5DJTB

Crystal structure of lov2 (c450a) domain in complex with zdk2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
59
structure length
59
Chain Sequence
SVDNKFNKEMLSARVEIYGLPNLNWGQRFAFISSLTDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords NPH1-2
publication title LOVTRAP: an optogenetic system for photoinduced protein dissociation.
pubmed doi rcsb
source organism Avena sativa
total genus 22
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2015-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5djtB00
4IOIH 1EDIA 1SS1A 2KIKA 2RKLA 2KS1B 1LP1A 2B88A 1Y47A 4ZNCA 5EFWB 1OVUA 2LR2A 1U7MA 2M5AA 5DJUB 2LXBA 2OTKE 4MN4C 3PH0A 1DEEG 3MZWB 2WMMA 2I8DA 2QVAA 2UWJE 3ZDMA 2ZAEB 4HJGH 4K35A 1JM0A 4KJMA 4ZMDA 2HR3A 4BXLA 5CBNA 4CPGA 2LXCB 1BDCA 1LT1A 4JBZA 1MFTA 4ASVA 2KUBA 5C39A 5K5GB 3FXEA 4NPEA 4K3AA 1JMBA 4GOEA 1NVOA 2JWDA 1OVVA 1EDJA 1BDDA 4HKZH 1U7JA 4GOFA 2SPZA 3QWOC 2R44A 4NPFX 1EDKA 4HB1A 4GODA 1OVRA 1X0TA 2KZIA 4ASWA 2QRXA 3MHVA 1EDLA 2K3RA 3S1KA 4NPDA 5DJTB 1H0TA 2M0BA 1H0TB 1EC5A 2KZJA 3FXDA 2B87A 2B87B 1LP1B 2P58A 2Q1KA 4WWIA 1FC2C 1Q2NA 1S3JA 1ZXGA 2B89A 2KI7B 2M5AB 5CBOA 1ZW0A 3RGUA 4EYYQ
chains in the Genus database with same CATH superfamily
1EDIA 2WSCJ 5AVVB 1LTJC 3NXSA 2WSSH 1IFIA 4U3FE 1JNMA 1KB9I 5GTHH 5AVXB 2J5UA 1SFCC 5KKZB 1QL1A 1J1EC 3PH0A 1N7LA 2QM8A 1JMMA 3OJAB 3A7OA 4H44B 3O6QA 1HVVA 3P32A 3P8MC 1RE4C 1LGHB 2CPBA 1FZGA 4BRYB 3H32A 3W68A 3WMM0 3AECC 4OGQD 5TISE 2PRRA 3L72J 3BRVB 1Q86Q 3L72D 3SWFA 3VOPA 3L72G 1GU4A 3H25A 4R4LA 3V6IA 1OVRA 3V4QA 1LTBC 3MTUE 2JDIH 3A0HH 1PZQA 1NKZB 1M1JB 3HUSC 3VP9A 2CPSA 2GUSA 1K04A 2E75B 3RK2C 1H0TA 3I55P 1RF1A 1P84H 2Q3IA 3AE8C 5AW0B 2ZVOB 1LP1B 1ZR4A 1GW3A 1SQBD 1VQ8P 1SQBG 2M3BA 1YQ4C 1K05A 1L2PA 3RK3B 2W8ZA 1VQOP 3B4SA 5APUA 3P7KA 2WPVB 5KLVE 1LTAC 1OX3A 1DIPA 4H0LB 2ZYGA 4D6TE 2YKOA 3CCRP 2RMZA 2QJKB 2YKQA 5KLVK 2WZ7A 2P1JA 1UIXA 5TISH 2I8DA 2A45H 2ITAA 1Y9BA 3USSA 3L74E 1GK4A 2BEQD 1IFPA 3V2RA 3VN0A 3RL0B 3B8EB 3F89A 3SFDC 3IFMA 2YO3A 4PD4D 1FDOA 3B5NB 3AE9C 1PFIA 1N73A 5GTIE 4YTPC 1EDJA 4HYTB 4HKZH 2Q3EA 1QL2A 2R44A 1GTWA 1M56D 2PGDA 2KSEA 2IX7C 3HTKB 3TNUB 4N6JA 5BU8B 1EDLA 1YBKA 1T3JA 1KB9E 1EXIA 4NPDA 1BE3E 3N4XA 1S4XA 1IO4A 2WSEJ 4W80A 4R4MA 3H1LJ 3CCLP 3U1AA 1Q2NA 1ZRTE 3QH9A 3H1LD 3H1LG 3G6EP 1OW8A 1SQQJ 2E74D 3EFGA 1ZV8A 1LTIC 2OYHB 1SQQD 1AA0A 1SQQG 3GLMA 4WY4B 3KHUA 5AVZB 2POHA 1T6AA 3CX5D 4PJ0H 1QVGO 1FU1A 1M8OB 2J58A 1S1CX 2W90A 3JC22 5GTIH 5APYA 1PL5A 3KZIE 1RQVA 1NKNA 2VRSA 3A5TA 3GHGB 1PPJD 1NGMB 2KOGA 1PPJG 2YNYA 2IYPA 2J59M 3KXDA 3O8ZA 1KB9H 1G2CA 1MFTA 1MUUA 5AVQB 2O1JA 2HPCA 3PJSK 3H1HE 2QA4P 3H1JE 1URQC 4Y28J 1JCCA 3V4WA 2FXPA 2KZIA 2YKPA 1HBWA 1VQLP 4IL6X 2AXTE 2L91A 5AW1B 1FZCA 1IFNA 2E42A 3Q3DA 1ZLLA 4L76A 4U7JA 1VQKP 1SQXJ 4L74A 2N1TB 4XE5B 1SQXD 1SQXG 1NTMJ 1NTZJ 2B89A 3L37A 1NTMD 1NTMG 1NTZD 1W2BO 2FYUE 1NTZG 3N7NA 1ZR2A 2M8RA 3SFEC 1M1KQ 3MUDC 2RKLA 4KT0J 4JPZB 1PGJA 2YIUB 2ZJSE 3KZIH 3PP5A 1JB0J 2KLUA 1D7MA 1LP1A 1FAVA 1KQFB 3G9RA 3TDKA 5APTA 3FGAD 1OVUA 1MKMA 1LNQA 2O1KA 2R5BA 1FZAA 4RO0A 