5DJTB

Crystal structure of lov2 (c450a) domain in complex with zdk2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
59
structure length
59
Chain Sequence
b'SVDNKFNKEMLSARVEIYGLPNLNWGQRFAFISSLTDDPSQSANLLAEAKKLNDAQAPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NPH1-2
publication title LOVTRAP: an optogenetic system for photoinduced protein dissociation.
pubmed doi rcsb
source organism Avena sativa
molecule tags Signaling protein
total genus 22
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2015-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5djtB00
2Q1KA 2QVAA 4BXLA 4WWIA 2M0BA 1ZXGA 1NVOA 2KUBA 1X0TA 5CBNA 1BDDA 2RKLA 2KIKA 3PH0A 2B88A 1Y47A 4EYYQ 1ZW0A 4GOFA 1FC2C 3RGUA 1EDLA 4NPFX 1Q2NA 2LXBA 1H0TB 2B89A 2QRXA 1H0TA 4K3AA 2UWJE 5DJTB 1DEEG 1LP1B 5CBOA 4HKZH 1LP1A 1OVUA 4KJMA 1OVRA 4MN4C 5C39A 1BDCA 1EDJA 2M5AB 4ZMDA 2KS1B 2M5AA 1EC5A 4GODA 5K5GB 2P58A 1U7JA 2KZIA 3FXEA 4JBZA 4ASWA 3ZDMA 3QWOC 1EDKA 5EFWB 4K35A 4ASVA 1JMBA 2R44A 2LXCB 2ZAEB 2LR2A 1MFTA 3S1KA 2SPZA 2HR3A 1EDIA 2B87B 2JWDA 4GOEA 2B87A 1OVVA 2K3RA 4HB1A 4HJGH 2KI7B 1SS1A 1JM0A 1U7MA 4NPDA 4NPEA 1S3JA 1LT1A 2I8DA 3FXDA 4IOIH 4CPGA 2OTKE 3MHVA 2WMMA 2KZJA 4ZNCA 3MZWB 5DJUB
chains in the Genus database with same CATH superfamily
5KLIC 2E42A 3G4SP 1IFPA 3HD7A 1IFNA 1JTHA 3KQGA 1NTKG 2A06E 2KUBA 3C8VA 1OFCX 2IBZE 2RKLA 3VTPC 2WZ7A 3BRTB 1T6AA 1SQXK 2OGUA 2ZYGA 1DD3A 1L0NG 4H13B 1H89A 1FZEA 3M06A 1KQSO 3FWLA 3CI9A 1NTKD 4GKGA 1DEBA 3AE3C 2ZVOB 2FBWC 1NTKJ 3H32A 3TYYA 1L0ND 2L91A 1FAVA 3L71E 1L2PA 3E1RA 1SQPG 5K5GB 2PAJA 3TGUG 1L0NJ 1Z56A 3CCLP 1EXJA 1JY2O 2Q3IA 3RK2C 5KAIH 1FS0E 2FYNB 1DX7A 2N1TB 1SQPD 1KORA 3Q3DA 3TGUD 2ZYDA 1MZ9A 3NMDA 1CZQA 1SQPJ 1EZVG 1OXZA 2JWDA 2B87A 1JY3O 3E7KA 5GTIE 1S5LE 1SQXJ 1KYOD 3CX5H 4C7NA 5APWA 1H88A 1L0LE 1USDA 4C7RA 2JO1A 4JYCA 1EZVD 1FZGA 3CMAP 3BASA 1N2DC 1M56D 1SQXE 2KNCA 3KXDA 3CXHD 4AQRD 3PH0A 3CMEP 1VQ4P 3WUUA 2B89A 4Y99C 2C9LY 4H44C 3U59A 2FY8A 2KYVA 1VQOP 2OYOA 4I7ZC 5GTHH 2J59M 3AE7C 3HE4A 2QJKB 2C0XA 1FDMA 3JCUE 2YMYA 5TJHA 2WPSA 4WY4D 5CCHD 1FZBA 3B4SA 1SQBG 1EDKA 4W7ZA 2BEZF 3GLMA 3L4FA 5APXA 5L8RJ 4KT0J 3LIDA 2G8YA 2A45G 5TISE 2W6AA 1ZRTD 5APQA 3L35A 3VMZA 1JY2P 1SQBD 4GOEA 5M1BA 4O9BA 1NU1K 5E79H 1FU1A 1JB0J 1SQBJ 3B5ND 2QG4A 2GUVA 5AVVB 1LTGC 1M1KQ 2HYNA 1VQ7P 2OARA 5B66H 1ZXGA 1NTMK 4IFDK 4I1LA 4GIFA 1GU5A 1ZLLA 3S4RA 3L75G 2JDIH 1GZLA 2QJKC 1Q86Q 2PGDA 4JYBA 2C9NY 1HBWA 3GF3A 2NPSA 2QRXA 3AE6C 3GW6A 1GL2B 1OVUA 2I1KA 3PJSK 1SFCC 2WSFJ 1KILB 3L75D 1T2KD 1P84H 1SFCA 3G6EP 1EC5A 1NTMG 1VF5D 5CMZA 3L75J 2IFNA 1PPJE 3M91A 3FXEA 3MUDA 4YTPC 1AA0A 1NU1J 2XV5A 4K35A 4ASVA 2P10A 2YIUC 2GUSA 2FXMA 1NTMD 4GT1A 2YO3A 3VN0A 3IAOA 5AVQB 1NTMJ 1EZVI 3BATA 4HJGH 3F5HA 4HB1A 2FFDC 4EIJA 3L73E 2AEJA 4OVNF 5CJ0A 1BCCG 3CXHI 2ITAA 1YJ9P 2HPCB 1WRGA 1NKNA 2FFDA 2OTKE 4H0LB 1AVOA 3MZWB 2K9JB 4IL6H 3RK3B 1RHZB 2Q1KA 3T97B 1YBKA 3KHUA 1HF9A 5APVA 1BCCD 1M57D 4WY4C 5CCHC 2YXQB 3H1KJ 1RF0C 1BCCJ 3R2PA 1RQUA 5CCHA 1YJNP 1GK6A 1Y8AA 1RF0A 1S4XA 1NAFA 2LXBA 1FOSE 1DEEG 4B86A 3Q2YA 4L76A 2YXRB 