4BXLA

Structure of alpha-synuclein in complex with an engineered binding protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
DGEIFYLPNLNPDQLCAFFHSVHDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Fibril
molecule keywords AS69
publication title Sequestration of a Beta-Hairpin for Control of Alpha-Synuclein Aggregation.
pubmed doi rcsb
source organism Synthetic construct
total genus 13
structure length 46
sequence length 46
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4bxlA00
1LP1B 4GODA 1JMBA 1LP1A 1X0TA 3FXEA 4K3AA 2M0BA 1ZXGA 4ASVA 4NPEA 1U7MA 1U7JA 2LXCB 4HJGH 2P58A 1OVUA 1EC5A 1SS1A 1MFTA 2KIKA 1Q2NA 5DJTB 2K3RA 4ASWA 4BXLA 5CBNA 2SPZA 4HKZH 2HR3A 1EDKA 3ZDMA 2B87B 4KJMA 2I8DA 2RKLA 1BDDA 2KS1B 1H0TB 1JM0A 3RGUA 3FXDA 1H0TA 3QWOC 1EDIA 4HB1A 2WMMA 5K5GB 4EYYQ 2Q1KA 3MZWB 4K35A 1S3JA 4CPGA 1DEEG 2LXBA 4NPDA 5DJUB 4NPFX 2B87A 4JBZA 2KI7B 1ZW0A 3PH0A 4ZMDA 2B88A 3S1KA 2LR2A 2KUBA 4IOIH 1FC2C 2B89A 5C39A 4GOEA 1OVRA 2M5AB 2KZIA 2M5AA 2UWJE 4MN4C 2OTKE 4GOFA 1BDCA 2KZJA 1EDLA 5EFWB 3MHVA 2JWDA 5CBOA 2QRXA 2QVAA 4WWIA 1NVOA 1OVVA 2R44A 1Y47A 1EDJA 2ZAEB 1LT1A 4ZNCA
chains in the Genus database with same CATH superfamily
4D6TD 2Y0CA 1LP1A 1FDMA 5APTA 1U7MA 3M0DC 1X79B 3EQ2A 3M06A 4I7ZB 1RF1C 2GUVA 3R2PA 3L4FA 1OVUA 2OYIC 2HODB 1WRGA 3OJAB 2E42A 3CWBD 5CBNA 3H1LJ 3WUTA 3RL0D 2I8DA 1PIXA 1QL1A 4UB6H 2ZXXA 1LGHB 2YMKA 4JF7A 2OYHA 5APQA 3HE5B 4W7YA 2IBZG 2YKOA 3L71E 4NPFX 1BE3G 1RHZB 3A0BH 2E75C 3H1HJ 1Y9BA 5GTHE 3C9IA 1S1CX 3GW6A 1N7SC 2E76D 1YJ9P 1NTKD 5CJ0A 2M5AB 1QX8A 3C8VA 1LTBC 2IBZD 2A06E 3EFFK 3W67A 1BSHA 1OX3A 1T3UA 2KYVA 3HD7B 3P8CD 3NMDA 2IYPA 3TGUG 1IC2A 2NPSD 5TJHA 2JJLA 3AEBC 2KSJA 1SQPE 1BGYE 3G3ZA 2XV5A 2K37A 2WTYA 2P58A 1LTIC 3Q2YA 3HUSA 2YXRB 3TGUD 1QL2A 1KQSO 1LTJB 4ASWA 3JCUE 2E43A 1OW7A 3ZDMA 3IFMA 1NTMG 2AEMA 4HYTB 4YXDC 2ZT9B 3H1KG 4PJ0H 2K88A 2W6BA 3PRJA 5CJ4A 2A45G 2HYNA 4I1LA 3MGNA 1K8AQ 1AFOA 5APVA 4EDFA 5M1BA 1SQXJ 1CI6B 4R4MA 5AVXB 5AW1B 4UB8E 4B86A 3H1KD 1K9MQ 2OYIA 1NOHA 2YKPA 1L4AD 3LW5J 1P84I 1SLQA 2MJZA 4PV1C 1HJ0A 4GT1A 1LTJC 5AVZB 1X22A 1S9KD 5CCGC 1VF5B 2XKMA 1JY3P 1KD1Q 4RO0A 1AQTA 2N1TD 1L0ND 1KV4A 2M3EA 2RN0A 1OZHA 4YTPC 4PD4I 3V2NA 1GK6A 3FXEA 5APWA 3CX5H 2AEFA 1SQVE 1JTHA 4IL6X 4KT0J 1Z56A 1N7SA 2HODA 3H1IJ 3WUVA 3WU2E 2Q7CA 2QJPB 1EDKA 1VQ6P 3BATA 4U3FJ 1LNQA 2WPSA 3M0AA 3H6PA 1ZR2A 3CCVP 3H1JJ 5CCHC 1H89A 2O01N 2OARA 1KB9D 3FX0A 3TK1A 3I56P 1CW5A 1T2KD 2P2UA 1M56D 1KQFB 1EZVI 4IL6E 3HE5A 3L72G 3RL0g 1ZRTD 2BCCJ 1KYOE 1MZ9A 2L5GB 1OW8A 1SQQG 5KLVG 1PFIA 3U1AA 2M5AA 3L72D 1MUUA 3Q5PA 3VMYA 3LW5H 4C46A 4JYCA 4WWIA 1GDTA 4RESB 4D6TJ 1NU1G 3QH9A 4H44C 3B4SA 1FZEA 3F89A 1N2DC 1BGYD 3AE5C 2D2CD 2YNYA 1LTGC 1U57A 1L0NK 1PPJG 5H2FH 1LT9B 1ZMEC 1Q86Q 1EZVE 3II6A 2CPSA 2H7HA 5AVWB 3PTZA 5KKZC 2ZXEB 2O01H 4TLFA 1NU1D 1UIIA 2C9NY 4KHXA 1LTJA 3AE2C 5B5EE 5BU5A 1FDIA 2J58A 1SVFA 5CCGA 3T97A 3FXDA 3B5NB 4Y99C 4U7JA 5AW7B 3RK3E 3TYYA 1GL2D 3KYQA 4H0LD 2R3CA 2R32A 2XDJA 4C7RA 1GMJA 2QM7A 4RKUJ 1FU1A 3MTUE 1IFDA 5E79E 1CI6A 3CMEP 1URQC 2HLOA 4N78E 