4BXLA

Structure of alpha-synuclein in complex with an engineered binding protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
DGEIFYLPNLNPDQLCAFFHSVHDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequestration of a Beta-Hairpin for Control of Alpha-Synuclein Aggregation.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Fibril
molecule keywords AS69
total genus 13
structure length 46
sequence length 46
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4bxlA00
3PH0A 1X0TA 4ZNCA 5DJTB 1MFTA 3S1KA 4ZMDA 2WMMA 1EDIA 1LP1B 2KIKA 2B87A 4KJMA 3QWOC 2QVAA 2M0BA 1EDJA 4HB1A 2K3RA 2ZAEB 2B89A 2LXBA 2UWJE 2OTKE 1S3JA 1Y47A 2RKLA 1U7MA 2P58A 3FXDA 4HJGH 5CBOA 4IOIH 3ZDMA 1Q2NA 1LT1A 1OVUA 4NPEA 4MN4C 5C39A 2B87B 2B88A 1LP1A 2JWDA 1H0TB 4K3AA 2KI7B 2I8DA 4BXLA 4NPFX 5CBNA 5EFWB 2M5AB 1DEEG 4GOFA 4JBZA 3MHVA 1U7JA 1ZW0A 1SS1A 1OVVA 1BDCA 2KUBA 4GODA 4ASVA 4CPGA 4EYYQ 1NVOA 4NPDA 2Q1KA 1ZXGA 2R44A 1H0TA 2KS1B 4HKZH 1OVRA 2KZJA 2KZIA 4GOEA 1FC2C 2HR3A 1JMBA 2SPZA 5K5GB 3MZWB 1JM0A 1EDKA 1EDLA 2LXCB 5DJUB 4K35A 2LR2A 3FXEA 4WWIA 1EC5A 1BDDA 2QRXA 3RGUA 2M5AA 4ASWA
chains in the Genus database with same CATH superfamily
2W8ZA 3BCCG 3L72D 3CXHE 1KB9I 4H13B 2XNXA 4PV1B 1IFIA 1L0LD 1SVFA 2R5DA 2KXPB 2WSSH 3L70J 4UB6H 5E79H 3KHUA 2WMMA 2K9JB 3VMAA 4H13C 1EDIA 1L0ND 2KIKA 3EWKA 1T3UA 2R5BA 1NTMJ 2NPSB 2ITAA 1VPCA 2YIUB 2IX7C 2QVAA 2CPSA 2M0BA 1GU5A 1BGYE 1EDJA 5CJ0A 1KFMA 1MFZA 1FS0E 3G71P 1IO4A 1LTAC 1Q7YQ 1GL2D 1AVYA 2K9YA 1QLED 1NU1J 1KB9H 1WT6A 3H1IE 3CMAP 1YITP 3V6IA 4B86A 2V7QH 3AEEC 2PRRA 3CXHI 3PP5A 3B5NB 2WPSA 3WMM0 3VMZA 5AVQB 1S3JA 4WBAA 4RKUJ 1H88A 1Y47A 4H13D 2E76C 2QJKC 1GK6A 2YKQA 2IBZE 3L37A 2O01J 3GG2A 4YPCA 5KJ7A 3WUTA 1VQ9P 3CWBE 2N1TA 3B5NA 3FXDA 1KILE 4PV1C 1NTKK 3TNUA 5GTHE 2FYZA 3LIDA 1J1EB 2WPRA 3ZDMA 5B5EE 1FZCA 2OYHC 1IFJA 1K8AQ 3Q5PA 4PD4D 1SQBG 1K73Q 2JR8A 4GDOA 5KKZC 1NTKE 1SQXD 3Q1MA 3L73G 1H8AA 1FZBA 1KILC 1SQVD 1YTZT 3WU2E 3HUSA 1SQPG 1FOSE 3M9BA 1J1DB 4NPEA 4PD4I 1EZVD 4H0LB 1N73A 1OW7A 2KOGA 3H1KD 1S5LE 3H1LJ 1FZCC 2KS1A 2B88A 2K37A 1KFNA 2KNCB 1LT9A 4TT3H 1BGYG 2KI7B 1JY2N 3R2PA 4H0LC 1NTMG 2JO1A 3JCUE 2I8DA 2Y9YA 1SQQD 1KILA 2IPPA 2WSCH 1JMMA 1L0LK 1L4AC 1SQXE 3HD7C 4JYCA 4XE5B 1RE4A 5AW2B 3F5HA 1IK9A 4I7ZC 1Q90D 1SQXK 2FXOA 2WITA 1AVOA 2R3SA 3L71J 3BCCJ 1HJ0A 3Q3DA 1U7JA 4I7ZB 1FE6A 5APTA 2H43A 2N9YB 1ZW0A 2QIWA 1VF5B 2IBZG 1EXJA 1JY3P 1BDCA 3P8MC 3RK3D 1NYHA 1N2DC 4CPGA 2GUVA 2JDIH 2O01H 2E75B 2XNDH 3AE2C 1NAYA 1XTGB 3D6ZA 2QG4A 2FBWC 2RH0A 1DH3A 2AEMA 3TYYA 1S9KE 1MKMA 2W6JH 3L75G 3CCJP 1ZXGA 1RY3A 1PPJD 5BU8B 2R44A 5KAFE 1FJKA 1NO4A 5AW0B 3WUVA 3M0DC 1HWTC 3BRTB 3PRJA 1YQ4C 5TISE 2Z4EA 1JCDA 1KMIZ 2K1AA 1N73C 2BEZF 4HKZH 4YXWH 3L74E 5KTBA 1PZQA 3HD7D 1MZ9A 1T3JA 3L36A 1ZMEC 1R5SA 3W68A 2H89C 3N7NA 2NRGA 1KQSO 2QA4P 5KJ7C 2FYUD 4OVNF 1VQMP 1BGYJ 1BCCD 4HYTB 2R32A 3FWNA 3HTKB 1R8EA 3I55P 1AQ5A 1FC2C 5H2FH 3OJAB 3RBXA 3CCEP 1BE3D 1MV8A 3VP8A 4I1LA 1A02J 1JMBA 3A2AA 3O8ZA 1SFCB 3CX5H 5KLVD 2E43A 1P84E 3AECC 1KTMA 3AE8C 1M57D 3TGUG 3BASA 1YQ3C 1EZVE 4IL6E 