2Z4EA

Crystal structure of d-dimer from human fibrin complexed with gly-his-arg-pro-tyr-amide
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
67
structure length
67
Chain Sequence
VIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Probing the beta-chain hole of fibrinogen with synthetic peptides that differ at their amino termini
pubmed doi rcsb
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
total genus 22
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2z4eA00
1M1JB 1RE4C 2OYHA 1W2EA 1N73C 1LWUB 1FZGA 1JY3O 2OYIC 1RE3A 1T3UA 1N86A 1RF1B 2HLOA 3GHGA 3H32B 2HODB 3GHGB 3H32A 2Q9IA 2HPCB 1LT9C 2FFDC 1LTJA 2XNXA 1JY3N 2Z4EA 2FFDB 2A45G 3BVHA 1RE4A 1M1JC 1M1JA 1FZBA 1FZCA 1FZCB 1JY2O 1RF0C 3E1IA 2OYHC 1LT9A 1N73B 1LTJC 2FFDA 2A45I 2OYIB 1FZAA 3GHGC 1LTJB 3HUSB 1RE3C 1RF1C 2A45H 2HODA 2HPCA 1FZFA 1RF1A 3HUSC 3HUSA 1N73A 1LT9B 2OYIA 1FZEA 1JY3P 2H43A 1JY2P 1RF0A 1LWUA 1LWUC 1JY2N 1FZCC 2OYHB
chains in the Genus database with same CATH superfamily
3RL0g 2RH0A 2Y9YA 3TDKA 1VQKP 4NPDA 4C7RA 3R4YA 1E5WA 1KFMA 1PPJD 1RQUA 3BRTB 2K1AA 2E75C 3OAKA 4IL6E 1EXJA 1RQVA 4PD4E 5CCHD 3P8CD 2WT7A 4RO0A 2MKVA 3AECC 3CCMP 2YXRB 3H1LE 3Q5PA 4Z1MH 3V5BA 5KAFE 1M1JC 1YYCA 2R3SA 1NTMJ 1K73Q 4RKUJ 4PD4I 1FDMA 1PGOA 1H89A 1BGYG 2BASA 3BRVB 1OFCX 3Q5RA 3PLNA 4QMAA 3G3ZA 3NXSA 4WY4B 2Q5UA 1M1KQ 1EDKA 1VQLP 1HGVA 3LW5J 1EZVD 1KYOI 1AVOA 3A0HH 5APUA 3TSIA 3CX5I 3FWLA 3L37A 5KAIE 4C7NB 4I7ZC 1BSHA 4NPEA 1Q82Q 3L74J 4UB6E 1LWUC 1CZQA 1KQLA 2KS1A 1X9VA 2I1JA 2P67A 2QIWA 4N3YB 3USSA 5B5EE 1NGMB 1KB9H 1NYHA 4YPCA 4GOEA 1SQXJ 2G8YA 3MTUE 1RE3A 3VMYA 1N86A 2WZ7A 1R8EA 4JF7A 4O9BA 2C0XA 1LT9C 2BCCE 3M9QA 3RK2D 1SQBG 3L71D 1U57A 2W6JH 1SQPD 2KXPB 2XDJA 1GW3A 2ZYGA 2KOGA 1X22A 2N9BA 1OWAA 1S5LH 1M1JA 5CCHC 5GTIH 1PFIA 2WPSA 1NTZJ 1RF0C 3CWBE 1HUCA 2WITA 1FAVA 1KILA 1VQ7P 2Q3IA 4LLHA 3B71A 1SQXD 3RGUA 2L5GB 3ITKA 1YITP 2GA1A 5M1BA 3CCUP 3KDPB 1KZUB 4YXDC 3O6QA 4HYTB 2ZYAA 3L70E 3TF5A 2WSCJ 1OZHA 2OTLP 2H43A 2PFXA 4H0LD 2FKWB 1JY2N 1GK4A 3VOPA 1W2EA 3KHUA 1NTZD 1Y47A 2QM8A 1SQBE 5AW5B 1JY3O 3FXDA 3TNUB 3VMZA 1LJ2A 3WU2H 1PGQA 1T3UA 3EFGA 4ASVA 3HE5A 1PZQA 3CL3D 3T97B 1VF5D 3RL0B 3VYIA 3AEFC 3H1KD 1K8AQ 1YQ3C 1JEKA 1IFNA 1ZV8A 2IBZE 1QL2A 1BCCD 2M0BA 2WSEH 5CCHA 2Z5HA 3L72E 3IFMA 3PRJA 1HH0A 3EQ2A 3V2QA 1N8RQ 1L4AD 1SQVJ 2K37A 3V4QA 3AE6C 3B5NB 3AE5C 1GDTA 5AW0B 3W67A 3B8EB 1HBWA 3AEGC 1N7SD 2A45H 1AQTA 1ZR2A 4PD4H 5CBNA 3GF7A 5APQA 1JY2P 3B5ND 1YJWP 1QX8A 1RF0A 4OVNF 3CX5H 1EZVG 4LC1A 1LNQA 1KILC 1N7SB 1Q7YQ 5CCGC 3WMM0 2M3BA 4PV1D 4H0LC 3HD7C 2A06D 2FYUJ 1LT1A 1URQC 2ZT9C 4XE5B 3P8CE 1GL2B 3CXHH 1VQ4P 3AE1C 3M9BA 2D2CB 2FYUD 3N7NA 2WSFH 3P7KA 3S9OA 2W6BA 2A45G 3BCCJ 2HG5D 2Q3EA 2AEMA 3H1HE 4D6TJ 1GL2D 2E5TA 3L71E 3EFFK 4K35A 3OA7A 1MFTA 4Y99C 4MN4C 3Q1MA 5BVZA 1OW8A 3FWNA 2KIKA 1FZAA 3U1CA 1JO5A 1X8YA 3CC4P 5KLVD 1FOSE 2FY8A 3HUSC 2E42A 1S5LX 2JO1A 2OGUA 1E79H 2E74D 2JEEA 1IK7A 3H1JD 1J1DC 2YNYA 2NZ2A 5B66E 4H13C 3F89A 4U3FE 1SQPK 4YXWH 1N73C 1GMJA 2B9BA 3H1LG 1ZN5A 3H1IJ 1NVOA 2JP3A 1KILD 4GIFA 2CPBA 2M3EA 2V4HA 2WSCH 1YQ4C 1L0LG 3TGUE 5AVYB 4UB8E 2YO3A 1BGYE 1JY3N 1ZP0C 1KMIZ 2YIUC 3F5HA 1NTKK 3CX5D 2ZXXA 5TISE 1MKMA 2WMMA 1KILB 3L75G 3MP7B 1NHLA 1JTHA 3KQGA 1KB9D 1ZOYC 1LTBC 4UB6H 3AEEC 1Y9BA 5GTIE 3GG2A 2B87B 5B66H 1URQA 1LTAC 1PV3A 1S5LE 3A0BE 4K3AA 3SWYA 3CI9A 2XV5A 1GL2C 1NTKJ 1CI6B 1CSBA 1GU5A 1FZFA 1RF1A 1RF1C 3HUSA 1MZ9A 2Y9ZA 1DH3A 1EXIA 1SQQE 1SFCB 4AQRD 1FZEA 5AW6B 1JY3P 3C1LA 1OX3A 2YKOA 2P7JA 3L73E 3SWFA 2KNCA 1IC2A 1VDFA 2V7QJ 2QE7H 1LP1A 1RE4C 1L0NE 1NU1E 2E75D 1BSNA 2ZVNB 1BGYD 4A7PA 3ABVC 1FZGA 3Q3DA 2QJKC 1BCCJ 5K5GB 1KC8Q 1Y8AA 2BEZF 2HR3A 3A0HE 3HTKA 3H1KE 1QVFO 1J2JB 1L4AB 4IFFA 1L0LK 2DW3A 4PD4D 1J1DB 1NH4A 3L36A 2Z4EA 4PJ0E 1BE3J 2O01N 4OGQC 1TU3F 3O8ZA 2K3RA 3EWKA 1T2KD 1GW4A 1JCCA 3CXHI 2PAJA 2WPVB 5CCGA 1NKZB 1N2DC 3L73D 1KFNA 1FE6A 1SFCA 1SVFA 2M8RA 1Q2NA 2O3JA 