5DJTB

Crystal structure of lov2 (c450a) domain in complex with zdk2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
59
structure length
59
Chain Sequence
SVDNKFNKEMLSARVEIYGLPNLNWGQRFAFISSLTDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NPH1-2
publication title LOVTRAP: an optogenetic system for photoinduced protein dissociation.
pubmed doi rcsb
source organism Avena sativa
molecule tags Signaling protein
total genus 22
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2015-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5djtB00
1X0TA 1EC5A 2UWJE 4NPDA 4NPFX 2KS1B 1LP1B 2M0BA 2SPZA 4BXLA 1NVOA 2QRXA 2B88A 1MFTA 2RKLA 4MN4C 1Y47A 4EYYQ 1OVRA 5C39A 2KUBA 1OVUA 1LP1A 1ZXGA 2LXBA 5DJTB 4ZNCA 1U7MA 2OTKE 1JM0A 1U7JA 4HB1A 2ZAEB 2KI7B 4K35A 1EDIA 4ASWA 2B89A 4K3AA 3FXDA 1SS1A 3PH0A 3MHVA 4ASVA 2K3RA 2M5AB 1H0TB 1BDCA 2QVAA 2WMMA 2LR2A 4JBZA 4CPGA 2B87B 4WWIA 4HKZH 1ZW0A 2KZIA 4ZMDA 2P58A 3FXEA 3MZWB 5DJUB 3S1KA 1H0TA 5CBOA 3QWOC 4GOFA 2JWDA 4IOIH 2B87A 1EDJA 5EFWB 1EDLA 2R44A 4HJGH 5K5GB 4KJMA 1S3JA 3ZDMA 5CBNA 1LT1A 2I8DA 1Q2NA 1JMBA 2M5AA 2HR3A 1FC2C 2KZJA 4GOEA 1DEEG 2Q1KA 4NPEA 1OVVA 2KIKA 2LXCB 1EDKA 4GODA 3RGUA 1BDDA
chains in the Genus database with same CATH superfamily
4PJ0H 4NPFX 3L36A 1NVOA 3SWFA 1GU5A 4D6TJ 3VMYA 2KB7P 3T97B 2C0WA 3V4QA 2E76C 3TGUJ 4BWNA 1PL5A 1SQPE 4U3FG 2PAJA 1KTMA 1FZCC 2H88C 1URQA 3CMEP 1IZNB 1KB9E 1GL2A 2WVRA 1SS1A 3CWBJ 4XFJA 1SQQE 1RHZB 4M3LA 3L75E 3BCCD 2NPSB 3TYYA 3LIEA 3L70D 2WWWA 4H44D 2HLOA 2FXMA 1NTKD 4C7NB 3AECC 1JNMA 1BSNA 4YXWH 2PGDA 4N6JA 4LGDE 1EDJA 2AEJA 1Y9BA 2KNCA 5CJ4A 4H13D 5CCHA 1S3JA 2GM4A 2KLVA 1L0LD 2W27A 3GG2A 2K9YA 1JMBA 3PRJA 3H1HJ 4NPEA 2QEXP 1PP9J 1OVVA 2KIKA 2LXCB 4HH2A 1FU1A 2WPQA 3H1LD 1YIJP 4H44C 2ZFCA 3V6IA 1EDKA 3R2PA 2HPCA 2KS1B 1X79B 2ZXXA 1USDA 2RMZA 4TLFA 1JO5A 4EIJA 2O1JA 2ZYAA 4H13C 1PGQA 4I6MC 1KILD 1OVRA 5C39A 3H1JE 