4BXLA

Structure of alpha-synuclein in complex with an engineered binding protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
DGEIFYLPNLNPDQLCAFFHSVHDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AS69
publication title Sequestration of a Beta-Hairpin for Control of Alpha-Synuclein Aggregation.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Fibril
total genus 13
structure length 46
sequence length 46
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4bxlA00
2B89A 1NVOA 2M5AA 2I8DA 1EC5A 1U7MA 2K3RA 2KS1B 1Y47A 4WWIA 2OTKE 2KZIA 1ZW0A 4GODA 1OVUA 3FXDA 3PH0A 2LXCB 1ZXGA 1EDKA 1U7JA 5EFWB 2M0BA 2KIKA 2QRXA 2LR2A 1DEEG 4HJGH 2KZJA 1EDLA 5DJTB 1SS1A 3MZWB 4HKZH 1LT1A 2Q1KA 2ZAEB 2LXBA 2HR3A 5C39A 1JMBA 4CPGA 1LP1B 2SPZA 2B87A 2KUBA 4KJMA 1X0TA 2UWJE 2P58A 4ZMDA 2QVAA 1EDIA 5CBOA 4ZNCA 2RKLA 1H0TB 4NPEA 4GOEA 2R44A 4K3AA 3MHVA 1EDJA 3QWOC 4ASWA 2WMMA 4ASVA 1Q2NA 2JWDA 4JBZA 4EYYQ 1FC2C 3RGUA 3S1KA 2M5AB 1BDCA 4K35A 3ZDMA 2B88A 1OVVA 1OVRA 1S3JA 1H0TA 4HB1A 2KI7B 5K5GB 2B87B 5CBNA 1MFTA 3FXEA 4MN4C 5DJUB 4IOIH 1BDDA 4NPDA 4BXLA 4NPFX 1JM0A 1LP1A 4GOFA
chains in the Genus database with same CATH superfamily
1PGOA 5M1BA 1M1JA 3RK2B 3CXHH 3CCLP 3WUTA 3D71A 2XNXA 1DD4A 2YKOA 3AEFC 3GF7A 5AVVB 1RE3C 2W8ZA 2ZXEB 3MUDA 3BCCD 1FJPA 1ZR2A 1KILD 1BGYJ 2C0XA 3L72G 3TGUG 2FBWC 5KTBA 1PFIA 1FDOA 3GHGB 1SQQK 2D2CC 2KS1A 1NTZJ 1LTTC 3GLMA 1FOSE 2H7HA 2QA4P 4QMAA 3H1KG 4WVZA 2QJPC 1SQPD 2WSEH 5AW1B 3L72D 3AE8C 4DZOA 3WU2H 3Q2YA 3MHVA 3QWOC 4ASWA 1PPJD 1KORA 2WMMA 4ASVA 3U1CA 4JBZA 4A7PA 4U3FG 1Q81Q 3H1KD 1VQ9P 4K35A 3CXHD 2W83C 1RF0C 4W80A 1YYCA 1OVVA 1M7LA 1BCCE 3E1IA 1QLED 2NPSA 3C9IA 2IBZE 2A45I 5KLVJ 1E5WA 1OW8A 1L0LG 1T8ZA 2JKVA 1IFNA 5BU5A 2E42A 3H1ID 3P32A 4OVNF 4U3FD 2Z5HA 2O01N 3L35A 3BCCE 1H8AA 1KILE 1X8YA 1ZR4A 3KYQA 2XNDH 3G9RA 3CX5H 2W6JH 5AVXB 1EZVG 4L73A 4DCKA 1L0NJ 1PGJA 2WVRA 3IF4A 4PJ0H 2W6BA 1Q90D 2QM8A 1KILC 3LIDA 2R5DA 3PRJA 3L72E 2LXBA 3TGUE 2J5UA 3B5NB 2FKWB 3A0HE 5AW5B 5GTHE 3K5BA 2QE7H 1YIJP 1VF5D 3IAOA 2IX7C 1PPJE 3L71J 3KZIE 1J1EC 1IFDA 2Q6QA 2FFDB 3GMAA 1OZHA 2KLUA 2HODA 1Q82Q 1MZ9A 3H1KE 2LKMA 3TYYA 1SQPK 1EDJA 3CMEP 4D6TG 1SQBG 4EYYQ 2Q9IA 3HD7D 2E5YA 3M9QA 1W5CE 1DD3A 3MTUE 2P2UA 2L5GB 1SQQJ 3RK2D 5GTIE 4U3FE 1LTAC 3CX5D 4B86A 4N3YB 3RL0B 1XTCC 2POHA 2PGDA 2WQYC 2Y0CA 4WBAA 1N7SA 1JB0J 1L0LE 4O9BA 3CLQA 3CCMP 1R5LA 3Q5SA 1LWUB 4XFJA 3VMXA 1P84I 1USEA 5EFWB 1NU1D 3H32A 2KZJA 1RF1B 1EZVE 4BRYB 2Q1KA 2HR3A 2Y9YA 3Q5PA 2GUSA 2A06G 2J58A 2KNCB 1YJWP 1T6AA 1UIXA 5H2FH 3P8CE 2OYHA 1VF5C 1GL2B 3AE9C 1GZLA 3A0BE 2K88A 1A02F 1FE6A 2FXMA 4PD4E 4IL6E 1X79B 2A06D 3RGUA 3IFMA 4ZKUA 1NO4A 3M0DC 1NH4A 3TNUA 2C9NY 1JEKA 1M8OB 4D6TE 1BSHA 1SQBE 1X9VA 3HD7C 2YIUC 1KFMA 5K5GB 4LC1A 3RK2C 3HE4B 1MFTA 3USSA 3V2PA 1HWTC 3MP7B 3S9OA 3Q5RA 1UIIA 2R32A 3CI9A 2HLOA 2C9LY 3L37A 5L8RJ 5AW0B 2K3RA 1FZAA 3JC22 1SQPJ 3L75G 3HRNA 2BCCG 3GHGC 2FYNB 1JO5A 3JSVC 3B5ND 2A45G 3BRVB 1SQVG 5APUA 2YNYA 1OW6A 2PAJA 5DJTB 3NTNA 3L70J 2K9JA 3D6YA 4C7NA 3G3ZA 2Y9ZA 3CD6P 1NU1K 2YXRB 5C39A 1NTKG 1N2DC 