3L72G 3M0DC 2FFDA 1FOSF 1KQGB 2E5YA 3VN0A 4R4MA 1ZRTD 4N78E 5AW8B 1VQ8P 2ZVOB 1PP9J 2FYUK 4DT0A 2R5DA 3JC22 3G9RA 5AW3B 2YXQB 3K5BA 3KYQA 1LWUB 3H1IG 3H1JE 3UIAA 1MFZA 3RK2C 1KQSO 1JNMA 3GW6A 1SQXG 1OW6A 3H32B 1RF1B 3L73G 2HODB 1YTZT 4W80A 2ZFCA 1ZR4A 3L75E 2QJYB 2HPCB 2B89A 1KYOE 3AEDC 1AV1A 3JSVC 3BCCG 2QSIA 1KQFB 3TNUA 2A06G 2FXPA 5AVUB 1RE4A 2YO2A 1FZBA 5AW1B 1LTSC 2CK3H 2W90A 3MGNA 3P32A 5AVRB 1VQ6P 3CWBD 4DZOA 1AFOA 2A45I 3AE3C 2P2UA 4XA4A 5KLVE 3GHGC 1LTJB 2LKMA 2JKVA 2QRXA 1NTZK 4IOIH 5C39A 2XU6A 1KB9I 1JOCA 5KJ7C 5KKZB 3I55P 3L70D 1DX7A 5APSA 2N1TC 4EIJA 1S1CX 2MJZA 2W6AA 2N1TA 3MD0A 2KK7A 5AVTB 1J1EB 3L74G 1OXZA 2XNDH 1SQQD 2FXOA 2QJPC 3G4SP 1FJKA 1T3JA 3B4SA 2KYVA 3JCUE 3KPEA 4H44B 3CCLP 3H1LJ 4GDOA 2OYOA 3D6ZA 5AW7B 1GL2A 3H25A 4L75A 4AYCA 1NTME 1Q86Q 1QGKB 1IFJA 1LTIC 2QG4A 1KORA 2V7QH 5TJHA 3V2PA 1EDJA 1A02F 1JB0J 1KB9E 2NPSA 2IPPA 5EFWB 5AVWB 1JCDA 3RK3B 1FZCA 3H1ID 4IFDK 3H6PA 4M3LA 1LGHB 3AE4C 1SQVG 2WSSH 3H1HG 1GZLA 5AW9B 2VRSA 4GT1A 2I1KA 3H1LD 5KAIH 4EOTA 1NOHA 3L74E 5AVXB 3WUVA 5KJ7A 1D7MA 1VPCA 2OYIA 3C8VA 5H2FH 1PP9D 1YTZI 2KB7P 1PP9G 3IF4A 4HKZH 1YJNP 2W83C 1NU1D 1L0ND 3MHVA 3FX0A 3CC2P 1K04A 5H2FE 3NMDA 4BRYA 3AE9C 4EI2A 2OYHA 4HJGH 5KAFH 1BE3D 1SFCD 5AVSB 4C46A 4GOFA 1VQPP 4WB4A 2C9NY 2LXBA 2H8PD 5CCGD 1S9KD 1HTLC 1A02J 5BU8B 4IL6H 3CWBJ 3HE5B 3M0AA 3QWOC 2E75B 3HD7D 2B87A 2KZIA 4JYBA 4WWIA 2H89C 1S3JA 1DEEG 3PH0A 3AEBC 5TISH 2I8DA 1J1EC 4U7JA 3SWKA 1T6AA 1NTMG 1L0LE 3TGUG 2AEJA 4WY4C 2OYIB 1NAFA 2IBZG 3NFQA 3O6QB 1K05A 3T97A 1QLED 1G2CA 2P10A 2KSEA 3II6A 4PV1B 5GTHH 4ASWA 1LT9B 5KTBA 4D6TE 2C0WA 1KD1Q 1DD4A 1JUNA 1ZXGA 5APYA 1FC2C 2K9YA 3HE4A 4U3FD 1P84H 1SQVK 2E74C 2D2CD 2KP8A 3MZWB 3D6YA 3CD6P 2ZYDA 1FS0E 1SQPJ 3GHGA 1EDIA 1QEXA 4R4LA 4JQ0D 3FGAD 2IX7C 1KYOD 2QM7A 1VQOP 4KT0J 5CHXA 4IL6X 3PTZA 4KHXA 1WMKA 1BDCA 2CPSA 2JJLA 3E1RA 3H1KG 1JTHB 3WUUA 2O1KA 4ZKUA 3V2RA 4C7NA 5GTHE 1S9KE 1PPJE 3CXHE 4I2LC 1GD2E 1FJPA 2RKLA 2ZJSE 2L91A 1L4AC 1GK6A 1JM0A 4BXLA 2AXCA 2KZJA 2P58A 3LIEA 2AXTE 1Q81Q 1RH5B 1WRGA 3I5CA 3OJAB 5CMZA 5KLVK 2O01H 1DD3A 2FYUE 2GUSA 1R5LA 2ITAA 2NPSC 1FZCC 1OW7A 3CCVP 5AW2B 1ZMEC 3G71P 2IYPA 3WUTA 3L4FA 3Q2YA 1CW5A 1H0TA 2NRGA 1SQXK 1G2CB 2YMKA 3BASA 2Q9IA 3CMEP 1EZVE 1R5SA 2D2CC 5APWA 3AEAC 3L71J 3RBZA 1SQXE 2E76C 5BU5A 4H44D 2FFDB 2KNCB 2R3CA 3HD7A 4Y99B 2FXMA 3A5TA 1JMBA 5KLIC 1L2PA 2BCCJ 3E1IA 1SP4A 2OYHC 4JPZB 1LTJC 3IN6A 2KUBA 3A0BH 3HRNA 4OGQD 3SFEC 3PP5A 5DJTB 3GLMA 1HJ0A 1NTZE 1IFDA 1URQB 2QJYC 2ZT9B 3P8MC 4U3FJ 4U3FG 2K9JA 3WU2E 2W8ZA 1YIJP 3E7KA 3AE7C 4DCKA 1KTMA 2Y0EA 1M8OB 4CPGA 3L70J 1IFIA 3GF3A 1BDDA 1N7SA 1VF5C 1M56D 2PP6A 2YKQA 1IFMA 2FYZA 2YMYA 1IK9A 2IBZD 1NKNA 1U7MA 2M5AA 3V4WA 1FZCB 1BCCG 2Q7CA 2NPSD 1L4AA 1HJBA 3BCCD 4YTPC 1YBKA 2LR2A 2FYNB 3JCUH 1VQ5P 2KLUA 1KV4A 3AE2C 1SQBJ 3CCQP 1HVVA 1H8AA 4W7ZA 2ZXEB 2XNXA 3L75D 4IFMA 4N6JA 2IFMA 3W68A 4RJTA 3KXDA 1VQMP 4DOJA 2NPSB 4I7ZB 4NPFX 1LP1B 2BEQD 4WVZA 1NTKE 1EQ7A 1JY2O 1L0LD 3KZIE 3LW5H 3VP8A 2JWDA 3C9IA 1P84D 3HD7B 3GMAA 4L74A 1SQQJ 2B88A 2LXCB 1GTWA 3U1AA 1AVYA 1G1IA 5AVZB 3HUSB 3CCJP 2N1TD 3S1KA 3L72J 3B5NC 3Q5SA 1QVGO 1H88A 1USEA 2G3AA 1L0NJ 1NU1J 1SQVE 1Z56A 2PGDA 3CXHD 1L0NG 1NU1G 5AVVB 4EDFA 1BCCE 2WSFJ 1H0TB 3L72D 1XTGB 3S4RA 1VL2A 2N1TB 1EZVI 3BATA 1ZLLA 1W5CE 5E79E 4H13B 2GUVA 3M06A 1LTTC 3H1HD 3CPWO 2HLOA 2O01J 1NO4A 1FDIA 3AE8C 1SQPG 2BCCD 3A7OA 1SQBD 2M5AB 2JR8A 3L71G 4I1LA 3RBXA 1PL5A 4RESB 3VMAA 1AJYA 1GU4A 2IZ1A 3MUDA 4TLFA 2QA4P 2JDIH 3BVHA 1HWTC 2RMZA 3MUDC 2WPQA 5E79H 1RHZB 5CJ0A 1LT9A 3RK3E 1HF9A 2K9JB 3U59A 2H7HA 2A06E 4JBZA 2FBWC 3BCCE 1NTKG 2N9YB 3H1HJ 1T2KC 2FYNC 2IDBA 1KYOH 2HODA 3B5NA 2R5BA 1UIIA 3CCSP 2OTJP 3L74D 1SLQA 1T8ZA 2K88A 3TYYA 4ZKPA 2WSEJ 1L0NK 1NU1K 1OIPA 2Z5IA 1KILE 3A3YB 3H1JJ 3QH9A 1PIXA 2AEFA 1JMMA 1NTKD 1SFCC 1QL1A 3L70G 2WWWA 4LGDE 2ZAEB 4JYCA 1DEBA 2WVRA 1SQQK 1P84E 2KS1B 2QJKB 3KZIH 3V6IA 2WT7B 1NTMD 4EYYQ 2OTKE 