4N3YB 2OYIB 1GD2E 3H1KE 2YXRB 3CXHH 3E1RA 4K35A 2V7QJ 1OW6A 1URQA 2M8RA 1PL5A 3L75E 4H44B 3B4SA 2AXTH 1N7SA 1L0NJ 1KQGB 4N6JA 2QRXA 3V2PA 3O6QA 1AFOA 1KB9D 3HD7A 1FZAA 1LTGC 1NHLA 1M1JA 5L8RJ 2Q6QA 1NTZK 3AE4C 3AE7C 2NPSA 3RK2C 1T2KD 2FFDC 2G8YA 1NJIQ 2XDJA 1IJDB 3L74G 2OYHA 3CC2P 1KORA 2ZXEB 3S1KA 1PFIA 3M91A 3IF4A 2FFDB 1KYOH 3H1KJ 2A06D 3H1LD 3II6A 2IZ1A 2NPSD 3HTKA 1FAVA 4W7YA 1KB9E 1CSBA 1K05A 1JEKA 3ITKA 3L70E 4ZKUA 4QMAA 1VQOP 1KV4A 1Q86Q 2D2CB 3CCVP 2IDBA 3CCQP 3HD7B 4DOJA 1RQUA 3CCMP 1RQVA 1NTME 1FDMA 2BCCD 3V5BA 1USDA 1NTZG 2HPCA 1JY3N 2DW3A 1URQD 1IC2A 5CHXA 2K9JA 5B5EH 2OYIC 4N78D 2LXBA 2FXPA 1PGJA 2CK3H 2UWJE 2PAJA 2QJYB 1ZOYC 1E5WA 3B8EB 3H32B 2JWAA 3KQGA 3L73J 4DZOA 2E75C 2RKLA 1SQPK 2P58A 5APUA 3WU2H 3WUUA 2LKMA 2XV5A 5CCHD 4U3FG 3U59A 1QL1A 3RK2B 3H1JG 4Y99C 2FKWB 2QEXP 1IFNA 1HGZA 3A0HE 4HH2A 3H1HD 1OZHA 4D6TE 2HODA 4YTPC 5APQA 1W5CE 2CPBA 1GW4A 2P10A 4GIFA 4Y99B 1VDFA 1HVVA 2O1JA 1Q2NA 1LNQA 2QSIA 3M0DA 3V2RA 5KLIB 3V2QA 3FWLA 3IN6A 1LT1A 2HG5D 1OVUA 3IAOA 2QM8A 1X22A 1OIPA 1SQVE 2IYPA 2OARA 2OQQA 4U3FJ 5APWA 3LIEA 4D6TD 1K9MQ 1NTKJ 2FXMA 2WSFH 2O1KA 2WTYA 2B87B 2KLVA 3P7KA 1Q81Q 2E75D 1YHQP 3A7OA 2XZRA 1JY3O 1JB0J 2ZYDA 1NOHA 2KNCA 3U1AA 2WT7A 3BRVB 2A45G 5EFWB 1SQVJ 2O01N 4IL6X 4C7NA 2KLUA 1LTTC 3G9RA 4IL6H 1YJWP 1GU4A 3A3YB 2QM7A 4JBZA 3O6QB 2JJLA 5AW8B 3UIAA 3VTPC 2BASA 2L5GB 5AW5B 2ZVNB 1NWQA 2ZYGA 3RL0g 5KAFH 1L0NE 4L75A 1HJBA 1YBKA 2QJYC 2WSCJ 2AXTE 3N4XA 4U3FE 2OTLP 2KUBA 1GW3A 4IFFA 3TDKA 1PGOA 3PTZA 1CI6A 3TSIA 2N1TB 5M1BA 5AW9B 1NVOA 4EYYQ 2H7HA 2OGUA 1SFCD 2Q3IA 2Q1KA 3L72E 4H0LD 4C7NB 1N8RQ 3MP7B 1NKNA 2E5TA 3HE5B 5AVRB 1S9KD 5KAIH 3A0BE 1RH5B 2YMKA 2D2CD 4UB8E 3RK2D 3SSUA 3CX5D 3M06A 1KYOE 3L74J 3MUDC 3RK3E 3W67A 5H2FE 3VP9A 3L72G 1AQTA 2A45H 1VQNP 2AEFA 4I6MC 1BE3J 1S1CX 1SLQA 4EDFA 1JTHB 4R4MA 3C1LA 3PHLA 5CCGC 4EI2A 1DX7A 1NTKD 1W2EA 2PGDA 4LLHA 3RK3C 3H1JJ 4PJ0E 1L0NG 2KSEA 2YO3A 4L73A 4AQRD 3CX5E 3MIWA 1P84I 5B66E 2KZJA 2H88C 4GOEA 3B5ND 3GW6A 3H6PA 1AV1A 2IBZI 2P67A 3I5CA 3CCUP 1JCCA 2Q9IA 2SPZA 1DEBA 1LT9B 3GHGB 1OFCX 4XA4A 3USSA 5K5GB 1VQ5P 3H1JE 4XFJA 2M3EA 3MD0A 3KZIH 1EDKA 2GUSA 1A02F 1LJ2A 3Q5RA 1VQLP 1BCCE 3G3ZA 1URQC 1PP9D 4U7JA 2ZJSE 3SFEC 4AYCA 4WWIA 3L70G 1HBWA 3GF3A 4OGQB 4KHXA 1T2KC 3VYIA 1EC5A 4R4LA 2E74D 2YIUC 1J1DC 2JKVA 3L71D 1GL2A 2HODB 1OMIA 1ZRTD 2Q7CA 1BSNA 1L0NK 5BU5A 2NPSC 2C0WA 5AW7B 1Y8AA 2R3CA 1ZR2A 4RESB 1LTJB 1USEA 2L91A 5AVTB 1X9VA 4ZNCA 5DJTB 1SQBD 1SFCA 3RK3B 1MFTA 2ZXXA 3H32A 3T97A 2C9LY 1GL2C 4ZMDA 4BRYB 1LTJC 5APSA 1LWUB 1SQQE 1LP1B 1SQPD 3TF5A 1VQ4P 2B87A 3D6YA 4KJMA 3OW2O 1RE3C 1FJPA 3AEGC 1YTZI 1S72P 1RF1C 2HYNA 4GT1A 2HLOA 1NU1G 1BGYD 2MJZA 4HB1A 4JYBA 4WB4A 3RBZA 1KC8Q 2IYOA 3SWKA 1G1JA 3FX0A 3NFQA 3CC4P 1PIXA 2WWWA 4W7ZA 1DIPA 3EFFK 1VQPP 3HUSC 3CCRP 1AJYA 1URQB 2K3RA 3L73E 3H1ID 1KD1Q 2HFED 2B9BA 1FZGA 1LWUA 4C7RA 2A45I 2ZFCA 2KP8A 1YI2P 5CJ4A 3A0HH 3AE5C 2Q3EA 2O3JA 1SQXJ 5AVYB 3AEFC 1M1JB 1L4AA 5KAIE 3CWBD 3CD6P 2ZYAA 3RL0C 1IZNB 1SQPJ 3OAKA 1WRGA 2IZ0A 5CCGD 1FBMA 2XU6A 4HJGH 2MKVA 3VOPA 3SWFA 3D70A 