1QLED 2Q7CA 1T2KD 1H88A 4IFFA 1S9KD 4CPGA 2LXCB 4ZKUA 5KTBA 2HYNA 1KTMA 1YQ3C 4OGQB 2Q5UA 3CWBE 1YTZI 2M3EA 3V2NA 4RJTA 3AE7C 3CCVP 3II6A 2SPZA 5KKZC 2IBZI 1KMIZ 2YO2A 1NU1J 3L73E 1GMJA 4I7ZB 1H0TB 3L36A 1RF1B 3FXDA 3F5HA 2BCCG 1L0LK 1BGYE 2E5TA 4AYCA 1KYOI 3TNUA 2N9BA 3LIEA 2M5AB 1A02J 1ZW0A 3T97B 3C1LA 1Q90D 2R5DA 2R32A 4RESB 4Z1MH 1FS0E 5AVSB 2O01H 1AVOA 3NFQA 2JO1A 4U3FJ 1P84D 3BCCE 2HG5D 2BEZF 2OYHA 1L4AC 4Y99C 1PGPA 4BXLA 2Y9YA 3RK3C 5L8RJ 1MV8A 3CCSP 1SP4A 3L71E 4EDFA 2XZRA 2LKMA 2H8PD 2XKMA 2XDJA 1SFCD 2ZVNB 1LTGC 3FXEA 4H0LC 4NPEA 1PGQA 1JMBA 2IZ1A 3CC4P 3RK3E 1G1JA 2XU6A 2A45G 2B9BA 1RE4A 3TYYA 1YITP 1HF9A 2OYIC 3R2PA 1JY3N 1IJDB 3A0BH 1PV3A 3L75J 1FZEA 2FYNC 5KJ7A 1RQUA 1N8RQ 3L75D 5AW3B 3L75G 5B5EE 2E76D 1AJYA 2B87A 1VF5D 2NRGA 4YXWH 3AE1C 2WWWA 4EI2A 3CPWO 4PV1D 1FDIA 1R8EA 2E74B 3KDPB 4C7NA 5H2FE 2HFED 1SQPE 2GA1A 2KS1A 5CJ4A 2N1TA 2QJYB 1YIJP 3JSVC 4D6TJ 1WT6A 2IBZE 4D6TD 4GDOA 4D6TG 1SQPK 3CMEP 1DEEG 2Y0DA 3BRTB 3VMZA 1N86A 1LWUC 3TF5A 3GMAA 3ITKA 3M91A 1EZVI 3L74J 2Z4EA 5KLIB 3L74D 3L74G 1KYOE 1DD3A 1G2CB 3D70A 4ASVA 1JY2O 3SWKA 2HPCB 4WY4C 5B5EH 1FJKA 2WT7B 1NJIQ 3EQ2A 2WITA 1J1DB 1CZQA 1XTCC 2QRXA 2KYVA 4LLHA 1JY3P 1YTZT 3CMAP 1FZCB 5CHXA 5E79H 3IAOA 3CCEP 3M06A 1LT9A 1EC5A 1BE3J 1AVYA 1K73Q 1BE3D 2K1AA 2Q1KA 1BE3G 1HGZA 1VDFA 2H7HA 4IFDK 1IFJA 3V5BA 5CBOA 3LIDA 3GW6A 1ZRTD 1CI6B 4WVZA 3HD7D 3PHLA 3HD7A 2A06E 3H1IJ 2E5YA 3H1ID 1RY3A 3H1IG 3CC7P 1Y47A 4ZNCA 3TGUE 1KYOH 3D6ZA 2M5AA 3AEFC 1Z56A 1GK6A 3T97A 2HODA 3UIAA 3E7KA 2NPSD 1E5WA 2NPSA 4N3YB 1PP9J 2YMKA 3D6YA 1PP9D 1PP9G 2IYOA 2K9JA 2C0WA 2YIUC 3KPEA 3AE6C 3TSIA 3VYIA 2WPQA 4PD4I 4NPFX 3MHVA 3Q5RA 3CD6P 1RHZB 5KAFE 2FYZA 3A2AA 2OTJP 1RE3A 1GL2D 1GL2A 1AQ5A 3H1KE 1N7SD 1N7SA 3M0AA 2D2CC 1EZVE 4OGQC 2R3CA 2XV5A 1URQD 1URQA 1BCCE 4EYYQ 2P2UA 1HH0A 3P8CD 1L0NJ 3G3ZA 4IL6E 5CMZA 1EXJA 1L0ND 1L0NG 2KP8A 1YI2P 3E1IA 3AEAC 3CL3D 3CCQP 2Y9ZA 1JOCA 2LXBA 2OTKE 1IK9A 3L72E 3MZWB 2V7QJ 3U59A 3MUDA 3M0DA 2W6JH 4ZMDA 2O01J 1M57D 3L70E 1BDCA 2OQQA 1KN7A 4W7ZA 5BVZA 1YJNP 1IFMA 1GW4A 2WSCH 5KAFH 1SFCB 1J1EB 3CWBJ 1SQBE 4XA4A 1VL2A 1YHQP 1BDDA 3CWBD 1GDTA 3CWBG 1U57A 5CCHD 1NWQA 5CCHA 4GODA 4ZKPA 5AW5B 1SQBK 3CXHI 1ZOYC 3AEEC 4XFJA 2P7JA 3V2QA 1KQGB 1L0LJ 4IL6H 2M0BA 3L73J 2WT7A 1L0LD 1L0LG 2E76B 3L73D 3L73G 3CCJP 2B87B 2ZT9C 4WWIA 1VF5B 1JUNA 2KI7B 3VP8A 1BGYJ 1IZNB 1KFNA 3RL0g 1N73C 1BGYD 1USDA 1BGYG 4WB4A 1K9MQ 2H89C 4PV1B 2ZFCA 2QEXP 1S5LX 4C7NB 4YXDC 2W6BA 2KS1B 4A7PA 2KNCA 4PD4E 1RF0A 1FJPA 1XTGB 2W27A 3AEDC 5M1BA 1VQ7P 5DJUB 4I6MC 1VPCA 2NZ2A 1CI6A 2C9LY 1NAFA 1Q82Q 2FYUK 4LGDE 3AE4C 2ZYDA 2K37A 1KILD 1KILA 1DX7A 2PP6A 2GM4A 1X22A 2E74C 5K5GB 2Z5HA 4K3AA 2QJYC 1NVOA 1L4AD 4DOJA 3H1LE 4L75A 3PTZA 1DEBA 1NYHA 4ASWA 1SQQE 2AXTH 1GU5A 1VQNP 4I2LC 1LT9B 1SQQK 3K5BA 2IFNA 4PD4H 5AW9B 1OWAA 4UB6E 4N78E 3C8VA 4C7RA 5APSA 4LC1A 5AVRB 3RGUA 4H44C 4H13D 1UIIA 1NU1D 1NU1G 2YXQB 1PPJE 3HD7B 2OYOA 3ABVC 1J1DC 5CCGC 1SQPJ 1BSHA 1SQPD 1FZCC 1WMKA 2G3AA 2FFDA 2LR2A 1OW6A 1GZLA 1KQLA 3CXHE 3M9BA 5APWA 2HODB 1P84I 1SQVE 2NPSB 2WSEH 1PGOA 5AW7B 