4OWFA 4GODA 5DJUB 4D6TG 4BWNA 4W7YA 1USDA 2R32A 4HH2A 3CWBG 3RK3D 1OVVA 2O1JA 3HTKB 2RN0A 1NTMK 3FXEA 3LIDA 3NTNA 5AW4B 4DJGA 4AUWA 1KN7A 1SQBK 3H1IE 3N4XA 4WY4A 2J5UA 4OH8B 4ZNCA 4OGQB 1YHQP 4WY4D 1ZRTE 1PPJG 1XTCC 1BE3G 3TGUJ 1N7SC 4Y28J 5CBOA 1M7LA 1BGYJ 4XFJA 3MIWA 1FDOA 1S2EA 1NJIQ 1FBMA 2YKPA 1N7LA 4GKGA 2IBZI 1AQ5A 1EDLA 1MV8A 1U7JA 3VMXA 1N73A 2C9LY 2Y0DA 1K9MQ 3TK1A 4L73A 1IZNB 1YI2P 5KLVG 3CLQA 5KJ7D 4L76A 4PJ0H 1FU1A 1SQVD 1OVRA 1URQD 2ZT9D 3L35A 3RK2B 5B5EH 3D70A 5APXA 1M90Q 1NAYA 2SPZA 2OYIC 1OMIA 1HGZA 3L73J 2E74B 3CCRP 3IR9A 2IFNA 2OQQA 2UWJE 1CI6A 3A2AA 3GHGB 1G1JA 2FYUG 1VQ9P 1PGPA 1IFPA 2KI7B 2POHA 4PV1C 1UIXA 3RL0C 3M0DA 2Y0CA 2R44A 3PJSK 4ZMDA 2FFDC 2QEXP 3IAOA 3RK3C 3CCEP 5CJ4A 2WPRA 1M57D 2KSJA 3H1KJ 3VTPC 1W2BO 1MUUA 1SQQG 1X79B 2OARA 2WTYA 1WT6A 3I56P 3OW2O 4H0LB 4I6MC 1BE3E 1ZW0A 4D6TD 5KKZC 2AXTH 4KJMA 4UB8H 1YJ9P 1NWQA 4H13D 1P84I 4WBAA 4B86A 4HB1A 1EC5A 2WQYC 1S72P 1RY3A 3SFDC 2IYOA 3M9HA 1VQNP 3D71A 2YIUB 2XKMA 5APVA 1OVUA 2Q6QA 4TT3H 5KLIB 2E43A 1M1JB 2XZRA 1PGJA 2J59M 3SSUA 1IO4A 2QJPB 5APTA 3M91A 3V2NA 1PP9E 2IZ0A 3H32A 3G6EP 3TGUD 3PHLA 4N78D 2HYNA 2JWAA 1L0LJ 1LTJA 1DIPA 3CX5E 4BRYB 5L8RJ 1SS1A 2W27A 1LTGC 3HE4B 3ZDMA 1VF5B 1AA0A 3L75J 2E76D 3RL0D 1NTZG 2BCCG 4H44C 2H88C 2PRRA 1IJDB 5AVQB 1N73B 2KLVA 2GM4A 2HFED 1RE3C 1S4XA 2Q1KA 2HPCA 2J58A 3VP9A 3CC7P 2E76B 3R2PA 2P1JA 1Q90D 5KLVJ 3H1JG 1SQPE 3CMAP 1LWUA 2QVAA 1X0TA 2OYHB
chains in the Genus database with same CATH topology
4C7RA 1E5WA 1KFMA 3BRTB 3OAKA 5CCHD 3P8CD 2WT7A 3V5BA 1M1JC 1YYCA 1FDMA 1H89A 3BRVB 2BASA 3G3ZA 3NXSA 4WY4B 2Q5UA 1HGVA 3TSIA 5APUA 3L37A 4C7NB 1LWUC 1CZQA 1KQLA 2P67A 1X9VA 2I1JA 3MTUE 3VMYA 1RE3A 1N86A 2WZ7A 4JF7A 2C0XA 1LT9C 3M9QA 3RK2D 2XDJA 1GW3A 2KOGA 2N9BA 1OWAA 5CCHC 1M1JA 1PFIA 2WPSA 1RF0C 1HUCA 2WITA 1FAVA 1KILA 2Q3IA 4LLHA 2L5GB 3KDPB 1KZUB 4HYTB 2H43A 2FKWB 1JY2N 1GK4A 3VOPA 1W2EA 2QM8A 5AW5B 3TNUB 1JY3O 3VMZA 1T3UA 3EFGA 3HE5A 3CL3D 3VYIA 3RL0B 1ZV8A 1IFNA 1QL2A 2WSEH 5CCHA 2Z5HA 3IFMA 1HH0A 3EQ2A 3V2QA 1L4AD 3V4QA 3B5NB 1GDTA 5AW0B 3B8EB 1HBWA 1N7SD 2A45H 1ZR2A 5APQA 1JY2P 3B5ND 1RF0A 4LC1A 1N7SB 1KILC 5CCGC 3WMM0 2M3BA 3HD7C 4XE5B 1URQC 3P8CE 1GL2B 3M9BA 3N7NA 3P7KA 2WSFH 2W6BA 2A45G 2HG5D 1GL2D 4Y99C 3OA7A 5BVZA 1JO5A 1FZAA 3U1CA 1X8YA 3HUSC 2E42A 2JEEA 1J1DC 2YNYA 1SQPK 1N73C 1ZN5A 1KILD 4GIFA 2CPBA 2WSCH 5AVYB 2YO3A 1JY3N 1NTKK 1KILB 1NHLA 1JTHA 3KQGA 1LTBC 1URQA 1LTAC 3SWYA 3SWFA 1GU5A 3CI9A 2XV5A 1GL2C 1RF1C 1CSBA 1CI6B 1FZFA 1RF1A 3HUSA 1MZ9A 1DH3A 1SFCB 4AQRD 1FZEA 5AW6B 1JY3P 2YKOA 2P7JA 2WPQA 1IC2A 1VDFA 4N3YB 1RE4C 1FZGA 3HTKA 1J2JB 1L4AB 4IFFA 1L0LK 1J1DB 1NH4A 3L36A 2Z4EA 1T2KD 3O8ZA 1GW4A 1JCCA 5CCGA 2PAJA 1NKZB 1N2DC 4EOTA 1KFNA 1SFCA 1SVFA 2M8RA 3M0DC 2FFDA 1FOSF 3VN0A 4N78E 5AW8B 2FYUK 2R5DA 5AW3B 3KYQA 1LWUB 3UIAA 1MFZA 3RK2C 1JNMA 1RF1B 3H32B 2HODB 1YTZT 4W80A 2ZFCA 1ZR4A 2HPCB 3TNUA 5AVUB 1RE4A 2YO2A 1FZBA 5AW1B 1LTSC 3MGNA 3P32A 5AVRB 4DZOA 1AFOA 2A45I 4XA4A 2P2UA 3GHGC 1LTJB 2LKMA 1NTZK 2XU6A 5KJ7C 1JOCA 1DX7A 5APSA 2N1TC 4EIJA 2MJZA 2W6AA 2N1TA 3MD0A 5AVTB 1J1EB 1OXZA 1FJKA 1T3JA 2KYVA 3KPEA 5AW7B 1GL2A 4AYCA 3V2PA 1IFJA 1LTIC 1A02F 2NPSA 2IPPA 5AVWB 1FZCA 1JCDA 3RK3B 4IFDK 3H6PA 4M3LA 1LGHB 5AW9B 1GZLA 2VRSA 4GT1A 2I1KA 1NOHA 5AVXB 5KJ7A 1VPCA 2OYIA 1YTZI 2KB7P 3NMDA 2OYHA 5AVSB 1SFCD 4C46A 4WB4A 2C9NY 2H8PD 5CCGD 1HTLC 1A02J 5BU8B 3M0AA 3HE5B 3HD7D 4JYBA 1J1EC 4WY4C 2OYIB 1NAFA 3NFQA 3T97A 1G2CA 3II6A 1LT9B 5KTBA 2C0WA 1JUNA 5APYA 3HE4A 1SQVK 2KP8A 3GHGA 2IX7C 2QM7A 5CHXA 4KHXA 2CPSA 2JJLA 1JTHB 4ZKUA 2O1KA 1S9KE 3V2RA 4C7NA 4I2LC 1GD2E 1FJPA 1L4AC 1GK6A 3LIEA 1WRGA 3I5CA 3OJAB 5CMZA 5KLVK 2O01H 2GUSA 2NPSC 1FZCC 5AW2B 3L4FA 1CW5A 1SQXK 1G2CB 3BASA 2Q9IA 5APWA 5BU5A 2FFDB 2R3CA 3HD7A 4Y99B 2FXMA 3A5TA 3E1IA 2OYHC 1SP4A 1LTJC 3HRNA 3PP5A 1URQB 1IFDA 3P8MC 1S9KD 1IFIA 2YMYA 1N7SA 2PP6A 2YKQA 1IFMA 2FYZA 1IK9A 1NKNA 3V4WA 2Q7CA 