2LR2A 1BE3J 3FWLA 3BCCG 2WSFJ 4OWFA 2Y9YA 5CCHA 2WSSH 1YIJP 1YITP 1NH4A 2AEJA 1HUCA 4H13C 1VQ9P 3TSIA 4XE5B 2R44A 3SSUA 1OXZA 1PP9E 2N9BA 1SQVD 1NAYA 3TGUJ 4IFFA 1YTZT 3V2PA 3HE4A 2C0WA 4JQ0D 3KPEA 2FY8A 3VMAA 2OYHC 1PGOA 4XA4A 4YXWH 2JWAA 3TNUB 2WQYC 1JY2O 1FBMA 3E7KA 3RL0B 3RBXA 1P84D 2K9JA 4KJMA 2O1KA 3RK3C 3H25A 1BCCE 1TU3F 2BEQD 1NU1K 1NHLA 1NTMJ 2FYNB 3L70G 1Q82Q 2LXBA 3H1KJ 4PD4D 3B71A 4L73A 2B88A 3SFDC 4JPZB 3S1KA 1VQPP 2CPBA 1W2EA 1IZNB 2E76B 2WPQA 2B89A 1RH5B 1RQUA 2N9YB 1VQLP 3A0HH 3V6IA 3L70D 1E79H 2J5UA 2QEXP 3GF7A 2QSIA 5KJ7D 1SFCD 3G4SP 1PV3A 3HTKA 3L75G 2NPSB 1Y47A 2XNDH 3L74E 3PHLA 3L36A 3BRTB 3L73E 4GODA 4WY4C 5KAFH 4UB6E 1IO4A 2FFDB 3SFEC 1NTZE 1U7JA 2PGDA 1VQ4P 1URQA 1LT9A 3CC7P 1L2PA 3VMXA 3CWBG 1GW4A 1BSNA 3GLMA 2ITAA 3HRNA 3H32B 3ITKA 3RK2D 3EWKA 4OGQD 2ZFCA 1H0TB 2R3SA 3C1LA 4XFJA 3B5NA 5AW0B 4HB1A 1N8RQ 2BASA 3GHGB 1WT6A 1KC8Q 4N78D 4JBZA 1LJ2A 4DJGA 4C7NA 3PH0A 1L4AB 1ZR4A 1M90Q 3AE8C 2P67A 2M8RA 2ZVOB 3L72J 4EIJA 1SQBE 1YJNP 2E74D 1NTKG 4I2LC 3CL3D 3SWYA 1SQQJ 2A45H 1L0LD 2Q9IA 4L75A 3CCQP 2XNXA 3MHVA 4IFMA 5KLVJ 2N1TB 4I7ZC 3KZIH 1AVOA 3B8EB 3IF4A 2OTJP 1NAFA 5AW4B 1DD4A 3Q5SA 2V7QH 4PJ0E 1KILD 3CX5I 1NU1J 2AXTH 5TISH 3H1LE 1LTTC 1W5CE 1IFMA 2YO3A 2KLVA 3RGUA 3AE1C 1GK4A 4AQRD 4DT0A 2P1JA 4LGDE 1IJDB 1W2BO 2QIWA 1KB9H 1AA0A 3H1HE 4WY4A 1HF9A 1CZQA 4ZMDA 1AJYA 1MV8A 3CXHH 3HD7C 2FYUD 5GTHH 5C39A 3E1IA 1A02J 3E1RA 3P7KA 1M1KQ 1KFNA 4WVZA 3CX5E 1BDCA 2Q5UA 2KZJA 1S72P 1GU4A 4LLHA 1FZBA 2E75D 1MKMA 2WSEJ 1L0NG 1N7SD 3L73D 3BCCJ 1VPCA 2NPSA 2KSEA 5AW2B 3N4XA 1L0LK 3LIEA 2ZJSE 4K3AA 3VOPA 4NPEA 5APYA 1FDOA 2FFDA 2KNCB 1R5LA 1JO5A 1S2EA 3MP7B 1JY3N 2KB7P 1QVFO 2ZT9C 1KYOI 3M9QA 1EC5A 1NTKK 2HPCB 5DJTB 2WSCH 4A7PA 1T6AA 4HKZH 1YYCA 2O01J 3H32A 2Q3EA 3VTPC 3PP5A 2WPVB 1H0TA 4DZOA 3VYIA 2W8ZA 1JY2N 2I1KA 2QJKB 1GL2B 1JY2P 5AVRB 2WMMA 1DIPA 5K5GB 4H0LB 1SQXE 1QLED 3L71G 3GHGA 1NJIQ 4WB4A 4YPCA 3CC4P 3BCCE 3FGAD 1K05A 1ZW0A 1VF5C 2IYOA 1NGMB 5GTIH 3CD6P 3L70J 5APSA 5AW3B 2VRSA 2A06G 3L71D 4N3YB 4TT3H 2LKMA 2OTKE 2KOGA 5H2FE 1G1JA 2FYUK 3O8ZA 1Q81Q 2YO2A 2QRXA 1VQNP 2J59M 2K1AA 2N1TA 4PV1D 1IFNA 2IFMA 1JCCA 1M1JB 2Y9ZA 3UIAA 1EDJA 1SP4A 3IR9A 2A06D 1BGYG 3CCSP 1IFJA 3AECC 2QJPC 3VN0A 1VL2A 5CCGD 2M0BA 3LIDA 4ASVA 3L75J 3H1LD 2WSEH 3OW2O 3WMM0 3H1IE 1DH3A 2FXMA 1YQ4C 2JO1A 3HD7A 4U3FE 3H1JE 2V4HA 1FZFA 3F5HA 1SQPD 2B87B 2Q6QA 1DX7A 3AE9C 1EDIA 1FJPA 1P84H 2QE7H 3CWBJ 2Y0EA 2BCCE 3IAOA 2PP6A 3MZWB 3VP9A 1DEBA 5CCHD 2P7JA 1OFCX 3S4RA 3D71A 3D6YA 1ZP0C 4PD4H 1T3JA 2HFED 2JR8A 1L0LJ 1LWUB 1N73B 1M8OB 4D6TE 3A7OA 1SFCB 1OIPA 3I5CA 2FBWC 5KLIB 2OYOA 1NTKJ 1LT9C 3G9RA 2IBZI 3Q3DA 3OAKA 4OVNF 1SQVG 1AQ5A 4O9BA 2WT7B 1USEA 2KNCA 3B5NC 2IDBA 3MUDA 4Y28J 1MFTA 1RE4C 4H44D 2BEZF 3M9BA 3RK2B 4OGQB 3NXSA 2RH0A 1RF0A 3R4YA 1KZUB 1GU5A 1SQXD 2WZ7A 1GL2A 5L8RJ 1YTZI 3A0HE 1SQPK 3GG2A 4K35A 2KK7A 4CPGA 4NPDA 1MFZA 1NO4A 4Z1MH 1EXJA 3AEEC 2IBZE 2OQQA 1S4XA 1BE3E 1J2JB 2QJYB 1J1DB 2KUBA 3G71P 2NZ2A 1VDFA 2E74B 1FOSF 1KYOD 3AE4C 3GF3A 1R5SA 1X9VA 2A45I 2C9LY 1URQD 3HUSB 3KXDA 2C0XA 3AEGC 2OTLP 