1ZOYC 1J2JB 2HYNA 1EXIA 2NRGA 1GW4A 2RMZA 1SQVD 4OGQB 2A06E 3H1LJ 5AVZB 1USDA 3L36A 1JMMA 3BASA 2OTJP 4YTPC 3H1IJ 3HTKB 2GA1A 1KILB 3FX0A 1T2KD 3RL0D 4DOJA 1AJYA 1NTKD 3S1KA 1ZMEC 1E79H 4JYBA 1L0NG 3KXDA 4YPCA 1URQC 2FYUG 3MIWA 1G2CA 2ITAA 3TF5A 1K05A 2WSEJ 3AE4C 2YKPA 1YTZI 1J1EB 2PRRA 4IOIH 2KLVA 3L74G 3L71G 1LTSC 3KHUA 2P67A 2OYIC 1RHZB 5AVYB 2FYUD 1PP9G 5TJHA 2WWWA 1NHLA 2YKQA 3M9HA 3W67A 2K1AA 1ZXGA 2CK3H 3L73G 3O8ZA 3L75E 1Q7YQ 3RK3E 1VL2A 3N7NA 3B5NC 3WMM0 2BCCE 5APVA 1GL2D 5AVTB 1SQVE 2B9BA 2FFDC 3PHLA 2XDJA 1WRGA 4YXDC 2JWAA 1LTGC 1VQLP 2KUBA 2P58A 3LW5H 3L73D 3RK3C 3WUVA 2QVAA 1MUUA 2BEQD 3G4SP 1NTMG 1NTKE 3VMZA 5E79E 3HUSA 5AVWB 1N73C 3H6PA 1FAVA 2FXOA 2N1TC 1KYOI 4GKGA 2H89C 2I1KA 2GM4A 4N6JA 2HG5D 2N9YB 2HFED 1T2KC 1QX8A 1IO4A 1OFCX 3SFDC 4H13C 4W7YA 1L0NE 5KJ7A 2B87B 1NU1J 5DJUB 2ZT9B 2FYUE 4NPFX 1LP1A 1LTJB 1JTHA 3G71P 1N7SC 3AEEC 3I5CA 4C46A 3A0HH 5CHXA 1Y8AA 3L74E 5B5EE 2K9YA 3EWKA 3LIEA 3KZIH 1SP4A 3H1JG 3AEBC 3HD7B 1BCCD 1PP9E 4IFMA 2M0BA 2WZ7A 4WY4A 3OJAB 1RQUA 3HE5A 1L4AB 4OH8B 3L4FA 3E1RA 3L73E 4OGQD 3G6EP 3SWYA 1GL2C 1VQPP 2O01J 4U7JA 3SFEC 1GDTA 1KN7A 3H1JD 5GTIH 3H1HG 2C0WA 3RL0g 3AE6C 2PP6A 2WITA 3CWBJ 1XTGB 2M3EA 1KB9I 1Q2NA 2M8RA 4L74A 1NTME 4JPZB 2M5AB 1W2BO 1WT6A 5AW8B 1P84E 3VTPC 1T3JA 1OWAA 2WPVB 3TGUD 5CCHA 3H1HD 2RH0A 1S3JA 1VQMP 3CCSP 3FWLA 3F5HA 3GW6A 3VMYA 2V7QJ 1LTBC 5APXA 1VQ7P 2E76C 2FYNC 4WWIA 1AVOA 2YO2A 4KHXA 5KAIE 3CCUP 1JY3P 1URQB 3AEDC 1LGHB 4EOTA 2QRXA 3PJSK 3A0BH 1K8AQ 5KAFE 1HGVA 2O3JA 3MZWB 4PD4H 4IFFA 4IL6H 3H1JE 1YQ3C 4RO0A 5CJ0A 3T97B 4CPGA 5CMZA 2OYIB 3ABVC 1L0LD 4OGQC 1HF9A 1CI6A 1RE4A 2Y0DA 2ZVNB 1PV3A 4ZNCA 2RKLA 2G3AA 3VN0A 3R2PA 3Q3DA 3VMAA 1LTIC 3H1HE 1SFCA 1S5LE 2CPSA 1EZVD 2WSCH 1NAFA 2ZT9D 1H89A 1NOHA 5KLIC 2W6AA 1D7MA 3RK3B 2ZVOB 1MFZA 5CCGD 4BXLA 3P8CD 1IK7A 3VP9A 1N73B 1BE3G 2LXCB 2JR8A 4JQ0D 1SQXG 3U59A 2N1TB 1JY3N 4PD4D 1L4AD 3V6IA 3TK1A 3QH9A 3BATA 3EFFK 1Z56A 2GUVA 3OAKA 4PV1C 3SSUA 1EDKA 4H44C 4D6TD 1SQBD 3A7OA 4H13B 2P10A 3KQGA 1QVGO 1KZUB 2BEZF 3U1AA 1IZNB 3N4XA 1OMIA 1DX7A 3PP5A 2AEJA 2P1JA 1N7SB 1HUCA 1LWUA 1HGZA 2WSSH 1HTLC 2Q5UA 1YQ4C 1RF1A 1L0LK 1FZCC 1R5SA 2YXQB 1IK9A 1ZP0C 2VRSA 1CZQA 5APTA 3VOPA 2JEEA 1RE3A 1HJBA 3SWFA 2ZT9C 2QG4A 1BCCJ 3SWKA 4I7ZB 1LTJC 3CC7P 3FXEA 2Z4EA 3I56P 1URQD 5CCGC 1BGYG 4I6MC 3I55P 1KQGB 1HVVA 2A45H 1G1JA 5APYA 2BASA 2NPSD 1GW3A 1BE3E 3BCCJ 1JUNA 1ZW0A 4GODA 1NTZG 1KQFB 1QL2A 1SQXE 1L4AC 1SVFA 3HE4A 1X22A 1KYOE 4N78D 4AYCA 1RQVA 2WPQA 1KC8Q 4HYTB 5E79H 2OQQA 4JF7A 1BGYD 4EI2A 1KB9D 4HKZH 1M1JC 2AXCA 1YITP 1N7LA 2E5TA 1SQBK 1KQSO 1RF0A 1PGPA 3R4YA 2E76B 2YO3A 1G1IA 1NTZD 3L72J 1YHQP 3TGUJ 2IBZD 1K04A 4ZMDA 1S2EA 3MUDC 3KPEA 1EDIA 4EDFA 1H0TB 2G8YA 4C7RA 1OX3A 3D6ZA 5KLVG 2NZ2A 3H1KJ 3L75D 3RK3D 2J59M 5APSA 2BCCD 4LLHA 3AEGC 3O6QA 1BDCA 1EXJA 3CXHI 3TDKA 5B5EH 1NJIQ 2N1TD 4GDOA 2XKMA 3HTKA 4U3FJ 1BDDA 1KV4A 1KILA 1M57D 2IZ0A 2E74C 4JYCA 1KTMA 1ZV8A 2V4HA 5AVRB 1VQOP 3BVHA 4H13D 2N9BA 2ZJSE 3Q1MA 3E7KA 4N78E 1L0LJ 1JY3O 4UB8H 1KFNA 4AUWA 1BGYE 2NPSC 1KB9E 1NYHA 2XZRA 3P8MC 5KLIB 