2NPSD 1L4AA 1HJBA 1H8AA 1HVVA 4W7ZA 2ZXEB 4IFMA 4N6JA 2IFMA 4DOJA 2NPSB 1FZCB 1EQ7A 1JY2O 3LW5H 3VP8A 3C9IA 3HD7B 1GTWA 3U1AA 1G1IA 5AVZB 3HUSB 2N1TD 3B5NC 1H88A 1Z56A 5AVVB 1XTGB 3BATA 2N1TB 1ZLLA 2GUVA 3M06A 1LTTC 2HLOA 1NO4A 3A7OA 4I1LA 4RESB 1GU4A 3MUDA 3BVHA 1HWTC 5CJ0A 1LT9A 3U59A 2H7HA 1T2KC 2HODA 3B5NA 2R5BA 3TYYA 1SLQA 1T8ZA 4ZKPA 1L0NK 1NU1K 2Z5IA 3A3YB 4O9BA 1JMMA 1SFCC 1QL1A 4LGDE 2WWWA 4JYCA 1DEBA 1SQQK 2WT7B 4W7YA 2R32A 4HH2A 3RK3D 2O1JA 3HTKB 5AW4B 3NTNA 1NTMK 3LIDA 4AUWA 1SQBK 3N4XA 4WY4A 4OH8B 4WY4D 1XTCC 1N7SC 1M7LA 3MIWA 1FBMA 2YKPA 1N7LA 4GKGA 1AQ5A 1MV8A 3VMXA 1N73A 2C9LY 3TK1A 3CLQA 5KJ7D 1FOSE 1FU1A 1URQD 3L35A 3RK2B 5APXA 2OYIC 1HGZA 3IR9A 2IFNA 1CI6A 3A2AA 3GHGB 1G1JA 2POHA 3RL0C 3M0DA 2FFDC 3RK3C 5CJ4A 2WPRA 2KSJA 3VTPC 1MUUA 1X79B 2OARA 2WTYA 1WT6A 4I6MC 1NWQA 4WBAA 4B86A 1RY3A 3M9HA 2XKMA 5APVA 2E43A 1M1JB 2XZRA 1IO4A 2J59M 5APTA 3M91A 3V2NA 3H32A 4N78D 2HYNA 1LTJA 2W27A 1LTGC 3HE4B 3RL0D 5AVQB 1N73B 1IJDB 2KLVA 2GM4A 2HFED 1RE3C 2HPCA 2J58A 3VP9A 3R2PA 2P1JA 1LWUA 2XNXA 2OYHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1J B;  1RE4 C;  2OYH A;  1W2E A;  1N73 C;  1LWU B;  1FZG A;  1JY3 O;  2OYI C;  1RE3 A;  1T3U A;  1N86 A;  1RF1 B;  2HLO A;  3GHG A;  3H32 B;  2HOD B;  3GHG B;  3H32 A;  2Q9I A;  2HPC B;  1LT9 C;  2FFD C;  1LTJ A;  2XNX A;  1JY3 N;  2Z4E A;  2FFD B;  2A45 G;  3BVH A;  1RE4 A;  1M1J C;  1M1J A;  1FZB A;  1FZC A;  1FZC B;  1JY2 O;  1RF0 C;  3E1I A;  2OYH C;  1LT9 A;  1N73 B;  1LTJ C;  2FFD A;  2A45 I;  2OYI B;  1FZA A;  3GHG C;  1LTJ B;  3HUS B;  1RE3 C;  1RF1 C;  2A45 H;  2HOD A;  2HPC A;  1FZF A;  1RF1 A;  3HUS C;  3HUS A;  1N73 A;  1LT9 B;  2OYI A;  1FZE A;  1JY3 P;  2H43 A;  1JY2 P;  1RF0 A;  1LWU A;  1LWU C;  1JY2 N;  1FZC C;  2OYH B; 
#chains in the Genus database with same CATH topology
 3RL0 g;  2RH0 A;  2Y9Y A;  3TDK A;  1VQK P;  4NPD A;  4C7R A;  3R4Y A;  1E5W A;  1KFM A;  1PPJ D;  1RQU A;  3BRT B;  2K1A A;  2E75 C;  3OAK A;  4IL6 E;  1EXJ A;  1RQV A;  4PD4 E;  5CCH D;  3P8C D;  2WT7 A;  4RO0 A;  2MKV A;  3AEC C;  3CCM P;  2YXR B;  3H1L E;  3Q5P A;  4Z1M H;  3V5B A;  5KAF E;  1M1J C;  1YYC A;  2R3S A;  1NTM J;  1K73 Q;  4RKU J;  4PD4 I;  1FDM A;  1PGO A;  1H89 A;  1BGY G;  2BAS A;  3BRV B;  1OFC X;  3Q5R A;  3PLN A;  4QMA A;  3G3Z A;  3NXS A;  4WY4 B;  2Q5U A;  1M1K Q;  1EDK A;  1VQL P;  1HGV A;  3LW5 J;  1EZV D;  1KYO I;  1AVO A;  3A0H H;  5APU A;  3TSI A;  3CX5 I;  3FWL A;  3L37 A;  5KAI E;  4C7N B;  4I7Z C;  1BSH A;  4NPE A;  1Q82 Q;  3L74 J;  4UB6 E;  1LWU C;  1CZQ A;  1KQL A;  2KS1 A;  1X9V A;  2I1J A;  2P67 A;  2QIW A;  4N3Y B;  3USS A;  5B5E E;  1NGM B;  1KB9 H;  1NYH A;  4YPC A;  4GOE A;  1SQX J;  2G8Y A;  3MTU E;  1RE3 A;  3VMY A;  1N86 A;  2WZ7 A;  1R8E A;  4JF7 A;  4O9B A;  2C0X A;  1LT9 C;  2BCC E;  3M9Q A;  3RK2 D;  1SQB G;  3L71 D;  1U57 A;  2W6J H;  1SQP D;  2KXP B;  2XDJ A;  1GW3 A;  2ZYG A;  2KOG A;  1X22 A;  2N9B A;  1OWA A;  1S5L H;  1M1J A;  5CCH C;  5GTI H;  1PFI A;  2WPS A;  1NTZ J;  1RF0 C;  3CWB E;  1HUC A;  2WIT A;  1FAV A;  1KIL A;  1VQ7 P;  2Q3I A;  4LLH A;  3B71 A;  1SQX D;  3RGU A;  2L5G B;  3ITK A;  1YIT P;  2GA1 A;  5M1B A;  3CCU P;  3KDP B;  1KZU B;  4YXD C;  3O6Q A;  4HYT B;  2ZYA A;  3L70 E;  3TF5 A;  2WSC J;  1OZH A;  2OTL P;  2H43 A;  2PFX A;  4H0L D;  2FKW B;  1JY2 N;  1GK4 A;  3VOP A;  1W2E A;  3KHU A;  1NTZ D;  1Y47 A;  2QM8 A;  1SQB E;  5AW5 B;  1JY3 O;  3FXD A;  3TNU B;  3VMZ A;  1LJ2 A;  3WU2 H;  1PGQ A;  1T3U A;  3EFG A;  4ASV A;  3HE5 A;  1PZQ A;  3CL3 D;  3T97 B;  1VF5 D;  3RL0 B;  3VYI A;  3AEF C;  3H1K D;  1K8A Q;  1YQ3 C;  1JEK A;  1IFN A;  1ZV8 A;  2IBZ E;  1QL2 A;  1BCC D;  2M0B A;  2WSE H;  5CCH A;  2Z5H A;  3L72 E;  3IFM A;  3PRJ A;  1HH0 A;  3EQ2 A;  3V2Q A;  1N8R Q;  1L4A D;  1SQV J;  2K37 A;  3V4Q A;  3AE6 C;  3B5N B;  3AE5 C;  1GDT A;  5AW0 B;  3W67 A;  