5DJTB

Crystal structure of lov2 (c450a) domain in complex with zdk2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
59
structure length
59
Chain Sequence
SVDNKFNKEMLSARVEIYGLPNLNWGQRFAFISSLTDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title LOVTRAP: an optogenetic system for photoinduced protein dissociation.
pubmed doi rcsb
source organism Avena sativa
molecule tags Signaling protein
molecule keywords NPH1-2
total genus 22
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2015-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5djtB00
1EDLA 1H0TB 2UWJE 4IOIH 4WWIA 2M5AA 1NVOA 2SPZA 4GODA 1EDJA 2R44A 2RKLA 2HR3A 1ZW0A 1Y47A 1JMBA 2KUBA 4NPEA 3QWOC 4JBZA 2B89A 2B87B 1EDKA 4HB1A 4GOFA 1FC2C 3S1KA 1JM0A 2K3RA 2QRXA 4ZNCA 1OVRA 4ZMDA 4NPFX 1H0TA 3FXEA 1LP1B 4MN4C 1EDIA 5K5GB 5DJUB 2LXCB 1Q2NA 4CPGA 2Q1KA 4BXLA 2JWDA 3MZWB 1BDDA 3PH0A 3ZDMA 2LR2A 3MHVA 2LXBA 2KZJA 2KI7B 2B87A 4NPDA 5CBOA 1S3JA 2ZAEB 1SS1A 1X0TA 1OVUA 5C39A 1LP1A 3RGUA 4GOEA 4K35A 4K3AA 1ZXGA 2WMMA 4HKZH 1U7JA 1EC5A 1BDCA 1MFTA 2M0BA 5EFWB 1OVVA 1U7MA 2OTKE 2I8DA 1LT1A 2KS1B 2P58A 4ASWA 2M5AB 1DEEG 4ASVA 2KZIA 2KIKA 3FXDA 2QVAA 5DJTB 5CBNA 4KJMA 2B88A 4EYYQ 4HJGH
chains in the Genus database with same CATH superfamily
1P84H 5CJ0A 5L8RJ 1LTBC 2J58A 2WPQA 3RL0g 1NTKJ 3CX5I 4M3LA 1M57D 2IBZI 2Y9YA 4EOTA 3AEAC 1JMMA 2KB7P 1OZHA 3G9RA 4DT0A 2P2UA 3L71J 2JO1A 2UWJE 5AW0B 3TDKA 3L72J 1HWTC 2XNXA 3H1LJ 2FXOA 3A0HE 3ABVC 3L71E 3TYYA 1SQXK 4D6TG 1GTWA 1NTMK 2M5AA 2Y9ZA 4WY4A 1MKMA 1NVOA 3P32A 3Q5PA 2XZRA 1FOSF 4QMAA 5CCHD 1EDJA 4W7ZA 2R44A 3H1JE 3VMAA 3Q2YA 5AVVB 1JY2O 3TNUB 1PGOA 1ZW0A 1JMBA 1G2CA 2KUBA 1S4XA 2D2CB 1M1KQ 4IL6H 1RF0A 2D2CD 2GA1A 1N73A 3H1LE 1BCCE 1E5WA 1ZOYC 2WVRA 1NTZJ 3E7KA 3H6PA 4LLHA 5AW1B 3A2AA 2WT7A 1NTZD 5APTA 1QEXA 1SQXD 2BEZF 2KYVA 3B5NB 3OA7A 3GF3A 3PHLA 2PAJA 2Y0EA 1Y9BA 1EXJA 1ZLLA 3JCUE 1LWUA 3C9IA 3O6QA 3JCUH 1JM0A 3CCMP 2K3RA 2QRXA 1SQBD 4JYCA 5KLIC 3V2QA 4NPFX 3CLQA 2ZVNB 1GW4A 1KQLA 1ZP0C 3IAOA 1Q82Q 1IFJA 3H1KG 2QIWA 1K8AQ 3BATA 4MN4C 1A02J 4PJ0H 1OW8A 2MJZA 2QSIA 3L72D 4WY4D 4CPGA 1IJDB 3KPEA 1PGJA 5AW4B 3E1IA 3MZWB 3CWBD 3IFMA 4H44C 1VQ7P 1JY2N 1KFMA 4EI2A 3VN0A 3R2PA 1GW3A 3M9BA 4OVNF 3CMEP 4B86A 1ZRTD 1FZFA 1N73B 1VDFA 1H0TB 2NPSC 4GIFA 1FZGA 2HPCB 3G6EP 1VQ5P 3EWKA 3FWLA 2C9NY 2WSSH 2QG4A 2P1JA 1BGYD 3RK3E 4PV1C 1NTME 4UB6E 3E1RA 2O1JA 1T6AA 2E5YA 3H1KJ 3HTKA 1NU1K 3O6QB 2OYHC 2WSCH 2W8ZA 1LT9C 1G1IA 5APVA 1KFNA 2J5UA 2POHA 4EIJA 3CC7P 4O9BA 2GUVA 1NH4A 2HFED 2O01H 1IFPA 5KTBA 1RF0C 2FXPA 3AEDC 1FZBA 2FFDC 1W2BO 3L72G 1N73C 3CXHI 1H8AA 4IFDK 4HYTB 2QJYC 2NPSA 3CX5E 2JR8A 2IBZE 3Q5RA 3AE3C 2K9JA 1YTZI 2FYNB 3N7NA 3CCLP 1FE6A 1J1EC 1SQPG 1HUCA 3HE4A 3T97A 3I55P 1HGVA 1PL5A 2E74D 3QH9A 1FZCB 5AW9B 3WMM0 2HODA 1RY3A 2YMKA 3CCVP 1SFCB 1RE3A 2M0BA 1BDCA 1JB0J 1GL2A 2K1AA 4DJGA 1SQBK 3L74G 5AVQB 1SQQG 1FZAA 2OTKE 3P8CD 1N8RQ 2KS1B 2OGUA 4WB4A 5BU5A 4ASWA 3OW2O 1LGHB 2OYIC 3HTKB 1KMIZ 2KLVA 5CCGD 5GTIH 2PRRA 1K73Q 3EFGA 2KZIA 3AE4C 3KDPB 2W6BA 3H1LG 1LWUC 1NTZE 2Y0CA 3F5HA 1E79H 3FGAD 3FXDA 