1JY3O 2QE7H 2JWAA 4AQRD 1YQ3C 1S5LX 4O9BA 3RL0D 4I2LC 3CXHE 3HE4B 3PHLA 1CI6B 5AVUB 1CSBA 5APTA 1YI2P 3RK2B 1FZCA 5B66E 4U3FJ 3A0HE 2P67A 2KZIA 4W80A 4PV1D 3VTPC 2P58A 1D7MA 1SQXK 1FZFA 2IX7C 3Q5PA 4GIFA 1LT9B 5L8RJ 1PPJG 3FGAD 1L4AB 1NWQA 1FZAA 3H6PA 3RL0C 5KLVK 3PLNA 4L76A 5K5GB 4YTPC 4OH8B 2YMKA 2Q9IA 1SQXG 2NZ2A 3A5TA 3NXSA 5CMZA 2KXPB 1PV3A 3N4XA 4PV1C 1NTMD 5KLVG 1N7SD 1G2CA 2FFDC 3PP5A 5AVZB 2ZVOB 1S9KE 3I56P 3CPWO 3G6EP 1BE3E 2VRSA 3TNUA 2JO1A 1NU1D 3M9QA 2E74B 4HB1A 3LW5J 1EZVD 1QEXA 1PIXA 3BRTB 2BCCD 3CC4P 1RE3C 5TISE 4K35A 4WVZA 2A45G 3V4WA 2B89A 2P2UA 3PH0A 1N7SC 2YO3A 2M5AB 1BDCA 1K9MQ 2AEMA 4CPGA 1M57D 1WMKA 2CK3H 3O6QB 5KAFH 3L70G 3CX5I 3OW2O 1L0LK 1CW5A 4GOFA 3P8MC 5KAIE 4I1LA 3N7NA 1WRGA 2DW3A 3KYQA 3RBXA 2R3SA 4KJMA 1SQVD 4A7PA 1LT1A 1YJNP 1Q2NA 1IK7A 4UB6E 1L0LG 1NHLA 3A2AA 1FC2C 4PD4D 3GF3A 1M8OB 2JKVA 3M9BA 1IC2A 1RQVA 3RGUA 2KOGA 3CCJP 1SQXJ 3H1LG 4B86A 3L74D 1LP1B 3CCRP 2QRXA 1EXJA 5KKZC 2XNXA 2IBZD 2FFDA 5KLVJ 5GTIH 2KUBA 3G4SP 1JUNA 2R32A 3NTNA 2B9BA 1U7MA 1X22A 1U7JA 3IF4A 3RK3D 2A06E 3HRNA 2Z4EA 1LTJB 2PP6A 1RY3A 2H89C 3QH9A 3AE9C 1KORA 1H0TB 1J1DC 3S4RA 1RE3A 2YKOA 2QJKC 1X8YA 1NJIQ 1VQ8P 1N7SA 3CC7P 5AW5B 3V5BA 1UIIA 4OGQB 4IL6H 1VQLP 1H89A 2YXRB 1GTWA 3RK3C 1EDLA 1OFCX 1OZHA 3CCVP 3L70J 1ZP0C 1ZRTD 2FYNC 3L72D 1N73B 2Q6QA 1M7LA 5B5EE 2Q1KA 2OYIC 2O01H 4D6TE 2XNDH 1SFCD 4PD4H 1HJ0A 3VMZA 3D6YA 1JY3P 2IYOA 3TGUE 1X0TA 1NOHA 1L0LJ 1NTZD 1SQPD 3SWYA 1KB9D 2WSEJ 4MN4C 3CWBE 2K37A 2KSJA 3H1LJ 2Z5IA 1PFIA 1OXZA 4EI2A 2RH0A 1JM0A 1KC8Q 2QSIA 2E5YA 2GUSA 1LJ2A 1DD4A 5APUA 1SFCC 1KD1Q 2BCCG 1ZV8A 3W67A 3FWNA 1NKNA 2E42A 1W2BO 5CCHD 1BCCD 2NPSC 4LLHA 2PFXA 1LNQA 3AE4C 1OIPA 3SSUA 1H8AA 3H1HE 1IK9A 2B87A 1PP9E 4JYBA 3CC2P 2IDBA 3L35A 3RBZA 1SQBD 3H1KG 2YKQA 5AW3B 2D2CB 1L0NK 1PGJA 3KPEA 2I8DA 2QG4A 5AVTB 1T6AA 5AVXB 2ZVNB 3M06A 1ZR4A 3HTKB 1VQOP 1FZEA 3H1JD 2AXTE 2N1TD 1L0NG 2OYIA 1ZR2A 3HUSC 