2HPCA 1N7SD 1M1KQ 2LR2A 2KP8A 1SS1A 1NTZE 1DIPA 1L0ND 2L91A 1IFJA 2R3SA 4I2LC 1S72P 5APWA 2OTLP 2SPZA 1P84H 2XV5A 2QEXP 2ZFCA 1SLQA 3AE7C 1S9KE 3FGAD 3W68A 4PV1B 3L74D 3L71D 4H44B 4K3AA 1SQQG 2Y0EA 3NFQA 1PP9D 4DT0A 4RJTA 2JWDA 2OGUA 3AE3C 3M0AA 1FS0E 1RH5B 3ZDMA 5KLVE 2WPRA 5KAIH 1PL5A 3V4WA 4D6TJ 1SQBJ 1SQQD 5CBNA 3CX5I 3VYIA 1SQVK 1FZCB 5KAFH 2MJZA 1JCCA 2QM7A 2WT7B 1LJ2A 1YJNP 3M91A 3HUSB 1QEXA 1H88A 3CPWO 1NTMD 1NTKK 2WSCJ 1L2PA 1P84D 4BWNA 2QJYB 5CJ4A 3OW2O 2WSFH 2Q7CA 2E76D 2KIKA 3PTZA 4TLFA 2OARA 2KSJA 4DJGA 1DEBA 2R5BA 1S5LH 1QVFO 2IZ1A 1LT9A 4HH2A 1J1DC 3L71E 1LP1B 3JCUH 1JY2P 1L0NK 2AEMA 3HD7A 2FYUK 1JNMA 3KDPB 2AXTE 2IDBA 1JCDA 1HBWA 2OYOA 2IYPA 3CCJP 1IFMA 2E43A 1ZRTE 2JJLA 3NXSA 4UB8E 1GK4A 3PLNA 1M1JB 4WY4B 4ZKPA 1SQQE 3HE5B 1OVRA 4I7ZC 1QGKB 5AW9B 3EFGA 1OXZA 3GHGA 2I1JA 5AVSB 2OYHC 4MN4C 1SQPG 3C1LA 4GIFA 2IFMA 2M5AA 1IFPA 1ZLLA 5AVUB 1YI2P 1GMJA 1PPJG 2KS1B 3L70G 1VDFA 4KT0J 1MKMA 5BU8B 1FBMA 2CPBA 1A02J 1PGQA 4I1LA 1T3UA 1NTMK 4HJGH 5BVZA 1EDLA 1KD1Q 2YMKA 3MGNA 1JY2N 4LGDE 3L75J 4UB6E 1PZQA 2KYVA 4PV1D 2E74B 3H1LG 2BCCJ 3L70D 4GT1A 4H44D 3H1IG 1URQA 1GK6A 1SQVJ 3IN6A 4AQRD 2UWJE 4RESB 3CC2P 2AEFA 1YJ9P 2JDIH 2NPSB 4H0LC 3CCVP 3B4SA 2JO1A 1AV1A 3P7KA 1NTKJ 4IL6X 3H1LD 3B71A 3T97A 1GD2E 1HJ0A 2OYIA 1NGMB 4Y99C 2YMYA 1QL1A 3F89A 2QSIA 2B88A 3UIAA 1IFIA 1FU1A 1VQ5P 1AFOA 1VQNP 1K9MQ 2M3BA 3CCRP 2O1JA 1KYOH 1VQ4P 1CI6B 3AE5C 4XA4A 3B5NA 3JCUE 1NVOA 2WPSA 2FYUJ 2DW3A 1CW5A 2FFDA 1SQPE 1JOCA 1AQ5A 2IPPA 1SFCB 3GG2A 1OVUA 3FXDA 5KJ7D 3L74J 3L70E 1N73A 2W90A 1KMIZ 2HODB 2QIWA 1PIXA 5B66E 1PP9J 3ITKA 2N1TA 3CXHE 3NMDA 2Q3IA 3OA7A 3L73J 1AA0A 1FZGA 2ZYGA 3H1LE 1BE3D 4WY4D 3H1IE 3WUUA 4NPEA 1SQXD 2R44A 4Z1MH 1KYOD 5TISH 1NU1G 2E75B 1OW7A 1NTMJ 2O01H 3S4RA 1J1DB 1VQ6P 3V2RA 1KB9H 3A2AA 4BRYA 2O1KA 3V2NA 4L76A 1GU4A 3GF3A 1K73Q 3WU2E 3HUSC 1YBKA 1JM0A 3H32B 2B89A 1KQLA 2JP3A 2KXPB 2KNCA 1CSBA 1RY3A 2I8DA 3CCEP 5KKZB 5CCHD 1N86A 2QJYC 1GL2A 3LW5J 3PH0A 2E74D 1VPCA 2V7QH 5KJ7C 4M3LA 2KOGA 2OYHB 1N8RQ 3AE2C 1FDIA 2IBZI 2Q3EA 1FDMA 5AW7B 1LT1A 4RKUJ 1JY2O 2ZAEB 1M90Q 3CWBG 1JMBA 4R4LA 3H1JJ 1EQ7A 1U57A 2WTYA 3CX5E 2QJKC 1X0TA 2D2CB 1LT9C 3TNUB 2FXPA 2FYZA 1NWQA 1NAYA 1BSNA 2QJPB 1IJDB 2IYOA 1VQ8P 4PJ0E 2WSFJ 1NKZB 4WY4C 1FJKA 3C8VA 3MD0A 3CWBD 2H43A 2W27A 1SQXK 3H1HJ 2KSEA 2FY8A 3A3YB 3M9BA 1NU1E 3TSIA 1H0TA 1GTWA 2Z5IA 4IFDK 5AW6B 4H0LB 1S9KD 1SFCD 2K37A 1YTZT 2KB7P 4Y28J 1FZBA 3RBZA 2K9JB 4W7ZA 2H8PD 4C7NB 1U7MA 1Y47A 4Y99B 3AE1C 1MV8A 2OTKE 5CCHC 3RBXA 3M06A 5KLVD 3O6QB 2R3CA 2AXTH 1DEEG 5TISE 1S1CX 1S4XA 1LNQA 3D70A 2ZYAA 5AW4B 3CC4P 3H25A 4KJMA 1AQTA 2E75D 3CWBE 2MKVA 1G2CB 5CBOA 3BRTB 1FZEA 2H88C 3AECC 2HPCB 1VQKP 5AW2B 1WMKA 1AVYA 1EZVI 3CMAP 5H2FE 3FWNA 2ZYDA 1RE4C 1NTZK 3A5TA 4L75A 1FOSF 4HB1A 3V2QA 1M56D 4XE5B 3IR9A 1HH0A 1FZFA 1R8EA 1W2EA 3V4QA 1SFCC 5AVQB 4UB6H 3VP8A 1ZRTD 1EC5A 4PD4I 2KZIA 3CCQP 1TU3F 1IC2A 3II6A 2KK7A 1BE3J 1U7JA 1Y9BA 4EIJA 1SQXJ 1FZCA 2IFNA 2D2CD 2WT7A 1OIPA 5KLVK 4TT3H 4OWFA 4R4MA 2B87A 5AW3B 3EQ2A 3RL0C 1LTJA 4GOEA 2E75C 5APQA 3V5BA 1NKNA 1VF5B 5CCGA 2P7JA 1BCCG 3M0DA 1S5LX 2IBZG 2ZXXA 1GU5A 1FC2C 1DH3A 1JTHB 4H0LD 2RN0A 2PFXA 3AEAC 1LWUC 4YXWH 3CL3D 1Q86Q 1L4AA 2QJKB 5GTHH 1LT9B 2KI7B 2XU6A 1RF1C 3BCCG 4NPDA 4WB4A 1ZN5A 3B8EB 5KKZC 2YIUB 5B66H 4GOFA