3A0HH 3L73J 1T2KC 1OIPA 2QVAA 4OGQB 2L91A 4C46A 4L75A 3CXHE 2NRGA 5M1BA 1KV4A 1OW7A 1Z56A 3GF7A 5CCGC 1BE3E 2KLUA 3MGNA 4KJMA 5KJ7C 3AEFC 3KXDA 3H1JG 3RBXA 2BCCG 3U1AA 3A7OA 3MD0A 4YXWH 1L0LD 4PV1B 2B88A 2NPSD 4EYYQ 1JUNA 1RE4C 4JQ0D 4R4MA 3HE4B 1AJYA 1GL2C 3RK2D 5B5EE 4H13C 1FDIA 1RE3C 2XNDH 4YTPC 1NTMJ 2K88A 2QEXP 1RF1C 1KILD 4PD4E 3W67A 1EDLA 3USSA 2FXMA 1NAFA 4WY4C 1SQPE 4H44B 1Q86Q 1DEBA 3MTUE 1URQB 1LTJB 1YTZT 4H44D 2BASA 3M0DA 1SLQA 4KHXA 5AVSB 3D71A 2HPCA 4GODA 3CX5D 2QJKC 2IBZG 3KZIE 1SQQD 1L4AD 2JP3A 1SP4A 2KNCB 2OQQA 3H32B 3RL0D 3TGUJ 5BU8B 2HR3A 1L0NK 2ZXEB 1GK6A 2IZ1A 1KYOD 3HD7A 5CJ4A 1GK4A 1DD3A 2IPPA 4GDOA 4H0LD 4IL6X 4JBZA 4RO0A 3PP5A 1PGQA 3G71P 2W27A 1VQ8P 2OYHA 1M56D 1L4AC 1X9VA 2XV5A 2ZT9C 1GD2E 1PZQA 4HB1A 4GOFA 1FC2C 1LTIC 1W5CE 1VQLP 3FWNA 4XFJA 2OYOA 3S1KA 1EZVD 2OYIB 3CCUP 5GTHE 1VQNP 1J1DC 3VMXA 2AEFA 1HGZA 2Q6QA 2OTLP 1H0TA 1NYHA 1KILA 1LP1B 2R3CA 1JY3N 4LGDE 1JNMA 3L74J 1EZVI 3AE1C 4I7ZC 1EDIA 2WPVB 3PTZA 1GDTA 3CCEP 2YKPA 4D6TJ 5KJ7D 2PFXA 3BCCJ 3VMYA 1SQPJ 1M7LA 1P84D 3L75D 2JWDA 3L75G 2N1TD 1H89A 3PRJA 1S5LH 4JF7A 1Q7YQ 5KAFH 2Z4EA 2QJYB 1QGKB 2O3JA 1BGYE 3H1KE 3MP7B 3NXSA 4H0LC 3IN6A 2LR2A 3MHVA 5AW3B 3RK3D 1JOCA 3B4SA 1HTLC 3F89A 5H2FH 2KP8A 3HE5A 2KI7B 3V2PA 1KB9H 2BCCJ 2YKQA 1YI2P 2DW3A 2E75B 2ZT9D 2E76B 3CX5H 3WU2H 1Q81Q 2N1TC 3IF4A 5CBOA 1PIXA 1VPCA 1QX8A 2KSEA 5AVZB 1S3JA 1VF5C 3M91A 4YXDC 2FFDB 1BE3D 4AYCA 1S9KE 1L2PA 1N7SC 1P84E 1SS1A 1X0TA 3C8VA 4L76A 3TGUG 2OYIA 3OJAB 3CWBJ 1JO5A 5C39A 1M1JC 2XKMA 1HH0A 1NHLA 1EZVE 1L0ND 2JWAA 2QM8A 1X8YA 3AEBC 3HUSC 3JSVC 3RGUA 1YITP 4N3YB 1EXIA 1LTSC 3H25A 5APWA 1K9MQ 2XDJA 2FY8A 4HH2A 4PD4I 3G4SP 4Z1MH 1OMIA 2WMMA 3M06A 4TT3H 5KKZB 2KXPB 3NTNA 3GG2A 2JDIH 5AW2B 5GTIE 3AEGC 1MFTA 4Y99B 1JCCA 1XTCC 3HE5B 4I1LA 1SQXJ 2NZ2A 2Q3EA 3B5ND 1BCCD 1SQBG 1KQFB 3TSIA 2IDBA 1SQQK 3AE5C 4LC1A 5B5EH 4L74A 1A02F 4PJ0E 4DZOA 4Y28J 1VF5D 5KAIE 3CPWO 2N9BA 1P84I 5APXA 3H1IG 5KLVK 2Q7CA 1DEEG 2YXRB 2WSFH 2FYUD 4ASVA 5KLVD 2FKWB 2KIKA 3B5NC 3B8EB 3CCSP 3VOPA 1JY3P 2R5BA 3L74E 4PV1D 1YIJP 2HYNA 1ZN5A 4KT0J 1NU1D 2A45I 3OAKA 4OH8B 1FDOA 2LKMA 5CCHA 1BGYJ 2D2CC 2IYPA 2QJPB 4I2LC 1SQPD 2ZYGA 4PD4D 2V7QJ 1NKZB 1NTKD 1YYCA 4HJGH 3T97B 2I1JA 5AW8B 2QM7A 1S1CX 2RH0A 1GU4A 1FZCA 1M1JA 5TISH 1QL2A 1SFCA 3GHGC 3L74D 1T3JA 1VQ6P 1L0LE 1M8OB 1EQ7A 1JY3O 1N7SA 2IFMA 1D7MA 1UIXA 4U3FE 2JJLA 2YO2A 3CL3D 3G3ZA 4IOIH 3WU2E 4DOJA 1FJKA 1KYOH 1MZ9A 1N7LA 1KYOI 1KZUB 2YKOA 3H1ID 3L72E 1OWAA 3B71A 1R8EA 1OX3A 3KHUA 3RK3C 3AEEC 2WSEJ 1Y8AA 2RKLA 4TLFA 1MFZA 1PV3A 3Q5SA 3BVHA 4C7RA 1VQ4P 1G1JA 4RKUJ 4JPZB 1AFOA 1Y47A 3L70E 2ZFCA 1RHZB 4NPEA 1URQC 2FYZA 2FYUG 1PPJG 3PJSK 1CSBA 1KN7A 2B89A 3EFFK 2B87B 3LW5H 2C0WA 2CK3H 1EDKA 3TGUD 1SQQE 3HRNA 4U3FG 2E74B 3NMDA 1WT6A 1FZEA 2Z5HA 4UB6H 5APYA 3SWYA 1NKNA 1K04A 5AVWB 5CHXA 2R3SA 1L0NG 1ZMEC 2ITAA 1W2EA 1S2EA 2C0XA 3K5BA 1YHQP 4ZNCA 3H1HE 1OVRA 3KQGA 3NFQA 1N7SB 2AEMA 4RJTA 3FXEA 1ZV8A 2W6JH 1NOHA 4L73A 1DD4A 4U7JA 2M3BA 2B9BA 5AVUB 4H13D 2CPBA 3V2NA 1URQA 2N1TB 2XU6A 1SQXE 1USEA 2A45G 2E5TA 1IFNA 2G8YA 3FX0A 1AA0A 