3L70E 2ZXXA 2POHA 3A0BH 5APYA 3HE5A 3B5NC 4PD4E 1UIIA 4TLFA 3GMAA 2Q7CA 3B5NA 3AEFC 3WMM0 4A7PA 1AV1A 1SVFA 3F89A 4LC1A 1JMBA 4Y28J 2Z4EA 2A45I 2LXCB 2ZAEB 2JWAA 1E5WA 1N7LA 1OVVA 1DD4A 1JNMA 2K9YA 2H43A 1FZCA 3D71A 1T2KC 2Y9ZA 2YMKA 3CWBD 4JF7A 1VF5C 3RL0C 2BASA 3LW5J 5AW4B 2RH0A 3CWBJ 3P8CD 3CCVP 2K88A 4XFJA 1KB9D 1J1EB 3AEEC 1XTGB 1PP9E 5KAFH 1FC2C 1LTBC 1K05A 3BCCG 1QGKB 2WSCJ 1L4AA 1H0TA 5AW9B 3WU2H 2XU6A 3NFQA 5AVXB 3V5BA 1P84I 3HUSC 4GODA 4PV1B 1NWQA 2KS1A 3BCCD 1PZQA 2HG5D 2V7QJ 4EDFA 2KZIA 1K9MQ 3HUSA 2QJPB 1ZV8A 5KAFE 3BCCJ 2W6BA 3CC4P 2KOGA 3SSUA 1FBMA 3KDPB 1YQ3C 2XDJA 1RH5B 2ZJSE 2O1KA 5AW6B 1BE3G 2E75B 4EI2A 1CW5A 1LTTC 1FZFA 3H1JJ 4NPDA 2GM4A 4YXWH 4U3FJ 1R8EA 3ITKA 3USSA 3KPEA 3M9HA 2E43A 1BE3D 1Q90D 2VRSA 2M0BA 3JSVC 3H1JE 2QM7A 1HJ0A 1AJYA 2N1TD 3G3ZA 1H8AA 2Y9YA 1RQVA 5KKZB 3AE9C 1AVYA 4YXDC 2P2UA 3FX0A 4DZOA 1YITP 1RF1B 1KQGB 1Q2NA 2WQYC 3GHGB 2OTJP 4K3AA 5AW1B 2OYIC 1SQPK 4KJMA 1BSHA 5C39A 4D6TD 2R3CA 1Q81Q 2OYIA 3V4WA 1OW7A 2M5AB 3C9IA 3M9QA 1KZUB 3QH9A 4D6TJ 2KSJA 2QJYB 4U7JA 2QE7H 3IR9A 4C7NB 1GDTA 4RJTA 3WUVA 1HGZA 1A02F 1M1JC 1VPCA 1M1JA 5GTIH 1S5LH 4BRYA 5KKZC 3V6IA 1NTKE 1WMKA 1U7MA 1ZOYC 4NPEA 1KB9I 4IOIH 1RF1C 2XNXA 2WMMA 1MV8A 2WT7A 1L0NE 2CK3H 1YTZI 1N8RQ 1IZNB 3M0DC 3TGUJ 1PGPA 1YHQP 3VMXA 2KP8A 2B88A 4H13C 3TNUB 3M0DA 3L74G 1IK7A 1EXIA 1EDLA 2KK7A 3V2RA 2IZ0A 1SQPE 4IFMA 4YPCA 5KLVG 3Q5SA 1LP1B 3A7OA 1PIXA 1VQ6P 1CI6B 1S5LX 1OWAA 3ABVC 1WT6A 3L74D 1T3UA 3CX5D 1SQBK 2LKMA 2Q5UA 1KYOE 3KZIE 3JCUH 1USEA 2NRGA 3L72G 5KLVD 2MJZA 3H1HG 4R4LA 1ZP0C 3Q5RA 4ASWA 1EZVE 3QWOC 5KLVJ 5AW2B 1M7LA 1JOCA 3PHLA 2FYUK 5TISH 2FYNC 2N1TC 1K04A 3CXHE 1LT9B 1S9KD 2HLOA 3L72D 2N1TA 1VDFA 3H1HD 1S1CX 1GL2D 3PLNA 4N6JA 4OWFA 1KILD 3L72J 1JM0A 3AE5C 2FKWB 1JMMA 1SQQG 4C46A 1IFDA 1KN7A 3SWYA 1N73B 4RO0A 3OW2O 1BGYG 2FYUG 2ZVNB 1VQNP 3G9RA 3HTKB 3H25A 1SQQD 2KIKA 4EYYQ 2M3EA 5CJ4A 4R4MA 3CL3D 1SQQJ 2WPVB 1BGYD 2FYUD 4LGDE 1JY3P 1ZRTE 5DJTB 4H0LD 1NJIQ 1BGYJ 2FYUJ 1SQBE 3RK3D 2E76B 5BU5A 2O01N 1T8ZA 1MKMA 2Q3EA 3U1AA 3CCJP 3I55P 5AW5B 3VP8A 1OX3A 3UIAA 2P7JA 1JY2N 2FXPA 1LTJB 1IFJA 1N73C 1YYCA 1GW4A 4QMAA 1PL5A 1G2CB 2W8ZA 2OTLP 1QVGO 2SPZA 1GMJA 2J5UA 2PRRA 3MTUE 3CCQP 2D2CD 3I5CA 1JY3N 4L75A 5APTA 1N7SB 1W2BO 2OYHB 1IC2A 1LT1A 1PFIA 4CPGA 1VL2A 2JR8A 3L75E 2KZJA 1P84D 1NTZG 1W2EA 3WUTA 3O8ZA 1AFOA 4AYCA 1OZHA 3VYIA 3AE1C 1IK9A 1SQVG 1NU1E 1HWTC 5AW8B 1KFNA 1IJDB 3Q1MA 2FXOA 5AW0B 1QLED 3SWKA 1NTZD 3CX5I 1FOSF 2HODB 2KB7P 2WSEH 2K37A 1NTME 5CHXA 2E5YA 3H1LG 1GU4A 1SQVD 1NTZJ 1GL2C 1LNQA 2UWJE 1KILC 1KFMA 3VMYA 3A5TA 4MN4C 4PD4H 1M8OB 1DH3A 1EDJA 3D6YA 2AEMA 4WY4A 3RBXA 4ZMDA 3H1LD 2YNYA 1YI2P 4JPZB 1G1IA 3H1LJ 3MGNA 1NO4A 1XTCC 3H1KE 5AVWB 1BCCE 4GDOA 2IYOA 2H88C 2D2CB 3A2AA 3KYQA 2WPQA 4OGQD 4IL6X 2IPPA 2W83C 1OW8A 2NZ2A 1GTWA 5CCGD 1NGMB 4PV1D 4H0LC 2HPCA 1URQD 3TSIA 2O01J 3RK3C 1SP4A 2K9JA 1KD1Q 4BXLA 1UIXA 4UB6H 3T97A 1TU3F 1ZR2A 1NKZB 1OMIA 3AE2C 2BCCG 1YIJP 2IDBA 2QEXP 3HD7D 1QX8A 1PP9G 3G71P 2QIWA 1LWUB 2E75D 3TDKA 2DW3A 5KJ7D 2JEEA 2AXTE 2BCCD 3EWKA 4HKZH 1RY3A 1KQFB 3OJAB 1NH4A 