5CBNA 1HGVA 1M1JC 1IFDA 3Q1MA 1SQVK 2E75C 2K9JB 4U3FD 4U3FG 1SVFA 2FKWB 1NTME 1KORA 1NTZE 3M9HA 4GOFA 3W67A 1LTJA 1LWUA 1JTHA 5APQA 4UB6H 1VQ9P 4HB1A 1Y8AA 2W83C 3WUVA 2L5GB 2I1JA 1NTMK 3IR9A 2A45I 1NTZK 1QEXA 1SFCA 5DJTB 1T2KC 1KFMA 3I5CA 1KQSO 2KSJA 2QJKC 5APVA 1GL2B 1N7SB 2G8YA 3HE5A 4I1LA 4O9BA 4B86A 4EOTA 2QJPB 1URQB 5AW6B 3CXHH 1NTKE 4OWFA 1S9KE 1HTLC 4KHXA 3RL0C 2B88A 2A06D 1NTKK 1YYCA 1FOSE 5GTHE 3TGUJ 3B5NC 3RBZA 5AW2B 2PAJA 3AEBC 3TGUD 3HUSA 2QVAA 3H6PA 3ZDMA 4GT1A 5KLVJ 1X79B 3RK2D 2HR3A 2P67A 5KLVD 1FOSF 5KLVG 1YJ9P 1T8ZA 1EQ7A 4JBZA 3L4FA 1NAYA 3LW5H 2MKVA 5AW4B 5APXA 2BCCE 1WRGA 3C9IA 1EDKA 2FXMA 2OARA 5AVWB 3IN6A 2OYHC 4GIFA 1JCDA 3HE4A 2FBWC 1OIPA 3G4SP 1P84E 2WSFH 1A02F 1OW7A 2IZ0A 3H1KJ 2KLVA 2H43A 4TLFA 3H1KD 4IFMA 3H1KG 2QM7A 3MD0A 1QGKB 1EZVD 3MGNA 1EZVG 1BCCJ 2JWAA 1SS1A 5H2FH 1KB9D 2XNXA 1BCCD 1BCCG 3GHGC 1ZN5A 4RKUJ 2KNCB 5KJ7C 3SWYA 2D2CD 1U7MA 1GD2E 4OH8B 1FZBA 5AVUB 2E76C 3MIWA 1DD4A 4AUWA 1VF5C 1H8AA 1FZFA 1KILB 3EFFK 3L70J 4PV1C 1R5LA 3L75E 1ZMEC 1VQ5P 3L70D 3L70G 5C39A 3TK1A 2N1TC 5AW8B 2Q6QA 2R3SA 1SQBJ 3VMYA 1L4AB 2HLOA 3AE3C 4Y99B 1ZP0C 1R5SA 3S1KA 2ZXEB 4L73A 1USEA 2KK7A 3H1HJ 3WU2E 1KD1Q 1FC2C 2K9YA 3H1JJ 3H1HD 3H1HG 2BASA 2IFMA 3H1JD 3H1JG 1LTTC 2OYIB 2JR8A 1H89A 4H13B 3CLQA 2FYNB 3WUTA 3S9OA 1FDMA 2YXRB 3G71P 1KV4A 3D71A 2ZT9D 3OW2O 1NOHA 1JY3O 2FFDB 2WTYA 4PJ0E 1VQMP 1OZHA 1LT9C 2FYUJ 2QE7H 2WVRA 2PFXA 2FYUD 2FYUG 2ZAEB 4K35A 4KJMA 2WPRA 2W6AA 2KB7P 3VTPC 2FY8A 1S5LE 4JQ0D 1Q7YQ 4UB8E 4I7ZC 3HD7C 3EWKA 1Q81Q 1RF1C 3U1CA 4AQRD 3FX0A 2JP3A 3CX5I 3WU2H 1FE6A 1LTJB 3AE2C 1LWUB 1JTHB 2RH0A 2QG4A 1M7LA 2Z5IA 5BU5A 2NPSC 1LJ2A 3H1IE 3B71A 2JJLA 4BWNA 5TJHA 1X8YA 4HH2A 1OXZA 2C9NY 1HWTC 3HE5B 4QMAA 4N78D 4IOIH 1W2EA 4C46A 1PP9E 1CW5A 1AV1A 1E79H 1S5LH 1MZ9A 2YMYA 5EFWB 4UB8H 2CK3H 3OAKA 4W7YA 4MN4C 1RE3C 4H44D 1GL2C 2GUVA 3HUSB 1N7SC 3VMAA 1SQVJ 3CXHD 1NO4A 3RK2B 2OGUA 2I1KA 2QJPC 5CCGD 1SQVD 5CCGA 2ZYAA 1SQVG 4BRYA 1NH4A 3BCCJ 1VQ4P 1JO5A 3BCCD 3BCCG 3RBXA 3CCUP 4GOEA 3PRJA 1OVVA 1KC8Q 2IPPA 1MFZA 2V4HA 4YPCA 2IDBA 3P8CE 1M1JA 1LTSC 3L71J 2E75D 1L0NE 3L71D 3LW5J 3M0DC 3L71G 5B66E 3HE4B 1IK7A 1HUCA 1L4AA 3VMXA 1KZUB 2OTLP 1CSBA 1L0NK 2JEEA 1HJBA 3RK3D 1VQ6P 2RN0A 3BASA 3HRNA 1JY2N 1S2EA 3WUUA 1NTKJ 2KIKA 2C0XA 3O6QB 1NTKD 5CCHC 1AFOA 5KAIE 1NTKG 4H0LD 5KLIC 3MP7B 1FBMA 2WSFJ 3CX5E 2QIWA 3CI9A 3H32B 3JCUE 2D2CB 2N9YB 2OYIA 2Y0EA 2UWJE 2AEFA 1AQTA 1JM0A 3GG2A 4WBAA 2WQYC 4DJGA 2JKVA 3RL0D 1SQPG 1LT1A 2AEMA 4JYBA 1DH3A 1L0LE 1G1IA 1J2JB 3B5ND 2IBZD 3B5NA 2IBZG 5B66H 1JEKA 2K88A 2BCCJ 2JWDA 1RF0C 4EIJA 1N2DC 1RH5B 2BCCD 3QWOC 2O01N 3BATA 5CJ0A 1OFCX 3HTKA 1X0TA 2MJZA 2ZXXA 1X9VA 3A0BE 1NHLA 3SSUA 3CC2P 2O3JA 2V7QH 3BVHA 1KYOD 1SQXE 3PLNA 3I56P 4DT0A 3A3YB 5KAIH 1KILC 3R4YA 4JYCA 2AEJA 2Q9IA 2XNDH 3CX5H 3OA7A 2P58A 3KQGA 3IF4A 1S3JA 1OMIA 2QSIA 4DZOA 1SQXK 3JCUH 4M3LA 3M9QA 1JY2P 4DCKA 1KILE 3CCMP 4WY4D 4WY4A 1HJ0A 1S72P 4OVNF 5AVTB 3NMDA 1VQPP 2ZT9B 3V2PA 5AVYB 3S4RA 1PIXA 2WMMA 1M90Q 1QVFO 3FWNA 1N73B 4JF7A 1BSNA 4HJGH 2H88C 4TT3H 3GF7A 3GHGA 2AXCA 3GF3A 1TU3F 2A06G 1W5CE 4H13C 5KJ7D 1T3UA 2KUBA 1K8AQ 1QX8A 3Q5PA 3TGUG 4GKGA 3NTNA 1U7JA 2P10A 2FFDC 1NU1E 3FWLA 3AEGC 2K3RA 2KXPB 3KYQA 2Y0CA 5E79E 2FXOA 1SLQA 3L35A 2DW3A 2KZJA 2WPSA 1NU1K 2N1TD 3AE5C 3E1RA 2E43A 3Q5SA 1ZXGA 3A0HE 3Q2YA 1YJWP 1IC2A