3L70G 3W68A 1OFCX 3RK3B 5K5GB 5DJUB 3AE9C 4DCKA 1VQMP 1LTGC 1Q2NA 5E79E 1PFIA 1WMKA 3L71D 1M90Q 1N2DC 3H32A 5APSA 4BXLA 1FAVA 2I1KA 5KLVG 2WSFJ 1T2KD 2IFNA 3PH0A 1IK9A 2RMZA 3KYQA 3M0AA 3P8MC 1BE3J 1LTTC 3V4WA 2QA4P 1ZR4A 3H1JD 3P8CE 1H88A 1IFIA 2LXBA 3MUDA 1SQPK 5CMZA 3RL0C 3BCCG 2KZJA 2B87A 1YJ9P 3L75J 2BCCD 4NPDA 2H89C 1XTGB 1X79B 1YQ3C 3M0DC 1PP9D 3L75E 4Y99C 3RK2C 2YIUB 3D6YA 2N9YB 1FJPA 2M8RA 3CWBE 3S9OA 1S5LX 3A3YB 3Q1MA 3CD6P 2IX7C 3A0BE 3L73G 2FYNC 3RK2B 1OVUA 2V7QH 3HUSA 5APQA 2Q5UA 3CXHD 3CMAP 1KILB 1LP1A 2A06E 2MKVA 1OW6A 3A0BH 2VRSA 2E74C 3AE8C 1RQUA 1AQ5A 1GZLA 1HVVA 2E43A 1URQD 1L4AB 3V4QA 3TGUE 3TK1A 2HLOA 3CC2P 4XE5B 1BCCJ 1R5SA 2H88C 1LT9B 4BWNA 4K3AA 1SQXG 3UIAA 3LIDA 1KYOE 4R4LA 5APUA 3V2RA 3CC4P 1AVOA 2K37A 3PLNA 1LNQA 2L5GB 1YJNP 1KTMA 3BRVB 3I5CA 1SQVK 5EFWB 1PPJD 5B66E 1U7MA 1PP9G 4OWFA 5TISE 3H1HJ 1SQVE 5AVTB 1ZRTE 2OARA 2CPSA 3H1KD 4WY4B 1LJ2A 1L0NJ 3VYIA 1S9KD 3GHGB 3IR9A 2H43A 4I6MC 3GW6A 1N86A 1NTKE 1HF9A 4N78D 4D6TE 5GTHH 1AV1A 1VL2A 2WQYC 3CWBG 1G2CB 3CI9A 2PGDA 4ZKPA 1CI6B 5CBNA 1X22A 3A5TA 3BCCE 2O01J 3TF5A 4IFMA 2AXTE 1DX7A 1LTAC 1SVFA 1NTKK 2KSJA 2YIUC 4EDFA 2WT7B 1J1DB 1PP9E 2H8PD 2KK7A 3B5NA 2WSEH 2H7HA 1SQVG 1NU1E 2E75C 2AEJA 1CW5A 2J59M 1QL1A 2WPRA 4ZKUA 1BGYG 1NU1J 1K05A 1LWUB 1BCCG 2A45H 2WITA 1BE3G 1CZQA 3VMZA 4JYBA 2ZYDA 2ZT9B 1IO4A 1YJWP 3D70A 1NWQA 1L0LJ 2P10A 3BCCD 1VQ9P 4UB8E 2PP6A 1FU1A 2E75D 3L70J 4WWIA 2E76D 1IK7A 3AECC 1NTMG 1KQSO 2SPZA 1NJIQ 3M9HA 2IYOA 3H1HG 3GLMA 3MIWA 4I7ZB 3V6IA 4C7NB 5BVZA 1SFCC 2Q3IA 3GHGA 3L73D 1JTHA 2JKVA 2M3EA 1S5LE 3O8ZA 5KAFE 2JEEA 2K9YA 2QJKB 3P7KA 2A06G 5TJHA 1FZCC 1DH3A 1FDMA 4XA4A 2YNYA 1GU5A 1KB9D 3QWOC 1QVGO 4U3FJ 2FYUK 1CI6A 1RF1A 2RN0A 1T3UA 3AE7C 1DIPA 2WWWA 1SFCD 1SQVD 1NTKG 2W83C 1KQGB 3D6ZA 3RBZA 4N6JA 1TU3F 1M1JB 3AE2C 3H1IJ 3II6A 3H1LD 1HJBA 1KB9E 4ZMDA 3CCRP 2O01N 4OGQD 1VQKP 1SQQJ 1Q90D 1J2JB 3GMAA 1VF5B 3VTPC 1JEKA 2E76C 3VP8A 1IC2A 5KAIH 4A7PA 1L0LG 2LXCB 2NPSB 3HD7C 3N4XA 4C7NA 2ZVOB 5KLVE 5E79H 1HJ0A 1JTHB 1YBKA 2K9JB 2Q1KA 2IZ0A 1UIIA 3L36A 3L37A 1NU1G 1KC8Q 1FS0E 1BDDA 1NTMD 3ZDMA 1MV8A 2QE7H 3BASA 2GUSA 3SFDC 3CCJP 2HODB 1GL2D 2G3AA 3L73E 1KILE 3C1LA 1L0NE 3M9QA 1ZR2A 1RF1B 1GL2B 2A06D 3BRTB 1KILC 4AQRD 4AUWA 5KLVJ 3CXHH 3ITKA 2FYUJ 4N78E 4YPCA 5AW5B 2YXQB 4BRYA 4D6TD 1JCDA 2O1KA 3LIEA 2KS1A 1USDA 2ZAEB 1IFDA 1KORA 2FYUE 1WRGA 1IZNB 1IFMA 4PD4H 3SSUA 2QJPC 3LW5J 3Q3DA 4WVZA 3V5BA 1KB9I 2HG5D 2R5DA 1VQPP 1NO4A 1RE4A 2Q9IA 3JC22 2FFDA 3WUTA 2BCCE 2IBZD 5KJ7A 1MUUA 4IFFA 3RL0B 5CCGA 4GT1A 1QLED 2N1TA 3U1CA 1S72P 2AXTH 1NAYA 5AVYB 1FOSE 4H0LB 4RESB 5B66H 1FBMA 1PGPA 3S4RA 5AVXB 4W80A 1NTZG 3VP9A 1SQBE 4GKGA 3H1HD 3SFEC 3L4FA 1SQVJ 1RH5B 5AVRB 4GOEA 4K35A 2GM4A 1SQBJ 1ZXGA 4W7YA 2WSCJ 4HKZH 4U3FD 4UB8H 1U7JA 1EC5A 1OXZA 1U57A 2ZJSE 5H2FE 1QVFO 3SWKA 1BSHA 1OVVA 2BEQD 2WZ7A 1NTZK 1KD1Q 1T8ZA 5KKZC 3CCQP 1J1EB 2Z5IA 1LTJC 4BRYB 3AE6C 2I8DA 1LT1A 1EZVG 1LTJA 2P58A 4WBAA 2M5AB 2R32A 1R5LA 2W6AA 3KZIH 1GMJA 3EQ2A 2W90A 1N7SD 1PPJE 2YO3A 3L35A 3L70D 5AW7B 5CCHC 3HD7D 2OTJP 3HUSB 1AQTA 2KNCA 1RQVA 2AXCA 4H13B 3TNUA 3L71G 3HD7B 3U59A 1NGMB 2P7JA 3WUVA 2ZYAA 2C9LY 2WPSA 3MUDC 2WTYA 1AVYA 1BSNA 5DJTB 2ZXXA 5AW6B 3I56P 2P67A 1L4AA 3H1IE 3WUUA 1PP9J 3SWFA 2KOGA 2OYHB 1YQ4C 2FBWC 2E42A 1HBWA 1LT9A 2Y0DA 5KLIB 1JY2P 1VQOP 4OGQC 1L0LK 2V4HA 2YMYA 3R4YA 3H1JJ 4IL6E