1S72P 1Z56A 3CXHD 2E76D 3RL0g 1KB9H 3CI9A 1Q82Q 3JCUE 2IBZG 4U3FE 3CD6P 1TU3F 2ITAA 2JR8A 1KFMA 5E79E 4GKGA 4K3AA 5BU8B 1RE4C 4DZOA 2ZT9D 2N1TC 2V4HA 1K8AQ 4I7ZC 3RK2C 3VN0A 1SFCA 1JTHB 5AVSB 3M0AA 3CCSP 3WU2H 1OMIA 2BCCJ 1VQMP 5CBOA 3Q3DA 1LT9C 2NPSA 1M90Q 2P7JA 3AEDC 4Z1MH 2H43A 1KMIZ 1L4AC 1FZBA 1IFPA 4C7NA 3KHUA 1YBKA 3BATA 4JPZB 1R8EA 1U57A 3H1IG 3L72G 2ZT9C 2E75B 1H88A 1BE3D 3H1KJ 1URQB 1A02F 1GL2B 2FYUK 2M8RA 1M1KQ 4GT1A 1EXIA 4IFMA 5BVZA 3M0DC 2V7QH 1LTSC 5APSA 4BXLA 3CLQA 1NTZG 3CXHH 3AEFC 2R3CA 3P8CE 2HYNA 2O01J 1W2EA 1HTLC 3HUSA 1L0NJ 5AW0B 2FYUG 5DJTB 1IFDA 5B66H 4ZNCA 2KNCB 3A0HH 4YPCA 2QJYC 2WSFH 2O3JA 3KDPB 1VDFA 2K3RA 2BEZF 3FX0A 4R4MA 2QVAA 2LR2A 1USEA 2N9YB 3HE4A 1FAVA 3E1RA 1SQBK 1M1JB 4ZMDA 1RE4A 1BCCG 2J58A 2N1TA 1PPJE 2W6BA 5DJUB 2WZ7A 1NAYA 2HODA 1K73Q 1LTAC 1SLQA 1SQXE 3VP8A 1DIPA 2M3EA 1FE6A 1LT9A 1SQBG 3L73G 1KQFB 2JP3A 3OAKA 1L4AA 1QX8A 2WSCH 2KLUA 1YQ4C 4GOEA 5KLVE 1R5SA 2YXQB 4KT0J 1OWAA 1EZVI 3H1IJ 1BGYD 1YITP 2XZRA 3L72J 1FZCB 3CCLP 2A06D 3H32A 1S5LE 2MKVA 1S2EA 5TISH 1GK6A 2I1KA 3M0DA 1VF5D 3L71D 5AW9B 2ZYDA 3ITKA 5AW7B 4C46A 2AEFA 4Y99C 1NTZJ 1VQ5P 1EDIA 3B5ND 4ASWA 5M1BA 2FYUJ 2FKWB 1E5WA 1T3UA 1Q7YQ 5KAIH 1OW7A 2J5UA 3JC22 3L70E 4TT3H 3R4YA 3PJSK 1VF5C 4UB6H 2JWDA 3KZIE 5APWA 4LC1A 4PD4I 2RN0A 1NTKK 2QJPC 1A02J 4H44B 1N2DC 1S1CX 3HE5B 4D6TD 4N78E 1AQTA 1BCCJ 3TGUD 1HWTC 2KSEA 1L0LE 2OARA 3AE1C 3B5NC 1BSHA 4OVNF 3BCCG 1RH5B 3AEGC 1VQKP 4DCKA 2IBZI 4H13B 3IAOA 1DEEG 3CWBD 1NTKG 3H1LE 5CHXA 3BASA 1HVVA 2WTYA 1SQBJ 3L73J 2WT7B 4H0LD 2J59M 2Q7CA 2IFMA 2SPZA 2I1JA 1AV1A 4HYTB 3BVHA 2RKLA 1DEBA 3G9RA 1KILE 1P84D 1QVFO 3IN6A 2E5TA 5H2FH 1LP1A 4WY4D 1ZXGA 2R5DA 2HFED 2OTKE 4GDOA 4BRYA 1KILB 2IPPA 3CL3D 3H1HD 1PZQA 1FJPA 2KK7A 4H0LC 1LWUC 1MZ9A 3FWLA 5CCGD 1PP9D 4RKUJ 3RL0B 1Q90D 4EDFA 5GTHE 2WMMA 4JBZA 2OYOA 1FZGA 1GW3A 2W90A 3P32A 1RF1B 2QA4P 1G1JA 1KYOD 1H0TA 4WY4C 2BEQD 2R5BA 