chains in the Genus database with same CATH topology
4IOIH 1EDIA 1SS1A 2KIKA 2RKLA 2KS1B 1LP1A 2B88A 1Y47A 4ZNCA 5EFWB 1OVUA 2LR2A 1U7MA 2M5AA 5DJUB 2LXBA 2OTKE 4MN4C 3PH0A 1DEEG 3MZWB 2WMMA 2I8DA 2QVAA 2UWJE 3ZDMA 2ZAEB 4HJGH 4K35A 1JM0A 4KJMA 4ZMDA 2HR3A 4BXLA 5CBNA 4CPGA 2LXCB 1BDCA 1LT1A 4JBZA 1MFTA 4ASVA 2KUBA 5C39A 5K5GB 3FXEA 4NPEA 4K3AA 1JMBA 4GOEA 1NVOA 2JWDA 1OVVA 1EDJA 1BDDA 4HKZH 1U7JA 4GOFA 2SPZA 3QWOC 2R44A 4NPFX 1EDKA 4HB1A 4GODA 1OVRA 1X0TA 2KZIA 4ASWA 2QRXA 3MHVA 1EDLA 2K3RA 3S1KA 4NPDA 5DJTB 1H0TA 2M0BA 1H0TB 1EC5A 2KZJA 3FXDA 2B87A 2B87B 1LP1B 2P58A 2Q1KA 4WWIA 1FC2C 1Q2NA 1S3JA 1ZXGA 2B89A 2KI7B 2M5AB 5CBOA 1ZW0A 3RGUA 4EYYQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOI H;  1EDI A;  1SS1 A;  2KIK A;  2RKL A;  2KS1 B;  1LP1 A;  2B88 A;  1Y47 A;  4ZNC A;  5EFW B;  1OVU A;  2LR2 A;  1U7M A;  2M5A A;  5DJU B;  2LXB A;  2OTK E;  4MN4 C;  3PH0 A;  1DEE G;  3MZW B;  2WMM A;  2I8D A;  2QVA A;  2UWJ E;  3ZDM A;  2ZAE B;  4HJG H;  4K35 A;  1JM0 A;  4KJM A;  4ZMD A;  2HR3 A;  4BXL A;  5CBN A;  4CPG A;  2LXC B;  1BDC A;  1LT1 A;  4JBZ A;  1MFT A;  4ASV A;  2KUB A;  5C39 A;  5K5G B;  3FXE A;  4NPE A;  4K3A A;  1JMB A;  4GOE A;  1NVO A;  2JWD A;  1OVV A;  1EDJ A;  1BDD A;  4HKZ H;  1U7J A;  4GOF A;  2SPZ A;  3QWO C;  2R44 A;  4NPF X;  1EDK A;  4HB1 A;  4GOD A;  1OVR A;  1X0T A;  2KZI A;  4ASW A;  2QRX A;  3MHV A;  1EDL A;  2K3R A;  3S1K A;  4NPD A;  5DJT B;  1H0T A;  2M0B A;  1H0T B;  1EC5 A;  2KZJ A;  3FXD A;  2B87 A;  2B87 B;  1LP1 B;  2P58 A;  2Q1K A;  4WWI A;  1FC2 C;  1Q2N A;  1S3J A;  1ZXG A;  2B89 A;  2KI7 B;  2M5A B;  5CBO A;  1ZW0 A;  3RGU A;  4EYY Q; 
#chains in the Genus database with same CATH topology
 1EDI A;  2WSC J;  5AVV B;  1LTJ C;  3NXS A;  2WSS H;  1IFI A;  4U3F E;  1JNM A;  1KB9 I;  5GTH H;  5AVX B;  2J5U A;  1SFC C;  5KKZ B;  1QL1 A;  1J1E C;  3PH0 A;  1N7L A;  2QM8 A;  1JMM A;  3OJA B;  3A7O A;  4H44 B;  3O6Q A;  1HVV A;  3P32 A;  3P8M C;  1RE4 C;  1LGH B;  2CPB A;  1FZG A;  4BRY B;  3H32 A;  3W68 A;  3WMM 0;  3AEC C;  4OGQ D;  5TIS E;  2PRR A;  3L72 J;  3BRV B;  1Q86 Q;  3L72 D;  3SWF A;  3VOP A;  3L72 G;  1GU4 A;  3H25 A;  4R4L A;  3V6I A;  1OVR A;  3V4Q A;  1LTB C;  3MTU E;  2JDI H;  3A0H H;  1PZQ A;  1NKZ B;  1M1J B;  3HUS C;  3VP9 A;  2CPS A;  2GUS A;  1K04 A;  2E75 B;  3RK2 C;  1H0T A;  3I55 P;  1RF1 A;  1P84 H;  2Q3I A;  3AE8 C;  5AW0 B;  2ZVO B;  1LP1 B;  1ZR4 A;  1GW3 A;  1SQB D;  1VQ8 P;  1SQB G;  2M3B A;  1YQ4 C;  1K05 A;  1L2P A;  3RK3 B;  2W8Z A;  1VQO P;  3B4S A;  5APU A;  3P7K A;  2WPV B;  5KLV E;  1LTA C;  1OX3 A;  1DIP A;  4H0L B;  2ZYG A;  4D6T E;  2YKO A;  3CCR P;  2RMZ A;  2QJK B;  2YKQ A;  5KLV K;  2WZ7 A;  2P1J A;  1UIX A;  5TIS H;  2I8D A;  2A45 H;  2ITA A;  1Y9B A;  3USS A;  3L74 E;  1GK4 A;  2BEQ D;  1IFP A;  3V2R A;  3VN0 A;  3RL0 B;  3B8E B;  3F89 A;  3SFD C;  3IFM A;  2YO3 A;  4PD4 D;  1FDO A;  3B5N B;  3AE9 C;  1PFI A;  1N73 A;  5GTI E;  4YTP C;  1EDJ A;  4HYT B;  4HKZ H;  2Q3E A;  1QL2 A;  2R44 A;  1GTW A;  1M56 D;  2PGD A;  2KSE A;  2IX7 C;  3HTK B;  3TNU B;  4N6J A;  5BU8 B;  1EDL A;  1YBK A;  1T3J A;  1KB9 E;  1EXI A;  4NPD A;  1BE3 E;  3N4X A;  1S4X A;  1IO4 A;  2WSE J;  4W80 A;  4R4M A;  3H1L J;  3CCL P;  3U1A A;  1Q2N A;  1ZRT E;  3QH9 A;  3H1L D;  3H1L G;  3G6E P;  1OW8 A;  1SQQ J;  2E74 D;  3EFG A;  1ZV8 A;  1LTI C;  2OYH B;  1SQQ D;  1AA0 A;  1SQQ G;  3GLM A;  4WY4 B;  3KHU A;  5AVZ B;  2POH A;  1T6A A;  3CX5 D;  4PJ0 H;  1QVG O;  1FU1 A;  1M8O B;  2J58 A;  1S1C X;  2W90 A;  3JC2 2;  5GTI H;  5APY A;  1PL5 A;  3KZI E;  1RQV A;  1NKN A;  2VRS A;  3A5T A;  3GHG B;  1PPJ D;  1NGM B;  2KOG A;  1PPJ G;  2YNY A;  2IYP A;  2J59 M;  3KXD A;  3O8Z A;  1KB9 H;  1G2C A;  1MFT A;  1MUU A;  5AVQ B;  2O1J A;  2HPC A;  3PJS K;  3H1H E;  2QA4 P;  3H1J E;  1URQ C;  4Y28 J;  1JCC A;  3V4W A;  2FXP A;  2KZI A;  2YKP A;  1HBW A;  1VQL P;  4IL6 X;  2AXT E;  2L91 A;  5AW1 B;  1FZC A;  1IFN A;  2E42 A;  3Q3D A;  1ZLL A;  4L76 A;  4U7J A;  1VQK P;  1SQX J;  4L74 A;  2N1T B;  4XE5 B;  1SQX D;  1SQX G;  1NTM J;  1NTZ J;  2B89 A;  3L37 A;  1NTM D;  1NTM G;  1NTZ D;  1W2B O;  2FYU E;  1NTZ G;  3N7N A;  1ZR2 A;  2M8R A;  3SFE C;  1M1K Q;  3MUD C;  2RKL A;  4KT0 J;  4JPZ B;  1PGJ A;  2YIU B;  2ZJS E;  3KZI H;  3PP5 A;  1JB0 J;  2KLU A;  1D7M A;  1LP1 A;  1FAV A;  1KQF B;  3G9R A;  3TDK A;  5APT A;  3FGA D;  1OVU A;  1MKM A;  1LNQ A;  2O1K A;  2R5B A;  1FZA A;  4RO0 A;  1QLE D;  2Q7C A;  1T2K D;  1H88 A;  4IFF A;  1S9K D;  4CPG A;  2LXC B;  4ZKU A;  5KTB A;  2HYN A;  1KTM A;  1YQ3 C;  4OGQ B;  2Q5U A;  3CWB E;  1YTZ I;  2M3E A;  3V2N A;  4RJT A;  3AE7 C;  3CCV P;  3II6 A;  2SPZ A;  5KKZ C;  2IBZ I;  1KMI Z;  2YO2 A;  1NU1 J;  3L73 E;  1GMJ A;  4I7Z B;  1H0T B;  3L36 A;  1RF1 B;  3FXD A;  3F5H A;  2BCC G;  1L0L K;  1BGY E;  2E5T A;  4AYC A;  1KYO I;  3TNU A;  2N9B A;  3LIE A;  2M5A B;  1A02 J;  1ZW0 A;  3T97 B;  3C1L A;  1Q90 D;  2R5D A;  2R32 A;  4RES B;  4Z1M H;  1FS0 E;  5AVS B;  2O01 H;  1AVO A;  3NFQ A;  2JO1 A;  4U3F J;  1P84 D;  3BCC E;  2HG5 D;  2BEZ F;  2OYH A;  1L4A C;  4Y99 C;  1PGP A;  4BXL A;  2Y9Y A;  3RK3 C;  5L8R J;  1MV8 A;  3CCS P;  1SP4 A;  3L71 E;  4EDF A;  2XZR A;  2LKM A;  2H8P D;  2XKM A;  2XDJ A;  1SFC D;  2ZVN B;  1LTG C;  3FXE A;  4H0L C;  4NPE A;  1PGQ A;  1JMB A;  2IZ1 A;  3CC4 P;  3RK3 E;  1G1J A;  2XU6 A;  2A45 G;  2B9B A;  1RE4 A;  3TYY A;  1YIT P;  1HF9 A;  2OYI C;  3R2P A;  1JY3 N;  1IJD B;  3A0B H;  1PV3 A;  3L75 J;  1FZE A;  2FYN C;  5KJ7 A;  1RQU A;  1N8R Q;  3L75 D;  5AW3 B;  3L75 G;  5B5E E;  2E76 D;  1AJY A;  2B87 A;  1VF5 D;  2NRG A;  4YXW H;  3AE1 C;  2WWW A;  4EI2 A;  3CPW O;  4PV1 D;  1FDI A;  1R8E A;  2E74 B;  3KDP B;  4C7N A;  5H2F E;  2HFE D;  1SQP E;  2GA1 A;  2KS1 A;  5CJ4 A;  2N1T A;  2QJY B;  1YIJ P;  3JSV C;  4D6T J;  1WT6 A;  2IBZ E;  4D6T D;  4GDO