5CCHA 1GD2E 2HPCB 1LTTC 2N1TD 3RK2C 3RK2D 1NHLA 1MFZA 3N7NA 1N73A 2OYIC 3P32A 2ZFCA 1G1IA 3LIDA 1X8YA 2N1TA 1LT9C 2KB7P 2IX7C 4HYTB 4N6JA 3L35A 1GW4A 1RF0C 3NFQA 3MTUE 5APYA 1NAFA 3P8CE 2CPBA 1JY2P 1L4AB 1SFCD 1SFCC 3HD7D 1GU5A 1M1JC 3GHGA 5AVWB 3HD7A 1S9KD 2W6AA 2IFMA 2WTYA 3VP8A 3B5NB 1H89A 1FZCC 1DEBA 4W7YA 1LTJB 3M06A 2WWWA 3VYIA 4N78E 2OYIB 1NU1K 3KYQA 1LTGC 5CMZA 3M9QA 2R5DA 1J1EC 1CZQA 2KSJA 2FFDB 3R2PA 3M91A 5AW5B 2QM7A 5APTA 1IJDB 1ZR4A 5AVYB 2WZ7A 2O1KA 1GL2D 1LWUC 1HWTC 5BU5A 2WSCH 1URQB 2Q7CA 4ZKUA 1Z56A 1JY2N 1GL2A 2P1JA 1IC2A 3NMDA 2LKMA 1KILC 5APXA 2R3CA 3KDPB 3MD0A 1RF1C 5AVXB 1JOCA 2PAJA 2Q5UA 2OYIA 3RK3C 3M0DA 4WY4C 5KJ7D 1N86A 2M3BA 2H8PD 2WPSA 3OA7A 4O9BA 3C9IA 1SQQK 3A3YB 5KJ7A 1ZN5A 1A02F 1HGVA 1RE4C 3BRTB 2L5GB 3OJAB 1NOHA 1JY3P 3VP9A 2FYUK 3G3ZA 1URQD 1N73B 1KFNA 3WMM0 1FAVA 2WT7A 1JY3O 3TYYA 2BASA 1X9VA 2N1TB 3RK2B 1CW5A 1URQA 1N2DC 1L0LK 5CCGC 5CCGD 2YO2A 1JNMA 1LT9B 1N7SC 1N7SD 1NWQA 1L0NK 3E1IA 3RL0D 1J1DB 4I2LC 5CCGA 2YKQA 2P2UA 1FZGA 1NO4A 2PP6A 2OYHC 4XE5B 5AVTB 1SFCB 3GHGB 1JUNA 5APVA 1M1JB 3U59A 5CHXA 3II6A 3HTKB 2KOGA 1M7LA 5AW7B 2Q9IA 1EQ7A 4WBAA 1LTAC 3EQ2A 1FZCB 1SQVK 1T8ZA 5AVUB 1OXZA 1T3JA 2J59M 1YTZT 1OWAA 2M8RA 1NKZB 1LT9A 4JYBA 4OH8B 2WSFH 2HG5D 1FOSE 4I6MC 1GZLA 4AYCA 1RF0A 2N9BA 2OARA 2HFED 2YNYA 2J58A 3L4FA 2HODA 2C9LY 1GL2B 3HE5A 1SFCA 1MZ9A 1AFOA 1H88A 5CJ0A 1M1JA 4W80A 1QL1A 1SQPK 2ZXEB 3HTKA 2W27A 3LIEA 3H32A 3V4WA 2NPSC 2NPSD 3LW5H 1FZCA 1A02J 1RF1B 1NTMK 3I5CA 1GU4A 1ZV8A 3HRNA 3P7KA 4HH2A 2WT7B 3TSIA 3M0AA 2WPQA 1SQBK 2GM4A 3EFGA 2C9NY 2Z4EA 2Q3IA 1JO5A 2H43A 2O01H 3TK1A 1LWUA 5AW6B 1W2EA 3HUSC 1KILD 1XTGB 3A2AA 5AVRB 1L4AC 2KLVA 2I1JA 2WSEH 1CI6A 3CL3D 3IR9A 1N7SB 3RK3D 5CJ4A 1KILA 2KYVA 2P67A 4WY4D 1KFMA 3MUDA 3RL0B 1NTZK 4Y99C 1LTBC 1RF1A 2E42A 1N7LA 4M3LA 4LC1A 1HVVA 1YYCA 4WY4A 4ZKPA 3B5NC 3HE4B 2OYHB 5BVZA 1HUCA 4N3YB 1LTJC 1HGZA 3MIWA 3V5BA 4JF7A 2VRSA 3A7OA 3KQGA 4IFDK 1GTWA 4C7RA 2JEEA 4I1LA 1RE4A 1FZAA 5KTBA 1SP4A 2FFDC 3BATA 3MGNA 5KLVK 1VDFA 1FZFA 1ZR2A 3BRVB 3OAKA 4EIJA 3NXSA 3PP5A 1HTLC 1PFIA 1WT6A 2YO3A 5BU8B 1RE3C 1N7SA 3V2QA 2HODB 3HE5B 4C7NA 1KZUB 1FDMA 1JTHA 2Z5IA 2HYNA 3U1CA 2YKPA 3HE4A 2OYHA 2I1KA 1NKNA 4EOTA 3H32B 3V4QA 1SVFA 4LGDE 2C0XA 1JY3N 2XKMA 1DX7A 2WITA 2C0WA 1JMMA 1HH0A 2NPSB 3KPEA 1WRGA 4WB4A 5CCHC 2R32A 2WPRA 2IFNA 3P8CD 1N73C 1J1EB 1YTZI 2FXMA 2FKWB 5AW2B 1MV8A 1T2KC 2YKOA 3SWYA 1JCCA 2N1TC 1X79B 3L37A 5AW1B 1LTIC 3VOPA 4W7ZA 1HBWA 2KP8A 5AW8B 1LWUB 1LGHB 2FYZA 4B86A 1J1DC 1GDTA 4N78D 4AQRD 3A5TA 2H7HA 1E5WA 1IFJA 1CI6B 1H8AA 2YMYA 1IK9A 1MUUA 1DH3A 3HUSB 1KILB 2QM8A 1FZEA 1AQ5A 3GHGC 2IPPA 2GUVA 3CI9A 3HD7C 1FJPA 3RK3B 1JY2O 2NPSA 4WY4B 