5CBOA 3RL0B 3BCCD 3KXDA 1N7SD 1OWAA 3EQ2A 4PD4E 1R5LA 1JY2O 2YNYA 4WY4B 4DJGA 3C9IA 2QJKB 3G6EP 1L0LG 1PPJG 3KPEA 3V2NA 2E5YA 1N7LA 1QX8A 4AUWA 4IFMA 3FGAD 1SQBJ 1NH4A 2Y0DA 3CWBJ 3L75J 3AEAC 1N86A 3M9QA 4MN4C 3TK1A 1CZQA 3H1IJ 5CCHA 1NAFA 5C39A 3B71A 2KSJA 1LP1A 2E76D 2JWDA 3AEDC 5APXA 5AVVB 4I2LC 5CCHC 1JNMA 1H0TB 2I1JA 1FOSF 1IFDA 2AXCA 2ZVOB 3KYQA 2YMYA 4NPFX 5BVZA 2RN0A 1J1EC 1H89A 3BVHA 4ZKPA 1LT9C 1LTBC 1DEEG 1OX3A 3I56P 1QEXA 1CI6B 1VL2A 1IFMA 3AE9C 2YXQB 3MHVA 1JTHA 3PJSK 2P1JA 2QJPB 3GF7A 1QL2A 2A06E 3P32A 4KT0J 4LC1A 2W6AA 1OVVA 4YXDC 3TGUD 3CMEP 1JO5A 4GODA 4UB8H 1YJNP 3NMDA 2RMZA 3CCLP 4A7PA 4NPDA 2PFXA 2Q5UA 1L4AB 2P2UA 2JP3A 3E7KA 3HE5A 3KDPB 1OXZA 2OYOA 2W27A 1T8ZA 5GTIE 2OTJP 1HF9A 1L0LE 1HGVA 1SQXG 1MUUA 2IFMA 3L73D 1PPJE 1KQLA 1D7MA 1SQVG 5B66H 3AE1C 1EQ7A 1SFCC 4N78E 1EZVG 3GLMA 1NU1E 3A5TA 2FYNB 3H1KG 1LWUC 1QVGO 1FZEA 1NTMD 2AEJA 5CMZA 3KZIE 2WSEH 3JSVC 1YIJP 2A06G 1SQQG 1KN7A 3OA7A 1HTLC 3H1HE 1JOCA 4WY4D 2G3AA 3IR9A 1OVRA 3L4FA 2WQYC 3BCCE 2KZIA 2E42A 1NKZB 2V4HA 1FZFA 1S5LH 3MZWB 4H44C 2I1KA 1S5LX 1JM0A 1NTZD 1SQQK 2IBZD 3MUDA 1EDLA 1S4XA 2NZ2A 2PP6A 3H25A 2LXCB 2FYUJ 2WSFJ 3M0AA 5DJUB 5AVUB 2LR2A 3TGUJ 2YKOA 2KYVA 4EOTA 3CI9A 1ZV8A 2P7JA 3HE4A 4WY4A 2YO2A 1SQVK 1PV3A 3L75D 4U3FD 3K5BA 3E1IA 2J58A 3H1JD 4RO0A 1Y9BA 3PLNA 3AE6C 3H1HG 2M5AA 3RGUA 3CXHD 3CCSP 4L74A 4ASWA 3PH0A 3Q5SA 5APYA 5KLVK 1X0TA 4Y28J 1VQ7P 2VRSA 3GMAA 2WT7B 3GHGA 4BRYA 1IK7A 1EZVI 1S2EA 3L35A 3LW5H 1EXIA 2FYUG 1M56D 3R4YA 2WSEJ 4D6TG 2M3BA 2BEQD 1BCCG 3QWOC 4TLFA 3SFDC 1N73B 2HPCB 2ZT9B 3CC7P 2W6BA 2Y0CA 1PP9J 3HUSB 4OGQC 5AW1B 2E74C 3SWYA 1BE3G 1RF0A 5TISH 1YYCA 1VQKP 3V4WA 1RE4C 1K04A 2E74B 1KYOD 2FYUE 1FZCB 3VN0A 1SP4A 1KILD 4D6TJ 5CCGA 1QVFO 2ZAEB 4M3LA 1JY2P 2B89A 2JEEA 2Z5HA 1FU1A 3A0BH 2OTKE 1W2BO 1RF0C 1ZLLA 1G2CA 4JPZB 1ZR4A 1L0LJ 1U7MA 1LTSC 3AE3C 1G2CB 1RE3A 2GA1A 3HRNA 3P8CD 1UIIA 3NXSA 1P84H 3C8VA 4IOIH 3AEBC 4OH8B 1PGQA 4RJTA 1JUNA 4PJ0H 3HE4B 2N9BA 3CX5I 3L74D 2Z5IA 2C9NY 3CPWO 2N1TD 2WVRA 4L76A 3BATA 3V4QA 3H1LG 1CW5A 3MGNA 2W83C 2WZ7A 3P8CE 4WVZA 1DD3A 1PP9E 5KLVG 5KJ7D 5AW6B 3S4RA 1KILB 1VQ6P 1X79B 1SQBE 4K3AA 4UB6E 5E79E 1BE3E 1KQFB 1NTKG 1RF1A 2FFDA 2N1TC 4BXLA 5CBNA 3H1LE 2BCCG 2OYHB 4DCKA 1M1KQ 1M8OB 1SQBK 2POHA 1E79H 4H44D 5KKZB 4PV1D 1UIXA 1Z56A 3JC22 5KLIC 1N7SC 2M5AB 1NU1K 2ZT9D 3CL3D 4WY4C 5GTIH 2J59M 1T6AA 4GOFA 1GTWA 1QGKB 1M7LA 1GL2B 4GKGA 1N7SB 1X8YA 3IFMA 3RL0D 1SS1A 1U57A 1NTMK 1XTCC 5TJHA 2FYNC 2WPQA 3LW5J 4ASVA 1G1IA 2E76B 2K88A 1HUCA 1PP9G 1GMJA 1GZLA 3L70D 1PGPA 4Z1MH 1J2JB 2OYIA 3CLQA 3Q2YA 3B5NC 2WPVB 1GDTA 3L71G 5AVWB 1HH0A 2C0XA 1M90Q 1TU3F 4OWFA 1KZUB 2BCCE 4JQ0D 4O9BA 1RF1B 1VQ8P 1FDOA 1SQPE 2ZT9C 5AVSB 1H0TA 2KS1B 5GTHH 3GHGC 5AVXB 1DD4A 3ABVC 3MTUE 5AW3B 1VF5D 5APVA 2KB7P 1Q82Q 2KK7A 1ZN5A 4W80A 3H1HJ 2FYUK 5KLVJ 1NTZJ 1RHZB 1KYOI 2H8PD 3U1CA 1WMKA 2XKMA 1LGHB 2QJPC 2YKPA 3F89A 4BWNA 1NGMB 3QH9A 5AW4B 2GM4A 2HR3A 1NU1D 3EFGA 1YJ9P 1M1JC 4C46A 1ZP0C 3JCUH 3T97B 1L4AD 4EIJA 5KLVE 1P84D 1L2PA 1OW8A 4IFDK 1LTJA 2Y0EA 1BSHA 3D71A 2IFNA 3H1IG 1SQQJ 3L72J 4PD4H 5AVZB 2Y9ZA 4LGDE 2J5UA 3FXEA 2D2CC 2QE7H 2W90A 4OGQD 3VMXA 1IFPA 1BDDA 2BCCJ 3NTNA 3TNUB 3TGUE 1ZRTE 3CWBG 1NTZE 2FY8A 3L71E 1LTIC 4DT0A 3S9OA 3G4SP 1AA0A 1VF5C 3M9HA 4JF7A 1FDIA 1BCCJ 1GK4A 3VMYA