chains in the Genus database with same CATH topology
2B89A 1NVOA 2M5AA 2I8DA 1EC5A 1U7MA 2K3RA 2KS1B 1Y47A 4WWIA 2OTKE 2KZIA 1ZW0A 4GODA 1OVUA 3FXDA 3PH0A 2LXCB 1ZXGA 1EDKA 1U7JA 5EFWB 2M0BA 2KIKA 2QRXA 2LR2A 1DEEG 4HJGH 2KZJA 1EDLA 5DJTB 1SS1A 3MZWB 4HKZH 1LT1A 2Q1KA 2ZAEB 2LXBA 2HR3A 5C39A 1JMBA 4CPGA 1LP1B 2SPZA 2B87A 2KUBA 4KJMA 1X0TA 2UWJE 2P58A 4ZMDA 2QVAA 1EDIA 5CBOA 4ZNCA 2RKLA 1H0TB 4NPEA 4GOEA 2R44A 4K3AA 3MHVA 1EDJA 3QWOC 4ASWA 2WMMA 4ASVA 1Q2NA 2JWDA 4JBZA 4EYYQ 1FC2C 3RGUA 3S1KA 2M5AB 1BDCA 4K35A 3ZDMA 2B88A 1OVVA 1OVRA 1S3JA 1H0TA 4HB1A 2KI7B 5K5GB 2B87B 5CBNA 1MFTA 3FXEA 4MN4C 5DJUB 4IOIH 1BDDA 4NPDA 4BXLA 4NPFX 1JM0A 1LP1A 4GOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B89 A;  1NVO A;  2M5A A;  2I8D A;  1EC5 A;  1U7M A;  2K3R A;  2KS1 B;  1Y47 A;  4WWI A;  2OTK E;  2KZI A;  1ZW0 A;  4GOD A;  1OVU A;  3FXD A;  3PH0 A;  2LXC B;  1ZXG A;  1EDK A;  1U7J A;  5EFW B;  2M0B A;  2KIK A;  2QRX A;  2LR2 A;  1DEE G;  4HJG H;  2KZJ A;  1EDL A;  5DJT B;  1SS1 A;  3MZW B;  4HKZ H;  1LT1 A;  2Q1K A;  2ZAE B;  2LXB A;  2HR3 A;  5C39 A;  1JMB A;  4CPG A;  1LP1 B;  2SPZ A;  2B87 A;  2KUB A;  4KJM A;  1X0T A;  2UWJ E;  2P58 A;  4ZMD A;  2QVA A;  1EDI A;  5CBO A;  4ZNC A;  2RKL A;  1H0T B;  4NPE A;  4GOE A;  2R44 A;  4K3A A;  3MHV A;  1EDJ A;  3QWO C;  4ASW A;  2WMM A;  4ASV A;  1Q2N A;  2JWD A;  4JBZ A;  4EYY Q;  1FC2 C;  3RGU A;  3S1K A;  2M5A B;  1BDC A;  4K35 A;  3ZDM A;  2B88 A;  1OVV A;  1OVR A;  1S3J A;  1H0T A;  4HB1 A;  2KI7 B;  5K5G B;  2B87 B;  5CBN A;  1MFT A;  3FXE A;  4MN4 C;  5DJU B;  4IOI H;  1BDD A;  4NPD A;  4BXL A;  4NPF X;  1JM0 A;  1LP1 A;  4GOF A; 
#chains in the Genus database with same CATH topology
 1PGO A;  5M1B A;  1M1J A;  3RK2 B;  3CXH H;  3CCL P;  3WUT A;  3D71 A;  2XNX A;  1DD4 A;  2YKO A;  3AEF C;  3GF7 A;  5AVV B;  1RE3 C;  2W8Z A;  2ZXE B;  3MUD A;  3BCC D;  1FJP A;  1ZR2 A;  1KIL D;  1BGY J;  2C0X A;  3L72 G;  3TGU G;  2FBW C;  5KTB A;  1PFI A;  1FDO A;  3GHG B;  1SQQ K;  2D2C C;  2KS1 A;  1NTZ J;  1LTT C;  3GLM A;  1FOS E;  2H7H A;  2QA4 P;  4QMA A;  3H1K G;  4WVZ A;  2QJP C;  1SQP D;  2WSE H;  5AW1 B;  3L72 D;  3AE8 C;  4DZO A;  3WU2 H;  3Q2Y A;  3MHV A;  3QWO C;  4ASW A;  1PPJ D;  1KOR A;  2WMM A;  4ASV A;  3U1C A;  4JBZ A;  4A7P A;  4U3F G;  1Q81 Q;  3H1K D;  1VQ9 P;  4K35 A;  3CXH D;  2W83 C;  1RF0 C;  4W80 A;  1YYC A;  1OVV A;  1M7L A;  1BCC E;  3E1I A;  1QLE D;  2NPS A;  3C9I A;  2IBZ E;  2A45 I;  5KLV J;  1E5W A;  1OW8 A;  1L0L G;  1T8Z A;  2JKV A;  1IFN A;  5BU5 A;  2E42 A;  3H1I D;  3P32 A;  4OVN F;  4U3F D;  2Z5H A;  2O01 N;  3L35 A;  3BCC E;  1H8A A;  1KIL E;  1X8Y A;  1ZR4 A;  3KYQ A;  2XND H;  3G9R A;  3CX5 H;  2W6J H;  5AVX B;  1EZV G;  4L73 A;  4DCK A;  1L0N J;  1PGJ A;  2WVR A;  3IF4 A;  4PJ0 H;  2W6B A;  1Q90 D;  2QM8 A;  1KIL