3B8E B;  1HBW A;  3AEG C;  1N7S D;  2A45 H;  1AQT A;  1ZR2 A;  4PD4 H;  5CBN A;  3GF7 A;  5APQ A;  1JY2 P;  3B5N D;  1YJW P;  1QX8 A;  1RF0 A;  4OVN F;  3CX5 H;  1EZV G;  4LC1 A;  1LNQ A;  1KIL C;  1N7S B;  1Q7Y Q;  5CCG C;  3WMM 0;  2M3B A;  4PV1 D;  4H0L C;  3HD7 C;  2A06 D;  2FYU J;  1LT1 A;  1URQ C;  2ZT9 C;  4XE5 B;  3P8C E;  1GL2 B;  3CXH H;  1VQ4 P;  3AE1 C;  3M9B A;  2D2C B;  2FYU D;  3N7N A;  2WSF H;  3P7K A;  3S9O A;  2W6B A;  2A45 G;  3BCC J;  2HG5 D;  2Q3E A;  2AEM A;  3H1H E;  4D6T J;  1GL2 D;  2E5T A;  3L71 E;  3EFF K;  4K35 A;  3OA7 A;  1MFT A;  4Y99 C;  4MN4 C;  3Q1M A;  5BVZ A;  1OW8 A;  3FWN A;  2KIK A;  1FZA A;  3U1C A;  1JO5 A;  1X8Y A;  3CC4 P;  5KLV D;  1FOS E;  2FY8 A;  3HUS C;  2E42 A;  1S5L X;  2JO1 A;  2OGU A;  1E79 H;  2E74 D;  2JEE A;  1IK7 A;  3H1J D;  1J1D C;  2YNY A;  2NZ2 A;  5B66 E;  4H13 C;  3F89 A;  4U3F E;  1SQP K;  4YXW H;  1N73 C;  1GMJ A;  2B9B A;  3H1L G;  1ZN5 A;  3H1I J;  1NVO A;  2JP3 A;  1KIL D;  4GIF A;  2CPB A;  2M3E A;  2V4H A;  2WSC H;  1YQ4 C;  1L0L G;  3TGU E;  5AVY B;  4UB8 E;  2YO3 A;  1BGY E;  1JY3 N;  1ZP0 C;  1KMI Z;  2YIU C;  3F5H A;  1NTK K;  3CX5 D;  2ZXX A;  5TIS E;  1MKM A;  2WMM A;  1KIL B;  3L75 G;  3MP7 B;  1NHL A;  1JTH A;  3KQG A;  1KB9 D;  1ZOY C;  1LTB C;  4UB6 H;  3AEE C;  1Y9B A;  5GTI E;  3GG2 A;  2B87 B;  5B66 H;  1URQ A;  1LTA C;  1PV3 A;  1S5L E;  3A0B E;  4K3A A;  3SWY A;  3CI9 A;  2XV5 A;  1GL2 C;  1NTK J;  1CI6 B;  1CSB A;  1GU5 A;  1FZF A;  1RF1 A;  1RF1 C;  3HUS A;  1MZ9 A;  2Y9Z A;  1DH3 A;  1EXI A;  1SQQ E;  1SFC B;  4AQR D;  1FZE A;  5AW6 B;  1JY3 P;  3C1L A;  1OX3 A;  2YKO A;  2P7J A;  3L73 E;  3SWF A;  2KNC A;  1IC2 A;  1VDF A;  2V7Q J;  2QE7 H;  1LP1 A;  1RE4 C;  1L0N E;  1NU1 E;  2E75 D;  1BSN A;  2ZVN B;  1BGY D;  4A7P A;  3ABV C;  1FZG A;  3Q3D A;  2QJK C;  1BCC J;  5K5G B;  1KC8 Q;  1Y8A A;  2BEZ F;  2HR3 A;  3A0H E;  3HTK A;  3H1K E;  1QVF O;  1J2J B;  1L4A B;  4IFF A;  1L0L K;  2DW3 A;  4PD4 D;  1J1D B;  1NH4 A;  3L36 A;  2Z4E A;  4PJ0 E;  1BE3 J;  2O01 N;  4OGQ C;  1TU3 F;  3O8Z A;  2K3R A;  3EWK A;  1T2K D;  1GW4 A;  1JCC A;  3CXH I;  2PAJ A;  2WPV B;  5CCG A;  1NKZ B;  1N2D C;  3L73 D;  1KFN A;  1FE6 A;  1SFC A;  1SVF A;  2M8R A;  1Q2N A;  2O3J A;  3L72 G;  3M0D C;  2FFD A;  1FOS F;  1KQG B;  2E5Y A;  3VN0 A;  4R4M A;  1ZRT D;  4N78 E;  5AW8 B;  1VQ8 P;  2ZVO B;  1PP9 J;  2FYU K;  4DT0 A;  2R5D A;  3JC2 2;  3G9R A;  5AW3 B;  2YXQ B;  3K5B A;  3KYQ A;  1LWU B;  3H1I G;  3H1J E;  3UIA A;  1MFZ A;  3RK2 C;  1KQS O;  1JNM A;  3GW6 A;  1SQX G;  1OW6 A;  3H32 B;  1RF1 B;  3L73 G;  2HOD B;  1YTZ T;  4W80 A;  2ZFC A;  1ZR4 A;  3L75 E;  2QJY B;  2HPC B;  2B89 A;  1KYO E;  3AED C;  1AV1 A;  3JSV C;  3BCC G;  2QSI A;  1KQF B;  3TNU A;  2A06 G;  2FXP A;  5AVU B;  1RE4 A;  2YO2 A;  1FZB A;  5AW1 B;  1LTS C;  2CK3 H;  2W90 A;  3MGN A;  3P32 A;  5AVR B;  1VQ6 P;  3CWB D;  4DZO A;  1AFO A;  2A45 I;  3AE3 C;  2P2U A;  4XA4 A;  5KLV E;  3GHG C;  1LTJ B;  2LKM A;  2JKV A;  2QRX A;  1NTZ K;  4IOI H;  5C39 A;  2XU6 A;  1KB9 I;  1JOC A;  5KJ7 C;  5KKZ B;  3I55 P;  3L70 D;  1DX7 A;  5APS A;  2N1T C;  4EIJ A;  1S1C X;  2MJZ A;  2W6A A;  2N1T A;  3MD0 A;  2KK7 A;  5AVT B;  1J1E B;  3L74 G;  1OXZ A;  2XND H;  1SQQ D;  2FXO A;  2QJP C;  3G4S P;  1FJK A;  1T3J A;  3B4S A;  2KYV A;  3JCU E;  3KPE A;  4H44 B;  3CCL P;  3H1L J;  4GDO A;  2OYO A;  3D6Z A;  5AW7 B;  1GL2 A;  3H25 A;  4L75 A;  4AYC A;  1NTM E;  1Q86 Q;  1QGK B;  1IFJ A;  1LTI C;  2QG4 A;  1KOR A;  2V7Q H;  5TJH A;  3V2P A;  1EDJ A;  1A02 F;  1JB0 J;  1KB9 E;  2NPS A;  2IPP A;  5EFW B;  5AVW B;  1JCD A;  3RK3 B;  1FZC A;  3H1I D;  4IFD K;  3H6P A;  4M3L A;  1LGH B;  3AE4 C;  1SQV G;  2WSS H;  3H1H G;  1GZL A;  5AW9 B;  2VRS A;  4GT1 A;  2I1K A;  3H1L D;  5KAI H;  4EOT A;  1NOH A;  3L74 E;  5AVX B;  3WUV A;  5KJ7 A;  1D7M A;  1VPC A;  2OYI A;  