chains in the Genus database with same CATH topology
3PH0A 1X0TA 4ZNCA 5DJTB 1MFTA 3S1KA 4ZMDA 2WMMA 1EDIA 1LP1B 2KIKA 2B87A 4KJMA 3QWOC 2QVAA 2M0BA 1EDJA 4HB1A 2K3RA 2ZAEB 2B89A 2LXBA 2UWJE 2OTKE 1S3JA 1Y47A 2RKLA 1U7MA 2P58A 3FXDA 4HJGH 5CBOA 4IOIH 3ZDMA 1Q2NA 1LT1A 1OVUA 4NPEA 4MN4C 5C39A 2B87B 2B88A 1LP1A 2JWDA 1H0TB 4K3AA 2KI7B 2I8DA 4BXLA 4NPFX 5CBNA 5EFWB 2M5AB 1DEEG 4GOFA 4JBZA 3MHVA 1U7JA 1ZW0A 1SS1A 1OVVA 1BDCA 2KUBA 4GODA 4ASVA 4CPGA 4EYYQ 1NVOA 4NPDA 2Q1KA 1ZXGA 2R44A 1H0TA 2KS1B 4HKZH 1OVRA 2KZJA 2KZIA 4GOEA 1FC2C 2HR3A 1JMBA 2SPZA 5K5GB 3MZWB 1JM0A 1EDKA 1EDLA 2LXCB 5DJUB 4K35A 2LR2A 3FXEA 4WWIA 1EC5A 1BDDA 2QRXA 3RGUA 2M5AA 4ASWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PH0 A;  1X0T A;  4ZNC A;  5DJT B;  1MFT A;  3S1K A;  4ZMD A;  2WMM A;  1EDI A;  1LP1 B;  2KIK A;  2B87 A;  4KJM A;  3QWO C;  2QVA A;  2M0B A;  1EDJ A;  4HB1 A;  2K3R A;  2ZAE B;  2B89 A;  2LXB A;  2UWJ E;  2OTK E;  1S3J A;  1Y47 A;  2RKL A;  1U7M A;  2P58 A;  3FXD A;  4HJG H;  5CBO A;  4IOI H;  3ZDM A;  1Q2N A;  1LT1 A;  1OVU A;  4NPE A;  4MN4 C;  5C39 A;  2B87 B;  2B88 A;  1LP1 A;  2JWD A;  1H0T B;  4K3A A;  2KI7 B;  2I8D A;  4BXL A;  4NPF X;  5CBN A;  5EFW B;  2M5A B;  1DEE G;  4GOF A;  4JBZ A;  3MHV A;  1U7J A;  1ZW0 A;  1SS1 A;  1OVV A;  1BDC A;  2KUB A;  4GOD A;  4ASV A;  4CPG A;  4EYY Q;  1NVO A;  4NPD A;  2Q1K A;  1ZXG A;  2R44 A;  1H0T A;  2KS1 B;  4HKZ H;  1OVR A;  2KZJ A;  2KZI A;  4GOE A;  1FC2 C;  2HR3 A;  1JMB A;  2SPZ A;  5K5G B;  3MZW B;  1JM0 A;  1EDK A;  1EDL A;  2LXC B;  5DJU B;  4K35 A;  2LR2 A;  3FXE A;  4WWI A;  1EC5 A;  1BDD A;  2QRX A;  3RGU A;  2M5A A;  4ASW A; 
#chains in the Genus database with same CATH topology
 2W8Z A;  3BCC G;  3L72 D;  3CXH E;  1KB9 I;  4H13 B;  2XNX A;  4PV1 B;  1IFI A;  1L0L D;  1SVF A;  2R5D A;  2KXP B;  2WSS H;  3L70 J;  4UB6 H;  5E79 H;  3KHU A;  2WMM A;  2K9J B;  3VMA A;  4H13 C;  1EDI A;  1L0N D;  2KIK A;  3EWK A;  1T3U A;  2R5B A;  1NTM J;  2NPS B;  2ITA A;  1VPC A;  2YIU B;  2IX7 C;  2QVA A;  2CPS A;  2M0B A;  1GU5 A;  1BGY E;  1EDJ A;  5CJ0 A;  1KFM A;  1MFZ A;  1FS0 E;  3G71 P;  1IO4 A;  1LTA C;  1Q7Y Q;  1GL2 D;  1AVY A;  2K9Y A;  1QLE D;  1NU1 J;  1KB9 H;  1WT6 A;  3H1I E;  3CMA P;  1YIT P;  3V6I A;  4B86 A;  2V7Q H;  3AEE C;  2PRR A;  3CXH I;  3PP5 A;  3B5N B;  2WPS A;  3WMM 0;  3VMZ A;  5AVQ B;  1S3J A;  4WBA A;  4RKU J;  1H88 A;  1Y47 A;  4H13 D;  2E76 C;  2QJK C;  1GK6 A;  2YKQ A;  2IBZ E;  3L37 A;  2O01 J;  3GG2 A;  4YPC A;  5KJ7 A;  3WUT A;  1VQ9 P;  3CWB E;  2N1T A;  3B5N A;  3FXD A;  1KIL E;  4PV1 C;  1NTK K;  3TNU A;  5GTH E;  2FYZ A;  3LID A;  1J1E B;  2WPR A;  3ZDM A;  5B5E E;  1FZC A;  2OYH C;  1IFJ A;  1K8A Q;  3Q5P A;  4PD4 D;  1SQB G;  1K73 Q;  2JR8 A;  4GDO A;  5KKZ C;  1NTK E;  1SQX D;  3Q1M A;  3L73 G;  1H8A A;  1FZB