C;  3LID A;  2R5D A;  3PRJ A;  3L72 E;  2LXB A;  3TGU E;  2J5U A;  3B5N B;  2FKW B;  3A0H E;  5AW5 B;  5GTH E;  3K5B A;  2QE7 H;  1YIJ P;  1VF5 D;  3IAO A;  2IX7 C;  1PPJ E;  3L71 J;  3KZI E;  1J1E C;  1IFD A;  2Q6Q A;  2FFD B;  3GMA A;  1OZH A;  2KLU A;  2HOD A;  1Q82 Q;  1MZ9 A;  3H1K E;  2LKM A;  3TYY A;  1SQP K;  1EDJ A;  3CME P;  4D6T G;  1SQB G;  4EYY Q;  2Q9I A;  3HD7 D;  2E5Y A;  3M9Q A;  1W5C E;  1DD3 A;  3MTU E;  2P2U A;  2L5G B;  1SQQ J;  3RK2 D;  5GTI E;  4U3F E;  1LTA C;  3CX5 D;  4B86 A;  4N3Y B;  3RL0 B;  1XTC C;  2POH A;  2PGD A;  2WQY C;  2Y0C A;  4WBA A;  1N7S A;  1JB0 J;  1L0L E;  4O9B A;  3CLQ A;  3CCM P;  1R5L A;  3Q5S A;  1LWU B;  4XFJ A;  3VMX A;  1P84 I;  1USE A;  5EFW B;  1NU1 D;  3H32 A;  2KZJ A;  1RF1 B;  1EZV E;  4BRY B;  2Q1K A;  2HR3 A;  2Y9Y A;  3Q5P A;  2GUS A;  2A06 G;  2J58 A;  2KNC B;  1YJW P;  1T6A A;  1UIX A;  5H2F H;  3P8C E;  2OYH A;  1VF5 C;  1GL2 B;  3AE9 C;  1GZL A;  3A0B E;  2K88 A;  1A02 F;  1FE6 A;  2FXM A;  4PD4 E;  4IL6 E;  1X79 B;  2A06 D;  3RGU A;  3IFM A;  4ZKU A;  1NO4 A;  3M0D C;  1NH4 A;  3TNU A;  2C9N Y;  1JEK A;  1M8O B;  4D6T E;  1BSH A;  1SQB E;  1X9V A;  3HD7 C;  2YIU C;  1KFM A;  5K5G B;  4LC1 A;  3RK2 C;  3HE4 B;  1MFT A;  3USS A;  3V2P A;  1HWT C;  3MP7 B;  3S9O A;  3Q5R A;  1UII A;  2R32 A;  3CI9 A;  2HLO A;  2C9L Y;  3L37 A;  5L8R J;  5AW0 B;  2K3R A;  1FZA A;  3JC2 2;  1SQP J;  3L75 G;  3HRN A;  2BCC G;  3GHG C;  2FYN B;  1JO5 A;  3JSV C;  3B5N D;  2A45 G;  3BRV B;  1SQV G;  5APU A;  2YNY A;  1OW6 A;  2PAJ A;  5DJT B;  3NTN A;  3L70 J;  2K9J A;  3D6Y A;  4C7N A;  3G3Z A;  2Y9Z A;  3CD6 P;  1NU1 K;  2YXR B;  5C39 A;  1NTK G;  1N2D C;  1ZOY C;  1J2J B;  2HYN A;  1EXI A;  2NRG A;  1GW4 A;  2RMZ A;  1SQV D;  4OGQ B;  2A06 E;  3H1L J;  5AVZ B;  1USD A;  3L36 A;  1JMM A;  3BAS A;  2OTJ P;  4YTP C;  3H1I J;  3HTK B;  2GA1 A;  1KIL B;  3FX0 A;  1T2K D;  3RL0 D;  4DOJ A;  1AJY A;  1NTK D;  3S1K A;  1ZME C;  1E79 H;  4JYB A;  1L0N G;  3KXD A;  4YPC A;  1URQ C;  2FYU G;  3MIW A;  1G2C A;  2ITA A;  3TF5 A;  1K05 A;  2WSE J;  3AE4 C;  2YKP A;  1YTZ I;  1J1E B;  2PRR A;  4IOI H;  2KLV A;  3L74 G;  3L71 G;  1LTS C;  3KHU A;  2P67 A;  2OYI C;  1RHZ B;  5AVY B;  2FYU D;  1PP9 G;  5TJH A;  2WWW A;  1NHL A;  2YKQ A;  3M9H A;  3W67 A;  2K1A A;  1ZXG A;  2CK3 H;  3L73 G;  3O8Z A;  3L75 E;  1Q7Y Q;  3RK3 E;  1VL2 A;  3N7N A;  3B5N C;  3WMM 0;  2BCC E;  5APV A;  1GL2 D;  5AVT B;  1SQV E;  2B9B A;  2FFD C;  3PHL A;  2XDJ A;  1WRG A;  4YXD C;  2JWA A;  1LTG C;  1VQL P;  2KUB A;  2P58 A;  3LW5 H;  3L73 D;  3RK3 C;  3WUV A;  2QVA A;  1MUU A;  2BEQ D;  3G4S P;  1NTM G;  1NTK E;  3VMZ A;  5E79 E;  3HUS A;  5AVW B;  1N73 C;  3H6P A;  1FAV A;  2FXO A;  2N1T C;  1KYO I;  4GKG A;  2H89 C;  2I1K A;  2GM4 A;  4N6J A;  2HG5 D;  2N9Y B;  2HFE D;  1T2K C;  1QX8 A;  1IO4 A;  1OFC X;  3SFD C;  4H13 C;  4W7Y A;  1L0N E;  5KJ7 A;  2B87 B;  1NU1 J;  5DJU B;  2ZT9 B;  2FYU E;  4NPF X;  1LP1 A;  1LTJ B;  1JTH A;  3G71 P;  1N7S C;  3AEE C;  3I5C A;  4C46 A;  3A0H