3C8V A;  5H2F H;  1PP9 D;  1YTZ I;  2KB7 P;  1PP9 G;  3IF4 A;  4HKZ H;  1YJN P;  2W83 C;  1NU1 D;  1L0N D;  3MHV A;  3FX0 A;  3CC2 P;  1K04 A;  5H2F E;  3NMD A;  4BRY A;  3AE9 C;  4EI2 A;  2OYH A;  4HJG H;  5KAF H;  1BE3 D;  1SFC D;  5AVS B;  4C46 A;  4GOF A;  1VQP P;  4WB4 A;  2C9N Y;  2LXB A;  2H8P D;  5CCG D;  1S9K D;  1HTL C;  1A02 J;  5BU8 B;  4IL6 H;  3CWB J;  3HE5 B;  3M0A A;  3QWO C;  2E75 B;  3HD7 D;  2B87 A;  2KZI A;  4JYB A;  4WWI A;  2H89 C;  1S3J A;  1DEE G;  3PH0 A;  3AEB C;  5TIS H;  2I8D A;  1J1E C;  4U7J A;  3SWK A;  1T6A A;  1NTM G;  1L0L E;  3TGU G;  2AEJ A;  4WY4 C;  2OYI B;  1NAF A;  2IBZ G;  3NFQ A;  3O6Q B;  1K05 A;  3T97 A;  1QLE D;  1G2C A;  2P10 A;  2KSE A;  3II6 A;  4PV1 B;  5GTH H;  4ASW A;  1LT9 B;  5KTB A;  4D6T E;  2C0W A;  1KD1 Q;  1DD4 A;  1JUN A;  1ZXG A;  5APY A;  1FC2 C;  2K9Y A;  3HE4 A;  4U3F D;  1P84 H;  1SQV K;  2E74 C;  2D2C D;  2KP8 A;  3MZW B;  3D6Y A;  3CD6 P;  2ZYD A;  1FS0 E;  1SQP J;  3GHG A;  1EDI A;  1QEX A;  4R4L A;  4JQ0 D;  3FGA D;  2IX7 C;  1KYO D;  2QM7 A;  1VQO P;  4KT0 J;  5CHX A;  4IL6 X;  3PTZ A;  4KHX A;  1WMK A;  1BDC A;  2CPS A;  2JJL A;  3E1R A;  3H1K G;  1JTH B;  3WUU A;  2O1K A;  4ZKU A;  3V2R A;  4C7N A;  5GTH E;  1S9K E;  1PPJ E;  3CXH E;  4I2L C;  1GD2 E;  1FJP A;  2RKL A;  2ZJS E;  2L91 A;  1L4A C;  1GK6 A;  1JM0 A;  4BXL A;  2AXC A;  2KZJ A;  2P58 A;  3LIE A;  2AXT E;  1Q81 Q;  1RH5 B;  1WRG A;  3I5C A;  3OJA B;  5CMZ A;  5KLV K;  2O01 H;  1DD3 A;  2FYU E;  2GUS A;  1R5L A;  2ITA A;  2NPS C;  1FZC C;  1OW7 A;  3CCV P;  5AW2 B;  1ZME C;  3G71 P;  2IYP A;  3WUT A;  3L4F A;  3Q2Y A;  1CW5 A;  1H0T A;  2NRG A;  1SQX K;  1G2C B;  2YMK A;  3BAS A;  2Q9I A;  3CME P;  1EZV E;  1R5S A;  2D2C C;  5APW A;  3AEA C;  3L71 J;  3RBZ A;  1SQX E;  2E76 C;  5BU5 A;  4H44 D;  2FFD B;  2KNC B;  2R3C A;  3HD7 A;  4Y99 B;  2FXM A;  3A5T A;  1JMB A;  5KLI C;  1L2P A;  2BCC J;  3E1I A;  1SP4 A;  2OYH C;  4JPZ B;  1LTJ C;  3IN6 A;  2KUB A;  3A0B H;  3HRN A;  4OGQ D;  3SFE C;  3PP5 A;  5DJT B;  3GLM A;  1HJ0 A;  1NTZ E;  1IFD A;  1URQ B;  2QJY C;  2ZT9 B;  3P8M C;  4U3F J;  4U3F G;  2K9J A;  3WU2 E;  2W8Z A;  1YIJ P;  3E7K A;  3AE7 C;  4DCK A;  1KTM A;  2Y0E A;  1M8O B;  4CPG A;  3L70 J;  1IFI A;  3GF3 A;  1BDD A;  1N7S A;  1VF5 C;  1M56 D;  2PP6 A;  2YKQ A;  1IFM A;  2FYZ A;  2YMY A;  1IK9 A;  2IBZ D;  1NKN A;  1U7M A;  2M5A A;  3V4W A;  1FZC B;  1BCC G;  2Q7C A;  2NPS D;  1L4A A;  1HJB A;  3BCC D;  4YTP C;  1YBK A;  2LR2 A;  2FYN B;  3JCU H;  1VQ5 P;  2KLU A;  1KV4 A;  3AE2 C;  1SQB J;  3CCQ P;  1HVV A;  1H8A A;  4W7Z A;  2ZXE B;  2XNX A;  3L75 D;  4IFM A;  4N6J A;  2IFM A;  3W68 A;  4RJT A;  3KXD A;  1VQM P;  4DOJ A;  2NPS B;  4I7Z B;  4NPF X;  1LP1 B;  2BEQ D;  4WVZ A;  1NTK E;  1EQ7 A;  1JY2 O;  1L0L D;  3KZI E;  3LW5 H;  3VP8 A;  2JWD A;  3C9I A;  1P84 D;  3HD7 B;  3GMA A;  4L74 A;  1SQQ J;  2B88 A;  2LXC B;  1GTW A;  3U1A A;  1AVY A;  1G1I A;  5AVZ B;  3HUS B;  3CCJ P;  2N1T D;  3S1K A;  3L72 J;  3B5N C;  3Q5S A;  1QVG O;  1H88 A;  1USE A;  2G3A A;  1L0N J;  1NU1 J;  1SQV E;  1Z56 A;  2PGD A;  3CXH D;  1L0N G;  1NU1 G;  5AVV B;  4EDF A;  1BCC E;  2WSF J;  1H0T B;  3L72 D;  1XTG B;  3S4R A;  1VL2 A;  2N1T B;  1EZV I;  3BAT A;  1ZLL A;  1W5C E;  5E79 E;  4H13 B;  2GUV A;  3M06 A;  1LTT C;  3H1H D;  3CPW O;  2HLO A;  2O01 J;  1NO4 A;  1FDI A;  3AE8 C;  1SQP G;  2BCC D;  3A7O A;  1SQB D;  2M5A B;  2JR8 A;  3L71 G;  4I1L A;  3RBX A;  1PL5 A;  4RES B;  3VMA A;  1AJY A;  1GU4 A;  2IZ1 A;  3MUD A;  4TLF A;  2QA4 P;  2JDI H;  3BVH A;  1HWT C;  2RMZ A;  3MUD C;  2WPQ A;  5E79 H;  1RHZ B;  5CJ0 A;  1LT9 A;  3RK3 E;  1HF9 A;  2K9J B;  3U59 A;  2H7H A;  2A06 E;  4JBZ A;  2FBW C;  3BCC E;  1NTK G;  2N9Y B;  3H1H J;  1T2K C;  2FYN C;  2IDB A;  1KYO H;  2HOD A;  3B5N A;  2R5B A;  1UII A;  3CCS P;  2OTJ P;  3L74 D;  1SLQ A;  1T8Z A;  2K88 