5KLIB 4PV1B 5EFWB 2IYPA 1NKZB 1DX7A 4UB8E 1J1EC 3GHGC 3VP9A 2FFDB 3HD7D 2OYHC 3ZDMA 2G3AA 2D2CC 2W83C 3AE3C 1AFOA 1KB9I 5CCGC 1GMJA 3GW6A 3D70A 1DD3A 3B5NA 2ZJSE 1JCCA 1AA0A 1VQ6P 1NO4A 4WBAA 3BCCJ 4NPDA 1LTTC 2CPBA 4L75A 1YHQP 1NTMK 1GU4A 1BGYG 4IL6X 1NTKJ 1KN7A 1N7SB 2E43A 3CCMP 1P84H 3HD7C 3C9IA 4JYCA 1K04A 2POHA 1RQUA 2YMYA 3L71G 2IFNA 2FXPA 4IFDK 1NU1K 2JJLA 4DT0A 3MP7B 2BCCE 1NTMG 2NPSD 1JB0J 3FXDA 3C1LA 2Z5HA 1SQQD 5AW6B 2Y9YA 3L75D 2WITA 4AUWA 5KTBA 3Q5SA 1QLED 1NU1G 1LWUA 2H7HA 1KYOH 3S1KA 3CMAP 1EZVG 3H1KE 1MV8A 1KV4A 2FXOA 1AVOA 1ZN5A 2KP8A 4WY4A 2AXTH 3CXHI 1SQVK 2Q3IA 3GHGA 2JEEA 2OYHA 4PD4E 3U1CA 1L0NE 2Q5UA 2FBWC 3JSVC 5CCGA 1DH3A 3H25A 1EC5A 3A0BE 3MGNA 3V2NA 1SQVG 1LTGC 2B88A 2K9JA 3CX5E 2IBZE 5E79H 1Q86Q 1J1DB 3PTZA 4QMAA 1JY2N 1QGKB 2C9LY 3CCUP 2K1AA 1BGYJ 2Y0CA 5APQA 3HD7A 3RK2D 1PPJD 2L91A 3L74G 1Q81Q 3RK3B 1YTZT 3L71J 4ASVA 2BASA 3TSIA 2OTJP 1NTMJ 2FYNB 4YXDC 1SQXD 4WWIA 3EWKA 1KQSO 2Q3EA 3A3YB 1M1JC 3U1AA 1VQ9P 1L4AD 1N7LA 1GZLA 2PRRA 3EFFK 1HF9A 3Q5RA 2W6JH 3Q1MA 1VL2A 3MD0A 1NYHA 3T97A 5KLVD 1NU1J 1K05A 4HJGH 3H1IE 1ZRTE 3L72E 1AVYA 2QM8A 1FJKA 3LW5H 1T2KC 5AVWB 2P1JA 2Y0EA 3L4FA 4RESB 3W68A 3OA7A 1QL2A 4GODA 2YIUB 5AW4B 5AVQB 1FDIA 1NTZE 3M9HA 3WUVA 3U59A 1SFCB 4RO0A 1NTZK 1S9KD 1SQPK 1VQ7P 2FYUE 3BRVB 2E74D 1FOSF 3MUDC 4PJ0E 1SQQK 1X9VA 1SQVJ 5APVA 2KI7B 4EOTA 4AYCA 1HGVA 1GDTA 1SQPG 1FOSE 4XA4A 3EFGA 3AEBC 2W8ZA 1IFMA 2KS1A 1AJYA 4N78D 2JDIH 1BCCE 3AEAC 3WU2E 3S9OA 2AXCA 1SQQG 5BU5A 3I5CA 3L75G 1WT6A 2O01N 3NFQA 3L74J 2E74C 2MJZA 2NRGA 3CCEP 2FY8A 3A7OA 2QM7A 1M1JA 3GLMA 1SQBE 3L73E 3Q2YA 2G8YA 3F5HA 5AVVB 1L2PA 4OWFA 2W6AA 1ZMEC 1G1IA 1CI6A 3HUSB 1ZOYC 1N86A 1NAFA 2HPCB 1M56D 1S5LH 3AE5C 2ZXEB 3KQGA 3II6A 3CCQP 4DJGA 4W7YA 3AE7C 2UWJE 1PGOA 2OQQA 2A45H 2ZYGA 4L74A 3B8EB 2WPRA 3VYIA 2N1TB 4I7ZB 3I55P 1HH0A 1OVUA 2HODB 4RJTA 5TJHA 3USSA 2LXBA 4DOJA 2E76B 2C0XA 3IR9A 3UIAA 4L73A 3H1JG 