H;  5CHX A;  1Y8A A;  3L74 E;  5B5E E;  2K9Y A;  3EWK A;  3LIE A;  3KZI H;  1SP4 A;  3H1J G;  3AEB C;  3HD7 B;  1BCC D;  1PP9 E;  4IFM A;  2M0B A;  2WZ7 A;  4WY4 A;  3OJA B;  1RQU A;  3HE5 A;  1L4A B;  4OH8 B;  3L4F A;  3E1R A;  3L73 E;  4OGQ D;  3G6E P;  3SWY A;  1GL2 C;  1VQP P;  2O01 J;  4U7J A;  3SFE C;  1GDT A;  1KN7 A;  3H1J D;  5GTI H;  3H1H G;  2C0W A;  3RL0 g;  3AE6 C;  2PP6 A;  2WIT A;  3CWB J;  1XTG B;  2M3E A;  1KB9 I;  1Q2N A;  2M8R A;  4L74 A;  1NTM E;  4JPZ B;  2M5A B;  1W2B O;  1WT6 A;  5AW8 B;  1P84 E;  3VTP C;  1T3J A;  1OWA A;  2WPV B;  3TGU D;  5CCH A;  3H1H D;  2RH0 A;  1S3J A;  1VQM P;  3CCS P;  3FWL A;  3F5H A;  3GW6 A;  3VMY A;  2V7Q J;  1LTB C;  5APX A;  1VQ7 P;  2E76 C;  2FYN C;  4WWI A;  1AVO A;  2YO2 A;  4KHX A;  5KAI E;  3CCU P;  1JY3 P;  1URQ B;  3AED C;  1LGH B;  4EOT A;  2QRX A;  3PJS K;  3A0B H;  1K8A Q;  5KAF E;  1HGV A;  2O3J A;  3MZW B;  4PD4 H;  4IFF A;  4IL6 H;  3H1J E;  1YQ3 C;  4RO0 A;  5CJ0 A;  3T97 B;  4CPG A;  5CMZ A;  2OYI B;  3ABV C;  1L0L D;  4OGQ C;  1HF9 A;  1CI6 A;  1RE4 A;  2Y0D A;  2ZVN B;  1PV3 A;  4ZNC A;  2RKL A;  2G3A A;  3VN0 A;  3R2P A;  3Q3D A;  3VMA A;  1LTI C;  3H1H E;  1SFC A;  1S5L E;  2CPS A;  1EZV D;  2WSC H;  1NAF A;  2ZT9 D;  1H89 A;  1NOH A;  5KLI C;  2W6A A;  1D7M A;  3RK3 B;  2ZVO B;  1MFZ A;  5CCG D;  4BXL A;  3P8C D;  1IK7 A;  3VP9 A;  1N73 B;  1BE3 G;  2LXC B;  2JR8 A;  4JQ0 D;  1SQX G;  3U59 A;  2N1T B;  1JY3 N;  4PD4 D;  1L4A D;  3V6I A;  3TK1 A;  3QH9 A;  3BAT A;  3EFF K;  1Z56 A;  2GUV A;  3OAK A;  4PV1 C;  3SSU A;  1EDK A;  4H44 C;  4D6T D;  1SQB D;  3A7O A;  4H13 B;  2P10 A;  3KQG A;  1QVG O;  1KZU B;  2BEZ F;  3U1A A;  1IZN B;  3N4X A;  1OMI A;  1DX7 A;  3PP5 A;  2AEJ A;  2P1J A;  1N7S B;  1HUC A;  1LWU A;  1HGZ A;  2WSS H;  1HTL C;  2Q5U A;  1YQ4 C;  1RF1 A;  1L0L K;  1FZC C;  1R5S A;  2YXQ B;  1IK9 A;  1ZP0 C;  2VRS A;  1CZQ A;  5APT A;  3VOP A;  2JEE A;  1RE3 A;  1HJB A;  3SWF A;  2ZT9 C;  2QG4 A;  1BCC J;  3SWK A;  4I7Z B;  1LTJ C;  3CC7 P;  3FXE A;  2Z4E A;  3I56 P;  1URQ D;  5CCG C;  1BGY G;  4I6M C;  3I55 P;  1KQG B;  1HVV A;  2A45 H;  1G1J A;  5APY A;  2BAS A;  2NPS D;  1GW3 A;  1BE3 E;  3BCC J;  1JUN A;  1ZW0 A;  4GOD A;  1NTZ G;  1KQF B;  1QL2 A;  1SQX E;  1L4A C;  1SVF A;  3HE4 A;  1X22 A;  1KYO E;  4N78 D;  4AYC A;  1RQV A;  2WPQ A;  1KC8 Q;  4HYT B;  5E79 H;  2OQQ A;  4JF7 A;  1BGY D;  4EI2 A;  1KB9 D;  4HKZ H;  1M1J C;  2AXC A;  1YIT P;  1N7L A;  2E5T A;  1SQB K;  1KQS O;  1RF0 A;  1PGP A;  3R4Y A;  2E76 B;  2YO3 A;  1G1I A;  1NTZ D;  3L72 J;  1YHQ P;  3TGU J;  2IBZ D;  1K04 A;  4ZMD A;  1S2E A;  3MUD C;  3KPE A;  1EDI A;  4EDF A;  1H0T B;  2G8Y A;  4C7R A;  1OX3 A;  3D6Z A;  5KLV G;  2NZ2 A;  3H1K J;  3L75 D;  3RK3 D;  2J59 M;  5APS A;  2BCC D;  4LLH A;  3AEG C;  3O6Q A;  1BDC A;  1EXJ A;  3CXH I;  3TDK A;  5B5E H;  1NJI Q;  2N1T D;  4GDO A;  2XKM A;  3HTK A;  4U3F J;  1BDD A;  1KV4 A;  1KIL A;  1M57 D;  2IZ0 A;  2E74 C;  4JYC A;  1KTM A;  1ZV8 A;  2V4H A;  5AVR B;  1VQO P;  3BVH A;  4H13 D;  