A;  4D6T G;  1SQP K;  3CME P;  1DEE G;  2Y0D A;  3BRT B;  3VMZ A;  1N86 A;  1LWU C;  3TF5 A;  3GMA A;  3ITK A;  3M91 A;  1EZV I;  3L74 J;  2Z4E A;  5KLI B;  3L74 D;  3L74 G;  1KYO E;  1DD3 A;  1G2C B;  3D70 A;  4ASV A;  1JY2 O;  3SWK A;  2HPC B;  4WY4 C;  5B5E H;  1FJK A;  2WT7 B;  1NJI Q;  3EQ2 A;  2WIT A;  1J1D B;  1CZQ A;  1XTC C;  2QRX A;  2KYV A;  4LLH A;  1JY3 P;  1YTZ T;  3CMA P;  1FZC B;  5CHX A;  5E79 H;  3IAO A;  3CCE P;  3M06 A;  1LT9 A;  1EC5 A;  1BE3 J;  1AVY A;  1K73 Q;  1BE3 D;  2K1A A;  2Q1K A;  1BE3 G;  1HGZ A;  1VDF A;  2H7H A;  4IFD K;  1IFJ A;  3V5B A;  5CBO A;  3LID A;  3GW6 A;  1ZRT D;  1CI6 B;  4WVZ A;  3HD7 D;  3PHL A;  3HD7 A;  2A06 E;  3H1I J;  2E5Y A;  3H1I D;  1RY3 A;  3H1I G;  3CC7 P;  1Y47 A;  4ZNC A;  3TGU E;  1KYO H;  3D6Z A;  2M5A A;  3AEF C;  1Z56 A;  1GK6 A;  3T97 A;  2HOD A;  3UIA A;  3E7K A;  2NPS D;  1E5W A;  2NPS A;  4N3Y B;  1PP9 J;  2YMK A;  3D6Y A;  1PP9 D;  1PP9 G;  2IYO A;  2K9J A;  2C0W A;  2YIU C;  3KPE A;  3AE6 C;  3TSI A;  3VYI A;  2WPQ A;  4PD4 I;  4NPF X;  3MHV A;  3Q5R A;  3CD6 P;  1RHZ B;  5KAF E;  2FYZ A;  3A2A A;  2OTJ P;  1RE3 A;  1GL2 D;  1GL2 A;  1AQ5 A;  3H1K E;  1N7S D;  1N7S A;  3M0A A;  2D2C C;  1EZV E;  4OGQ C;  2R3C A;  2XV5 A;  1URQ D;  1URQ A;  1BCC E;  4EYY Q;  2P2U A;  1HH0 A;  3P8C D;  1L0N J;  3G3Z A;  4IL6 E;  5CMZ A;  1EXJ A;  1L0N D;  1L0N G;  2KP8 A;  1YI2 P;  3E1I A;  3AEA C;  3CL3 D;  3CCQ P;  2Y9Z A;  1JOC A;  2LXB A;  2OTK E;  1IK9 A;  3L72 E;  3MZW B;  2V7Q J;  3U59 A;  3MUD A;  3M0D A;  2W6J H;  4ZMD A;  2O01 J;  1M57 D;  3L70 E;  1BDC A;  2OQQ A;  1KN7 A;  4W7Z A;  5BVZ A;  1YJN P;  1IFM A;  1GW4 A;  2WSC H;  5KAF H;  1SFC B;  1J1E B;  3CWB J;  1SQB E;  4XA4 A;  1VL2 A;  1YHQ P;  1BDD A;  3CWB D;  1GDT A;  3CWB G;  1U57 A;  5CCH D;  1NWQ A;  5CCH A;  4GOD A;  4ZKP A;  5AW5 B;  1SQB K;  3CXH I;  1ZOY C;  3AEE C;  4XFJ A;  2P7J A;  3V2Q A;  1KQG B;  1L0L J;  4IL6 H;  2M0B A;  3L73 J;  2WT7 A;  1L0L D;  1L0L G;  2E76 B;  3L73 D;  3L73 G;  3CCJ P;  2B87 B;  2ZT9 C;  4WWI A;  1VF5 B;  1JUN A;  2KI7 B;  3VP8 A;  1BGY J;  1IZN B;  1KFN A;  3RL0 g;  1N73 C;  1BGY D;  1USD A;  1BGY G;  4WB4 A;  1K9M Q;  2H89 C;  4PV1 B;  2ZFC A;  2QEX P;  1S5L X;  4C7N B;  4YXD C;  2W6B A;  2KS1 B;  4A7P A;  2KNC A;  4PD4 E;  1RF0 A;  1FJP A;  1XTG B;  2W27 A;  3AED C;  5M1B A;  1VQ7 P;  5DJU B;  4I6M C;  1VPC A;  2NZ2 A;  1CI6 A;  2C9L Y;  1NAF A;  1Q82 Q;  2FYU K;  4LGD E;  3AE4 C;  2ZYD A;  2K37 A;  1KIL D;  1KIL A;  1DX7 A;  2PP6 A;  2GM4 A;  1X22 A;  2E74 C;  5K5G B;  2Z5H A;  4K3A A;  2QJY C;  1NVO A;  1L4A D;  4DOJ A;  3H1L E;  4L75 A;  3PTZ A;  1DEB A;  1NYH A;  4ASW A;  1SQQ E;  2AXT H;  1GU5 A;  1VQN P;  4I2L C;  1LT9 B;  1SQQ K;  3K5B A;  2IFN A;  4PD4 H;  5AW9 B;  1OWA A;  4UB6 E;  4N78 E;  3C8V A;  4C7R A;  5APS A;  4LC1 A;  5AVR B;  3RGU A;  4H44 C;  4H13 D;  1UII A;  1NU1 D;  1NU1 G;  2YXQ B;  1PPJ E;  3HD7 B;  2OYO A;  3ABV C;  1J1D C;  5CCG C;  1SQP J;  1BSH A;  1SQP D;  1FZC C;  1WMK A;  2G3A A;  2FFD A;  2LR2 A;  1OW6 