3MUDA 1MUUA 1KILC 2IZ1A 2HG5D 1VQ4P 3SFDC 1QL1A 3AEEC 3KZIH 1JCDA 3TF5A 1T3JA 1T8ZA 5KJ7D 3G71P 3B4SA 4OGQD 3GF7A 3C8VA 2ZT9B 2XU6A 1RF1C 1KQGB 1SQPJ 3FXEA 1HUCA 3V2QA 1LTJC 2WSEH 1VQNP 3H32B 3G3ZA 3NMDA 2M3BA 1JY2O 5AW8B 5KLIC 1SQQJ 1XTCC 2WPVB 2Y9ZA 1UIXA 3BCCE 3L75J 3VMXA 5AW1B 2YNYA 2L5GB 1YTZI 1FDOA 1LGHB 4XE5B 1RF0C 1NTKE 3HE5A 2M5AA 1G2CB 5KJ7C 1P84I 5AVYB 5APXA 4OGQC 3O6QA 4R4LA 1KFNA 3TNUB 1S4XA 3WMM0 1GW4A 4N3YB 3SWKA 2QJYB 1EQ7A 1N73C 1JOCA 2XDJA 2WT7A 3F89A 5GTHH 1GD2E 1BE3G 1YJ9P 2GA1A 3E1IA 3P7KA 1KYOI 1LTBC 2LKMA 2OGUA 3O8ZA 3TDKA 1AQ5A 3V2RA 1VQPP 3H1KD 1FBMA 1KILA 3H1JJ 4UB8H 2V7QJ 2WQYC 2O1KA 4WB4A 3L37A 2D2CD 2CPSA 1YJWP 1RF1A 1L0ND 3K5BA 1OW8A 1HBWA 1HGZA 1GK4A 1LTJA 5KAFE 1N8RQ 2IZ0A 2WSFJ 4BRYB 3CX5D 3VOPA 5B5EH 1RF0A 2P10A 4Y99B 1BDDA 1BGYE 5KJ7A 3V2PA 1NH4A 1CZQA 2Y0DA 1IFIA 3E7KA 4KHXA 2K88A 1MFTA 5H2FE 3L71E 1ZLLA 4EYYQ 1NTME 1N73A 4U3FD 3D71A 1VF5B 2N9BA 1FS0E 2WSCJ 2OTLP 2QJPB 2A06G 5GTIE 1BE3J 1OX3A 3MHVA 1NU1E 3AE6C 1JEKA 1E79H 1KQLA 3B5NB 3H1ID 1ZW0A 1EZVE 3D6ZA 5APYA 3MZWB 5CJ0A 3VMAA 3QWOC 4IOIH 3AE8C 1PGPA 2R44A 3ABVC 1JY3N 2E75D 4Y28J 5CBNA 3A0BH 1URQD 2WSSH 1Y8AA 1GL2D 3OJAB 1SVFA 1IO4A 2XV5A 2HR3A 4IL6E 3CX5H 2FYUD 3SFEC 4IFFA 2YO2A 1IFNA 4D6TG 1SQVE 3MIWA 2YIUC 1QVGO 2M0BA 1FDMA 1NGMB 1KZUB 3TGUG 1SP4A 1IJDB 2WPSA 2KYVA 5KKZB 4H0LB 1LWUB 2H8PD 1P84E 1Y47A 3P8CD 2E75C 1XTGB 2QIWA 3KXDA 3M91A 1URQC 3JCUH 1GL2C 3CWBG 2YKPA 3WUUA 1YYCA 2ZAEB 3L74E 3MTUE 1MKMA 4ZKPA 3HTKA 4WY4B 4JQ0D 1R5LA 2FYZA 3B71A 1VPCA 1W5CE 1JY2P 1J1EB 3GHGB 3L73D 5AW2B 2OYHB 2QJKB 2B87B 4HKZH 3RK3E 1IFJA 5AVRB 1KYOE 4JF7A 5CCHC 1T2KD 3TK1A 3GMAA 4W7ZA 1J2JB 3LIDA 4ZKUA 2K9JB 1OW6A 3EQ2A 2GUVA 3H1HG 1HJBA 2XKMA 1PP9G 2A45I 4U7JA 3IFMA 1LTIC 2C9NY 2OYIB 3HD7B 2KZJA 1JTHA 1JMMA 1MFZA 4C7RA 3AE2C 3WUTA
chains in the Genus database with same CATH topology