1GK6A 5AW3B 2O1JA 3H6PA 3BASA 4Y99B 3M9HA 3VN0A 3VMXA 4GKGA 1G1JA 1ZLLA 1XTCC 3TNUA 3O8ZA 5APWA 4DZOA 5AW0B 3CLQA 1S9KE 5APQA 2HPCA 1IFDA 1G2CB 2JJLA 3P8MC 2POHA 1IO4A 1QL2A 1GK4A 1IFIA 1FU1A 1NH4A 4RESB 4GIFA 1NTKK 3VTPC 3L36A 1L4AD 4GT1A 3T97A 3HUSA 1GL2C 2MJZA 2E43A 4XA4A 1L4AA 5APUA 4C7NB 1JTHB 1HJBA 3V2RA 3B5ND 5APSA 2XNXA 5AVVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LWU A;  1LT9 A;  3BVH A;  3GHG B;  1JY3 O;  1FZC A;  1FZE A;  1N73 C;  1T3U A;  1W2E A;  3HUS C;  3GHG C;  1RE4 A;  1RF1 B;  1JY2 P;  1FZA A;  2FFD B;  1LTJ A;  1RE3 A;  1RF0 A;  2A45 H;  2OYH A;  1M1J B;  1RF1 C;  1JY2 O;  2XNX A;  2HPC B;  2FFD C;  2OYI A;  2Q9I A;  2A45 I;  1FZB A;  1M1J C;  2HOD A;  1N73 A;  2OYI C;  3H32 B;  1FZF A;  3HUS A;  1N86 A;  3GHG A;  1LT9 B;  1LWU B;  1FZC B;  1JY3 N;  3E1I A;  1LWU C;  1RF1 A;  2FFD A;  1LT9 C;  2A45 G;  1FZC C;  2HPC A;  1FZG A;  1M1J A;  1RE4 C;  2OYH B;  1LTJ B;  2OYI B;  1JY2 N;  1LTJ C;  1RE3 C;  1JY3 P;  1RF0 C;  3H32 A;  2Z4E A;  2OYH C;  2H43 A;  2HLO A;  1N73 B;  2HOD B;  3HUS B; 
#chains in the Genus database with same CATH topology
 3USS A;  3M0D C;  4KHX A;  3BVH A;  4IFF A;  1HF9 A;  3B5N A;  3AEF C;  3NTN A;  5KAI H;  1PZQ A;  2H88 C;  1LTJ A;  1H0T B;  1G2C A;  1KOR A;  1J2J B;  2P7J A;  3CCR P;  2FFD A;  5KLV G;  1BDC A;  3AEB C;  3VMY A;  3Q2Y A;  1K8A Q;  2YMK A;  3H1L E;  1VQ4 P;  1VPC A;  3W68 A;  3KZI E;  1JCD A;  1FJK A;  1T3U A;  2QJK C;  1OIP A;  2XDJ A;  3L75 E;  2BEZ F;  5GTI H;  1BCC D;  1H0T A;  2OQQ A;  1BE3 G;  4IL6 H;  1E79 H;  5AW9 B;  1EDK A;  3V2N A;  5H2F H;  4D6T D;  1GD2 E;  2HPC B;  2N1T D;  3RK2 D;  1N73 A;  3BCC E;  2ZFC A;  3FWN A;  3LID A;  1X8Y A;  2E5Y A;  3TDK A;  3NFQ A;  5APY A;  1JY2 P;  1L4A B;  2W6A A;  2IFM A;  1W5C E;  1KYO E;  1H89 A;  1DEB A;  4W7Y A;  3ABV C;  2WWW A;  3L73 G;  3KYQ A;  3H1J D;  4HB1 A;  2OTK E;  2KSJ A;  1S5L H;  3R2P A;  3M91 A;  1KD1 Q;  3CWB D;  1EZV G;  1IJD B;  2Y0D A;  1FS0 E;  1PPJ E;  5AVY B;  4NPF X;  5BU5 A;  1URQ B;  4ZKU A;  3GG2 A;  2Y9Z A;  3JSV C;  1N8R Q;  3AEA C;  3MD0 A;  1RF1 C;  1JOC A;  2PAJ A;  3MZW B;  1N86 A;  2M3B A;  3G9R A;  1SQX G;  5KJ7 A;  1A02 F;  4A7P A;  1Y47 A;  2L5G B;  3TGU G;  3G3Z A;  1L0N J;  2AXT E;  3EFF K;  4DCK A;  4HJG H;  2WT7 A;  3JCU H;  1URQ A;  5CCG D;  2RH0 A;  1N7S C;  3G6E P;  3CPW O;  1J1D B;  2P2U A;  1FZG A;  2PP6 A;  3PRJ A;  3GHG B;  4H44 D;  4BWN A;  1M1J B;  5B66 H;  1M7L A;  5AW7 B;  2Q9I A;  1EQ7 A;  1EXI A;  3A0B H;  1LTA C;  3WUT A;  1NTZ D;  5AVU B;  3PJS K;  2M8R A;  4JYB A;  2WSF H;  4DT0 A;  2Q6Q A;  2A06 E;  2E74 C;  2J58 A;  4PJ0 E;  2C9L Y;  4L74 A;  1KYO D;  1AFO A;  5KLI C;  1H88 A;  1M1J A;  3L70 J;  3H1K J;  3H32 A;  3V4W A;  2NPS D;  5B5E H;  2IDB A;  2B88 A;  2KNC B;  3CCS P;  1OW8 A;  3PHL A;  1PPJ D;  1P84 I;  2LXB A;  1L0L E;  1FDO A;  4H13 B;  2YIU C;  3P7K A;  1NVO A;  2GM4 A;  1NAY A;  2C9N Y;  2Q3I A;  1BCC G;  5L8R J;  3HUS C;  3A0H H;  3CX5 D;  2KLV A;  2JR8 A;  1CI6 A;  2FYU J;  3CL3 D;  5CJ4 A;  1KIL A;  4D6T G;  1KFM A;  4NPD A;  3RL0 B;  3PH0 A;  1N7L A;  4M3L A;  1YYC A;  1YHQ P;  1M57 D;  2OYH B;  1K05 A;  1SQV E;  3WU2 E;  2IBZ E;  2Y0C A;  1RE4 A;  3H1H J;  2KZI A;  3S1K A;  4BRY B;  3BRV B;  4EIJ A;  1RE3 C;  2JP3 A;  2HOD B;  1FDM A;  2YKP A;  2OYH A;  3H1J G;  4EOT A;  1VQ6 P;  3D71 A;  2C0X A;  4GOD A;  1JY3 N;  2W6J H;  2WIT A;  2C0W A;  2IZ1 A;  3JC2 2;  5CCH C;  1USD A;  4BRY A;  4BXL A;  2A06 D;  4PV1 C;  1FE6 A;  2FKW B;  2KXP B;  1T2K C;  2QJP C;  1SQP J;  2O01 N;  2E74 D;  1OFC X;  3VOP A;  1HBW A;  5AW8 B;  3CXH I;  4N78 D;  1NTM J;  2YMY A;  1IK9 A;  1KB9 I;  2KS1 A;  1FZE A;  2IPP A;  3HD7 C;  3RK3 B;  2E76 C;  4K35 A;  4WY4 B;  1GK6 A;  2K9J A;  3CME P;  1L0L D;  2O1J A;  1RQV A;  4UB6 H;  2BCC J;  2K88 A;  3P8M C;  2POH A;  3L74 J;  2WQY C;  1K73 Q;  1Q81 Q;  3F89 A;  4PD4 I;  1UII A;  2NZ2 A;  1GL2 C;  4C7N B;  4WVZ A;  3QWO C;  5KLV J;  1NTZ G;  5APS A;  4EI2 A;  4NPE A;  3L72 E;  2XNX A;  3GLM A;  2OYI C;  2W6B A;  4H0L B;  2R5B A;  4HKZ H;  3RK3 E;  3CD6 P;  1IFN A;  1VQO P;  1RY3 A;  3AEG C;  2UWJ E;  2Z5H A;  4ZMD A;  1TU3 F;  1FOS F;  2XZR A;  4L75 A;  2ZT9 B;  5TIS E;  1BE3 J;  1W2B O;  1YQ4 C;  1FZB A;  4LLH A;  2E75 B;  2WMM A;  4ZNC A;  2ZXX A;  1PPJ G;  4IFM A;  3KHU A;  1LTS C;  5KAF H;  2A45 G;  3N4X A;  5AW4 B;  1OX3 A;  4U7J A;  5CCH D;  2IYP A;  2PGD A;  3FX0 A;  1T2K D;  1NTK E;  2ZYD A;  1LTT C;  1ZME C;  3RK2 C;  1PGP A;  1NHL A;  1MFZ A;  3N7N A;  3AE7 C;  1G1I A;  1R8E A;  3AE5 C;  2N1T A;  1LT9 C;  4N6J A;  4OVN F;  1GW4 A;  3MTU E;  3L73 J;  1NAF A;  1JMB A;  3CC7 P;  2LR2 A;  3Q5R A;  3E7K A;  1SFC D;  1KV4 A;  3HD7 D;  2KIK A;  2E76 D;  1LJ2 A;  3H1I J;  5KAI E;  2WTY A;  2ZYA A;  3B5N B;  1FZC C;  1LTJ B;  3VYI A;  3KXD A;  1LTG C;  5CMZ A;  1EZV I;  1CZQ A;  2FFD B;  1DD3 A;  1ZRT D;  2R3S A;  3RBZ A;  1ZR4 A;  1WMK A;  2O1K A;  2P58 A;  1GL2 D;  1LWU C;  2Q1K A;  4U3F D;  1SQX J;  1Z56 A;  3L72 D;  1ZP0 C;  2QJK B;  2LKM A;  5APX A;  3MUD C;  3KDP B;  2A06 G;  5AVX B;  3M0D A;  4IL6 E;  3IF4 A;  2JWA A;  2H8P D;  2WPS A;  4O9B A;  5H2F E;  3OW2 O;  1ZN5 A;  1JM0 A;  2Y0E A;  1NOH A;  1JY3 P;  1KTM A;  1N73 B;  1KFN A;  1JY3 O;  1VQM P;  1S1C X;  2XND H;  1L0L K;  5CCG C;  1BGY J;  2YO2 A;  1JNM A;  2NRG A;  1L0L