2WSCH 4UB6E 2BCCJ 1IFMA 5AVSB 1JUNA 5AVZB 1FJPA 3MD0A 3H1IG 3CC2P 5APSA 2R5DA 3CWBE 4OGQB 2KSEA 1NOHA 2R32A 1GD2E 2LR2A 3H1ID 3O6QB 4N78D 3B71A 2I1JA 1URQB 1EDIA 1PGOA 5B5EE 1QL2A 3H1IJ 2KI7B 3BVHA 3CCEP 1PV3A 3AE4C 1LWUC 1YQ4C 1D7MA 3OAKA 1X79B 1DIPA 2RMZA 3HD7B 1JTHB 3BCCE 4WWIA 5KLIB 5APUA 2JP3A 1NVOA 1J1EC 5CBNA 1K8AQ 2FYZA 3OA7A 3V2PA 1JO5A 3RBZA 2L5GB 2CPSA 3A0HE 1G1JA 1OW6A 1QL1A 2A06G 3RL0g 4I2LC 1MFZA 2IBZG 1BE3J 4EOTA 4U3FE 3H32B 5CCGC 1KV4A 3P7KA 4PV1C 1URQC 4L73A 2ZT9D 3SFDC 3L37A 2WWWA 2QJPC 2B9BA 4DCKA 2QA4P 2A06D 1HVVA 2IBZD 3ZDMA 3CD6P 3TF5A 4PJ0E 3RK2B 3L71G 3NXSA 3EQ2A 2E75C 2BEQD 2K1AA 1Q82Q 1L0LK 4UB8E 5KJ7C 2B87B 2K3RA 1GW3A 5KJ7A 3PRJA 1S3JA 3I56P 2I8DA 2XKMA 1FDOA 1PGQA 3L71D 2WITA 3MHVA 4D6TE 1FDIA 3L71J 3C1LA 2KNCB 1JCCA 4LLHA 1RE4C 1OIPA 5KLVK 2N9BA 1LTSC 4GOFA 1L0LG 1RE4A 2E74D 2Y0EA 1HTLC 3GHGC 2JKVA 4RKUJ 1RF1A 2IX7C 3FWNA 3GHGA 2ZT9B 1SQXG 1A02J 1KYOH 3KZIH 4Y99B 2IYPA 2HFED 3HRNA 1L0LD 2NPSD 1K73Q 4H44B 3A3YB 2JJLA 2M5AA 3MP7B 2Z5IA 4WVZA 3HE4B 1L0LJ 2P58A 4I7ZB 1VQ5P 1U7JA 2QJYC 1SQXD 3TGUE 1VQPP 1R5LA 3CCRP 3CXHH 1SFCD 2ZXEB 5EFWB 4N3YB 3L36A 2CPBA 2O3JA 5KAIE 2PP6A 2ZYAA 2HR3A 1SQQK 1HH0A 3L74J 4I6MC 2E76D 3E1IA 2R5BA 1E79H 4HH2A 3K5BA 1S72P 3L74E 1QEXA 5DJUB 3CX5E 2ZT9C 2QVAA 1JEKA 2E74B 5KLVE 3H1HJ 3TNUA 1AQ5A 3JC22 1S9KE 3CPWO 2NPSB 3IF4A 3L72E 3SWFA 1N7SD 1LGHB 3H1HE 3CCSP 5AVYB 2IBZI 3V2QA 1LP1A 1KILE 1CI6A 1NYHA 2QM8A 1KTMA 3R4YA 2A45H 3EFFK 2M8RA 1SFCB 3GF7A 3AECC 2Q9IA 1BSNA 1VQMP 4DJGA 4W7YA 4W80A 1RE3C 5AW7B 2KXPB 2H7HA 4JBZA 3S9OA 1KMIZ 5GTHE 1YTZT 5H2FH 1RE3A 1LT9C 2R44A 1SQQE 2IFMA 1LT9A 2YIUB 2P1JA 3B8EB 2E74C 3M0AA 4XA4A 2WSFH 3IFMA 1J1DB 4IFFA 1PPJG 1BGYE 2FYUE 1NTZK 1T3JA 3SFEC 1SS1A 2M3BA 3U1CA 2FFDB 1SQVK 4WB4A 3CC7P 2NPSC 1Q7YQ 1R5SA 2J58A 5H2FE 2WSSH 3RK3E 2KLVA 5E79E 1PPJD 1N73A 3P8MC 3MIWA 1NU1G 2W90A 3CCMP 3L73G 3AEBC 4M3LA 3NTNA 3AEAC 5BVZA 1HGVA 3HTKA 5B66E 4WY4B 3AEDC 1HJBA 3RL0D 1VQKP 2XZRA 2AXCA 3MUDC 3RGUA 1EQ7A 1W5CE 1NU1D 4AUWA 1X9VA 2YKQA 3L73D 4ZKPA 1NHLA 2W27A 2E76C 3N7NA 2C0WA 3L73J 1KYOI 2O1JA 1L4AD 1ZMEC 2YKOA 1ZN5A 3HE5B 3M9BA 4RESB 1VQLP 1J1DC 5AVRB 3B5NB 1P84E 3TK1A 1IFIA 3H1KG 1LTJC 3V4QA 3CLQA 2R3SA 1GL2A 2AEFA 1SQVJ 3L70G 1KC8Q 2YKPA 3AE8C 1LTJA 1SLQA 1KILA 1GK4A 5AW3B 1QVFO 1NTZE 1G2CA 2WTYA 1LTAC 2Y0CA 3H1KD 4DOJA 1YJWP 1N7SC 1SQVE 2OYHC 2WSEJ 2ZFCA 3L70D 3W68A 1FZCB 2GA1A 1N7SA 2OYHA 3PTZA 1HUCA 4PD4D 3L70J 2RN0A 1OVRA 3VMAA 3D6ZA 5BU8B 2QSIA 3H1LE 1AQTA 2O01H 4IL6E 1VF5B 3RL0B 3FGAD 3AEGC 5AVTB 1Y47A 2AXTH 3CCUP 2HODA 4XE5B 4NPFX 1PGJA 1L4AB 1MUUA 3P32A 1H0TB 2G3AA 2KLUA 3LW5H 2W6JH 2KS1B 4HYTB 3PP5A 2WVRA 1ZR4A 3CWBG 3HUSB 3A0BE 3II6A 1IO4A 1FZCC 5KTBA 1KB9H 1X22A 2D2CC 3EFGA 4DT0A 1PP9D 2Z5HA 4JQ0D 5B5EH 1PP9J 1VQ9P 3VP9A 1S2EA 3GG2A 2XNDH 2BCCE 2V7QH 3P8CE 3FXDA 2P67A 1L4AC 1LTIC 4TT3H 1KB9E 3VOPA 2H8PD 2V4HA 2Q6QA 3RK2D 3LIEA 1VQ8P 1X0TA 1BDDA 2H89C 4Z1MH 1ZW0A 2WPRA 3A0HH 5AVUB 1LWUA 1FZAA 1M90Q 3V2NA 3H1IE 4WBAA 3H1JG 4N78E 3Q5PA 4U3FG 3W67A 5CBOA 2N9YB 1N86A 4H13D 2IZ1A 1BDCA 1J2JB 2OYIB 3WU2E 1JCDA 2YO2A 1NAYA 3H1JD 4OGQC 2MKVA 3D70A 3BRVB 2OQQA 2Y0DA 4U3FD 2E5TA 4PJ0H 4L74A 3N4XA 1KQLA 1NTKK 1FJKA 4PD4I 4OH8B 4UB8H 4ZKUA 5CCGA 1MFTA 3S1KA 3O6QA 4KHXA 1FE6A 3H6PA 2PFXA 1M1JB 1URQA 4BRYB 1L0NK 1BE3E 4H44D 1Y9BA 1U57A 1LJ2A 3IN6A 4BWNA 4D6TG 1X8YA 1CSBA 2WT7B 3HD7C 4ZNCA