chains in the Genus database with same CATH topology
1EDLA 1H0TB 2UWJE 4IOIH 4WWIA 2M5AA 1NVOA 2SPZA 4GODA 1EDJA 2R44A 2RKLA 2HR3A 1ZW0A 1Y47A 1JMBA 2KUBA 4NPEA 3QWOC 4JBZA 2B89A 2B87B 1EDKA 4HB1A 4GOFA 1FC2C 3S1KA 1JM0A 2K3RA 2QRXA 4ZNCA 1OVRA 4ZMDA 4NPFX 1H0TA 3FXEA 1LP1B 4MN4C 1EDIA 5K5GB 5DJUB 2LXCB 1Q2NA 4CPGA 2Q1KA 4BXLA 2JWDA 3MZWB 1BDDA 3PH0A 3ZDMA 2LR2A 3MHVA 2LXBA 2KZJA 2KI7B 2B87A 4NPDA 5CBOA 1S3JA 2ZAEB 1SS1A 1X0TA 1OVUA 5C39A 1LP1A 3RGUA 4GOEA 4K35A 4K3AA 1ZXGA 2WMMA 4HKZH 1U7JA 1EC5A 1BDCA 1MFTA 2M0BA 5EFWB 1OVVA 1U7MA 2OTKE 2I8DA 1LT1A 2KS1B 2P58A 4ASWA 2M5AB 1DEEG 4ASVA 2KZIA 2KIKA 3FXDA 2QVAA 5DJTB 5CBNA 4KJMA 2B88A 4EYYQ 4HJGH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EDL A;  1H0T B;  2UWJ E;  4IOI H;  4WWI A;  2M5A A;  1NVO A;  2SPZ A;  4GOD A;  1EDJ A;  2R44 A;  2RKL A;  2HR3 A;  1ZW0 A;  1Y47 A;  1JMB A;  2KUB A;  4NPE A;  3QWO C;  4JBZ A;  2B89 A;  2B87 B;  1EDK A;  4HB1 A;  4GOF A;  1FC2 C;  3S1K A;  1JM0 A;  2K3R A;  2QRX A;  4ZNC A;  1OVR A;  4ZMD A;  4NPF X;  1H0T A;  3FXE A;  1LP1 B;  4MN4 C;  1EDI A;  5K5G B;  5DJU B;  2LXC B;  1Q2N A;  4CPG A;  2Q1K A;  4BXL A;  2JWD A;  3MZW B;  1BDD A;  3PH0 A;  3ZDM A;  2LR2 A;  3MHV A;  2LXB A;  2KZJ A;  2KI7 B;  2B87 A;  4NPD A;  5CBO A;  1S3J A;  2ZAE B;  1SS1 A;  1X0T A;  1OVU A;  5C39 A;  1LP1 A;  3RGU A;  4GOE A;  4K35 A;  4K3A A;  1ZXG A;  2WMM A;  4HKZ H;  1U7J A;  1EC5 A;  1BDC A;  1MFT A;  2M0B A;  5EFW B;  1OVV A;  1U7M A;  2OTK E;  2I8D A;  1LT1 A;  2KS1 B;  2P58 A;  4ASW A;  2M5A B;  1DEE G;  4ASV A;  2KZI A;  2KIK A;  3FXD A;  2QVA A;  5DJT B;  5CBN A;  4KJM A;  2B88 A;  4EYY Q;  4HJG H; 
#chains in the Genus database with same CATH topology
 1P84 H;  5CJ0 A;  5L8R J;  1LTB C;  2J58 A;  2WPQ A;  3RL0 g;  1NTK J;  3CX5 I;  4M3L A;  1M57 D;  2IBZ I;  2Y9Y A;  4EOT A;  3AEA C;  1JMM A;  2KB7 P;  1OZH A;  3G9R A;  4DT0 A;  2P2U A;  3L71 J;  2JO1 A;  2UWJ E;  5AW0 B;  3TDK A;  3L72 J;  1HWT C;  2XNX A;  3H1L J;  2FXO A;  3A0H E;  3ABV C;  3L71 E;  3TYY A;  1SQX K;  4D6T G;  1GTW A;  1NTM K;  2M5A A;  2Y9Z A;  4WY4 A;  1MKM A;  1NVO A;  3P32 A;  3Q5P A;  2XZR A;  1FOS F;  4QMA A;  5CCH D;  1EDJ A;  4W7Z A;  2R44 A;  3H1J E;  3VMA A;  3Q2Y A;  5AVV B;  1JY2 O;  3TNU B;  1PGO A;  1ZW0 A;  1JMB A;  1G2C A;  2KUB A;  1S4X A;  2D2C B;  1M1K Q;  4IL6 H;  1RF0 A;  2D2C D;  2GA1 A;  1N73 A;  3H1L E;  1BCC E;  1E5W A;  1ZOY C;  2WVR A;  1NTZ J;  3E7K A;  3H6P A;  4LLH A;  5AW1 B;  3A2A A;  2WT7 A;  1NTZ D;  5APT A;  1QEX A;  1SQX D;  2BEZ F;  2KYV A;  3B5N B;  3OA7 A;  3GF3 A;  3PHL A;  2PAJ A;  2Y0E A;  1Y9B A;  1EXJ A;  1ZLL A;  3JCU E;  1LWU A;  3C9I A;  3O6Q A;  3JCU H;  1JM0 A;  3CCM P;  2K3R A;  2QRX A;  1SQB D;  4JYC A;  5KLI C;  3V2Q A;  4NPF X;  3CLQ A;  2ZVN B;  