G;  1NWQ A;  3E1I A;  2JKV A;  2B89 A;  2FXP A;  5CCG A;  1IFP A;  4Y28 J;  4UB8 H;  1Q2N A;  4I7Z B;  4H44 C;  1NTK D;  3SFE C;  1Q86 Q;  3Q5S A;  1KQG B;  5CHX A;  2KSE A;  2KOG A;  2WSS H;  2YXR B;  2AEJ A;  3L70 E;  1UIX A;  1S5L E;  3H25 A;  1SQV K;  1OXZ A;  1U7J A;  4RO0 A;  1RH5 B;  2HG5 D;  4I6M C;  1GZL A;  2B9B A;  1VQ8 P;  4AYC A;  3CCE P;  2N9B A;  2OAR A;  1NU1 J;  1DIP A;  2ZVO B;  1VQK P;  3PTZ A;  5CJ0 A;  3AE2 C;  1USE A;  2W27 A;  2ZAE B;  2NPS C;  1OVR A;  3LW5 H;  2KZJ A;  1BCC J;  1M56 D;  2FYU E;  1RF1 B;  2MKV A;  1P84 H;  1PGO A;  1QVF O;  4MN4 C;  1VQL P;  3JCU E;  1ZV8 A;  4D6T J;  1PP9 J;  2WT7 B;  3M0A A;  4WWI A;  3EFG A;  4IOI H;  2W8Z A;  2Z4E A;  1JO5 A;  3TK1 A;  5AW6 B;  1SQQ J;  2QIW A;  1L4A C;  1VF5 B;  2B87 B;  2WSE H;  1N7S B;  1M1K Q;  4DJG A;  3AE9 C;  1Q90 D;  4Y99 C;  1YBK A;  1RF1 A;  2E42 A;  5B66 E;  3H1L D;  2D2C B;  3A0B E;  3MIW A;  2FBW C;  5GTH H;  1PIX A;  1GTW A;  4C7R A;  1EDL A;  3AE4 C;  1FZA A;  5KTB A;  3MHV A;  3L75 D;  3BAT A;  4YPC A;  3MGN A;  2JDI H;  1VDF A;  3H1J J;  2QA4 P;  3OAK A;  3PP5 A;  1WT6 A;  3CWB J;  2YO3 A;  5BU8 B;  2B87 A;  2AEF A;  1N7S A;  1YIT P;  1SQP E;  2E74 B;  3EWK A;  3V6I A;  2K3R A;  2Z5I A;  3U1C A;  3Q5P A;  2I1K A;  1NKN A;  3BCC D;  2M0B A;  3H32 B;  5B5E E;  1IK7 A;  1NTM E;  2K1A A;  3KPE A;  4U3F G;  3CX5 H;  2R32 A;  1SQB E;  3L72 G;  2KUB A;  1J1E B;  5AW2 B;  3GF7 A;  3C8V A;  1AA0 A;  3SWY A;  2FXO A;  2PFX A;  1X79 B;  5AW1 B;  2BCC E;  2G8Y A;  2WPV B;  3A0H E;  3CXH H;  3LW5 J;  3B4S A;  4L73 A;  1L2P A;  1J1D C;  3A5T A;  2H7H A;  5EFW B;  1KB9 H;  1IFJ A;  1CI6 B;  3WUU A;  1H8A A;  3HUS B;  1KIL B;  2QM8 A;  4ASW A;  3GHG C;  3ITK A;  3L71 E;  1FJP A;  5AW3 B;  3H6P A;  3BAS A;  3VN0 A;  5KLV E;  4GKG A;  1XTC C;  3TNU A;  2P10 A;  3CLQ A;  1S9K E;  2WSE J;  1NTZ J;  4L76 A;  1GK4 A;  1IFI A;  1NH4 A;  1S3J A;  1NTK K;  4PD4 H;  3S9O A;  1SS1 A;  1QVG O;  3AED C;  3L36 A;  1NTK G;  1L4A D;  4GT1 A;  1KC8 Q;  3HUS A;  3SFD C;  3K5B A;  3B71 A;  1HJB A;  1KMI Z;  3GW6 A;  1EXJ A;  1S72 P;  4C46 A;  3CCM P;  5AVQ B;  1KIL E;  1OVU A;  1KYO I;  2R44 A;  1KQL A;  4PV1 B;  1GW3 A;  2QJP B;  2XU6 A;  1RE3 A;  3CC4 P;  4DOJ A;  2A45 I;  2QJY B;  3E1R A;  1NTM D;  3M9B A;  3U1A A;  2KS1 B;  3RL0 C;  4QMA A;  3L73 E;  1SQB D;  1OW7 A;  1YQ3 C;  4UB6 E;  2K9J B;  2HLO A;  3VMZ A;  3HD7 B;  3CX5 I;  5AVS B;  3H1I E;  2E76 B;  1MKM A;  5CCH A;  1S2E A;  3P32 A;  1GMJ A;  2KB7 P;  2IX7 C;  3L35 A;  2QVA A;  1RF0 C;  3H1L G;  2RMZ A;  3I55 P;  1M90 Q;  3P8C E;  3L71 D;  2CPB A;  1K04 A;  1SFC C;  1BSH A;  3C1L A;  3L75 G;  5AVW B;  