1YHQP 1PGQA 1G1IA 3TGUE 1M1JA 1VQ5P 5B66H 2M3BA 3H1ID 2IFNA 3RL0C 4I6MC 2WPRA 1EZVG 1KILB 3CPWO 1L0NJ 4HJGH 4U3FD 4H13D 2V7QJ 4WBAA 1Q2NA 1VQ8P 1N86A 1PL5A 2FYNC 1FE6A 1YQ3C 2RKLA 3CMAP 2JEEA 1RE3A 1EZVD 1LTAC 1RF1B 1NTME 2JDIH 1JUNA 4DCKA 2OYIB 1JMMA 1OW6A 2B9BA 2G8YA 3M9HA 3H1KE 1JEKA 2E76C 3L35A 1SQVK 1S5LH 1KB9I 3S9OA 2GM4A 1SQXK 2RMZA 3RK3D 2KP8A 3A0BE 3KHUA 1S9KE 2KI7B 2Z4EA 1AV1A 3L71J 3CCJP 3KZIE 2WVRA 4IOIH 2IZ0A 3A3YB 1RE4A 3CXHI 5AW9B 4GOEA 2NPSC 1L0NE 1JCDA 1OMIA 3P32A 1LWUA 4GOFA 1L0LG 2E75B 1N73A 2AXTE 1JTHB 5TISE 5KJ7A 2FFDC 1SFCA 1G2CB 1KFMA 2JP3A 1PP9G 1N7SB 2FKWB 3AE6C 3EFGA 3MIWA 2O3JA 2WT7A 2I1JA 1HH0A 1PP9D 1SQPJ 1BGYJ 1KB9E 3NFQA 3AEAC 4W7ZA 1VQOP 2PRRA 1M57D 1T8ZA 4GKGA 1FAVA 3GHGC 4QMAA 1YBKA 2SPZA 4WY4D 5KAIH 1BCCG 1H88A 1FZCB 2WSCJ 1GTWA 1HGZA 4EI2A 3CXHE 1ZRTE 5BVZA 1GD2E 1L4AC 1FZGA 3A5TA 1PGPA 3TNUA 1BCCD 5CHXA 1BE3D 3L72E 3W68A 1Y8AA 3NTNA 4BRYB 3PJSK 3WUUA 2FYUG 1HTLC 2N1TC 1SQQE 2ZYDA 4AUWA 2XU6A 2PAJA 5KLVE 2Z5HA 3U59A 1FZCC 1EDLA 2FYZA 3A2AA 5AVUB 2JWDA 5AVVB 3L74G 2QA4P 5APXA 4PV1B 3L73G 3BVHA 3AE3C 3CCLP 2XZRA 4ZNCA 1NTZG 3T97B 1NU1E 1KILA 2ZYAA 3L74D 1GZLA 1PPJE 3GMAA 1T2KC 1SQVJ 1KN7A 2P10A 1NTZD 1NTMD 2D2CB 3P8MC 3M0DA 3KQGA 3QWOC 1Q7YQ 1RF1A 5AVSB 5GTIE 2W6AA 4BWNA 2FXOA 2Q1KA 1PGJA 5AVTB 3TF5A 2YKQA 3CCMP 3JCUH 5DJUB 1N7LA 1DD3A 1YJWP 1CSBA 2WWWA 1SQBG 2GA1A 1YI2P 3CC2P 1Q90D 3CCRP 2UWJE 1K04A 1XTGB 1RY3A 2D2CC 5EFWB 3D6ZA 3HE4B 4UB8H 2W83C 5CBOA 3HD7D 1G2CA 1SQBD 2QVAA 3MUDC 1L4AA 2Z5IA 2GUSA 4EOTA 2K9JB 1FJKA 2YIUB 1OWAA 1X0TA 3M91A 1KQLA 1NYHA 4L76A 4AYCA 1RF0C 3H1LG 3O6QB 1P84E 1HGVA 2ZYGA 5AVQB 3N7NA 2W6JH 1ZOYC 2QJKC 2KIKA 1GL2C 2FXPA 4H44B 1M7LA 3V4WA 1XTCC 2R5BA 4H0LC 1SQPG 3G6EP 3CXHD 1FZCA 2NRGA 2KS1B 1HVVA 1JM0A 2DW3A 3CI9A 1A02F 2JKVA 2ZT9D 4PD4E 5KKZB 4N6JA 1R8EA 5AW6B 2H89C 1FS0E 2CK3H 2R5DA 4EYYQ 3H1HG 2Q3IA 1NTZK 1NTMK 2IX7C 3WU2H 1NKZB 4RJTA 1ZV8A 4IFDK 1JB0J 2YIUC 4W80A 1PZQA 3V2RA 4Y99B 3L70E 1X8YA 3HTKB 1SQQD 2PFXA 3USSA 1QGKB 4BRYA 2H43A 1KORA 5KLVD 2Y0DA 2W90A 3H1HD 1OVRA 1M1JC 4IL6H 4M3LA 3FWNA 1VF5D 1URQB 1KYOH 1EXIA 1HJBA 2POHA 2WITA 1FZAA 3OA7A 1LTSC 3L75E 3CX5D 4LC1A 3CCUP 1LP1B 1WMKA 3TDKA 1PP9J 1ZLLA 3VMZA 1SQBK 2LXCB 4H13B 1RE3C 2ZVNB 5AW5B 1JOCA 1PPJD 1E5WA 1QVGO 2H88C 3ABVC 1FOSE 2HR3A 1VQKP 3BASA 3CWBE 4C7NB 1SQXG 4DOJA 1AVYA 2OYHB 5APUA 3CLQA 1JNMA 1BCCJ 3BRVB 3JSVC 2O1JA 2HPCA 3D70A 1LWUC 1USDA 2E5TA 2IZ1A 3RK3B 1UIXA 5B5EH 4ZKPA 2IPPA 1H8AA 4HH2A 1N73C 5KJ7C 1L0LE 2QM8A 1SFCC 2G3AA 2OGUA 1QEXA 5KLIC 1GW3A 1FC2C 5B66E 1D7MA 1JY3O 3L37A 2KZIA 1KMIZ 3BCCD 4GIFA 4ZKUA 5BU8B 1NTKE 3RBZA 1SQQK 3K5BA 3KDPB 3CCEP 2FYUJ 5AW8B 1EQ7A 3SWFA 5E79H 5KLVK 1HBWA 2H8PD 1S5LX 4JYBA 1KILE 3P8CE 2ZAEB 2E5YA 1LT1A 2AXCA 5KAFE 1JMBA 2HG5D 2W27A 3H1IG 3RK2C 4OGQC 1ZXGA 2K9YA 3L74J 3V4QA 1HWTC 3L73J 3O6QA 4U3FG 3Q1MA 3AEFC 4R4LA 3H1JG 1RQVA 4OH8B 1SS1A 5CMZA 1NTZJ 1ZN5A 5AVYB 1J1EB 1S5LE 2K3RA 4BXLA 1IFPA 3I55P 4WY4B 3MD0A 3JC22 1BDDA 2YMYA 2KS1A 3B5ND 2KLUA 2BCCG 3V2QA 1NKNA 3H1JD 2QJYC 1J1DC 3IN6A 1KQGB 2FYUE 2E74C 1S3JA 1DEEG 2B87A 3V5BA 2MKVA 1IK9A 1KTMA 1NWQA 2BCCD 3HUSC 3U1CA 2QG4A 1IFIA 2WSFH 3SWKA 1J1EC 4D6TG 3VP8A 1VQ7P 5KTBA 4MN4C 2L91A 1SQBJ 3AE7C 3PLNA 4GDOA 1KILC 1VQMP 1K73Q 3L75D 1NVOA 1OVVA 2KXPB 1IK7A 4L74A 3AEDC 2YXQB 5KAIE 3Q5RA