chains in the Genus database with same CATH topology
2Q1KA 2QVAA 4BXLA 4WWIA 2M0BA 1ZXGA 1NVOA 2KUBA 1X0TA 5CBNA 1BDDA 2RKLA 2KIKA 3PH0A 2B88A 1Y47A 4EYYQ 1ZW0A 4GOFA 1FC2C 3RGUA 1EDLA 4NPFX 1Q2NA 2LXBA 1H0TB 2B89A 2QRXA 1H0TA 4K3AA 2UWJE 5DJTB 1DEEG 1LP1B 5CBOA 4HKZH 1LP1A 1OVUA 4KJMA 1OVRA 4MN4C 5C39A 1BDCA 1EDJA 2M5AB 4ZMDA 2KS1B 2M5AA 1EC5A 4GODA 5K5GB 2P58A 1U7JA 2KZIA 3FXEA 4JBZA 4ASWA 3ZDMA 3QWOC 1EDKA 5EFWB 4K35A 4ASVA 1JMBA 2R44A 2LXCB 2ZAEB 2LR2A 1MFTA 3S1KA 2SPZA 2HR3A 1EDIA 2B87B 2JWDA 4GOEA 2B87A 1OVVA 2K3RA 4HB1A 4HJGH 2KI7B 1SS1A 1JM0A 1U7MA 4NPDA 4NPEA 1S3JA 1LT1A 2I8DA 3FXDA 4IOIH 4CPGA 2OTKE 3MHVA 2WMMA 2KZJA 4ZNCA 3MZWB 5DJUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q1K A;  2QVA A;  4BXL A;  4WWI A;  2M0B A;  1ZXG A;  1NVO A;  2KUB A;  1X0T A;  5CBN A;  1BDD A;  2RKL A;  2KIK A;  3PH0 A;  2B88 A;  1Y47 A;  4EYY Q;  1ZW0 A;  4GOF A;  1FC2 C;  3RGU A;  1EDL A;  4NPF X;  1Q2N A;  2LXB A;  1H0T B;  2B89 A;  2QRX A;  1H0T A;  4K3A A;  2UWJ E;  5DJT B;  1DEE G;  1LP1 B;  5CBO A;  4HKZ H;  1LP1 A;  1OVU A;  4KJM A;  1OVR A;  4MN4 C;  5C39 A;  1BDC A;  1EDJ A;  2M5A B;  4ZMD A;  2KS1 B;  2M5A A;  1EC5 A;  4GOD A;  5K5G B;  2P58 A;  1U7J A;  2KZI A;  3FXE A;  4JBZ A;  4ASW A;  3ZDM A;  3QWO C;  1EDK A;  5EFW B;  4K35 A;  4ASV A;  1JMB A;  2R44 A;  2LXC B;  2ZAE B;  2LR2 A;  1MFT A;  3S1K A;  2SPZ A;  2HR3 A;  1EDI A;  2B87 B;  2JWD A;  4GOE A;  2B87 A;  1OVV A;  2K3R A;  4HB1 A;  4HJG H;  2KI7 B;  1SS1 A;  1JM0 A;  1U7M A;  4NPD A;  4NPE A;  1S3J A;  1LT1 A;  2I8D A;  3FXD A;  4IOI H;  4CPG A;  2OTK E;  3MHV A;  2WMM A;  2KZJ A;  4ZNC A;  3MZW B;  5DJU B; 
#chains in the Genus database with same CATH topology
 5KLI C;  2E42 A;  3G4S P;  1IFP A;  3HD7 A;  1IFN A;  1JTH A;  3KQG A;  1NTK G;  2A06 E;  2KUB A;  3C8V A;  1OFC X;  2IBZ E;  2RKL A;  3VTP C;  2WZ7 A;  3BRT B;  1T6A A;  1SQX K;  2OGU A;  2ZYG A;  1DD3 A;  1L0N G;  4H13 B;  1H89 A;  1FZE A;  3M06 A;  1KQS O;  3FWL A;  3CI9 A;  1NTK D;  4GKG A;  1DEB A;  3AE3 C;  2ZVO B;  2FBW C;  1NTK J;  3H32 A;  3TYY A;  1L0N D;  2L91 A;  1FAV A;  3L71 E;  1L2P A;  3E1R A;  1SQP G;  5K5G B;  2PAJ A;  3TGU G;  1L0N J;  1Z56 A;  3CCL P;  1EXJ A;  1JY2 O;  2Q3I A;  3RK2 C;  5KAI H;  1FS0 E;  2FYN B;  1DX7 A;  2N1T B;  1SQP D;  1KOR A;  3Q3D A;  3TGU D;  2ZYD A;  1MZ9 A;  3NMD A;  1CZQ A;  1SQP J;  1EZV G;  1OXZ A;  2JWD A;  2B87 A;  1JY3 O;  3E7K A;  5GTI E;  1S5L E;  1SQX J;  1KYO D;  3CX5 H;  4C7N A;  5APW A;  1H88 A;  1L0L E;  1USD A;  4C7R A;  2JO1 A;  4JYC A;  1EZV D;  1FZG A;  3CMA P;  3BAS A;  1N2D C;  1M56 D;  1SQX E;  2KNC A;  3KXD A;  3CXH D;  4AQR D;  3PH0 A;  3CME P;  1VQ4 P;  3WUU A;  2B89 A;  4Y99 C;  2C9L Y;  4H44 C;  3U59 A;  2FY8 A;  2KYV A;  1VQO P;  2OYO A;  