3HD7 A;  1SQX E;  1S9K D;  2I8D A;  3VP8 A;  1PGQ A;  3M06 A;  2OYI B;  2ZVN B;  2JO1 A;  3M9Q A;  1PGJ A;  2GA1 A;  2DW3 A;  5AW5 B;  4Z1M H;  3BCC G;  2WSC H;  2Q7C A;  1JY2 N;  1SQV D;  3AE1 C;  1GL2 A;  5DJU B;  1IC2 A;  2IBZ D;  1LP1 A;  3NMD A;  5KAF E;  2FYN C;  1BGY E;  2RN0 A;  1QLE D;  2OYI A;  3RK3 C;  3TF5 A;  4WY4 C;  1Y8A A;  5CBO A;  3OA7 A;  3C9I A;  5E79 H;  1L0L J;  1HGV A;  3BRT B;  3OJA B;  3VP9 A;  2FYU K;  3CCJ P;  2N1T B;  3RK2 B;  1CW5 A;  1N2D C;  3PLN A;  1LT9 B;  3RL0 D;  4I2L C;  2YKQ A;  2YXQ B;  2H89 C;  1NO4 A;  3H1I D;  4XE5 B;  1NU1 E;  5APV A;  2KK7 A;  4H0L C;  3U59 A;  3II6 A;  3HTK B;  1ZW0 A;  1VQ7 P;  2HR3 A;  3CCQ P;  1AVO A;  1DEE G;  4WBA A;  1FZC B;  1T8Z A;  2OGU A;  2E5T A;  1BCC E;  5KKZ B;  2IBZ I;  1T3J A;  2J59 M;  1OWA A;  1LNQ A;  1LT9 A;  1OZH A;  1FOS E;  2HFE D;  1ZOY C;  4D6T E;  2YNY A;  1PP9 E;  3CCL P;  4R4L A;  3HE5 A;  3D6Z A;  2AEM A;  4JQ0 D;  4W80 A;  1QL1 A;  1SQP K;  2O3J A;  1SQQ E;  2ZXE B;  3HTK A;  3LIE A;  3I56 P;  1FZC A;  5M1B A;  3W67 A;  4OGQ C;  1S4X A;  2WSC J;  1NTM K;  3I5C A;  1RQU A;  1GU4 A;  2Y9Y A;  2O01 J;  1NTM G;  3TSI A;  1SQB K;  1L0N E;  2H43 A;  1LWU A;  1SQB G;  3CMA P;  3TGU J;  1BGY D;  1W2E A;  5GTI E;  3A2A A;  3AE6 C;  2I1J A;  4UB8 E;  3G4S P;  3RK3 D;  2KYV A;  2P67 A;  3CWB E;  3S4R A;  2V7Q H;  3O6Q A;  4WY4 D;  3MUD A;  4EDF A;  1LTB C;  3CC2 P;  1KN7 A;  3B5N C;  3SWK A;  2JWD A;  5BVZ A;  1LTJ C;  3V5B A;  4JF7 A;  2VRS A;  4H44 B;  2J5U A;  2L91 A;  3A7O A;  4GOE A;  1QGK B;  2JEE A;  1EDI A;  1SP4 A;  2FFD C;  3L71 G;  5KLV K;  1FZF A;  5DJT B;  3FXD A;  1NYH A;  2G3A A;  3V2Q A;  1NU1 D;  1VQ5 P;  3GMA A;  4U3F J;  3GF3 A;  1KZU B;  3L72 J;  1JTH A;  2SPZ A;  2HYN A;  4H0L D;  3V4Q A;  4LGD E;  1P84 E;  2XKM A;  1DX7 A;  3H1K E;  1HH0 A;  2NPS B;  1WRG A;  4WB4 A;  2AXC A;  1ZXG A;  2WPR A;  2IFN A;  1N73 C;  1SQV G;  4OWF A;  1MV8 A;  2IBZ G;  2ZT9 D;  1PP9 D;  1JCC A;  1R5L A;  1LTI C;  2CK3 H;  4W7Z A;  2E75 D;  1LGH B;  3KZI H;  2FYZ A;  1NTZ E;  1SQQ D;  4B86 A;  1DH3 A;  4I7Z C;  1AQ5 A;  1JY2 O;  2NPS A;  4OGQ D;  1NTK J;  4Y99 B;  5GTH E;  1AV1 A;  1R5S A;  1G1J A;  1ZLL A;  3IAO A;  1L0N D;  5APW A;  5AW0 B;  2HPC A;  2W83 C;  4YTP C;  2JJL A;  3F5H A;  2V7Q J;  3H1H E;  3H1I G;  1EDJ A;  4CPG A;  2QEX P;  4XA4 A;  3FWL A;  1L4A A;  3V2R A;  3B5N D;  1QEX A;  4RKU J;  5AVV B;  1SLQ A;  1M8O B;  1Q82 Q;  2ZJS E;  1KQF B;  3CX5 E;  1KYO H;  2K9Y A;  4K3A A;  2GUS A;  5KJ7 C;  1SQX K;  1QX8 A;  3R4Y A;  5AVZ B;  1FBM A;  1VQN P;  2BEQ D;  3B8E B;  3SWF A;  1LT1 A;  1URQ C;  2XV5 A;  3CXH E;  2CPS A;  4AUW A;  1KB9 E;  