A;  1KIL C;  1SQV D;  1YTZ T;  3WU2 E;  3HUS A;  1SQP G;  1FOS E;  3M9B A;  1J1D B;  4NPE A;  4PD4 I;  1EZV D;  4H0L B;  1N73 A;  1OW7 A;  2KOG A;  3H1K D;  1S5L E;  3H1L J;  1FZC C;  2KS1 A;  2B88 A;  2K37 A;  1KFN A;  2KNC B;  1LT9 A;  4TT3 H;  1BGY G;  2KI7 B;  1JY2 N;  3R2P A;  4H0L C;  1NTM G;  2JO1 A;  3JCU E;  2I8D A;  2Y9Y A;  1SQQ D;  1KIL A;  2IPP A;  2WSC H;  1JMM A;  1L0L K;  1L4A C;  1SQX E;  3HD7 C;  4JYC A;  4XE5 B;  1RE4 A;  5AW2 B;  3F5H A;  1IK9 A;  4I7Z C;  1Q90 D;  1SQX K;  2FXO A;  2WIT A;  1AVO A;  2R3S A;  3L71 J;  3BCC J;  1HJ0 A;  3Q3D A;  1U7J A;  4I7Z B;  1FE6 A;  5APT A;  2H43 A;  2N9Y B;  1ZW0 A;  2QIW A;  1VF5 B;  2IBZ G;  1EXJ A;  1JY3 P;  1BDC A;  3P8M C;  3RK3 D;  1NYH A;  1N2D C;  4CPG A;  2GUV A;  2JDI H;  2O01 H;  2E75 B;  2XND H;  3AE2 C;  1NAY A;  1XTG B;  3D6Z A;  2QG4 A;  2FBW C;  2RH0 A;  1DH3 A;  2AEM A;  3TYY A;  1S9K E;  1MKM A;  2W6J H;  3L75 G;  3CCJ P;  1ZXG A;  1RY3 A;  1PPJ D;  5BU8 B;  2R44 A;  5KAF E;  1FJK A;  1NO4 A;  5AW0 B;  3WUV A;  3M0D C;  1HWT C;  3BRT B;  3PRJ A;  1YQ4 C;  5TIS E;  2Z4E A;  1JCD A;  1KMI Z;  2K1A A;  1N73 C;  2BEZ F;  4HKZ H;  4YXW H;  3L74 E;  5KTB A;  1PZQ A;  3HD7 D;  1MZ9 A;  1T3J A;  3L36 A;  1ZME C;  1R5S A;  3W68 A;  2H89 C;  3N7N A;  2NRG A;  1KQS O;  2QA4 P;  5KJ7 C;  2FYU D;  4OVN F;  1VQM P;  1BGY J;  1BCC D;  4HYT B;  2R32 A;  3FWN A;  3HTK B;  1R8E A;  3I55 P;  1AQ5 A;  1FC2 C;  5H2F H;  3OJA B;  3RBX A;  3CCE P;  1BE3 D;  1MV8 A;  3VP8 A;  4I1L A;  1A02 J;  1JMB A;  3A2A A;  3O8Z A;  1SFC B;  3CX5 H;  5KLV D;  2E43 A;  1P84 E;  3AEC C;  1KTM A;  3AE8 C;  1M57 D;  3TGU G;  3BAS A;  1YQ3 C;  1EZV E;  4IL6 E;  4N3Y B;  2OYI B;  1GD2 E;  3H1K E;  2YXR B;  3CXH H;  3E1R A;  4K35 A;  2V7Q J;  1OW6 A;  1URQ A;  2M8R A;  1PL5 A;  3L75 E;  4H44 B;  3B4S A;  2AXT H;  1N7S A;  1L0N J;  1KQG B;  4N6J A;  2QRX A;  3V2P A;  3O6Q A;  1AFO A;  1KB9 D;  3HD7 A;  1FZA A;  1LTG C;  1NHL A;  1M1J A;  5L8R J;  2Q6Q A;  1NTZ K;  3AE4 C;  3AE7 C;  2NPS A;  3RK2 C;  1T2K D;  2FFD C;  2G8Y A;  1NJI Q;  2XDJ A;  1IJD B;  3L74 G;  2OYH A;  3CC2 P;  1KOR A;  2ZXE B;  3S1K A;  1PFI A;  3M91 A;  3IF4 A;  2FFD B;  1KYO H;  3H1K J;  2A06 D;  3H1L D;  3II6 A;  2IZ1 A;  2NPS D;  3HTK A;  1FAV A;  4W7Y A;  1KB9 E;  1CSB A;  1K05 A;  1JEK A;  3ITK A;  3L70 E;  4ZKU A;  4QMA A;  1VQO P;  1KV4 A;  1Q86 Q;  2D2C B;  3CCV P;  2IDB A;  3CCQ P;  3HD7 B;  4DOJ A;  1RQU A;  3CCM P;  1RQV A;  1NTM E;  1FDM A;  2BCC D;  3V5B A;  1USD A;  1NTZ G;  2HPC A;  1JY3 N;  2DW3 A;  1URQ D;  1IC2 A;  5CHX A;  2K9J A;  5B5E H;  2OYI C;  4N78 D;  2LXB A;  2FXP A;  1PGJ A;  2CK3 H;  2UWJ E;  2PAJ A;  2QJY B;  1ZOY C;  1E5W A;  3B8E B;  3H32 B;  2JWA A;  3KQG A;  3L73 J;  4DZO A;  2E75 C;  2RKL A;  1SQP K;  2P58 A;  5APU A;  3WU2 H;  3WUU A;  2LKM A;  2XV5 A;  5CCH D;  4U3F G;  3U59 A;  1QL1 A;  3RK2 B;  3H1J G;  4Y99 C;  2FKW B;  2QEX P;  1IFN A;  1HGZ A;  3A0H E;  4HH2 A;  3H1H D;  1OZH A;  4D6T E;  2HOD A;  4YTP C;  5APQ A;  1W5C E;  2CPB A;  1GW4 