1GW4 A;  1KQL A;  1ZP0 C;  3IAO A;  1Q82 Q;  1IFJ A;  3H1K G;  2QIW A;  1K8A Q;  3BAT A;  4MN4 C;  1A02 J;  4PJ0 H;  1OW8 A;  2MJZ A;  2QSI A;  3L72 D;  4WY4 D;  4CPG A;  1IJD B;  3KPE A;  1PGJ A;  5AW4 B;  3E1I A;  3MZW B;  3CWB D;  3IFM A;  4H44 C;  1VQ7 P;  1JY2 N;  1KFM A;  4EI2 A;  3VN0 A;  3R2P A;  1GW3 A;  3M9B A;  4OVN F;  3CME P;  4B86 A;  1ZRT D;  1FZF A;  1N73 B;  1VDF A;  1H0T B;  2NPS C;  4GIF A;  1FZG A;  2HPC B;  3G6E P;  1VQ5 P;  3EWK A;  3FWL A;  2C9N Y;  2WSS H;  2QG4 A;  2P1J A;  1BGY D;  3RK3 E;  4PV1 C;  1NTM E;  4UB6 E;  3E1R A;  2O1J A;  1T6A A;  2E5Y A;  3H1K J;  3HTK A;  1NU1 K;  3O6Q B;  2OYH C;  2WSC H;  2W8Z A;  1LT9 C;  1G1I A;  5APV A;  1KFN A;  2J5U A;  2POH A;  4EIJ A;  3CC7 P;  4O9B A;  2GUV A;  1NH4 A;  2HFE D;  2O01 H;  1IFP A;  5KTB A;  1RF0 C;  2FXP A;  3AED C;  1FZB A;  2FFD C;  1W2B O;  3L72 G;  1N73 C;  3CXH I;  1H8A A;  4IFD K;  4HYT B;  2QJY C;  2NPS A;  3CX5 E;  2JR8 A;  2IBZ E;  3Q5R A;  3AE3 C;  2K9J A;  1YTZ I;  2FYN B;  3N7N A;  3CCL P;  1FE6 A;  1J1E C;  1SQP G;  1HUC A;  3HE4 A;  3T97 A;  3I55 P;  1HGV A;  1PL5 A;  2E74 D;  3QH9 A;  1FZC B;  5AW9 B;  3WMM 0;  2HOD A;  1RY3 A;  2YMK A;  3CCV P;  1SFC B;  1RE3 A;  2M0B A;  1BDC A;  1JB0 J;  1GL2 A;  2K1A A;  4DJG A;  1SQB K;  3L74 G;  5AVQ B;  1SQQ G;  1FZA A;  2OTK E;  3P8C D;  1N8R Q;  2KS1 B;  2OGU A;  4WB4 A;  5BU5 A;  4ASW A;  3OW2 O;  1LGH B;  2OYI C;  3HTK B;  1KMI Z;  2KLV A;  5CCG D;  5GTI H;  2PRR A;  1K73 Q;  3EFG A;  2KZI A;  3AE4 C;  3KDP B;  2W6B A;  3H1L G;  1LWU C;  1NTZ E;  2Y0C A;  3F5H A;  1E79 H;  3FGA D;  3FXD A;  3A0H H;  3L73 J;  1T2K C;  1OIP A;  2QVA A;  4OGQ B;  2L91 A;  4C46 A;  4L75 A;  3CXH E;  2NRG A;  5M1B A;  1KV4 A;  1OW7 A;  1Z56 A;  3GF7 A;  5CCG C;  1BE3 E;  2KLU A;  3MGN A;  4KJM A;  5KJ7 C;  3AEF C;  3KXD A;  3H1J G;  3RBX A;  2BCC G;  3U1A A;  3A7O A;  3MD0 A;  4YXW H;  1L0L D;  4PV1 B;  2B88 A;  2NPS D;  4EYY Q;  1JUN A;  1RE4 C;  4JQ0 D;  4R4M A;  3HE4 B;  1AJY A;  1GL2 C;  3RK2 D;  5B5E E;  4H13 C;  1FDI A;  1RE3 C;  2XND H;  4YTP C;  1NTM J;  2K88 A;  2QEX P;  1RF1 C;  1KIL D;  4PD4 E;  3W67 A;  1EDL A;  3USS A;  2FXM A;  1NAF A;  4WY4 C;  1SQP E;  4H44 B;  1Q86 Q;  1DEB A;  3MTU E;  1URQ B;  1LTJ B;  1YTZ T;  4H44 D;  2BAS A;  3M0D A;  1SLQ A;  4KHX A;  5AVS B;  3D71 A;  2HPC A;  4GOD A;  3CX5 D;  2QJK C;  2IBZ G;  3KZI E;  1SQQ D;  1L4A D;  2JP3 A;  1SP4 A;  2KNC B;  2OQQ A;  3H32 B;  3RL0 D;  3TGU J;  5BU8 B;  2HR3 A;  1L0N K;  2ZXE B;  1GK6 A;  2IZ1 A;  1KYO D;  3HD7 A;  5CJ4 A;  1GK4 A;  1DD3 A;  2IPP A;  4GDO A;  4H0L D;  4IL6 X;  4JBZ A;  4RO0 A;  3PP5 A;  1PGQ A;  3G71 P;  2W27 A;  1VQ8 P;  2OYH A;  1M56 D;  1L4A C;  1X9V A;  2XV5 A;  2ZT9 C;  1GD2 E;  1PZQ A;  4HB1 A;  4GOF A;  1FC2 C;  1LTI C;  1W5C E;  1VQL P;  3FWN A;  4XFJ A;  2OYO A;  3S1K A;  1EZV D;  2OYI B;  3CCU P;  5GTH E;  1VQN P;  1J1D C;  3VMX A;  2AEF A;  1HGZ A;  2Q6Q A;  2OTL P;  1H0T A;  1NYH A;  1KIL A;  1LP1 B;  2R3C A;  1JY3 N;  4LGD E;  1JNM A;  3L74 J;  1EZV I;  3AE1 C;  4I7Z