chains in the Genus database with same CATH topology
1LP1B 4GODA 1JMBA 1LP1A 1X0TA 3FXEA 4K3AA 2M0BA 1ZXGA 4ASVA 4NPEA 1U7MA 1U7JA 2LXCB 4HJGH 2P58A 1OVUA 1EC5A 1SS1A 1MFTA 2KIKA 1Q2NA 5DJTB 2K3RA 4ASWA 4BXLA 5CBNA 2SPZA 4HKZH 2HR3A 1EDKA 3ZDMA 2B87B 4KJMA 2I8DA 2RKLA 1BDDA 2KS1B 1H0TB 1JM0A 3RGUA 3FXDA 1H0TA 3QWOC 1EDIA 4HB1A 2WMMA 5K5GB 4EYYQ 2Q1KA 3MZWB 4K35A 1S3JA 4CPGA 1DEEG 2LXBA 4NPDA 5DJUB 4NPFX 2B87A 4JBZA 2KI7B 1ZW0A 3PH0A 4ZMDA 2B88A 3S1KA 2LR2A 2KUBA 4IOIH 1FC2C 2B89A 5C39A 4GOEA 1OVRA 2M5AB 2KZIA 2M5AA 2UWJE 4MN4C 2OTKE 4GOFA 1BDCA 2KZJA 1EDLA 5EFWB 3MHVA 2JWDA 5CBOA 2QRXA 2QVAA 4WWIA 1NVOA 1OVVA 2R44A 1Y47A 1EDJA 2ZAEB 1LT1A 4ZNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LP1 B;  4GOD A;  1JMB A;  1LP1 A;  1X0T A;  3FXE A;  4K3A A;  2M0B A;  1ZXG A;  4ASV A;  4NPE A;  1U7M A;  1U7J A;  2LXC B;  4HJG H;  2P58 A;  1OVU A;  1EC5 A;  1SS1 A;  1MFT A;  2KIK A;  1Q2N A;  5DJT B;  2K3R A;  4ASW A;  4BXL A;  5CBN A;  2SPZ A;  4HKZ H;  2HR3 A;  1EDK A;  3ZDM A;  2B87 B;  4KJM A;  2I8D A;  2RKL A;  1BDD A;  2KS1 B;  1H0T B;  1JM0 A;  3RGU A;  3FXD A;  1H0T A;  3QWO C;  1EDI A;  4HB1 A;  2WMM A;  5K5G B;  4EYY Q;  2Q1K A;  3MZW B;  4K35 A;  1S3J A;  4CPG A;  1DEE G;  2LXB A;  4NPD A;  5DJU B;  4NPF X;  2B87 A;  4JBZ A;  2KI7 B;  1ZW0 A;  3PH0 A;  4ZMD A;  2B88 A;  3S1K A;  2LR2 A;  2KUB A;  4IOI H;  1FC2 C;  2B89 A;  5C39 A;  4GOE A;  1OVR A;  2M5A B;  2KZI A;  2M5A A;  2UWJ E;  4MN4 C;  2OTK E;  4GOF A;  1BDC A;  2KZJ A;  1EDL A;  5EFW B;  3MHV A;  2JWD A;  5CBO A;  2QRX A;  2QVA A;  4WWI A;  1NVO A;  1OVV A;  2R44 A;  1Y47 A;  1EDJ A;  2ZAE B;  1LT1 A;  4ZNC A; 
#chains in the Genus database with same CATH topology
 4D6T D;  2Y0C A;  1LP1 A;  1FDM A;  5APT A;  1U7M A;  3M0D C;  1X79 B;  3EQ2 A;  3M06 A;  4I7Z B;  1RF1 C;  2GUV A;  3R2P A;  3L4F A;  1OVU A;  2OYI C;  2HOD B;  1WRG A;  3OJA B;  2E42 A;  3CWB D;  5CBN A;  3H1L J;  3WUT A;  3RL0 D;  2I8D A;  1PIX A;  1QL1 A;  4UB6 H;  2ZXX A;  1LGH B;  2YMK A;  4JF7 A;  2OYH A;  5APQ A;  3HE5 B;  4W7Y A;  2IBZ G;  2YKO A;  3L71 E;  4NPF X;  1BE3 G;  1RHZ B;  3A0B H;  2E75 C;  3H1H J;  1Y9B A;  5GTH E;  3C9I A;  1S1C X;  3GW6 A;  1N7S C;  2E76 D;  1YJ9 P;  1NTK D;  5CJ0 A;  2M5A B;  1QX8 A;  3C8V A;  1LTB C;  2IBZ D;  2A06 E;  3EFF K;  3W67 A;  1BSH A;  1OX3 A;  1T3U A;  2KYV A;  3HD7 B;  3P8C D;  3NMD A;  2IYP A;  3TGU G;  1IC2 A;  2NPS D;  5TJH A;  2JJL A;  3AEB C;  2KSJ A;  1SQP E;  1BGY E;  3G3Z A;  2XV5 A;  2K37 A;  2WTY A;  2P58 A;  1LTI C;  3Q2Y A;  3HUS A;  2YXR B;  3TGU D;  1QL2 A;  1KQS O;  1LTJ B;  4ASW A;  3JCU E;  2E43 A;  1OW7 A;  3ZDM A;  3IFM A;  1NTM G;  2AEM A;  4HYT B;  4YXD C;  2ZT9 B;  3H1K G;  4PJ0 H;  2K88 A;  2W6B A;  3PRJ A;  5CJ4 A;  2A45 G;  2HYN A;  4I1L A;  3MGN A;  1K8A Q;  1AFO A;  5APV