A;  3TYY A;  4ZKP A;  2WSE J;  1L0N K;  1NU1 K;  1OIP A;  2Z5I A;  1KIL E;  3A3Y B;  3H1J J;  3QH9 A;  1PIX A;  2AEF A;  1JMM A;  1NTK D;  1SFC C;  1QL1 A;  3L70 G;  2WWW A;  4LGD E;  2ZAE B;  4JYC A;  1DEB A;  2WVR A;  1SQQ K;  1P84 E;  2KS1 B;  2QJK B;  3KZI H;  3V6I A;  2WT7 B;  1NTM D;  4EYY Q;  2OTK E;  4OWF A;  4GOD A;  5DJU B;  4D6T G;  4BWN A;  4W7Y A;  1USD A;  2R32 A;  4HH2 A;  3CWB G;  3RK3 D;  1OVV A;  2O1J A;  3HTK B;  2RN0 A;  1NTM K;  3FXE A;  3LID A;  3NTN A;  5AW4 B;  4DJG A;  4AUW A;  1KN7 A;  1SQB K;  3H1I E;  3N4X A;  4WY4 A;  2J5U A;  4OH8 B;  4ZNC A;  4OGQ B;  1YHQ P;  4WY4 D;  1ZRT E;  1PPJ G;  1XTC C;  1BE3 G;  3TGU J;  1N7S C;  4Y28 J;  5CBO A;  1M7L A;  1BGY J;  4XFJ A;  3MIW A;  1FDO A;  1S2E A;  1NJI Q;  1FBM A;  2YKP A;  1N7L A;  4GKG A;  2IBZ I;  1AQ5 A;  1EDL A;  1MV8 A;  1U7J A;  3VMX A;  1N73 A;  2C9L Y;  2Y0D A;  1K9M Q;  3TK1 A;  4L73 A;  1IZN B;  1YI2 P;  5KLV G;  3CLQ A;  5KJ7 D;  4L76 A;  4PJ0 H;  1FU1 A;  1SQV D;  1OVR A;  1URQ D;  2ZT9 D;  3L35 A;  3RK2 B;  5B5E H;  3D70 A;  5APX A;  1M90 Q;  1NAY A;  2SPZ A;  2OYI C;  1OMI A;  1HGZ A;  3L73 J;  2E74 B;  3CCR P;  3IR9 A;  2IFN A;  2OQQ A;  2UWJ E;  1CI6 A;  3A2A A;  3GHG B;  1G1J A;  2FYU G;  1VQ9 P;  1PGP A;  1IFP A;  2KI7 B;  2POH A;  4PV1 C;  1UIX A;  3RL0 C;  3M0D A;  2Y0C A;  2R44 A;  3PJS K;  4ZMD A;  2FFD C;  2QEX P;  3IAO A;  3RK3 C;  3CCE P;  5CJ4 A;  2WPR A;  1M57 D;  2KSJ A;  3H1K J;  3VTP C;  1W2B O;  1MUU A;  1SQQ G;  1X79 B;  2OAR A;  2WTY A;  1WT6 A;  3I56 P;  3OW2 O;  4H0L B;  4I6M C;  1BE3 E;  1ZW0 A;  4D6T D;  5KKZ C;  2AXT H;  4KJM A;  4UB8 H;  1YJ9 P;  1NWQ A;  4H13 D;  1P84 I;  4WBA A;  4B86 A;  4HB1 A;  1EC5 A;  2WQY C;  1S72 P;  1RY3 A;  3SFD C;  2IYO A;  3M9H A;  1VQN P;  3D71 A;  2YIU B;  2XKM A;  5APV A;  1OVU A;  2Q6Q A;  4TT3 H;  5KLI B;  2E43 A;  1M1J B;  2XZR A;  1PGJ A;  2J59 M;  3SSU A;  1IO4 A;  2QJP B;  5APT A;  3M91 A;  3V2N A;  1PP9 E;  2IZ0 A;  3H32 A;  3G6E P;  3TGU D;  3PHL A;  4N78 D;  2HYN A;  2JWA A;  1L0L J;  1LTJ A;  1DIP A;  3CX5 E;  4BRY B;  5L8R J;  1SS1 A;  2W27 A;  1LTG C;  3HE4 B;  3ZDM A;  1VF5 B;  1AA0 A;  3L75 J;  2E76 D;  3RL0 D;  1NTZ G;  2BCC G;  4H44 C;  2H88 C;  2PRR A;  1IJD B;  5AVQ B;  1N73 B;  2KLV A;  2GM4 A;  2HFE D;  1RE3 C;  1S4X A;  2Q1K A;  2HPC A;  2J58 A;  3VP9 A;  3CC7 P;  2E76 B;  3R2P A;  2P1J A;  1Q90 D;  5KLV J;  3H1J G;  1SQP E;  3CMA P;  1LWU A;  2QVA A;  1X0T A;  2OYH B; 
#chains in the Genus database with same CATH homology
 4C7R A;  1E5W A;  1KFM A;  3BRT B;  3OAK A;  5CCH D;  3P8C D;  2WT7 A;  3V5B A;  1M1J C;  1YYC A;  1FDM A;  1H89 A;  3BRV B;  2BAS A;  3G3Z A;  3NXS A;  4WY4 B;  2Q5U A;  1HGV A;  3TSI A;  5APU A;  3L37 A;  4C7N B;  1LWU C;  1CZQ A;  1KQL A;  2P67 A;  1X9V A;  2I1J A;  3MTU E;  3VMY A;  1RE3 A;  1N86 A;  2WZ7 A;  4JF7 A;  2C0X A;  1LT9 C;  3M9Q A;  3RK2 D;  2XDJ A;  1GW3 A;  2KOG A;  2N9B A;  1OWA A;  5CCH C;  1M1J A;  1PFI A;  2WPS A;  1RF0 C;  1HUC A;  2WIT A;  1FAV A;  1KIL A;  2Q3I A;  4LLH A;  2L5G B;  3KDP B;  1KZU B;  4HYT B;  2H43 A;  2FKW B;  1JY2 N;  1GK4 A;  3VOP A;  1W2E A;  2QM8 A;  5AW5 B;  3TNU B;  1JY3 O;  3VMZ A;  1T3U A;  3EFG A;  3HE5 A;  3CL3 D;  3VYI A;  3RL0 B;  1ZV8 A;  1IFN A;  1QL2 A;  2WSE H;  5CCH A;  2Z5H A;  3IFM A;  1HH0 A;  3EQ2 A;  3V2Q A;  1L4A D;  3V4Q A;  3B5N B;  1GDT A;  5AW0 B;  3B8E B;  1HBW A;  1N7S D;  2A45 H;  1ZR2 A;  5APQ A;  1JY2 P;  3B5N D;  1RF0 A;  4LC1 A;  1N7S B;  1KIL C;  5CCG C;  3WMM 0;  2M3B A;  3HD7 C;  4XE5 B;  1URQ C;  3P8C E;  1GL2 B;  3M9B A;  3N7N A;  3P7K A;  2WSF H;  2W6B A;  2A45 G;  2HG5 D;  1GL2 D;  4Y99 C;  3OA7 A;  5BVZ A;  1JO5 A;  1FZA A;  3U1C A;  1X8Y A;  3HUS C;  2E42 A;  2JEE A;  1J1D C;  2YNY A;  1SQP K;  1N73 C;  1ZN5 A;  1KIL D;  4GIF A;  2CPB A;  2WSC H;  5AVY B;  2YO3 A;  1JY3 N;  1NTK K;  1KIL B;  1NHL