C;  1EDI A;  2WPV B;  3PTZ A;  1GDT A;  3CCE P;  2YKP A;  4D6T J;  5KJ7 D;  2PFX A;  3BCC J;  3VMY A;  1SQP J;  1M7L A;  1P84 D;  3L75 D;  2JWD A;  3L75 G;  2N1T D;  1H89 A;  3PRJ A;  1S5L H;  4JF7 A;  1Q7Y Q;  5KAF H;  2Z4E A;  2QJY B;  1QGK B;  2O3J A;  1BGY E;  3H1K E;  3MP7 B;  3NXS A;  4H0L C;  3IN6 A;  2LR2 A;  3MHV A;  5AW3 B;  3RK3 D;  1JOC A;  3B4S A;  1HTL C;  3F89 A;  5H2F H;  2KP8 A;  3HE5 A;  2KI7 B;  3V2P A;  1KB9 H;  2BCC J;  2YKQ A;  1YI2 P;  2DW3 A;  2E75 B;  2ZT9 D;  2E76 B;  3CX5 H;  3WU2 H;  1Q81 Q;  2N1T C;  3IF4 A;  5CBO A;  1PIX A;  1VPC A;  1QX8 A;  2KSE A;  5AVZ B;  1S3J A;  1VF5 C;  3M91 A;  4YXD C;  2FFD B;  1BE3 D;  4AYC A;  1S9K E;  1L2P A;  1N7S C;  1P84 E;  1SS1 A;  1X0T A;  3C8V A;  4L76 A;  3TGU G;  2OYI A;  3OJA B;  3CWB J;  1JO5 A;  5C39 A;  1M1J C;  2XKM A;  1HH0 A;  1NHL A;  1EZV E;  1L0N D;  2JWA A;  2QM8 A;  1X8Y A;  3AEB C;  3HUS C;  3JSV C;  3RGU A;  1YIT P;  4N3Y B;  1EXI A;  1LTS C;  3H25 A;  5APW A;  1K9M Q;  2XDJ A;  2FY8 A;  4HH2 A;  4PD4 I;  3G4S P;  4Z1M H;  1OMI A;  2WMM A;  3M06 A;  4TT3 H;  5KKZ B;  2KXP B;  3NTN A;  3GG2 A;  2JDI H;  5AW2 B;  5GTI E;  3AEG C;  1MFT A;  4Y99 B;  1JCC A;  1XTC C;  3HE5 B;  4I1L A;  1SQX J;  2NZ2 A;  2Q3E A;  3B5N D;  1BCC D;  1SQB G;  1KQF B;  3TSI A;  2IDB A;  1SQQ K;  3AE5 C;  4LC1 A;  5B5E H;  4L74 A;  1A02 F;  4PJ0 E;  4DZO A;  4Y28 J;  1VF5 D;  5KAI E;  3CPW O;  2N9B A;  1P84 I;  5APX A;  3H1I G;  5KLV K;  2Q7C A;  1DEE G;  2YXR B;  2WSF H;  2FYU D;  4ASV A;  5KLV D;  2FKW B;  2KIK A;  3B5N C;  3B8E B;  3CCS P;  3VOP A;  1JY3 P;  2R5B A;  3L74 E;  4PV1 D;  1YIJ P;  2HYN A;  1ZN5 A;  4KT0 J;  1NU1 D;  2A45 I;  3OAK A;  4OH8 B;  1FDO A;  2LKM A;  5CCH A;  1BGY J;  2D2C C;  2IYP A;  2QJP B;  4I2L C;  1SQP D;  2ZYG A;  4PD4 D;  2V7Q J;  1NKZ B;  1NTK D;  1YYC A;  4HJG H;  3T97 B;  2I1J A;  5AW8 B;  2QM7 A;  1S1C X;  2RH0 A;  1GU4 A;  1FZC A;  1M1J A;  5TIS H;  1QL2 A;  1SFC A;  3GHG C;  3L74 D;  1T3J A;  1VQ6 P;  1L0L E;  1M8O B;  1EQ7 A;  1JY3 O;  1N7S A;  2IFM A;  1D7M A;  1UIX A;  4U3F E;  2JJL A;  2YO2 A;  3CL3 D;  3G3Z A;  4IOI H;  3WU2 E;  4DOJ A;  1FJK A;  1KYO H;  1MZ9 A;  1N7L A;  1KYO I;  1KZU B;  2YKO A;  3H1I D;  3L72 E;  1OWA A;  3B71 A;  1R8E A;  1OX3 A;  3KHU A;  3RK3 C;  3AEE C;  2WSE J;  1Y8A A;  2RKL A;  4TLF A;  1MFZ A;  1PV3 A;  3Q5S A;  3BVH A;  4C7R A;  1VQ4 P;  1G1J A;  4RKU J;  4JPZ B;  1AFO A;  1Y47 A;  3L70 E;  2ZFC A;  1RHZ B;  4NPE A;  1URQ C;  2FYZ A;  2FYU G;  1PPJ G;  3PJS K;  1CSB A;  1KN7 A;  2B89 A;  3EFF K;  2B87 B;  3LW5 H;  2C0W A;  2CK3 H;  1EDK A;  3TGU D;  1SQQ E;  3HRN A;  4U3F G;  2E74 B;  3NMD A;  1WT6 A;  1FZE A;  2Z5H A;  4UB6 H;  5APY A;  3SWY A;  1NKN A;  1K04 A;  5AVW B;  5CHX A;  2R3S A;  1L0N G;  1ZME C;  2ITA A;  1W2E A;  1S2E A;  2C0X A;  3K5B A;  1YHQ P;  4ZNC A;  3H1H E;  1OVR A;  3KQG A;  3NFQ A;  1N7S B;  2AEM A;  4RJT A;  3FXE A;  1ZV8 A;  2W6J H;  1NOH A;  4L73 A;  1DD4 A;  4U7J A;  2M3B A;  2B9B A;  5AVU B;  4H13 D;  2CPB A;  3V2N A;  1URQ A;  2N1T B;  