A;  4EDF A;  5M1B A;  1SQX J;  1CI6 B;  4R4M A;  5AVX B;  5AW1 B;  4UB8 E;  4B86 A;  3H1K D;  1K9M Q;  2OYI A;  1NOH A;  2YKP A;  1L4A D;  3LW5 J;  1P84 I;  1SLQ A;  2MJZ A;  4PV1 C;  1HJ0 A;  4GT1 A;  1LTJ C;  5AVZ B;  1X22 A;  1S9K D;  5CCG C;  1VF5 B;  2XKM A;  1JY3 P;  1KD1 Q;  4RO0 A;  1AQT A;  2N1T D;  1L0N D;  1KV4 A;  2M3E A;  2RN0 A;  1OZH A;  4YTP C;  4PD4 I;  3V2N A;  1GK6 A;  3FXE A;  5APW A;  3CX5 H;  2AEF A;  1SQV E;  1JTH A;  4IL6 X;  4KT0 J;  1Z56 A;  1N7S A;  2HOD A;  3H1I J;  3WUV A;  3WU2 E;  2Q7C A;  2QJP B;  1EDK A;  1VQ6 P;  3BAT A;  4U3F J;  1LNQ A;  2WPS A;  3M0A A;  3H6P A;  1ZR2 A;  3CCV P;  3H1J J;  5CCH C;  1H89 A;  2O01 N;  2OAR A;  1KB9 D;  3FX0 A;  3TK1 A;  3I56 P;  1CW5 A;  1T2K D;  2P2U A;  1M56 D;  1KQF B;  1EZV I;  4IL6 E;  3HE5 A;  3L72 G;  3RL0 g;  1ZRT D;  2BCC J;  1KYO E;  1MZ9 A;  2L5G B;  1OW8 A;  1SQQ G;  5KLV G;  1PFI A;  3U1A A;  2M5A A;  3L72 D;  1MUU A;  3Q5P A;  3VMY A;  3LW5 H;  4C46 A;  4JYC A;  4WWI A;  1GDT A;  4RES B;  4D6T J;  1NU1 G;  3QH9 A;  4H44 C;  3B4S A;  1FZE A;  3F89 A;  1N2D C;  1BGY D;  3AE5 C;  2D2C D;  2YNY A;  1LTG C;  1U57 A;  1L0N K;  1PPJ G;  5H2F H;  1LT9 B;  1ZME C;  1Q86 Q;  1EZV E;  3II6 A;  2CPS A;  2H7H A;  5AVW B;  3PTZ A;  5KKZ C;  2ZXE B;  2O01 H;  4TLF A;  1NU1 D;  1UII A;  2C9N Y;  4KHX A;  1LTJ A;  3AE2 C;  5B5E E;  5BU5 A;  1FDI A;  2J58 A;  1SVF A;  5CCG A;  3T97 A;  3FXD A;  3B5N B;  4Y99 C;  4U7J A;  5AW7 B;  3RK3 E;  3TYY A;  1GL2 D;  3KYQ A;  4H0L D;  2R3C A;  2R32 A;  2XDJ A;  4C7R A;  1GMJ A;  2QM7 A;  4RKU J;  1FU1 A;  3MTU E;  1IFD A;  5E79 E;  1CI6 A;  3CME P;  1URQ C;  2HLO A;  4N78 E;  2LR2 A;  1BE3 J;  3FWL A;  3BCC G;  2WSF J;  4OWF A;  2Y9Y A;  5CCH A;  2WSS H;  1YIJ P;  1YIT P;  1NH4 A;  2AEJ A;  1HUC A;  4H13 C;  1VQ9 P;  3TSI A;  4XE5 B;  2R44 A;  3SSU A;  1OXZ A;  1PP9 E;  2N9B A;  1SQV D;  1NAY A;  3TGU J;  4IFF A;  1YTZ T;  3V2P A;  3HE4 A;  2C0W A;  4JQ0 D;  3KPE A;  2FY8 A;  3VMA A;  2OYH C;  1PGO A;  4XA4 A;  4YXW H;  2JWA A;  3TNU B;  2WQY C;  1JY2 O;  1FBM A;  3E7K A;  3RL0 B;  3RBX A;  1P84 D;  2K9J A;  4KJM A;  2O1K A;  3RK3 C;  3H25 A;  1BCC E;  1TU3 F;  2BEQ D;  1NU1 K;  1NHL A;  1NTM J;  2FYN B;  3L70 G;  1Q82 Q;  2LXB A;  3H1K J;  4PD4 D;  3B71 A;  4L73 A;  2B88 A;  3SFD C;  4JPZ B;  3S1K A;  1VQP P;  2CPB A;  1W2E A;  1IZN B;  2E76 B;  2WPQ A;  2B89 A;  1RH5 B;  1RQU A;  2N9Y B;  1VQL P;  3A0H H;  3V6I A;  3L70 D;  1E79 H;  2J5U A;  2QEX P;  3GF7 A;  2QSI A;  5KJ7 D;  1SFC D;  3G4S P;  1PV3 A;  3HTK A;  3L75 G;  2NPS B;  1Y47 A;  2XND H;  3L74 E;  3PHL A;  3L36 A;  3BRT B;  3L73 E;  4GOD A;  4WY4 C;  5KAF H;  4UB6 E;  1IO4 A;  2FFD B;  3SFE C;  1NTZ E;  1U7J A;  2PGD A;  1VQ4 P;  1URQ A;  1LT9 A;  3CC7 P;  1L2P A;  3VMX A;  3CWB G;  1GW4 A;  1BSN A;  3GLM A;  2ITA A;  3HRN A;  3H32 B;  3ITK A;  3RK2 D;  3EWK A;  4OGQ D;  2ZFC A;  1H0T B;  2R3S A;  3C1L A;  4XFJ A;  3B5N A;  5AW0 B;  4HB1 A;  1N8R Q;  2BAS A;  3GHG B;  1WT6 A;  1KC8 Q;  4N78 D;  4JBZ A;  1LJ2 A;  4DJG A;  