A;  1GZL A;  1KQL A;  3CXH E;  3M9B A;  5APW A;  2HOD B;  1P84 I;  1SQV E;  2NPS B;  2WSE H;  1PGO A;  5AW7 B;  5CBN A;  1HGV A;  1M1J C;  1IFD A;  3Q1M A;  1SQV K;  2E75 C;  2K9J B;  4U3F D;  4U3F G;  1SVF A;  2FKW B;  1NTM E;  1KOR A;  1NTZ E;  3M9H A;  4GOF A;  3W67 A;  1LTJ A;  1LWU A;  1JTH A;  5APQ A;  4UB6 H;  1VQ9 P;  4HB1 A;  1Y8A A;  2W83 C;  3WUV A;  2L5G B;  2I1J A;  1NTM K;  3IR9 A;  2A45 I;  1NTZ K;  1QEX A;  1SFC A;  5DJT B;  1T2K C;  1KFM A;  3I5C A;  1KQS O;  2KSJ A;  2QJK C;  5APV A;  1GL2 B;  1N7S B;  2G8Y A;  3HE5 A;  4I1L A;  4O9B A;  4B86 A;  4EOT A;  2QJP B;  1URQ B;  5AW6 B;  3CXH H;  1NTK E;  4OWF A;  1S9K E;  1HTL C;  4KHX A;  3RL0 C;  2B88 A;  2A06 D;  1NTK K;  1YYC A;  1FOS E;  5GTH E;  3TGU J;  3B5N C;  3RBZ A;  5AW2 B;  2PAJ A;  3AEB C;  3TGU D;  3HUS A;  2QVA A;  3H6P A;  3ZDM A;  4GT1 A;  5KLV J;  1X79 B;  3RK2 D;  2HR3 A;  2P67 A;  5KLV D;  1FOS F;  5KLV G;  1YJ9 P;  1T8Z A;  1EQ7 A;  4JBZ A;  3L4F A;  1NAY A;  3LW5 H;  2MKV A;  5AW4 B;  5APX A;  2BCC E;  1WRG A;  3C9I A;  1EDK A;  2FXM A;  2OAR A;  5AVW B;  3IN6 A;  2OYH C;  4GIF A;  1JCD A;  3HE4 A;  2FBW C;  1OIP A;  3G4S P;  1P84 E;  2WSF H;  1A02 F;  1OW7 A;  2IZ0 A;  3H1K J;  2KLV A;  2H43 A;  4TLF A;  3H1K D;  4IFM A;  3H1K G;  2QM7 A;  3MD0 A;  1QGK B;  1EZV D;  3MGN A;  1EZV G;  1BCC J;  2JWA A;  1SS1 A;  5H2F H;  1KB9 D;  2XNX A;  1BCC D;  1BCC G;  3GHG C;  1ZN5 A;  4RKU J;  2KNC B;  5KJ7 C;  3SWY A;  2D2C D;  1U7M A;  1GD2 E;  4OH8 B;  1FZB A;  5AVU B;  2E76 C;  3MIW A;  1DD4 A;  4AUW A;  1VF5 C;  1H8A A;  1FZF A;  1KIL B;  3EFF K;  3L70 J;  4PV1 C;  1R5L A;  3L75 E;  1ZME C;  1VQ5 P;  3L70 D;  3L70 G;  5C39 A;  3TK1 A;  2N1T C;  5AW8 B;  2Q6Q A;  2R3S A;  1SQB J;  3VMY A;  1L4A B;  2HLO A;  3AE3 C;  4Y99 B;  1ZP0 C;  1R5S A;  3S1K A;  2ZXE B;  4L73 A;  1USE A;  2KK7 A;  3H1H J;  3WU2 E;  1KD1 Q;  1FC2 C;  2K9Y A;  3H1J J;  3H1H D;  3H1H G;  2BAS A;  2IFM A;  3H1J D;  3H1J G;  1LTT C;  2OYI B;  2JR8 A;  1H89 A;  4H13 B;  3CLQ A;  2FYN B;  3WUT A;  3S9O A;  1FDM A;  2YXR B;  3G71 P;  1KV4 A;  3D71 A;  2ZT9 D;  3OW2 O;  1NOH A;  1JY3 O;  2FFD B;  2WTY A;  4PJ0 E;  1VQM P;  1OZH A;  1LT9 C;  2FYU J;  2QE7 H;  2WVR A;  2PFX A;  2FYU D;  2FYU G;  2ZAE B;  4K35 A;  4KJM A;  2WPR A;  2W6A A;  2KB7 P;  3VTP C;  2FY8 A;  1S5L E;  4JQ0 D;  1Q7Y Q;  4UB8 E;  4I7Z C;  3HD7 C;  3EWK A;  1Q81 Q;  1RF1 C;  3U1C A;  4AQR D;  3FX0 A;  2JP3 A;  3CX5 I;  3WU2 H;  1FE6 A;  1LTJ B;  3AE2 C;  1LWU B;  1JTH B;  2RH0 A;  2QG4 A;  1M7L A;  2Z5I A;  5BU5 A;  2NPS C;  1LJ2 A;  3H1I E;  3B71 A;  2JJL A;  4BWN A;  5TJH A;  1X8Y A;  4HH2 A;  1OXZ A;  2C9N Y;  1HWT C;  3HE5 B;  4QMA A;  4N78 D;  4IOI H;  1W2E A;  4C46 A;  1PP9 E;  1CW5 A;  1AV1 A;  1E79 H;  1S5L H;  1MZ9 A;  2YMY A;  5EFW B;  4UB8 H;  2CK3 H;  3OAK A;  4W7Y A;  4MN4 C;  1RE3 C;  4H44 D;  1GL2 C;  2GUV A;  3HUS B;  1N7S C;  3VMA A;  1SQV J;  3CXH D;  1NO4 A;  3RK2 B;  2OGU A;  2I1K A;  2QJP C;  5CCG D;  1SQV D;  5CCG A;  2ZYA A;  1SQV G;  4BRY A;  1NH4 A;  3BCC J;  1VQ4 P;  1JO5 A;  3BCC D;  3BCC G;  3RBX A;  3CCU P;  4GOE A;  3PRJ A;  1OVV A;  1KC8 Q;  2IPP A;  1MFZ A;  2V4H A;  4YPC A;  2IDB A;  3P8C E;  1M1J A;  1LTS C;  3L71 J;  2E75 D;  1L0N E;  3L71 D;  3LW5 J;  3M0D C;  3L71 G;  5B66 E;  3HE4 B;  1IK7 A;  1HUC A;  1L4A A;  3VMX A;  1KZU B;  2OTL P;  1CSB A;  1L0N K;  2JEE A;  1HJB A;  3RK3 D;  1VQ6 P;  2RN0 A;  3BAS A;  3HRN A;  1JY2 N;  1S2E A;  3WUU A;  1NTK J;  2KIK A;  2C0X A;  3O6Q B;  1NTK D;  5CCH C;  1AFO A;  5KAI E;  1NTK G;  4H0L D;  5KLI C;  3MP7 B;  1FBM A;  2WSF J;  3CX5 E;  2QIW A;  3CI9 A;  3H32 B;  3JCU E;  2D2C B;  2N9Y B;  2OYI A;  2Y0E A;  2UWJ E;  2AEF A;  1AQT A;  1JM0 A;  3GG2 A;  4WBA A;  2WQY C;  4DJG A;  2JKV A;  3RL0 D;  1SQP G;  1LT1 A;  2AEM A;  4JYB A;  1DH3 A;  1L0L E;  1G1I A;  1J2J B;  3B5N D;  2IBZ D;  3B5N A;  2IBZ G;  5B66 H;  1JEK A;  2K88 A;  2BCC J;  2JWD A;  1RF0 C;  4EIJ A;  1N2D C;  1RH5 B;  2BCC D;  3QWO C;  2O01 N;  3BAT A;  5CJ0 A;  1OFC X;  3HTK A;  1X0T A;  2MJZ A;  2ZXX A;  1X9V A;  3A0B E;  1NHL A;  3SSU A;  3CC2 P;  2O3J A;  2V7Q H;  3BVH A;  1KYO D;  1SQX E;  3PLN A;  3I56 P;  4DT0 A;  3A3Y B;  5KAI H;  1KIL C;  3R4Y A;  4JYC A;  2AEJ A;  2Q9I A;  2XND H;  3CX5 H;  3OA7 A;  2P58 A;  3KQG A;  3IF4 A;  1S3J A;  1OMI A;  2QSI A;  4DZO A;  1SQX K;  3JCU H;  4M3L A;  3M9Q A;  1JY2 P;  4DCK A;  1KIL E;  3CCM P;  4WY4 D;  4WY4 A;  1HJ0 A;  1S72 P;  4OVN F;  5AVT B;  3NMD A;  1VQP P;  2ZT9 B;  3V2P A;  5AVY B;  3S4R A;  1PIX A;  2WMM A;  1M90 Q;  1QVF O;  3FWN A;  1N73 B;  4JF7 A;  1BSN A;  4HJG H;  2H88 C;  4TT3 H;  3GF7 A;  3GHG A;  2AXC A;  3GF3 A;  1TU3 F;  2A06 G;  1W5C E;  4H13 C;  5KJ7 D;  1T3U A;  2KUB A;  1K8A Q;  1QX8 A;  3Q5P A;  3TGU G;  4GKG A;  3NTN A;  1U7J A;  2P10 A;  2FFD C;  1NU1 E;  3FWL A;  3AEG C;  2K3R A;  2KXP B;  3KYQ A;  2Y0C A;  5E79 E;  2FXO A;  1SLQ A;  3L35 A;  2DW3 A;  2KZJ A;  2WPS A;  1NU1 K;  2N1T D;  3AE5 C;  3E1R A;  2E43 A;  3Q5S A;  1ZXG A;  3A0H E;  3Q2Y A;  1YJW P;  1IC2 A; 
#chains in the Genus database with same CATH homology
 4IOI H;  1EDI A;  1SS1 A;  2KIK A;  2RKL A;  2KS1 B;  1LP1 A;  2B88 A;  1Y47 A;  4ZNC A;  5EFW B;  1OVU A;  2LR2 A;  1U7M A;  2M5A A;  5DJU B;  2LXB A;  2OTK E;  4MN4 C;  3PH0 A;  1DEE G;  3MZW B;  2WMM A;  2I8D A;  2QVA A;  2UWJ E;  3ZDM A;  2ZAE B;  4HJG H;  4K35 A;  1JM0 A;  4KJM A;  4ZMD A;  2HR3 A;  4BXL A;  5CBN A;  4CPG A;  2LXC B;  1BDC A;  1LT1 A;  4JBZ A;  1MFT A;  4ASV A;  2KUB A;  5C39 A;  5K5G B;  3FXE A;  4NPE A;  4K3A A;  1JMB A;  4GOE A;  1NVO A;  2JWD A;  1OVV A;  1EDJ A;  1BDD A;  4HKZ H;  1U7J A;  4GOF A;  2SPZ A;  3QWO C;  2R44 A;  4NPF X;  1EDK A;  4HB1 A;  4GOD A;  1OVR A;  1X0T A;  2KZI A;  4ASW A;  2QRX A;  3MHV A;  1EDL A;  2K3R A;  3S1K A;  4NPD A;  5DJT B;  1H0T A;  2M0B A;  1H0T B;  1EC5 A;  2KZJ A;  3FXD A;  2B87 A;  2B87 B;  1LP1 B;  2P58 A;  2Q1K A;  4WWI A;  1FC2 C;  1Q2N A;  1S3J A;  1ZXG A;  2B89 A;  2KI7 B;  2M5A B;  5CBO A;  1ZW0 A;  3RGU A;  4EYY Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...