2XU6 A;  1SQX E;  1USE A;  2A45 G;  2E5T A;  1IFN A;  2G8Y A;  3FX0 A;  1AA0 A;  3L70 G;  3W68 A;  1OFC X;  3RK3 B;  5K5G B;  5DJU B;  3AE9 C;  4DCK A;  1VQM P;  1LTG C;  1Q2N A;  5E79 E;  1PFI A;  1WMK A;  3L71 D;  1M90 Q;  1N2D C;  3H32 A;  5APS A;  4BXL A;  1FAV A;  2I1K A;  5KLV G;  2WSF J;  1T2K D;  2IFN A;  3PH0 A;  1IK9 A;  2RMZ A;  3KYQ A;  3M0A A;  3P8M C;  1BE3 J;  1LTT C;  3V4W A;  2QA4 P;  1ZR4 A;  3H1J D;  3P8C E;  1H88 A;  1IFI A;  2LXB A;  3MUD A;  1SQP K;  5CMZ A;  3RL0 C;  3BCC G;  2KZJ A;  2B87 A;  1YJ9 P;  3L75 J;  2BCC D;  4NPD A;  2H89 C;  1XTG B;  1X79 B;  1YQ3 C;  3M0D C;  1PP9 D;  3L75 E;  4Y99 C;  3RK2 C;  2YIU B;  3D6Y A;  2N9Y B;  1FJP A;  2M8R A;  3CWB E;  3S9O A;  1S5L X;  3A3Y B;  3Q1M A;  3CD6 P;  2IX7 C;  3A0B E;  3L73 G;  2FYN C;  3RK2 B;  1OVU A;  2V7Q H;  3HUS A;  5APQ A;  2Q5U A;  3CXH D;  3CMA P;  1KIL B;  1LP1 A;  2A06 E;  2MKV A;  1OW6 A;  3A0B H;  2VRS A;  2E74 C;  3AE8 C;  1RQU A;  1AQ5 A;  1GZL A;  1HVV A;  2E43 A;  1URQ D;  1L4A B;  3V4Q A;  3TGU E;  3TK1 A;  2HLO A;  3CC2 P;  4XE5 B;  1BCC J;  1R5S A;  2H88 C;  1LT9 B;  4BWN A;  4K3A A;  1SQX G;  3UIA A;  3LID A;  1KYO E;  4R4L A;  5APU A;  3V2R A;  3CC4 P;  1AVO A;  2K37 A;  3PLN A;  1LNQ A;  2L5G B;  1YJN P;  1KTM A;  3BRV B;  3I5C A;  1SQV K;  5EFW B;  1PPJ D;  5B66 E;  1U7M A;  1PP9 G;  4OWF A;  5TIS E;  3H1H J;  1SQV E;  5AVT B;  1ZRT E;  2OAR A;  2CPS A;  3H1K D;  4WY4 B;  1LJ2 A;  1L0N J;  3VYI A;  1S9K D;  3GHG B;  3IR9 A;  2H43 A;  4I6M C;  3GW6 A;  1N86 A;  1NTK E;  1HF9 A;  4N78 D;  4D6T E;  5GTH H;  1AV1 A;  1VL2 A;  2WQY C;  3CWB G;  1G2C B;  3CI9 A;  2PGD A;  4ZKP A;  1CI6 B;  5CBN A;  1X22 A;  3A5T A;  3BCC E;  2O01 J;  3TF5 A;  4IFM A;  2AXT E;  1DX7 A;  1LTA C;  1SVF A;  1NTK K;  2KSJ A;  2YIU C;  4EDF A;  2WT7 B;  1J1D B;  1PP9 E;  2H8P D;  2KK7 A;  3B5N A;  2WSE H;  2H7H A;  1SQV G;  1NU1 E;  2E75 C;  2AEJ A;  1CW5 A;  2J59 M;  1QL1 A;  2WPR A;  4ZKU A;  1BGY G;  1NU1 J;  1K05 A;  1LWU B;  1BCC G;  2A45 H;  2WIT A;  1BE3 G;  1CZQ A;  3VMZ A;  4JYB A;  2ZYD A;  2ZT9 B;  1IO4 A;  1YJW P;  3D70 A;  1NWQ A;  1L0L J;  2P10 A;  3BCC D;  1VQ9 P;  4UB8 E;  2PP6 A;  1FU1 A;  2E75 D;  3L70 J;  4WWI A;  2E76 D;  1IK7 A;  3AEC C;  1NTM G;  1KQS O;  2SPZ A;  1NJI Q;  3M9H A;  2IYO A;  3H1H G;  3GLM A;  3MIW A;  4I7Z B;  3V6I A;  4C7N B;  5BVZ A;  1SFC C;  2Q3I A;  3GHG A;  3L73 D;  1JTH A;  2JKV A;  2M3E A;  1S5L E;  3O8Z A;  5KAF E;  2JEE A;  2K9Y A;  2QJK B;  3P7K A;  2A06 G;  5TJH A;  1FZC C;  1DH3 A;  1FDM A;  4XA4 A;  2YNY A;  1GU5 A;  1KB9 D;  3QWO C;  1QVG O;  4U3F J;  2FYU K;  1CI6 A;  1RF1 A;  2RN0 A;  1T3U A;  3AE7 C;  1DIP A;  2WWW A;  1SFC D;  1SQV D;  1NTK G;  2W83 C;  1KQG B;  3D6Z A;  3RBZ A;  4N6J A;  1TU3 F;  1M1J B;  3AE2 C;  3H1I J;  3II6 A;  3H1L D;  1HJB A;  1KB9 E;  4ZMD A;  3CCR P;  2O01 N;  4OGQ D;  1VQK P;  1SQQ J;  1Q90 D;  1J2J B;  3GMA A;  1VF5 B;  3VTP C;  1JEK A;  2E76 C;  3VP8 A;  1IC2 A;  5KAI H;  4A7P A;  1L0L G;  2LXC B;  2NPS B;  3HD7 C;  3N4X A;  4C7N A;  2ZVO