4C7N A;  3PH0 A;  1L4A B;  1ZR4 A;  1M90 Q;  3AE8 C;  2P67 A;  2M8R A;  2ZVO B;  3L72 J;  4EIJ A;  1SQB E;  1YJN P;  2E74 D;  1NTK G;  4I2L C;  3CL3 D;  3SWY A;  1SQQ J;  2A45 H;  1L0L D;  2Q9I A;  4L75 A;  3CCQ P;  2XNX A;  3MHV A;  4IFM A;  5KLV J;  2N1T B;  4I7Z C;  3KZI H;  1AVO A;  3B8E B;  3IF4 A;  2OTJ P;  1NAF A;  5AW4 B;  1DD4 A;  3Q5S A;  2V7Q H;  4PJ0 E;  1KIL D;  3CX5 I;  1NU1 J;  2AXT H;  5TIS H;  3H1L E;  1LTT C;  1W5C E;  1IFM A;  2YO3 A;  2KLV A;  3RGU A;  3AE1 C;  1GK4 A;  4AQR D;  4DT0 A;  2P1J A;  4LGD E;  1IJD B;  1W2B O;  2QIW A;  1KB9 H;  1AA0 A;  3H1H E;  4WY4 A;  1HF9 A;  1CZQ A;  4ZMD A;  1AJY A;  1MV8 A;  3CXH H;  3HD7 C;  2FYU D;  5GTH H;  5C39 A;  3E1I A;  1A02 J;  3E1R A;  3P7K A;  1M1K Q;  1KFN A;  4WVZ A;  3CX5 E;  1BDC A;  2Q5U A;  2KZJ A;  1S72 P;  1GU4 A;  4LLH A;  1FZB A;  2E75 D;  1MKM A;  2WSE J;  1L0N G;  1N7S D;  3L73 D;  3BCC J;  1VPC A;  2NPS A;  2KSE A;  5AW2 B;  3N4X A;  1L0L K;  3LIE A;  2ZJS E;  4K3A A;  3VOP A;  4NPE A;  5APY A;  1FDO A;  2FFD A;  2KNC B;  1R5L A;  1JO5 A;  1S2E A;  3MP7 B;  1JY3 N;  2KB7 P;  1QVF O;  2ZT9 C;  1KYO I;  3M9Q A;  1EC5 A;  1NTK K;  2HPC B;  5DJT B;  2WSC H;  4A7P A;  1T6A A;  4HKZ H;  1YYC A;  2O01 J;  3H32 A;  2Q3E A;  3VTP C;  3PP5 A;  2WPV B;  1H0T A;  4DZO A;  3VYI A;  2W8Z A;  1JY2 N;  2I1K A;  2QJK B;  1GL2 B;  1JY2 P;  5AVR B;  2WMM A;  1DIP A;  5K5G B;  4H0L B;  1SQX E;  1QLE D;  3L71 G;  3GHG A;  1NJI Q;  4WB4 A;  4YPC A;  3CC4 P;  3BCC E;  3FGA D;  1K05 A;  1ZW0 A;  1VF5 C;  2IYO A;  1NGM B;  5GTI H;  3CD6 P;  3L70 J;  5APS A;  5AW3 B;  2VRS A;  2A06 G;  3L71 D;  4N3Y B;  4TT3 H;  2LKM A;  2OTK E;  2KOG A;  5H2F E;  1G1J A;  2FYU K;  3O8Z A;  1Q81 Q;  2YO2 A;  2QRX A;  1VQN P;  2J59 M;  2K1A A;  2N1T A;  4PV1 D;  1IFN A;  2IFM A;  1JCC A;  1M1J B;  2Y9Z A;  3UIA A;  1EDJ A;  1SP4 A;  3IR9 A;  2A06 D;  1BGY G;  3CCS P;  1IFJ A;  3AEC C;  2QJP C;  3VN0 A;  1VL2 A;  5CCG D;  2M0B A;  3LID A;  4ASV A;  3L75 J;  3H1L D;  2WSE H;  3OW2 O;  3WMM 0;  3H1I E;  1DH3 A;  2FXM A;  1YQ4 C;  2JO1 A;  3HD7 A;  4U3F E;  3H1J E;  2V4H A;  1FZF A;  3F5H A;  1SQP D;  2B87 B;  2Q6Q A;  1DX7 A;  3AE9 C;  1EDI A;  1FJP A;  1P84 H;  2QE7 H;  3CWB J;  2Y0E A;  2BCC E;  3IAO A;  2PP6 A;  3MZW B;  3VP9 A;  1DEB A;  5CCH D;  2P7J A;  1OFC X;  3S4R A;  3D71 A;  3D6Y A;  1ZP0 C;  4PD4 H;  1T3J A;  2HFE D;  2JR8 A;  1L0L J;  1LWU B;  1N73 B;  1M8O B;  4D6T E;  3A7O A;  1SFC B;  1OIP A;  3I5C A;  2FBW C;  5KLI B;  2OYO A;  1NTK J;  1LT9 C;  3G9R A;  2IBZ I;  3Q3D A;  3OAK A;  4OVN F;  1SQV G;  1AQ5 A;  4O9B A;  2WT7 B;  1USE A;  2KNC A;  3B5N C;  2IDB A;  3MUD A;  4Y28 J;  1MFT A;  1RE4 C;  4H44 D;  2BEZ F;  3M9B A;  3RK2 B;  4OGQ B;  3NXS A;  2RH0 A;  1RF0 A;  3R4Y A;  1KZU B;  1GU5 A;  1SQX D;  2WZ7 A;  1GL2 A;  5L8R J;  1YTZ I;  3A0H E;  1SQP K;  3GG2 A;  4K35 A;  2KK7 A;  4CPG A;  4NPD A;  1MFZ A;  1NO4 A;  4Z1M H;  1EXJ A;  3AEE C;  2IBZ E;  2OQQ A;  1S4X A;  1BE3 E;  1J2J B;  2QJY B;  1J1D B;  2KUB A;  3G71 P;  2NZ2 A;  1VDF