2A45 H;  3UIA A;  1IFM A;  4JYC A;  1VF5 C;  1VQ9 P;  3FXE A;  1P84 D;  2M5A B;  3L70 D;  1AJY A;  3AEE C;  3H1K D;  2LXC B;  5KLI B;  3V2P A;  3IFM A;  1CSB A;  2OTL P;  2D2C C;  1EC5 A;  3G71 P;  4IL6 X;  1VQP P;  2KI7 B;  3H1L J;  1YI2 P;  4KJM A;  3TNU B;  1Q7Y Q;  1BGY G;  2K37 A;  1U7M A;  2QG4 A;  2YIU B;  4PD4 E;  2AXT H;  3L75 J;  4HYT B;  3L74 E;  3ZDM A;  2N9Y B;  4R4M A;  2M5A A;  2FYU D;  3CCU P;  2W90 A;  1X22 A;  2PRR A;  1GU5 A;  1M1J C;  3GHG A;  2IZ0 A;  1HJ0 A;  3BCC J;  4N78 E;  1NU1 K;  2IYO A;  3H1H D;  1S5L X;  1NU1 G;  2R5D A;  1J1E C;  3WUV A;  2QM7 A;  5APT A;  2WZ7 A;  1HWT C;  2V4H A;  1BE3 E;  2P1J A;  2OTJ P;  3D70 A;  2KLU A;  4PJ0 H;  1KIL C;  2R3C A;  1YJW P;  2Q5U A;  1PP9 G;  3AE3 C;  5KJ7 D;  1SQQ K;  2KNC A;  3A3Y B;  4H13 C;  1RE4 C;  3Q1M A;  3CXH D;  1SQQ G;  1SQP D;  1URQ D;  2FY8 A;  3WMM 0;  1FC2 C;  1FAV A;  1JEK A;  1KB9 D;  3TYY A;  2BAS A;  1X9V A;  1VF5 D;  3MP7 B;  1N7S D;  1L0N K;  1YIJ P;  1L0N G;  2OYH C;  2D2C D;  5AVT B;  1SFC B;  1JUN A;  1PL5 A;  4GOF A;  1EZV E;  4GDO A;  2BCC D;  4PD4 D;  1AVY A;  3CWB G;  1T6A A;  3EQ2 A;  2RKL A;  2WSF J;  4XFJ A;  4EYY Q;  3L74 D;  3WU2 H;  4RJT A;  1RHZ B;  2ZYG A;  1YTZ T;  1NKZ B;  1FDI A;  1IZN B;  4OH8 B;  3RL0 g;  1RF0 A;  4YXW H;  3L4F A;  2HOD A;  1GL2 B;  5KLV D;  2QJY C;  1SFC A;  1LP1 B;  1MZ9 A;  1NJI Q;  3TGU E;  3FGA D;  3AEC C;  1VL2 A;  2FYN B;  1JB0 J;  5E79 E;  4ASV A;  1A02 J;  1SQB J;  3D6Y A;  4TT3 H;  4KT0 J;  3HRN A;  4HH2 A;  3L70 G;  1BSN A;  2WPQ A;  1OVV A;  1BE3 D;  3H1K G;  1X0T A;  2O01 H;  1Y9B A;  1KQS O;  5K5G B;  1KIL D;  1XTG B;  3CCV P;  5AVR B;  3IR9 A;  1ZRT E;  3L71 J;  1BDD A;  1NTZ K;  4YXD C;  5TJH A;  2QE7 H;  2WVR A;  3RGU A;  4LC1 A;  4U3F E;  1HVV A;  1K9M Q;  4WY4 A;  4ZKP A;  3AE8 C;  3HE4 B;  4H13 D;  1HUC A;  4N3Y B;  1HGZ A;  1D7M A;  3IN6 A;  3KQG A;  4IFD K;  4I1L A;  2FYU G;  3SSU A;  1ZR2 A;  5C39 A;  3NXS A;  1HTL C;  1PFI A;  3L73 D;  2OYO A;  1YJ9 P;  1DD4 A;  3HE5 B;  4C7N A;  1SQV J;  1U57 A;  2QRX A;  1EZV D;  3H1H G;  3HE4 A;  5CBN A;  1PV3 A;  4JBZ A;  1SVF A;  2Q3E A;  3VMA A;  1JMM A;  3Q3D A;  3RBX A;  3P8C D;  2ITA A;  1YTZ I;  2FXM A;  4PV1 D;  4OGQ B;  2ZT9 C;  2YKO A;  2N1T C;  3L37 A;  1SQX D;  2KP8 A;  1LWU B;  2E75 C;  1YJN P;  3TGU D;  5TIS H;  1GDT A;  4AQR D;  4TLF A;  1E5W A;  3T97 B;  1MUU A;  3O6Q B;  1SQP G;  2GUV A;  2QSI A;  3CI9 A;  1OW6 A;  3M9H A;  3VMX A;  1AQT A;  3O8Z A;  1MFT A;  4DZO A;  5APQ A;  1NGM B;  1IFD A;  1G2C B;  5KKZ C;  1IO4 A;  1QL2 A;  1FU1 A;  4RES B;  4GIF A;  1OMI A;  3H1J E;  2M3E A;  3VTP C;  3T97 A;  3QH9 A;  2MJZ A;  2E43 A;  2BCC G;  5APU A;  1JTH B;  4JPZ B;  3L74 G; 