4I7Z C;  5GTH H;  2J59 M;  3AE7 C;  3HE4 A;  2QJK B;  2C0X A;  1FDM A;  3JCU E;  2YMY A;  5TJH A;  2WPS A;  4WY4 D;  5CCH D;  1FZB A;  3B4S A;  1SQB G;  1EDK A;  4W7Z A;  2BEZ F;  3GLM A;  3L4F A;  5APX A;  5L8R J;  4KT0 J;  3LID A;  2G8Y A;  2A45 G;  5TIS E;  2W6A A;  1ZRT D;  5APQ A;  3L35 A;  3VMZ A;  1JY2 P;  1SQB D;  4GOE A;  5M1B A;  4O9B A;  1NU1 K;  5E79 H;  1FU1 A;  1JB0 J;  1SQB J;  3B5N D;  2QG4 A;  2GUV A;  5AVV B;  1LTG C;  1M1K Q;  2HYN A;  1VQ7 P;  2OAR A;  5B66 H;  1ZXG A;  1NTM K;  4IFD K;  4I1L A;  4GIF A;  1GU5 A;  1ZLL A;  3S4R A;  3L75 G;  2JDI H;  1GZL A;  2QJK C;  1Q86 Q;  2PGD A;  4JYB A;  2C9N Y;  1HBW A;  3GF3 A;  2NPS A;  2QRX A;  3AE6 C;  3GW6 A;  1GL2 B;  1OVU A;  2I1K A;  3PJS K;  1SFC C;  2WSF J;  1KIL B;  3L75 D;  1T2K D;  1P84 H;  1SFC A;  3G6E P;  1EC5 A;  1NTM G;  1VF5 D;  5CMZ A;  3L75 J;  2IFN A;  1PPJ E;  3M91 A;  3FXE A;  3MUD A;  4YTP C;  1AA0 A;  1NU1 J;  2XV5 A;  4K35 A;  4ASV A;  2P10 A;  2YIU C;  2GUS A;  2FXM A;  1NTM D;  4GT1 A;  2YO3 A;  3VN0 A;  3IAO A;  5AVQ B;  1NTM J;  1EZV I;  3BAT A;  4HJG H;  3F5H A;  4HB1 A;  2FFD C;  4EIJ A;  3L73 E;  2AEJ A;  4OVN F;  5CJ0 A;  1BCC G;  3CXH I;  2ITA A;  1YJ9 P;  2HPC B;  1WRG A;  1NKN A;  2FFD A;  2OTK E;  4H0L B;  1AVO A;  3MZW B;  2K9J B;  4IL6 H;  3RK3 B;  1RHZ B;  2Q1K A;  3T97 B;  1YBK A;  3KHU A;  1HF9 A;  5APV A;  1BCC D;  1M57 D;  4WY4 C;  5CCH C;  2YXQ B;  3H1K J;  1RF0 C;  1BCC J;  3R2P A;  1RQU A;  5CCH A;  1YJN P;  1GK6 A;  1Y8A A;  1RF0 A;  1S4X A;  1NAF A;  2LXB A;  1FOS E;  1DEE G;  4B86 A;  3Q2Y A;  4L76 A;  2YXR B;  3L70 E;  2ZXX A;  2POH A;  3A0B H;  5APY A;  3HE5 A;  3B5N C;  4PD4 E;  1UII A;  4TLF A;  3GMA A;  2Q7C A;  3B5N A;  3AEF C;  3WMM 0;  4A7P A;  1AV1 A;  1SVF A;  3F89 A;  4LC1 A;  1JMB A;  4Y28 J;  2Z4E A;  2A45 I;  2LXC B;  2ZAE B;  2JWA A;  1E5W A;  1N7L A;  1OVV A;  1DD4 A;  1JNM A;  2K9Y A;  2H43 A;  1FZC A;  3D71 A;  1T2K C;  2Y9Z A;  2YMK A;  3CWB D;  4JF7 A;  1VF5 C;  3RL0 C;  2BAS A;  3LW5 J;  5AW4 B;  2RH0 A;  3CWB J;  3P8C D;  3CCV P;  2K88 A;  4XFJ A;  1KB9 D;  1J1E B;  3AEE C;  1XTG B;  1PP9 E;  5KAF H;  1FC2 C;  1LTB C;  1K05 A;  3BCC G;  1QGK B;  2WSC J;  1L4A A;  1H0T A;  5AW9 B;  3WU2 H;  2XU6 A;  3NFQ A;  5AVX B;  3V5B A;  1P84 I;  3HUS C;  4GOD A;  4PV1 B;  1NWQ A;  2KS1 A;  3BCC D;  1PZQ A;  2HG5 D;  2V7Q J;  4EDF A;  2KZI A;  1K9M Q;  3HUS A;  2QJP B;  1ZV8 A;  5KAF E;  3BCC J;  2W6B A;  3CC4 P;  2KOG A;  3SSU A;  1FBM A;  3KDP B;  1YQ3 C;  2XDJ A;  1RH5 B;  2ZJS E;  2O1K A;  5AW6 B;  1BE3 G;  2E75 B;  4EI2 A;  1CW5 A;  1LTT C;  1FZF A;  3H1J J;  4NPD A;  2GM4 A;  4YXW H;  4U3F J;  1R8E A;  3ITK A;  3USS A;  3KPE A;  3M9H A;  2E43 A;  1BE3 D;  1Q90 D;  2VRS A;  2M0B A;  3JSV C;  3H1J E;  2QM7 A;  1HJ0 A;  1AJY A;  2N1T D;  3G3Z A;  1H8A A;  2Y9Y A;  1RQV A;  5KKZ B;  3AE9 C;  1AVY A;  4YXD C;  2P2U A;  3FX0 A;  4DZO A;  1YIT P;  1RF1 B;  1KQG B;  1Q2N A;  2WQY C;  3GHG B;  2OTJ P;  4K3A A;  5AW1 B;  2OYI C;  1SQP K;  4KJM A;  1BSH A;  5C39 A;  4D6T D;  2R3C