A;  2E74 B;  1FOS F;  1KYO D;  3AE4 C;  3GF3 A;  1R5S A;  1X9V A;  2A45 I;  2C9L Y;  1URQ D;  3HUS B;  3KXD A;  2C0X A;  3AEG C;  2OTL P;  1YHQ P;  1PGQ A;  1G1I A;  3TGU E;  1M1J A;  1VQ5 P;  5B66 H;  2M3B A;  3H1I D;  2IFN A;  3RL0 C;  4I6M C;  2WPR A;  1EZV G;  1KIL B;  3CPW O;  1L0N J;  4HJG H;  4U3F D;  4H13 D;  2V7Q J;  4WBA A;  1Q2N A;  1VQ8 P;  1N86 A;  1PL5 A;  2FYN C;  1FE6 A;  1YQ3 C;  2RKL A;  3CMA P;  2JEE A;  1RE3 A;  1EZV D;  1LTA C;  1RF1 B;  1NTM E;  2JDI H;  1JUN A;  4DCK A;  2OYI B;  1JMM A;  1OW6 A;  2B9B A;  2G8Y A;  3M9H A;  3H1K E;  1JEK A;  2E76 C;  3L35 A;  1SQV K;  1S5L H;  1KB9 I;  3S9O A;  2GM4 A;  1SQX K;  2RMZ A;  3RK3 D;  2KP8 A;  3A0B E;  3KHU A;  1S9K E;  2KI7 B;  2Z4E A;  1AV1 A;  3L71 J;  3CCJ P;  3KZI E;  2WVR A;  4IOI H;  2IZ0 A;  3A3Y B;  1RE4 A;  3CXH I;  5AW9 B;  4GOE A;  2NPS C;  1L0N E;  1JCD A;  1OMI A;  3P32 A;  1LWU A;  4GOF A;  1L0L G;  2E75 B;  1N73 A;  2AXT E;  1JTH B;  5TIS E;  5KJ7 A;  2FFD C;  1SFC A;  1G2C B;  1KFM A;  2JP3 A;  1PP9 G;  1N7S B;  2FKW B;  3AE6 C;  3EFG A;  3MIW A;  2O3J A;  2WT7 A;  2I1J A;  1HH0 A;  1PP9 D;  1SQP J;  1BGY J;  1KB9 E;  3NFQ A;  3AEA C;  4W7Z A;  1VQO P;  2PRR A;  1M57 D;  1T8Z A;  4GKG A;  1FAV A;  3GHG C;  4QMA A;  1YBK A;  2SPZ A;  4WY4 D;  5KAI H;  1BCC G;  1H88 A;  1FZC B;  2WSC J;  1GTW A;  1HGZ A;  4EI2 A;  3CXH E;  1ZRT E;  5BVZ A;  1GD2 E;  1L4A C;  1FZG A;  3A5T A;  1PGP A;  3TNU A;  1BCC D;  5CHX A;  1BE3 D;  3L72 E;  3W68 A;  1Y8A A;  3NTN A;  4BRY B;  3PJS K;  3WUU A;  2FYU G;  1HTL C;  2N1T C;  1SQQ E;  2ZYD A;  4AUW A;  2XU6 A;  2PAJ A;  5KLV E;  2Z5H A;  3U59 A;  1FZC C;  1EDL A;  2FYZ A;  3A2A A;  5AVU B;  2JWD A;  5AVV B;  3L74 G;  2QA4 P;  5APX A;  4PV1 B;  3L73 G;  3BVH A;  3AE3 C;  3CCL P;  2XZR A;  4ZNC A;  1NTZ G;  3T97 B;  1NU1 E;  1KIL A;  2ZYA A;  3L74 D;  1GZL A;  1PPJ E;  3GMA A;  1T2K C;  1SQV J;  1KN7 A;  2P10 A;  1NTZ D;  1NTM D;  2D2C B;  3P8M C;  3M0D A;  3KQG A;  3QWO C;  1Q7Y Q;  1RF1 A;  5AVS B;  5GTI E;  2W6A A;  4BWN A;  2FXO A;  2Q1K A;  1PGJ A;  5AVT B;  3TF5 A;  2YKQ A;  3CCM P;  3JCU H;  5DJU B;  1N7L A;  1DD3 A;  1YJW P;  1CSB A;  2WWW A;  1SQB G;  2GA1 A;  1YI2 P;  3CC2 P;  1Q90 D;  3CCR P;  2UWJ E;  1K04 A;  1XTG B;  1RY3 A;  2D2C C;  5EFW B;  3D6Z A;  3HE4 B;  4UB8 H;  2W83 C;  5CBO A;  3HD7 D;  1G2C A;  1SQB D;  2QVA A;  3MUD C;  1L4A A;  2Z5I A;  2GUS A;  4EOT A;  2K9J B;  1FJK A;  2YIU B;  1OWA A;  1X0T A;  3M91 A;  1KQL A;  1NYH A;  4L76 A;  4AYC A;  1RF0 C;  3H1L G;  3O6Q B;  1P84 E;  1HGV A;  2ZYG A;  5AVQ B;  3N7N A;  2W6J H;  1ZOY C;  2QJK C;  2KIK A;  1GL2 C;  2FXP A;  4H44 B;  1M7L A;  3V4W A;  1XTC C;  2R5B A;  4H0L C;  1SQP G;  3G6E P;  3CXH D;  1FZC A;  2NRG A;  2KS1 B;  1HVV A;  1JM0 A;  2DW3 A;  3CI9 A;  1A02 F;  2JKV A;  2ZT9 D;  4PD4 E;  5KKZ B;  4N6J A;  1R8E A;  5AW6 B;  2H89 C;  1FS0 E;  2CK3 H;  2R5D A;  4EYY Q;  3H1H G;  2Q3I A;  1NTZ K;  1NTM K;  2IX7 C;  3WU2 H;  1NKZ B;  4RJT A;  1ZV8 A;  4IFD K;  1JB0 J;  2YIU C;  4W80 A;  1PZQ A;  