#chains in the Genus database with same CATH homology
 4C46 A;  2W6B A;  3M0D C;  1SLQ A;  4KHX A;  3BVH A;  4IFF A;  5AVQ B;  3B5N A;  3NTN A;  1LTJ A;  2R5B A;  1G2C A;  2GUS A;  5KJ7 C;  1SQX K;  5AVZ B;  1J2J B;  1IFN A;  1FBM A;  2P7J A;  1RY3 A;  2FFD A;  3VMY A;  1KQL A;  2Z5H A;  3B8E B;  1VPC A;  3SWF A;  2XV5 A;  1URQ C;  1FOS F;  1GW3 A;  2CPS A;  2XZR A;  4AUW A;  1JCD A;  1FJK A;  1T3U A;  2XU6 A;  1RE3 A;  2A45 H;  3UIA A;  2XDJ A;  1IFM A;  4DOJ A;  4JYC A;  2A45 I;  1FZB A;  4LLH A;  3M9B A;  3U1A A;  4IFM A;  3RL0 C;  3V2P A;  1LTS C;  3IFM A;  2A45 G;  1CSB A;  3N4X A;  5AW4 B;  2HLO A;  5CCH D;  3VMZ A;  3HD7 B;  5AW9 B;  5AVS B;  3V2N A;  3TNU B;  1T2K D;  5CCH A;  1GD2 E;  2HPC B;  1LTT C;  2N1T D;  3RK2 C;  3RK2 D;  1NHL A;  1MFZ A;  3N7N A;  1N73 A;  2OYI C;  3P32 A;  2ZFC A;  1G1I A;  3LID A;  1X8Y A;  2N1T A;  1LT9 C;  2KB7 P;  2IX7 C;  4HYT B;  4N6J A;  3L35 A;  1GW4 A;  1RF0 C;  3NFQ A;  3MTU E;  5APY A;  1NAF A;  3P8C E;  2CPB A;  1JY2 P;  1L4A B;  1SFC D;  1SFC C;  3HD7 D;  1GU5 A;  1M1J C;  3GHG A;  5AVW B;  3HD7 A;  1S9K D;  2W6A A;  2IFM A;  2WTY A;  3VP8 A;  3B5N B;  1H89 A;  1FZC C;  1DEB A;  4W7Y A;  1LTJ B;  3M06 A;  2WWW A;  3VYI A;  4N78 E;  2OYI B;  1NU1 K;  3KYQ A;  1LTG C;  5CMZ A;  3M9Q A;  2R5D A;  1J1E C;  1CZQ A;  2KSJ A;  2FFD B;  3R2P A;  3M91 A;  5AW5 B;  2QM7 A;  5APT A;  1IJD B;  1ZR4 A;  5AVY B;  2WZ7 A;  2O1K A;  1GL2 D;  1LWU C;  1HWT C;  5BU5 A;  2WSC H;  1URQ B;  2Q7C A;  4ZKU A;  1Z56 A;  1JY2 N;  1GL2 A;  2P1J A;  1IC2 A;  3NMD A;  2LKM A;  1KIL C;  5APX A;  2R3C A;  3KDP B;  3MD0 A;  1RF1 C;  5AVX B;  1JOC A;  2PAJ A;  2Q5U A;  2OYI A;  3RK3 C;  3M0D A;  4WY4 C;  5KJ7 D;  1N86 A;  2M3B A;  2H8P D;  2WPS A;  3OA7 A;  4O9B A;  3C9I A;  1SQQ K;  3A3Y B;  5KJ7 A;  1ZN5 A;  1A02 F;  1HGV A;  1RE4 C;  3BRT B;  2L5G B;  3OJA B;  1NOH A;  1JY3 P;  3VP9 A;  2FYU K;  3G3Z A;  1URQ D;  1N73 B;  1KFN A;  3WMM 0;  1FAV A;  2WT7 A;  1JY3 O;  3TYY A;  2BAS A;  1X9V A;  2N1T B;  3RK2 B;  1CW5 A;  1URQ A;  1N2D C;  1L0L K;  5CCG C;  5CCG D;  2YO2 A;  1JNM A;  1LT9 B;  1N7S C;  1N7S D;  1NWQ A;  1L0N K;  3E1I A;  3RL0 D;  1J1D B;  4I2L C;  5CCG A;  2YKQ A;  2P2U A;  1FZG A;  1NO4 A;  2PP6 A;  2OYH C;  4XE5 B;  5AVT B;  1SFC B;  3GHG B;  1JUN A;  5APV A;  1M1J B;  3U59 A;  5CHX A;  3II6 A;  3HTK B;  2KOG A;  1M7L A;  5AW7 B;  2Q9I A;  1EQ7 A;  4WBA A;  1LTA C;  3EQ2 A;  1FZC B;  1SQV K;  1T8Z A;  5AVU B;  1OXZ A;  1T3J A;  2J59 M;  1YTZ T;  1OWA A;  2M8R A;  1NKZ B;  1LT9 A;  4JYB A;  4OH8 B;  2WSF H;  2HG5 D;  1FOS E;  4I6M C;  1GZL A;  