2N9B A;  2ZJS E;  3Q1M A;  3E7K A;  4N78 E;  1L0L J;  1JY3 O;  4UB8 H;  1KFN A;  4AUW A;  1BGY E;  2NPS C;  1KB9 E;  1NYH A;  2XZR A;  3P8M C;  5KLI B;  2HPC A;  1N7S D;  1M1K Q;  2LR2 A;  2KP8 A;  1SS1 A;  1NTZ E;  1DIP A;  1L0N D;  2L91 A;  1IFJ A;  2R3S A;  4I2L C;  1S72 P;  5APW A;  2OTL P;  2SPZ A;  1P84 H;  2XV5 A;  2QEX P;  2ZFC A;  1SLQ A;  3AE7 C;  1S9K E;  3FGA D;  3W68 A;  4PV1 B;  3L74 D;  3L71 D;  4H44 B;  4K3A A;  1SQQ G;  2Y0E A;  3NFQ A;  1PP9 D;  4DT0 A;  4RJT A;  2JWD A;  2OGU A;  3AE3 C;  3M0A A;  1FS0 E;  1RH5 B;  3ZDM A;  5KLV E;  2WPR A;  5KAI H;  1PL5 A;  3V4W A;  4D6T J;  1SQB J;  1SQQ D;  5CBN A;  3CX5 I;  3VYI A;  1SQV K;  1FZC B;  5KAF H;  2MJZ A;  1JCC A;  2QM7 A;  2WT7 B;  1LJ2 A;  1YJN P;  3M91 A;  3HUS B;  1QEX A;  1H88 A;  3CPW O;  1NTM D;  1NTK K;  2WSC J;  1L2P A;  1P84 D;  4BWN A;  2QJY B;  5CJ4 A;  3OW2 O;  2WSF H;  2Q7C A;  2E76 D;  2KIK A;  3PTZ A;  4TLF A;  2OAR A;  2KSJ A;  4DJG A;  1DEB A;  2R5B A;  1S5L H;  1QVF O;  2IZ1 A;  1LT9 A;  4HH2 A;  1J1D C;  3L71 E;  1LP1 B;  3JCU H;  1JY2 P;  1L0N K;  2AEM A;  3HD7 A;  2FYU K;  1JNM A;  3KDP B;  2AXT E;  2IDB A;  1JCD A;  1HBW A;  2OYO A;  2IYP A;  3CCJ P;  1IFM A;  2E43 A;  1ZRT E;  2JJL A;  3NXS A;  4UB8 E;  1GK4 A;  3PLN A;  1M1J B;  4WY4 B;  4ZKP A;  1SQQ E;  3HE5 B;  1OVR A;  4I7Z C;  1QGK B;  5AW9 B;  3EFG A;  1OXZ A;  3GHG A;  2I1J A;  5AVS B;  2OYH C;  4MN4 C;  1SQP G;  3C1L A;  4GIF A;  2IFM A;  2M5A A;  1IFP A;  1ZLL A;  5AVU B;  1YI2 P;  1GMJ A;  1PPJ G;  2KS1 B;  3L70 G;  1VDF A;  4KT0 J;  1MKM A;  5BU8 B;  1FBM A;  2CPB A;  1A02 J;  1PGQ A;  4I1L A;  1T3U A;  1NTM K;  4HJG H;  5BVZ A;  1EDL A;  1KD1 Q;  2YMK A;  3MGN A;  1JY2 N;  4LGD E;  3L75 J;  4UB6 E;  1PZQ A;  2KYV A;  4PV1 D;  2E74 B;  3H1L G;  2BCC J;  3L70 D;  4GT1 A;  4H44 D;  3H1I G;  1URQ A;  1GK6 A;  1SQV J;  3IN6 A;  4AQR D;  2UWJ E;  4RES B;  3CC2 P;  2AEF A;  1YJ9 P;  2JDI H;  2NPS B;  4H0L C;  3CCV P;  3B4S A;  2JO1 A;  1AV1 A;  3P7K A;  1NTK J;  4IL6 X;  3H1L D;  3B71 A;  3T97 A;  1GD2 E;  1HJ0 A;  2OYI A;  1NGM B;  4Y99 C;  2YMY A;  1QL1 A;  3F89 A;  2QSI A;  2B88 A;  3UIA A;  1IFI A;  1FU1 A;  1VQ5 P;  1AFO A;  1VQN P;  1K9M Q;  2M3B A;  3CCR P;  2O1J A;  1KYO H;  1VQ4 P;  1CI6 B;  3AE5 C;  4XA4 A;  3B5N A;  3JCU E;  1NVO A;  2WPS A;  2FYU J;  2DW3 A;  1CW5 A;  2FFD A;  1SQP E;  1JOC A;  1AQ5 A;  2IPP A;  1SFC B;  3GG2 A;  1OVU A;  3FXD A;  5KJ7 D;  3L74 J;  3L70 E;  1N73 A;  2W90 A;  1KMI Z;  2HOD B;  2QIW A;  1PIX A;  5B66 E;  1PP9 J;  3ITK A;  2N1T A;  3CXH E;  3NMD A;  2Q3I A;  3OA7 A;  3L73 J;  1AA0 A;  1FZG A;  2ZYG A;  3H1L E;  1BE3 D;  4WY4 D;  3H1I E;  3WUU A;  4NPE A;  1SQX D;  2R44 A;  4Z1M H;  1KYO D;  5TIS H;  1NU1 G;  2E75 B;  1OW7 A;  1NTM J;  2O01 H;  3S4R A;  1J1D B;  1VQ6 P;  3V2R A;  1KB9 H;  3A2A A;  4BRY A;  2O1K A;  3V2N A;  4L76 A;  1GU4 A;  3GF3 A;  1K73 Q;  3WU2 E;  3HUS C;  1YBK A;  1JM0 A;  3H32 B;  2B89 A;  1KQL A;  2JP3 A;  2KXP B;  2KNC A;  1CSB A;  1RY3 A;  2I8D A;  3CCE P;  5KKZ B;  5CCH