3V2R A;  4Y99 B;  3L70 E;  1X8Y A;  3HTK B;  1SQQ D;  2PFX A;  3USS A;  1QGK B;  4BRY A;  2H43 A;  1KOR A;  5KLV D;  2Y0D A;  2W90 A;  3H1H D;  1OVR A;  1M1J C;  4IL6 H;  4M3L A;  3FWN A;  1VF5 D;  1URQ B;  1KYO H;  1EXI A;  1HJB A;  2POH A;  2WIT A;  1FZA A;  3OA7 A;  1LTS C;  3L75 E;  3CX5 D;  4LC1 A;  3CCU P;  1LP1 B;  1WMK A;  3TDK A;  1PP9 J;  1ZLL A;  3VMZ A;  1SQB K;  2LXC B;  4H13 B;  1RE3 C;  2ZVN B;  5AW5 B;  1JOC A;  1PPJ D;  1E5W A;  1QVG O;  2H88 C;  3ABV C;  1FOS E;  2HR3 A;  1VQK P;  3BAS A;  3CWB E;  4C7N B;  1SQX G;  4DOJ A;  1AVY A;  2OYH B;  5APU A;  3CLQ A;  1JNM A;  1BCC J;  3BRV B;  3JSV C;  2O1J A;  2HPC A;  3D70 A;  1LWU C;  1USD A;  2E5T A;  2IZ1 A;  3RK3 B;  1UIX A;  5B5E H;  4ZKP A;  2IPP A;  1H8A A;  4HH2 A;  1N73 C;  5KJ7 C;  1L0L E;  2QM8 A;  1SFC C;  2G3A A;  2OGU A;  1QEX A;  5KLI C;  1GW3 A;  1FC2 C;  5B66 E;  1D7M A;  1JY3 O;  3L37 A;  2KZI A;  1KMI Z;  3BCC D;  4GIF A;  4ZKU A;  5BU8 B;  1NTK E;  3RBZ A;  1SQQ K;  3K5B A;  3KDP B;  3CCE P;  2FYU J;  5AW8 B;  1EQ7 A;  3SWF A;  5E79 H;  5KLV K;  1HBW A;  2H8P D;  1S5L X;  4JYB A;  1KIL E;  3P8C E;  2ZAE B;  2E5Y A;  1LT1 A;  2AXC A;  5KAF E;  1JMB A;  2HG5 D;  2W27 A;  3H1I G;  3RK2 C;  4OGQ C;  1ZXG A;  2K9Y A;  3L74 J;  3V4Q A;  1HWT C;  3L73 J;  3O6Q A;  4U3F G;  3Q1M A;  3AEF C;  4R4L A;  3H1J G;  1RQV A;  4OH8 B;  1SS1 A;  5CMZ A;  1NTZ J;  1ZN5 A;  5AVY B;  1J1E B;  1S5L E;  2K3R A;  4BXL A;  1IFP A;  3I55 P;  4WY4 B;  3MD0 A;  3JC2 2;  1BDD A;  2YMY A;  2KS1 A;  3B5N D;  2KLU A;  2BCC G;  3V2Q A;  1NKN A;  3H1J D;  2QJY C;  1J1D C;  3IN6 A;  1KQG B;  2FYU E;  2E74 C;  1S3J A;  1DEE G;  2B87 A;  3V5B A;  2MKV A;  1IK9 A;  1KTM A;  1NWQ A;  2BCC D;  3HUS C;  3U1C A;  2QG4 A;  1IFI A;  2WSF H;  3SWK A;  1J1E C;  4D6T G;  3VP8 A;  1VQ7 P;  5KTB A;  4MN4 C;  2L91 A;  1SQB J;  3AE7 C;  3PLN A;  4GDO A;  1KIL C;  1VQM P;  1K73 Q;  3L75 D;  1NVO A;  1OVV A;  2KXP B;  1IK7 A;  4L74 A;  3AED C;  2YXQ B;  5KAI E;  3Q5R A; 
#chains in the Genus database with same CATH homology
 1LP1 B;  4GOD A;  1JMB A;  1LP1 A;  1X0T A;  3FXE A;  4K3A A;  2M0B A;  1ZXG A;  4ASV A;  4NPE A;  1U7M A;  1U7J A;  2LXC B;  4HJG H;  2P58 A;  1OVU A;  1EC5 A;  1SS1 A;  1MFT A;  2KIK A;  1Q2N A;  5DJT B;  2K3R A;  4ASW A;  4BXL A;  5CBN A;  2SPZ A;  4HKZ H;  2HR3 A;  1EDK A;  3ZDM A;  2B87 B;  4KJM A;  2I8D A;  2RKL A;  1BDD A;  2KS1 B;  1H0T B;  1JM0 A;  3RGU A;  3FXD A;  1H0T A;  3QWO C;  1EDI A;  4HB1 A;  2WMM A;  5K5G B;  4EYY Q;  2Q1K A;  3MZW B;  4K35 A;  1S3J A;  4CPG A;  1DEE G;  2LXB A;  4NPD A;  5DJU B;  4NPF X;  2B87 A;  4JBZ A;  2KI7 B;  1ZW0 A;  3PH0 A;  4ZMD A;  2B88 A;  3S1K A;  2LR2 A;  2KUB A;  4IOI H;  1FC2 C;  2B89 A;  5C39 A;  4GOE A;  1OVR A;  2M5A B;  2KZI A;  2M5A A;  2UWJ E;  4MN4 C;  2OTK E;  4GOF A;  1BDC A;  2KZJ A;  1EDL A;  5EFW B;  3MHV A;  2JWD A;  5CBO A;  2QRX A;  2QVA A;  4WWI A;  1NVO A;  1OVV A;  2R44 A;  1Y47 A;  1EDJ A;  2ZAE B;  1LT1 A;  4ZNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...