4AYC A;  1RF0 A;  2N9B A;  2OAR A;  2HFE D;  2YNY A;  2J58 A;  3L4F A;  2HOD A;  2C9L Y;  1GL2 B;  3HE5 A;  1SFC A;  1MZ9 A;  1AFO A;  1H88 A;  5CJ0 A;  1M1J A;  4W80 A;  1QL1 A;  1SQP K;  2ZXE B;  3HTK A;  2W27 A;  3LIE A;  3H32 A;  3V4W A;  2NPS C;  2NPS D;  3LW5 H;  1FZC A;  1A02 J;  1RF1 B;  1NTM K;  3I5C A;  1GU4 A;  1ZV8 A;  3HRN A;  3P7K A;  4HH2 A;  2WT7 B;  3TSI A;  3M0A A;  2WPQ A;  1SQB K;  2GM4 A;  3EFG A;  2C9N Y;  2Z4E A;  2Q3I A;  1JO5 A;  2H43 A;  2O01 H;  3TK1 A;  1LWU A;  5AW6 B;  1W2E A;  3HUS C;  1KIL D;  1XTG B;  3A2A A;  5AVR B;  1L4A C;  2KLV A;  2I1J A;  2WSE H;  1CI6 A;  3CL3 D;  3IR9 A;  1N7S B;  3RK3 D;  5CJ4 A;  1KIL A;  2KYV A;  2P67 A;  4WY4 D;  1KFM A;  3MUD A;  3RL0 B;  1NTZ K;  4Y99 C;  1LTB C;  1RF1 A;  2E42 A;  1N7L A;  4M3L A;  4LC1 A;  1HVV A;  1YYC A;  4WY4 A;  4ZKP A;  3B5N C;  3HE4 B;  2OYH B;  5BVZ A;  1HUC A;  4N3Y B;  1LTJ C;  1HGZ A;  3MIW A;  3V5B A;  4JF7 A;  2VRS A;  3A7O A;  3KQG A;  4IFD K;  1GTW A;  4C7R A;  2JEE A;  4I1L A;  1RE4 A;  1FZA A;  5KTB A;  1SP4 A;  2FFD C;  3BAT A;  3MGN A;  5KLV K;  1VDF A;  1FZF A;  1ZR2 A;  3BRV B;  3OAK A;  4EIJ A;  3NXS A;  3PP5 A;  1HTL C;  1PFI A;  1WT6 A;  2YO3 A;  5BU8 B;  1RE3 C;  1N7S A;  3V2Q A;  2HOD B;  3HE5 B;  4C7N A;  1KZU B;  1FDM A;  1JTH A;  2Z5I A;  2HYN A;  3U1C A;  2YKP A;  3HE4 A;  2OYH A;  2I1K A;  1NKN A;  4EOT A;  3H32 B;  3V4Q A;  1SVF A;  4LGD E;  2C0X A;  1JY3 N;  2XKM A;  1DX7 A;  2WIT A;  2C0W A;  1JMM A;  1HH0 A;  2NPS B;  3KPE A;  1WRG A;  4WB4 A;  5CCH C;  2R32 A;  2WPR A;  2IFN A;  3P8C D;  1N73 C;  1J1E B;  1YTZ I;  2FXM A;  2FKW B;  5AW2 B;  1MV8 A;  1T2K C;  2YKO A;  3SWY A;  1JCC A;  2N1T C;  1X79 B;  3L37 A;  5AW1 B;  1LTI C;  3VOP A;  4W7Z A;  1HBW A;  2KP8 A;  5AW8 B;  1LWU B;  1LGH B;  2FYZ A;  4B86 A;  1J1D C;  1GDT A;  4N78 D;  4AQR D;  3A5T A;  2H7H A;  1E5W A;  1IFJ A;  1CI6 B;  1H8A A;  2YMY A;  1IK9 A;  1MUU A;  1DH3 A;  3HUS B;  1KIL B;  2QM8 A;  1FZE A;  1AQ5 A;  3GHG C;  2IPP A;  2GUV A;  3CI9 A;  3HD7 C;  1FJP A;  3RK3 B;  1JY2 O;  2NPS A;  4WY4 B;  1GK6 A;  5AW3 B;  2O1J A;  3H6P A;  3BAS A;  4Y99 B;  3M9H A;  3VN0 A;  3VMX A;  4GKG A;  1G1J A;  1ZLL A;  1XTC C;  3TNU A;  3O8Z A;  5APW A;  4DZO A;  5AW0 B;  3CLQ A;  1S9K E;  5APQ A;  2HPC A;  1IFD A;  1G2C B;  2JJL A;  3P8M C;  2POH A;  1IO4 A;  1QL2 A;  1GK4 A;  1IFI A;  1FU1 A;  1NH4 A;  4RES B;  4GIF A;  1NTK K;  3VTP C;  3L36 A;  1L4A D;  4GT1 A;  3T97 A;  3HUS A;  1GL2 C;  2MJZ A;  2E43 A;  4XA4 A;  1L4A A;  5APU A;  4C7N B;  1JTH B;  1HJB A;  3V2R A;  3B5N D;  5APS A;  2XNX A;  5AVV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...