B;  5KLV E;  5E79 H;  1HJ0 A;  1JTH B;  1YBK A;  2K9J B;  2Q1K A;  2IZ0 A;  1UII A;  3L36 A;  3L37 A;  1NU1 G;  1KC8 Q;  1FS0 E;  1BDD A;  1NTM D;  3ZDM A;  1MV8 A;  2QE7 H;  3BAS A;  2GUS A;  3SFD C;  3CCJ P;  2HOD B;  1GL2 D;  2G3A A;  3L73 E;  1KIL E;  3C1L A;  1L0N E;  3M9Q A;  1ZR2 A;  1RF1 B;  1GL2 B;  2A06 D;  3BRT B;  1KIL C;  4AQR D;  4AUW A;  5KLV J;  3CXH H;  3ITK A;  2FYU J;  4N78 E;  4YPC A;  5AW5 B;  2YXQ B;  4BRY A;  4D6T D;  1JCD A;  2O1K A;  3LIE A;  2KS1 A;  1USD A;  2ZAE B;  1IFD A;  1KOR A;  2FYU E;  1WRG A;  1IZN B;  1IFM A;  4PD4 H;  3SSU A;  2QJP C;  3LW5 J;  3Q3D A;  4WVZ A;  3V5B A;  1KB9 I;  2HG5 D;  2R5D A;  1VQP P;  1NO4 A;  1RE4 A;  2Q9I A;  3JC2 2;  2FFD A;  3WUT A;  2BCC E;  2IBZ D;  5KJ7 A;  1MUU A;  4IFF A;  3RL0 B;  5CCG A;  4GT1 A;  1QLE D;  2N1T A;  3U1C A;  1S72 P;  2AXT H;  1NAY A;  5AVY B;  1FOS E;  4H0L B;  4RES B;  5B66 H;  1FBM A;  1PGP A;  3S4R A;  5AVX B;  4W80 A;  1NTZ G;  3VP9 A;  1SQB E;  4GKG A;  3H1H D;  3SFE C;  3L4F A;  1SQV J;  1RH5 B;  5AVR B;  4GOE A;  4K35 A;  2GM4 A;  1SQB J;  1ZXG A;  4W7Y A;  2WSC J;  4HKZ H;  4U3F D;  4UB8 H;  1U7J A;  1EC5 A;  1OXZ A;  1U57 A;  2ZJS E;  5H2F E;  1QVF O;  3SWK A;  1BSH A;  1OVV A;  2BEQ D;  2WZ7 A;  1NTZ K;  1KD1 Q;  1T8Z A;  5KKZ C;  3CCQ P;  1J1E B;  2Z5I A;  1LTJ C;  4BRY B;  3AE6 C;  2I8D A;  1LT1 A;  1EZV G;  1LTJ A;  2P58 A;  4WBA A;  2M5A B;  2R32 A;  1R5L A;  2W6A A;  3KZI H;  1GMJ A;  3EQ2 A;  2W90 A;  1N7S D;  1PPJ E;  2YO3 A;  3L35 A;  3L70 D;  5AW7 B;  5CCH C;  3HD7 D;  2OTJ P;  3HUS B;  1AQT A;  2KNC A;  1RQV A;  2AXC A;  4H13 B;  3TNU A;  3L71 G;  3HD7 B;  3U59 A;  1NGM B;  2P7J A;  3WUV A;  2ZYA A;  2C9L Y;  2WPS A;  3MUD C;  2WTY A;  1AVY A;  1BSN A;  5DJT B;  2ZXX A;  5AW6 B;  3I56 P;  2P67 A;  1L4A A;  3H1I E;  3WUU A;  1PP9 J;  3SWF A;  2KOG A;  2OYH B;  1YQ4 C;  2FBW C;  2E42 A;  1HBW A;  1LT9 A;  2Y0D A;  5KLI B;  1JY2 P;  1VQO P;  4OGQ C;  1L0L K;  2V4H A;  2YMY A;  3R4Y A;  3H1J J;  4IL6 E; 
#chains in the Genus database with same CATH homology
 1EDL A;  1H0T B;  2UWJ E;  4IOI H;  4WWI A;  2M5A A;  1NVO A;  2SPZ A;  4GOD A;  1EDJ A;  2R44 A;  2RKL A;  2HR3 A;  1ZW0 A;  1Y47 A;  1JMB A;  2KUB A;  4NPE A;  3QWO C;  4JBZ A;  2B89 A;  2B87 B;  1EDK A;  4HB1 A;  4GOF A;  1FC2 C;  3S1K A;  1JM0 A;  2K3R A;  2QRX A;  4ZNC A;  1OVR A;  4ZMD A;  4NPF X;  1H0T A;  3FXE A;  1LP1 B;  4MN4 C;  1EDI A;  5K5G B;  5DJU B;  2LXC B;  1Q2N A;  4CPG A;  2Q1K A;  4BXL A;  2JWD A;  3MZW B;  1BDD A;  3PH0 A;  3ZDM A;  2LR2 A;  3MHV A;  2LXB A;  2KZJ A;  2KI7 B;  2B87 A;  4NPD A;  5CBO A;  1S3J A;  2ZAE B;  1SS1 A;  1X0T A;  1OVU A;  5C39 A;  1LP1 A;  3RGU A;  4GOE A;  4K35 A;  4K3A A;  1ZXG A;  2WMM A;  4HKZ H;  1U7J A;  1EC5 A;  1BDC A;  1MFT A;  2M0B A;  5EFW B;  1OVV A;  1U7M A;  2OTK E;  2I8D A;  1LT1 A;  2KS1 B;  2P58 A;  4ASW A;  2M5A B;  1DEE G;  4ASV A;  2KZI A;  2KIK A;  3FXD A;  2QVA A;  5DJT B;  5CBN A;  4KJM A;  2B88 A;  4EYY Q;  4HJG H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...