A;  1Q81 Q;  2OYI A;  3V4W A;  1OW7 A;  2M5A B;  3C9I A;  3M9Q A;  1KZU B;  3QH9 A;  4D6T J;  2KSJ A;  2QJY B;  4U7J A;  2QE7 H;  3IR9 A;  4C7N B;  1GDT A;  4RJT A;  3WUV A;  1HGZ A;  1A02 F;  1M1J C;  1VPC A;  1M1J A;  5GTI H;  1S5L H;  4BRY A;  5KKZ C;  3V6I A;  1NTK E;  1WMK A;  1U7M A;  1ZOY C;  4NPE A;  1KB9 I;  4IOI H;  1RF1 C;  2XNX A;  2WMM A;  1MV8 A;  2WT7 A;  1L0N E;  2CK3 H;  1YTZ I;  1N8R Q;  1IZN B;  3M0D C;  3TGU J;  1PGP A;  1YHQ P;  3VMX A;  2KP8 A;  2B88 A;  4H13 C;  3TNU B;  3M0D A;  3L74 G;  1IK7 A;  1EXI A;  1EDL A;  2KK7 A;  3V2R A;  2IZ0 A;  1SQP E;  4IFM A;  4YPC A;  5KLV G;  3Q5S A;  1LP1 B;  3A7O A;  1PIX A;  1VQ6 P;  1CI6 B;  1S5L X;  1OWA A;  3ABV C;  1WT6 A;  3L74 D;  1T3U A;  3CX5 D;  1SQB K;  2LKM A;  2Q5U A;  1KYO E;  3KZI E;  3JCU H;  1USE A;  2NRG A;  3L72 G;  5KLV D;  2MJZ A;  3H1H G;  4R4L A;  1ZP0 C;  3Q5R A;  4ASW A;  1EZV E;  3QWO C;  5KLV J;  5AW2 B;  1M7L A;  1JOC A;  3PHL A;  2FYU K;  5TIS H;  2FYN C;  2N1T C;  1K04 A;  3CXH E;  1LT9 B;  1S9K D;  2HLO A;  3L72 D;  2N1T A;  1VDF A;  3H1H D;  1S1C X;  1GL2 D;  3PLN A;  4N6J A;  4OWF A;  1KIL D;  3L72 J;  1JM0 A;  3AE5 C;  2FKW B;  1JMM A;  1SQQ G;  4C46 A;  1IFD A;  1KN7 A;  3SWY A;  1N73 B;  4RO0 A;  3OW2 O;  1BGY G;  2FYU G;  2ZVN B;  1VQN P;  3G9R A;  3HTK B;  3H25 A;  1SQQ D;  2KIK A;  4EYY Q;  2M3E A;  5CJ4 A;  4R4M A;  3CL3 D;  1SQQ J;  2WPV B;  1BGY D;  2FYU D;  4LGD E;  1JY3 P;  1ZRT E;  5DJT B;  4H0L D;  1NJI Q;  1BGY J;  2FYU J;  1SQB E;  3RK3 D;  2E76 B;  5BU5 A;  2O01 N;  1T8Z A;  1MKM A;  2Q3E A;  3U1A A;  3CCJ P;  3I55 P;  5AW5 B;  3VP8 A;  1OX3 A;  3UIA A;  2P7J A;  1JY2 N;  2FXP A;  1LTJ B;  1IFJ A;  1N73 C;  1YYC A;  1GW4 A;  4QMA A;  1PL5 A;  1G2C B;  2W8Z A;  2OTL P;  1QVG O;  2SPZ A;  1GMJ A;  2J5U A;  2PRR A;  3MTU E;  3CCQ P;  2D2C D;  3I5C A;  1JY3 N;  4L75 A;  5APT A;  1N7S B;  1W2B O;  2OYH B;  1IC2 A;  1LT1 A;  1PFI A;  4CPG A;  1VL2 A;  2JR8 A;  3L75 E;  2KZJ A;  1P84 D;  1NTZ G;  1W2E A;  3WUT A;  3O8Z A;  1AFO A;  4AYC A;  1OZH A;  3VYI A;  3AE1 C;  1IK9 A;  1SQV G;  1NU1 E;  1HWT C;  5AW8 B;  1KFN A;  1IJD B;  3Q1M A;  2FXO A;  5AW0 B;  1QLE D;  3SWK A;  1NTZ D;  3CX5 I;  1FOS F;  2HOD B;  2KB7 P;  2WSE H;  2K37 A;  1NTM E;  5CHX A;  2E5Y A;  3H1L G;  1GU4 A;  1SQV D;  1NTZ J;  1GL2 C;  1LNQ A;  2UWJ E;  1KIL C;  1KFM A;  3VMY A;  3A5T A;  4MN4 C;  4PD4 H;  1M8O B;  1DH3 A;  1EDJ A;  3D6Y A;  2AEM A;  4WY4 A;  3RBX A;  4ZMD A;  3H1L D;  2YNY A;  1YI2 P;  4JPZ B;  1G1I A;  3H1L J;  3MGN A;  1NO4 A;  1XTC C;  3H1K E;  5AVW B;  1BCC E;  4GDO A;  2IYO A;  2H88 C;  2D2C B;  3A2A A;  3KYQ A;  2WPQ A;  4OGQ D;  4IL6 X;  2IPP A;  2W83 C;  1OW8 A;  2NZ2 A;  1GTW A;  5CCG D;  1NGM B;  4PV1 D;  4H0L C;  2HPC A;  1URQ D;  3TSI A;  2O01 J;  3RK3 C;  1SP4 A;  2K9J A;  1KD1 Q;  4BXL A;  1UIX A;  4UB6 H;  3T97 A;  1TU3 F;  1ZR2 A;  1NKZ B;  1OMI A;  3AE2 C;  2BCC G;  1YIJ P;  2IDB A;  2QEX P;  3HD7 D;  1QX8 A;  1PP9 G;  3G71 P;  2QIW A;  1LWU B;  2E75 D;  3TDK A;  2DW3 A;  5KJ7 D;  2JEE A;  2AXT