A;  1JTH A;  3KQG A;  1LTB C;  1URQ A;  1LTA C;  3SWY A;  3SWF A;  1GU5 A;  3CI9 A;  2XV5 A;  1GL2 C;  1RF1 C;  1CSB A;  1CI6 B;  1FZF A;  1RF1 A;  3HUS A;  1MZ9 A;  1DH3 A;  1SFC B;  4AQR D;  1FZE A;  5AW6 B;  1JY3 P;  2YKO A;  2P7J A;  2WPQ A;  1IC2 A;  1VDF A;  4N3Y B;  1RE4 C;  1FZG A;  3HTK A;  1J2J B;  1L4A B;  4IFF A;  1L0L K;  1J1D B;  1NH4 A;  3L36 A;  2Z4E A;  1T2K D;  3O8Z A;  1GW4 A;  1JCC A;  5CCG A;  2PAJ A;  1NKZ B;  1N2D C;  4EOT A;  1KFN A;  1SFC A;  1SVF A;  2M8R A;  3M0D C;  2FFD A;  1FOS F;  3VN0 A;  4N78 E;  5AW8 B;  2FYU K;  2R5D A;  5AW3 B;  3KYQ A;  1LWU B;  3UIA A;  1MFZ A;  3RK2 C;  1JNM A;  1RF1 B;  3H32 B;  2HOD B;  1YTZ T;  4W80 A;  2ZFC A;  1ZR4 A;  2HPC B;  3TNU A;  5AVU B;  1RE4 A;  2YO2 A;  1FZB A;  5AW1 B;  1LTS C;  3MGN A;  3P32 A;  5AVR B;  4DZO A;  1AFO A;  2A45 I;  4XA4 A;  2P2U A;  3GHG C;  1LTJ B;  2LKM A;  1NTZ K;  2XU6 A;  5KJ7 C;  1JOC A;  1DX7 A;  5APS A;  2N1T C;  4EIJ A;  2MJZ A;  2W6A A;  2N1T A;  3MD0 A;  5AVT B;  1J1E B;  1OXZ A;  1FJK A;  1T3J A;  2KYV A;  3KPE A;  5AW7 B;  1GL2 A;  4AYC A;  3V2P A;  1IFJ A;  1LTI C;  1A02 F;  2NPS A;  2IPP A;  5AVW B;  1FZC A;  1JCD A;  3RK3 B;  4IFD K;  3H6P A;  4M3L A;  1LGH B;  5AW9 B;  1GZL A;  2VRS A;  4GT1 A;  2I1K A;  1NOH A;  5AVX B;  5KJ7 A;  1VPC A;  2OYI A;  1YTZ I;  2KB7 P;  3NMD A;  2OYH A;  5AVS B;  1SFC D;  4C46 A;  4WB4 A;  2C9N Y;  2H8P D;  5CCG D;  1HTL C;  1A02 J;  5BU8 B;  3M0A A;  3HE5 B;  3HD7 D;  4JYB A;  1J1E C;  4WY4 C;  2OYI B;  1NAF A;  3NFQ A;  3T97 A;  1G2C A;  3II6 A;  1LT9 B;  5KTB A;  2C0W A;  1JUN A;  5APY A;  3HE4 A;  1SQV K;  2KP8 A;  3GHG A;  2IX7 C;  2QM7 A;  5CHX A;  4KHX A;  2CPS A;  2JJL A;  1JTH B;  4ZKU A;  2O1K A;  1S9K E;  3V2R A;  4C7N A;  4I2L C;  1GD2 E;  1FJP A;  1L4A C;  1GK6 A;  3LIE A;  1WRG A;  3I5C A;  3OJA B;  5CMZ A;  5KLV K;  2O01 H;  2GUS A;  2NPS C;  1FZC C;  5AW2 B;  3L4F A;  1CW5 A;  1SQX K;  1G2C B;  3BAS A;  2Q9I A;  5APW A;  5BU5 A;  2FFD B;  2R3C A;  3HD7 A;  4Y99 B;  2FXM A;  3A5T A;  3E1I A;  2OYH C;  1SP4 A;  1LTJ C;  3HRN A;  3PP5 A;  1URQ B;  1IFD A;  3P8M C;  1S9K D;  1IFI A;  2YMY A;  1N7S A;  2PP6 A;  2YKQ A;  1IFM A;  2FYZ A;  1IK9 A;  1NKN A;  3V4W A;  2Q7C A;  2NPS D;  1L4A A;  1HJB A;  1H8A A;  1HVV A;  4W7Z A;  2ZXE B;  4IFM A;  4N6J A;  2IFM A;  4DOJ A;  2NPS B;  1FZC B;  1EQ7 A;  1JY2 O;  3LW5 H;  3VP8 A;  3C9I A;  3HD7 B;  1GTW A;  3U1A A;  1G1I A;  5AVZ B;  3HUS B;  2N1T D;  3B5N C;  1H88 A;  1Z56 A;  5AVV B;  1XTG B;  3BAT A;  2N1T B;  1ZLL A;  2GUV A;  3M06 A;  1LTT C;  2HLO A;  1NO4 A;  3A7O A;  4I1L A;  4RES B;  1GU4 A;  3MUD A;  3BVH A;  1HWT C;  5CJ0 A;  1LT9 A;  3U59 A;  2H7H A;  1T2K C;  2HOD A;  3B5N A;  2R5B A;  3TYY A;  1SLQ A;  1T8Z A;  4ZKP A;  1L0N K;  1NU1 K;  2Z5I A;  3A3Y B;  4O9B A;  1JMM A;  1SFC C;  1QL1 A;  4LGD E;  2WWW A;  4JYC A;  1DEB A;  1SQQ K;  2WT7 B;  4W7Y A;  2R32 A;  4HH2 A;  3RK3 D;  2O1J A;  3HTK B;  5AW4 B;  3NTN A;  1NTM K;  3LID A;  4AUW A;  1SQB K;  3N4X A;  4WY4 A;  4OH8 B;  4WY4 D;  1XTC C;  1N7S C;  1M7L A;  3MIW A;  1FBM A;  2YKP A;  1N7L A;  4GKG A;  1AQ5 A;  1MV8 A;  3VMX A;  1N73 A;  2C9L Y;  3TK1 A;  3CLQ A;  5KJ7 D;  1FOS E;  1FU1 A;  1URQ D;  3L35 A;  3RK2 B;  5APX A;  2OYI C;  1HGZ A;  3IR9 A;  2IFN A;  1CI6 A;  3A2A A;  3GHG B;  1G1J A;  2POH A;  3RL0 C;  3M0D A;  2FFD C;  3RK3 C;  5CJ4 A;  2WPR A;  2KSJ A;  3VTP C;  1MUU A;  1X79 B;  2OAR A;  2WTY A;  1WT6 A;  4I6M C;  1NWQ A;  4WBA A;  4B86 A;  1RY3 A;  3M9H A;  2XKM A;  5APV A;  2E43 A;  1M1J B;  2XZR A;  1IO4 A;  2J59 M;  5APT A;  3M91 A;  3V2N A;  3H32 A;  4N78 D;  2HYN A;  1LTJ A;  2W27 A;  1LTG C;  3HE4 B;  3RL0 D;  5AVQ B;  1N73 B;  1IJD B;  2KLV A;  2GM4 A;  2HFE D;  1RE3 C;  2HPC A;  2J58 A;  3VP9 A;  3R2P A;  2P1J A;  1LWU A;  2XNX A;  2OYH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...