A;  2P10 A;  4GIF A;  4Y99 B;  1VDF A;  1HVV A;  2O1J A;  1Q2N A;  1LNQ A;  2QSI A;  3M0D A;  3V2R A;  5KLI B;  3V2Q A;  3FWL A;  3IN6 A;  1LT1 A;  2HG5 D;  1OVU A;  3IAO A;  2QM8 A;  1X22 A;  1OIP A;  1SQV E;  2IYP A;  2OAR A;  2OQQ A;  4U3F J;  5APW A;  3LIE A;  4D6T D;  1K9M Q;  1NTK J;  2FXM A;  2WSF H;  2O1K A;  2WTY A;  2B87 B;  2KLV A;  3P7K A;  1Q81 Q;  2E75 D;  1YHQ P;  3A7O A;  2XZR A;  1JY3 O;  1JB0 J;  2ZYD A;  1NOH A;  2KNC A;  3U1A A;  2WT7 A;  3BRV B;  2A45 G;  5EFW B;  1SQV J;  2O01 N;  4IL6 X;  4C7N A;  2KLU A;  1LTT C;  3G9R A;  4IL6 H;  1YJW P;  1GU4 A;  3A3Y B;  2QM7 A;  4JBZ A;  3O6Q B;  2JJL A;  5AW8 B;  3UIA A;  3VTP C;  2BAS A;  2L5G B;  5AW5 B;  2ZVN B;  1NWQ A;  2ZYG A;  3RL0 g;  5KAF H;  1L0N E;  4L75 A;  1HJB A;  1YBK A;  2QJY C;  2WSC J;  2AXT E;  3N4X A;  4U3F E;  2OTL P;  2KUB A;  1GW3 A;  4IFF A;  3TDK A;  1PGO A;  3PTZ A;  1CI6 A;  3TSI A;  2N1T B;  5M1B A;  5AW9 B;  1NVO A;  4EYY Q;  2H7H A;  2OGU A;  1SFC D;  2Q3I A;  2Q1K A;  3L72 E;  4H0L D;  4C7N B;  1N8R Q;  3MP7 B;  1NKN A;  2E5T A;  3HE5 B;  5AVR B;  1S9K D;  5KAI H;  3A0B E;  1RH5 B;  2YMK A;  2D2C D;  4UB8 E;  3RK2 D;  3SSU A;  3CX5 D;  3M06 A;  1KYO E;  3L74 J;  3MUD C;  3RK3 E;  3W67 A;  5H2F E;  3VP9 A;  3L72 G;  1AQT A;  2A45 H;  1VQN P;  2AEF A;  4I6M C;  1BE3 J;  1S1C X;  1SLQ A;  4EDF A;  1JTH B;  4R4M A;  3C1L A;  3PHL A;  5CCG C;  4EI2 A;  1DX7 A;  1NTK D;  1W2E A;  2PGD A;  4LLH A;  3RK3 C;  3H1J J;  4PJ0 E;  1L0N G;  2KSE A;  2YO3 A;  4L73 A;  4AQR D;  3CX5 E;  3MIW A;  1P84 I;  5B66 E;  2KZJ A;  2H88 C;  4GOE A;  3B5N D;  3GW6 A;  3H6P A;  1AV1 A;  2IBZ I;  2P67 A;  3I5C A;  3CCU P;  1JCC A;  2Q9I A;  2SPZ A;  1DEB A;  1LT9 B;  3GHG B;  1OFC X;  4XA4 A;  3USS A;  5K5G B;  1VQ5 P;  3H1J E;  4XFJ A;  2M3E A;  3MD0 A;  3KZI H;  1EDK A;  2GUS A;  1A02 F;  1LJ2 A;  3Q5R A;  1VQL P;  1BCC E;  3G3Z A;  1URQ C;  1PP9 D;  4U7J A;  2ZJS E;  3SFE C;  4AYC A;  4WWI A;  3L70 G;  1HBW A;  3GF3 A;  4OGQ B;  4KHX A;  1T2K C;  3VYI A;  1EC5 A;  4R4L A;  2E74 D;  2YIU C;  1J1D C;  2JKV A;  3L71 D;  1GL2 A;  2HOD B;  1OMI A;  1ZRT D;  2Q7C A;  1BSN A;  1L0N K;  5BU5 A;  2NPS C;  2C0W A;  5AW7 B;  1Y8A A;  2R3C A;  1ZR2 A;  4RES B;  1LTJ B;  1USE A;  2L91 A;  5AVT B;  1X9V A;  4ZNC A;  5DJT B;  1SQB D;  1SFC A;  3RK3 B;  1MFT A;  2ZXX A;  3H32 A;  3T97 A;  2C9L Y;  1GL2 C;  4ZMD A;  4BRY B;  1LTJ C;  5APS A;  1LWU B;  1SQQ E;  1LP1 B;  1SQP D;  3TF5 A;  1VQ4 P;  2B87 A;  3D6Y A;  4KJM A;  3OW2 O;  1RE3 C;  1FJP A;  3AEG C;  1YTZ I;  1S72 P;  1RF1 C;  2HYN A;  4GT1 A;  2HLO A;  1NU1 G;  1BGY D;  2MJZ A;  4HB1 A;  4JYB A;  4WB4 A;  3RBZ A;  1KC8 Q;  2IYO A;  3SWK A;  1G1J A;  3FX0 A;  3NFQ A;  3CC4 P;  1PIX A;  2WWW A;  4W7Z A;  1DIP A;  3EFF K;  1VQP P;  3HUS C;  3CCR P;  1AJY A;  1URQ B;  2K3R A;  3L73 E;  3H1I D;  1KD1 Q;  2HFE D;  2B9B A;  1FZG A;  1LWU A;  4C7R A;  2A45 I;  2ZFC A;  2KP8 A;  1YI2 P;  5CJ4 A;  3A0H H;  3AE5 C;  2Q3E A;  2O3J A;  1SQX J;  5AVY B;  3AEF C;  1M1J B;  1L4A A;  5KAI E;  