D;  1N86 A;  2QJY C;  1GL2 A;  3LW5 J;  3PH0 A;  2E74 D;  1VPC A;  2V7Q H;  5KJ7 C;  4M3L A;  2KOG A;  2OYH B;  1N8R Q;  3AE2 C;  1FDI A;  2IBZ I;  2Q3E A;  1FDM A;  5AW7 B;  1LT1 A;  4RKU J;  1JY2 O;  2ZAE B;  1M90 Q;  3CWB G;  1JMB A;  4R4L A;  3H1J J;  1EQ7 A;  1U57 A;  2WTY A;  3CX5 E;  2QJK C;  1X0T A;  2D2C B;  1LT9 C;  3TNU B;  2FXP A;  2FYZ A;  1NWQ A;  1NAY A;  1BSN A;  2QJP B;  1IJD B;  2IYO A;  1VQ8 P;  4PJ0 E;  2WSF J;  1NKZ B;  4WY4 C;  1FJK A;  3C8V A;  3MD0 A;  3CWB D;  2H43 A;  2W27 A;  1SQX K;  3H1H J;  2KSE A;  2FY8 A;  3A3Y B;  3M9B A;  1NU1 E;  3TSI A;  1H0T A;  1GTW A;  2Z5I A;  4IFD K;  5AW6 B;  4H0L B;  1S9K D;  1SFC D;  2K37 A;  1YTZ T;  2KB7 P;  4Y28 J;  1FZB A;  3RBZ A;  2K9J B;  4W7Z A;  2H8P D;  4C7N B;  1U7M A;  1Y47 A;  4Y99 B;  3AE1 C;  1MV8 A;  2OTK E;  5CCH C;  3RBX A;  3M06 A;  5KLV D;  3O6Q B;  2R3C A;  2AXT H;  1DEE G;  5TIS E;  1S1C X;  1S4X A;  1LNQ A;  3D70 A;  2ZYA A;  5AW4 B;  3CC4 P;  3H25 A;  4KJM A;  1AQT A;  2E75 D;  3CWB E;  2MKV A;  1G2C B;  5CBO A;  3BRT B;  1FZE A;  2H88 C;  3AEC C;  2HPC B;  1VQK P;  5AW2 B;  1WMK A;  1AVY A;  1EZV I;  3CMA P;  5H2F E;  3FWN A;  2ZYD A;  1RE4 C;  1NTZ K;  3A5T A;  4L75 A;  1FOS F;  4HB1 A;  3V2Q A;  1M56 D;  4XE5 B;  3IR9 A;  1HH0 A;  1FZF A;  1R8E A;  1W2E A;  3V4Q A;  1SFC C;  5AVQ B;  4UB6 H;  3VP8 A;  1ZRT D;  1EC5 A;  4PD4 I;  2KZI A;  3CCQ P;  1TU3 F;  1IC2 A;  3II6 A;  2KK7 A;  1BE3 J;  1U7J A;  1Y9B A;  4EIJ A;  1SQX J;  1FZC A;  2IFN A;  2D2C D;  2WT7 A;  1OIP A;  5KLV K;  4TT3 H;  4OWF A;  4R4M A;  2B87 A;  5AW3 B;  3EQ2 A;  3RL0 C;  1LTJ A;  4GOE A;  2E75 C;  5APQ A;  3V5B A;  1NKN A;  1VF5 B;  5CCG A;  2P7J A;  1BCC G;  3M0D A;  1S5L X;  2IBZ G;  2ZXX A;  1GU5 A;  1FC2 C;  1DH3 A;  1JTH B;  4H0L D;  2RN0 A;  2PFX A;  3AEA C;  1LWU C;  4YXW H;  3CL3 D;  1Q86 Q;  1L4A A;  2QJK B;  5GTH H;  1LT9 B;  2KI7 B;  2XU6 A;  1RF1 C;  3BCC G;  4NPD A;  4WB4 A;  1ZN5 A;  3B8E B;  5KKZ C;  2YIU B;  5B66 H;  4GOF A; 
#chains in the Genus database with same CATH homology
 2B89 A;  1NVO A;  2M5A A;  2I8D A;  1EC5 A;  1U7M A;  2K3R A;  2KS1 B;  1Y47 A;  4WWI A;  2OTK E;  2KZI A;  1ZW0 A;  4GOD A;  1OVU A;  3FXD A;  3PH0 A;  2LXC B;  1ZXG A;  1EDK A;  1U7J A;  5EFW B;  2M0B A;  2KIK A;  2QRX A;  2LR2 A;  1DEE G;  4HJG H;  2KZJ A;  1EDL A;  5DJT B;  1SS1 A;  3MZW B;  4HKZ H;  1LT1 A;  2Q1K A;  2ZAE B;  2LXB A;  2HR3 A;  5C39 A;  1JMB A;  4CPG A;  1LP1 B;  2SPZ A;  2B87 A;  2KUB A;  4KJM A;  1X0T A;  2UWJ E;  2P58 A;  4ZMD A;  2QVA A;  1EDI A;  5CBO A;  4ZNC A;  2RKL A;  1H0T B;  4NPE A;  4GOE A;  2R44 A;  4K3A A;  3MHV A;  1EDJ A;  3QWO C;  4ASW A;  2WMM A;  4ASV A;  1Q2N A;  2JWD A;  4JBZ A;  4EYY Q;  1FC2 C;  3RGU A;  3S1K A;  2M5A B;  1BDC A;  4K35 A;  3ZDM A;  2B88 A;  1OVV A;  1OVR A;  1S3J A;  1H0T A;  4HB1 A;  2KI7 B;  5K5G B;  2B87 B;  5CBN A;  1MFT A;  3FXE A;  4MN4 C;  5DJU B;  4IOI H;  1BDD A;  4NPD A;  4BXL A;  4NPF X;  1JM0 A;  1LP1 A;  4GOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...