E;  2BCC D;  3EWK A;  4HKZ H;  1RY3 A;  1KQF B;  3OJA B;  1NH4 A;  2WSC H;  4UB6 E;  2BCC J;  1IFM A;  5AVS B;  1JUN A;  5AVZ B;  1FJP A;  3MD0 A;  3H1I G;  3CC2 P;  5APS A;  2R5D A;  3CWB E;  4OGQ B;  2KSE A;  1NOH A;  2R32 A;  1GD2 E;  2LR2 A;  3H1I D;  3O6Q B;  4N78 D;  3B71 A;  2I1J A;  1URQ B;  1EDI A;  1PGO A;  5B5E E;  1QL2 A;  3H1I J;  2KI7 B;  3BVH A;  3CCE P;  1PV3 A;  3AE4 C;  1LWU C;  1YQ4 C;  1D7M A;  3OAK A;  1X79 B;  1DIP A;  2RMZ A;  3HD7 B;  1JTH B;  3BCC E;  4WWI A;  5KLI B;  5APU A;  2JP3 A;  1NVO A;  1J1E C;  5CBN A;  1K8A Q;  2FYZ A;  3OA7 A;  3V2P A;  1JO5 A;  3RBZ A;  2L5G B;  2CPS A;  3A0H E;  1G1J A;  1OW6 A;  1QL1 A;  2A06 G;  3RL0 g;  4I2L C;  1MFZ A;  2IBZ G;  1BE3 J;  4EOT A;  4U3F E;  3H32 B;  5CCG C;  1KV4 A;  3P7K A;  4PV1 C;  1URQ C;  4L73 A;  2ZT9 D;  3SFD C;  3L37 A;  2WWW A;  2QJP C;  2B9B A;  4DCK A;  2QA4 P;  2A06 D;  1HVV A;  2IBZ D;  3ZDM A;  3CD6 P;  3TF5 A;  4PJ0 E;  3RK2 B;  3L71 G;  3NXS A;  3EQ2 A;  2E75 C;  2BEQ D;  2K1A A;  1Q82 Q;  1L0L K;  4UB8 E;  5KJ7 C;  2B87 B;  2K3R A;  1GW3 A;  5KJ7 A;  3PRJ A;  1S3J A;  3I56 P;  2I8D A;  2XKM A;  1FDO A;  1PGQ A;  3L71 D;  2WIT A;  3MHV A;  4D6T E;  1FDI A;  3L71 J;  3C1L A;  2KNC B;  1JCC A;  4LLH A;  1RE4 C;  1OIP A;  5KLV K;  2N9B A;  1LTS C;  4GOF A;  1L0L G;  1RE4 A;  2E74 D;  2Y0E A;  1HTL C;  3GHG C;  2JKV A;  4RKU J;  1RF1 A;  2IX7 C;  3FWN A;  3GHG A;  2ZT9 B;  1SQX G;  1A02 J;  1KYO H;  3KZI H;  4Y99 B;  2IYP A;  2HFE D;  3HRN A;  1L0L D;  2NPS D;  1K73 Q;  4H44 B;  3A3Y B;  2JJL A;  2M5A A;  3MP7 B;  2Z5I A;  4WVZ A;  3HE4 B;  1L0L J;  2P58 A;  4I7Z B;  1VQ5 P;  1U7J A;  2QJY C;  1SQX D;  3TGU E;  1VQP P;  1R5L A;  3CCR P;  3CXH H;  1SFC D;  2ZXE B;  5EFW B;  4N3Y B;  3L36 A;  2CPB A;  2O3J A;  5KAI E;  2PP6 A;  2ZYA A;  2HR3 A;  1SQQ K;  1HH0 A;  3L74 J;  4I6M C;  2E76 D;  3E1I A;  2R5B A;  1E79 H;  4HH2 A;  3K5B A;  1S72 P;  3L74 E;  1QEX A;  5DJU B;  3CX5 E;  2ZT9 C;  2QVA A;  1JEK A;  2E74 B;  5KLV E;  3H1H J;  3TNU A;  1AQ5 A;  3JC2 2;  1S9K E;  3CPW O;  2NPS B;  3IF4 A;  3L72 E;  3SWF A;  1N7S D;  1LGH B;  3H1H E;  3CCS P;  5AVY B;  2IBZ I;  3V2Q A;  1LP1 A;  1KIL E;  1CI6 A;  1NYH A;  2QM8 A;  1KTM A;  3R4Y A;  2A45 H;  3EFF K;  2M8R A;  1SFC B;  3GF7 A;  3AEC C;  2Q9I A;  1BSN A;  1VQM P;  4DJG A;  4W7Y A;  4W80 A;  1RE3 C;  5AW7 B;  2KXP B;  2H7H A;  4JBZ A;  3S9O A;  1KMI Z;  5GTH E;  1YTZ T;  5H2F H;  1RE3 A;  1LT9 C;  2R44 A;  1SQQ E;  2IFM A;  1LT9 A;  2YIU B;  2P1J A;  3B8E B;  2E74 C;  3M0A A;  4XA4 A;  2WSF H;  3IFM A;  1J1D B;  4IFF A;  1PPJ G;  1BGY E;  2FYU E;  1NTZ K;  1T3J A;  3SFE C;  1SS1 A;  2M3B A;  3U1C A;  2FFD B;  1SQV K;  4WB4 A;  3CC7 P;  2NPS C;  1Q7Y Q;  1R5S A;  2J58 A;  5H2F E;  2WSS H;  3RK3 E;  2KLV A;  5E79 E;  1PPJ D;  1N73 A;  3P8M C;  3MIW A;  1NU1 G;  2W90 A;  3CCM P;  3L73 G;  3AEB C;  4M3L A;  3NTN A;  3AEA C;  5BVZ A;  1HGV A;  3HTK A;  5B66 E;  4WY4 B;  3AED C;  1HJB A;  3RL0 D;  1VQK P;  2XZR A;  2AXC A;  3MUD C;  3RGU A;  1EQ7 A;  1W5C E;  1NU1 D;  