3CWB D;  3CD6 P;  2ZYA A;  3RL0 C;  1IZN B;  1SQP J;  3OAK A;  1WRG A;  2IZ0 A;  5CCG D;  1FBM A;  2XU6 A;  4HJG H;  2MKV A;  3VOP A;  3SWF A;  3D70 A;  5CBO A;  3RL0 B;  3BCC D;  3KXD A;  1N7S D;  1OWA A;  3EQ2 A;  4PD4 E;  1R5L A;  1JY2 O;  2YNY A;  4WY4 B;  4DJG A;  3C9I A;  2QJK B;  3G6E P;  1L0L G;  1PPJ G;  3KPE A;  3V2N A;  2E5Y A;  1N7L A;  1QX8 A;  4AUW A;  4IFM A;  3FGA D;  1SQB J;  1NH4 A;  2Y0D A;  3CWB J;  3L75 J;  3AEA C;  1N86 A;  3M9Q A;  4MN4 C;  3TK1 A;  1CZQ A;  3H1I J;  5CCH A;  1NAF A;  5C39 A;  3B71 A;  2KSJ A;  1LP1 A;  2E76 D;  2JWD A;  3AED C;  5APX A;  5AVV B;  4I2L C;  5CCH C;  1JNM A;  1H0T B;  2I1J A;  1FOS F;  1IFD A;  2AXC A;  2ZVO B;  3KYQ A;  2YMY A;  4NPF X;  5BVZ A;  2RN0 A;  1J1E C;  1H89 A;  3BVH A;  4ZKP A;  1LT9 C;  1LTB C;  1DEE G;  1OX3 A;  3I56 P;  1QEX A;  1CI6 B;  1VL2 A;  1IFM A;  3AE9 C;  2YXQ B;  3MHV A;  1JTH A;  3PJS K;  2P1J A;  2QJP B;  3GF7 A;  1QL2 A;  2A06 E;  3P32 A;  4KT0 J;  4LC1 A;  2W6A A;  1OVV A;  4YXD C;  3TGU D;  3CME P;  1JO5 A;  4GOD A;  4UB8 H;  1YJN P;  3NMD A;  2RMZ A;  3CCL P;  4A7P A;  4NPD A;  2PFX A;  2Q5U A;  1L4A B;  2P2U A;  2JP3 A;  3E7K A;  3HE5 A;  3KDP B;  1OXZ A;  2OYO A;  2W27 A;  1T8Z A;  5GTI E;  2OTJ P;  1HF9 A;  1L0L E;  1HGV A;  1SQX G;  1MUU A;  2IFM A;  3L73 D;  1PPJ E;  1KQL A;  1D7M A;  1SQV G;  5B66 H;  3AE1 C;  1EQ7 A;  1SFC C;  4N78 E;  1EZV G;  3GLM A;  1NU1 E;  3A5T A;  2FYN B;  3H1K G;  1LWU C;  1QVG O;  1FZE A;  1NTM D;  2AEJ A;  5CMZ A;  3KZI E;  2WSE H;  3JSV C;  1YIJ P;  2A06 G;  1SQQ G;  1KN7 A;  3OA7 A;  1HTL C;  3H1H E;  1JOC A;  4WY4 D;  2G3A A;  3IR9 A;  1OVR A;  3L4F A;  2WQY C;  3BCC E;  2KZI A;  2E42 A;  1NKZ B;  2V4H A;  1FZF A;  1S5L H;  3MZW B;  4H44 C;  2I1K A;  1S5L X;  1JM0 A;  1NTZ D;  1SQQ K;  2IBZ D;  3MUD A;  1EDL A;  1S4X A;  2NZ2 A;  2PP6 A;  3H25 A;  2LXC B;  2FYU J;  2WSF J;  3M0A A;  5DJU B;  5AVU B;  2LR2 A;  3TGU J;  2YKO A;  2KYV A;  4EOT A;  3CI9 A;  1ZV8 A;  2P7J A;  3HE4 A;  4WY4 A;  2YO2 A;  1SQV K;  1PV3 A;  3L75 D;  4U3F D;  3K5B A;  3E1I A;  2J58 A;  3H1J D;  4RO0 A;  1Y9B A;  3PLN A;  3AE6 C;  3H1H G;  2M5A A;  3RGU A;  3CXH D;  3CCS P;  4L74 A;  4ASW A;  3PH0 A;  3Q5S A;  5APY A;  5KLV K;  1X0T A;  4Y28 J;  1VQ7 P;  2VRS A;  3GMA A;  2WT7 B;  3GHG A;  4BRY A;  1IK7 A;  1EZV I;  1S2E A;  3L35 A;  3LW5 H;  1EXI A;  2FYU G;  1M56 D;  3R4Y A;  2WSE J;  4D6T G;  2M3B A;  2BEQ D;  1BCC G;  3QWO C;  4TLF A;  3SFD C;  1N73 B;  2HPC B;  2ZT9 B;  3CC7 P;  2W6B A;  2Y0C A;  1PP9 J;  3HUS B;  4OGQ C;  5AW1 B;  2E74 C;  3SWY A;  1BE3 G;  1RF0 A;  5TIS H;  1YYC A;  1VQK P;  3V4W A;  1RE4 C;  1K04 A;  2E74 B;  1KYO D;  2FYU E;  1FZC B;  3VN0 A;  1SP4 A;  1KIL D;  4D6T J;  5CCG A;  1QVF O;  2ZAE B;  4M3L A;  1JY2 P;  2B89 A;  2JEE A;  2Z5H A;  1FU1 A;  3A0B H;  2OTK E;  1W2B O;  1RF0 C;  1ZLL A;  1G2C A;  4JPZ B;  1ZR4 A;  1L0L J;  1U7M A;  1LTS C;  3AE3 C;  1G2C B;  1RE3 A;  2GA1 A;  3HRN A;  3P8C D;  1UII A;  3NXS A;  1P84 H;  3C8V A;  4IOI H;  3AEB C;  4OH8 B;  1PGQ A;  4RJT A;  1JUN A;  4PJ0 H;  3HE4 B;  2N9B A;  3CX5 I;  3L74 D;  2Z5I A;  2C9N Y;  3CPW O;  2N1T D;  2WVR A;  4L76 A;  3BAT A;  3V4Q A;  3H1L G;  1CW5 A;  3MGN A;  2W83 C;  2WZ7 A;  3P8C E;  4WVZ A;  1DD3 A;  1PP9 E;  5KLV G;  5KJ7 D;  5AW6 B;  3S4R A;  1KIL B;  1VQ6 P;  1X79 B;  1SQB E;  4K3A A;  4UB6 E;  5E79 E;  1BE3 E;  1KQF B;  1NTK G;  1RF1 A;  2FFD A;  2N1T C;  4BXL A;  5CBN A;  3H1L E;  2BCC G;  2OYH B;  4DCK A;  1M1K Q;  1M8O B;  1SQB K;  2POH A;  1E79 H;  4H44 D;  5KKZ B;  4PV1 D;  1UIX A;  1Z56 A;  3JC2 2;  5KLI C;  1N7S C;  2M5A B;  1NU1 K;  2ZT9 D;  3CL3 D;  4WY4 C;  5GTI H;  2J59 M;  1T6A A;  4GOF A;  1GTW A;  1QGK B;  1M7L A;  1GL2 B;  4GKG A;  1N7S B;  1X8Y A;  3IFM A;  3RL0 D;  1SS1 A;  1U57 A;  1NTM K;  1XTC C;  5TJH A;  2FYN C;  2WPQ A;  3LW5 J;  4ASV A;  1G1I A;  2E76 B;  2K88 A;  1HUC A;  1PP9 G;  1GMJ A;  1GZL A;  3L70 D;  1PGP A;  4Z1M H;  1J2J B;  2OYI A;  3CLQ A;  3Q2Y A;  3B5N C;  2WPV B;  1GDT A;  3L71 G;  5AVW B;  1HH0 A;  2C0X A;  1M90 Q;  1TU3 F;  4OWF A;  1KZU B;  2BCC E;  4JQ0 D;  4O9B A;  1RF1 B;  1VQ8 P;  1FDO A;  1SQP E;  2ZT9 C;  5AVS B;  1H0T A;  2KS1 B;  5GTH H;  3GHG C;  5AVX B;  1DD4 A;  3ABV C;  3MTU E;  5AW3 B;  1VF5 D;  5APV A;  2KB7 P;  1Q82 Q;  2KK7 A;  1ZN5 A;  4W80 A;  3H1H J;  2FYU K;  5KLV J;  1NTZ J;  1RHZ B;  1KYO I;  2H8P D;  3U1C A;  1WMK A;  2XKM A;  1LGH B;  2QJP C;  2YKP A;  3F89 A;  4BWN A;  1NGM B;  3QH9 A;  5AW4 B;  2GM4 A;  2HR3 A;  1NU1 D;  3EFG A;  1YJ9 P;  1M1J C;  4C46 A;  1ZP0 C;  3JCU H;  3T97 B;  1L4A D;  4EIJ A;  5KLV E;  1P84 D;  1L2P A;  1OW8 A;  4IFD K;  1LTJ A;  2Y0E A;  1BSH A;  3D71 A;  2IFN A;  3H1I G;  1SQQ J;  3L72 J;  4PD4 H;  5AVZ B;  2Y9Z A;  4LGD E;  2J5U A;  3FXE A;  2D2C C;  2QE7 H;  2W90 A;  4OGQ D;  3VMX A;  1IFP A;  1BDD A;  2BCC J;  3NTN A;  3TNU B;  3TGU E;  1ZRT E;  3CWB G;  1NTZ E;  2FY8 A;  3L71 E;  1LTI C;  4DT0 A;  3S9O A;  3G4S P;  1AA0 A;  1VF5 C;  3M9H A;  4JF7 A;  1FDI A;  1BCC J;  1GK4 A;  3VMY A; 
#chains in the Genus database with same CATH homology
 3PH0 A;  1X0T A;  4ZNC A;  5DJT B;  1MFT A;  3S1K A;  4ZMD A;  2WMM A;  1EDI A;  1LP1 B;  2KIK A;  2B87 A;  4KJM A;  3QWO C;  2QVA A;  2M0B A;  1EDJ A;  4HB1 A;  2K3R A;  2ZAE B;  2B89 A;  2LXB A;  2UWJ E;  2OTK E;  1S3J A;  1Y47 A;  2RKL A;  1U7M A;  2P58 A;  3FXD A;  4HJG H;  5CBO A;  4IOI H;  3ZDM A;  1Q2N A;  1LT1 A;  1OVU A;  4NPE A;  4MN4 C;  5C39 A;  2B87 B;  2B88 A;  1LP1 A;  2JWD A;  1H0T B;  4K3A A;  2KI7 B;  2I8D A;  4BXL A;  4NPF X;  5CBN A;  5EFW B;  2M5A B;  1DEE G;  4GOF A;  4JBZ A;  3MHV A;  1U7J A;  1ZW0 A;  1SS1 A;  1OVV A;  1BDC A;  2KUB A;  4GOD A;  4ASV A;  4CPG A;  4EYY Q;  1NVO A;  4NPD A;  2Q1K A;  1ZXG A;  2R44 A;  1H0T A;  2KS1 B;  4HKZ H;  1OVR A;  2KZJ A;  2KZI A;  4GOE A;  1FC2 C;  2HR3 A;  1JMB A;  2SPZ A;  5K5G B;  3MZW B;  1JM0 A;  1EDK A;  1EDL A;  2LXC B;  5DJU B;  4K35 A;  2LR2 A;  3FXE A;  4WWI A;  1EC5 A;  1BDD A;  2QRX A;  3RGU A;  2M5A A;  4ASW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...