4AUW A;  1X9V A;  2YKQ A;  3L73 D;  4ZKP A;  1NHL A;  2W27 A;  2E76 C;  3N7N A;  2C0W A;  3L73 J;  1KYO I;  2O1J A;  1L4A D;  1ZME C;  2YKO A;  1ZN5 A;  3HE5 B;  3M9B A;  4RES B;  1VQL P;  1J1D C;  5AVR B;  3B5N B;  1P84 E;  3TK1 A;  1IFI A;  3H1K G;  1LTJ C;  3V4Q A;  3CLQ A;  2R3S A;  1GL2 A;  2AEF A;  1SQV J;  3L70 G;  1KC8 Q;  2YKP A;  3AE8 C;  1LTJ A;  1SLQ A;  1KIL A;  1GK4 A;  5AW3 B;  1QVF O;  1NTZ E;  1G2C A;  2WTY A;  1LTA C;  2Y0C A;  3H1K D;  4DOJ A;  1YJW P;  1N7S C;  1SQV E;  2OYH C;  2WSE J;  2ZFC A;  3L70 D;  3W68 A;  1FZC B;  2GA1 A;  1N7S A;  2OYH A;  3PTZ A;  1HUC A;  4PD4 D;  3L70 J;  2RN0 A;  1OVR A;  3VMA A;  3D6Z A;  5BU8 B;  2QSI A;  3H1L E;  1AQT A;  2O01 H;  4IL6 E;  1VF5 B;  3RL0 B;  3FGA D;  3AEG C;  5AVT B;  1Y47 A;  2AXT H;  3CCU P;  2HOD A;  4XE5 B;  4NPF X;  1PGJ A;  1L4A B;  1MUU A;  3P32 A;  1H0T B;  2G3A A;  2KLU A;  3LW5 H;  2W6J H;  2KS1 B;  4HYT B;  3PP5 A;  2WVR A;  1ZR4 A;  3CWB G;  3HUS B;  3A0B E;  3II6 A;  1IO4 A;  1FZC C;  5KTB A;  1KB9 H;  1X22 A;  2D2C C;  3EFG A;  4DT0 A;  1PP9 D;  2Z5H A;  4JQ0 D;  5B5E H;  1PP9 J;  1VQ9 P;  3VP9 A;  1S2E A;  3GG2 A;  2XND H;  2BCC E;  2V7Q H;  3P8C E;  3FXD A;  2P67 A;  1L4A C;  1LTI C;  4TT3 H;  1KB9 E;  3VOP A;  2H8P D;  2V4H A;  2Q6Q A;  3RK2 D;  3LIE A;  1VQ8 P;  1X0T A;  1BDD A;  2H89 C;  4Z1M H;  1ZW0 A;  2WPR A;  3A0H H;  5AVU B;  1LWU A;  1FZA A;  1M90 Q;  3V2N A;  3H1I E;  4WBA A;  3H1J G;  4N78 E;  3Q5P A;  4U3F G;  3W67 A;  5CBO A;  2N9Y B;  1N86 A;  4H13 D;  2IZ1 A;  1BDC A;  1J2J B;  2OYI B;  3WU2 E;  1JCD A;  2YO2 A;  1NAY A;  3H1J D;  4OGQ C;  2MKV A;  3D70 A;  3BRV B;  2OQQ A;  2Y0D A;  4U3F D;  2E5T A;  4PJ0 H;  4L74 A;  3N4X A;  1KQL A;  1NTK K;  1FJK A;  4PD4 I;  4OH8 B;  4UB8 H;  4ZKU A;  5CCG A;  1MFT A;  3S1K A;  3O6Q A;  4KHX A;  1FE6 A;  3H6P A;  2PFX A;  1M1J B;  1URQ A;  4BRY B;  1L0N K;  1BE3 E;  4H44 D;  1Y9B A;  1U57 A;  1LJ2 A;  3IN6 A;  4BWN A;  4D6T G;  1X8Y A;  1CSB A;  2WT7 B;  3HD7 C;  4ZNC A; 
#chains in the Genus database with same CATH homology
 2Q1K A;  2QVA A;  4BXL A;  4WWI A;  2M0B A;  1ZXG A;  1NVO A;  2KUB A;  1X0T A;  5CBN A;  1BDD A;  2RKL A;  2KIK A;  3PH0 A;  2B88 A;  1Y47 A;  4EYY Q;  1ZW0 A;  4GOF A;  1FC2 C;  3RGU A;  1EDL A;  4NPF X;  1Q2N A;  2LXB A;  1H0T B;  2B89 A;  2QRX A;  1H0T A;  4K3A A;  2UWJ E;  5DJT B;  1DEE G;  1LP1 B;  5CBO A;  4HKZ H;  1LP1 A;  1OVU A;  4KJM A;  1OVR A;  4MN4 C;  5C39 A;  1BDC A;  1EDJ A;  2M5A B;  4ZMD A;  2KS1 B;  2M5A A;  1EC5 A;  4GOD A;  5K5G B;  2P58 A;  1U7J A;  2KZI A;  3FXE A;  4JBZ A;  4ASW A;  3ZDM A;  3QWO C;  1EDK A;  5EFW B;  4K35 A;  4ASV A;  1JMB A;  2R44 A;  2LXC B;  2ZAE B;  2LR2 A;  1MFT A;  3S1K A;  2SPZ A;  2HR3 A;  1EDI A;  2B87 B;  2JWD A;  4GOE A;  2B87 A;  1OVV A;  2K3R A;  4HB1 A;  4HJG H;  2KI7 B;  1SS1 A;  1JM0 A;  1U7M A;  4NPD A;  4NPE A;  1S3J A;  1LT1 A;  2I8D A;  3FXD A;  4IOI H;  4CPG A;  2OTK E;  3MHV A;  2WMM A;  2KZJ A;  4ZNC A;  3MZW B;  5DJU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...