1X0TA 1EC5A 2UWJE 4NPDA 4NPFX 2KS1B 1LP1B 2M0BA 2SPZA 4BXLA 1NVOA 2QRXA 2B88A 1MFTA 2RKLA 4MN4C 1Y47A 4EYYQ 1OVRA 5C39A 2KUBA 1OVUA 1LP1A 1ZXGA 2LXBA 5DJTB 4ZNCA 1U7MA 2OTKE 1JM0A 1U7JA 4HB1A 2ZAEB 2KI7B 4K35A 1EDIA 4ASWA 2B89A 4K3AA 3FXDA 1SS1A 3PH0A 3MHVA 4ASVA 2K3RA 2M5AB 1H0TB 1BDCA 2QVAA 2WMMA 2LR2A 4JBZA 4CPGA 2B87B 4WWIA 4HKZH 1ZW0A 2KZIA 4ZMDA 2P58A 3FXEA 3MZWB 5DJUB 3S1KA 1H0TA 5CBOA 3QWOC 4GOFA 2JWDA 4IOIH 2B87A 1EDJA 5EFWB 1EDLA 2R44A 4HJGH 5K5GB 4KJMA 1S3JA 3ZDMA 5CBNA 1LT1A 2I8DA 1Q2NA 1JMBA 2M5AA 2HR3A 1FC2C 2KZJA 4GOEA 1DEEG 2Q1KA 4NPEA 1OVVA 2KIKA 2LXCB 1EDKA 4GODA 3RGUA 1BDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X0T A;  1EC5 A;  2UWJ E;  4NPD A;  4NPF X;  2KS1 B;  1LP1 B;  2M0B A;  2SPZ A;  4BXL A;  1NVO A;  2QRX A;  2B88 A;  1MFT A;  2RKL A;  4MN4 C;  1Y47 A;  4EYY Q;  1OVR A;  5C39 A;  2KUB A;  1OVU A;  1LP1 A;  1ZXG A;  2LXB A;  5DJT B;  4ZNC A;  1U7M A;  2OTK E;  1JM0 A;  1U7J A;  4HB1 A;  2ZAE B;  2KI7 B;  4K35 A;  1EDI A;  4ASW A;  2B89 A;  4K3A A;  3FXD A;  1SS1 A;  3PH0 A;  3MHV A;  4ASV A;  2K3R A;  2M5A B;  1H0T B;  1BDC A;  2QVA A;  2WMM A;  2LR2 A;  4JBZ A;  4CPG A;  2B87 B;  4WWI A;  4HKZ H;  1ZW0 A;  2KZI A;  4ZMD A;  2P58 A;  3FXE A;  3MZW B;  5DJU B;  3S1K A;  1H0T A;  5CBO A;  3QWO C;  4GOF A;  2JWD A;  4IOI H;  2B87 A;  1EDJ A;  5EFW B;  1EDL A;  2R44 A;  4HJG H;  5K5G B;  4KJM A;  1S3J A;  3ZDM A;  5CBN A;  1LT1 A;  2I8D A;  1Q2N A;  1JMB A;  2M5A A;  2HR3 A;  1FC2 C;  2KZJ A;  4GOE A;  1DEE G;  2Q1K A;  4NPE A;  1OVV A;  2KIK A;  2LXC B;  1EDK A;  4GOD A;  3RGU A;  1BDD A; 
#chains in the Genus database with same CATH topology
 4PJ0 H;  4NPF X;  3L36 A;  1NVO A;  3SWF A;  1GU5 A;  4D6T J;  3VMY A;  2KB7 P;  3T97 B;  2C0W A;  3V4Q A;  2E76 C;  3TGU J;  4BWN A;  1PL5 A;  1SQP E;  4U3F G;  2PAJ A;  1KTM A;  1FZC C;  2H88 C;  1URQ A;  3CME P;  1IZN B;  1KB9 E;  1GL2 A;  2WVR A;  1SS1 A;  3CWB J;  4XFJ A;  1SQQ E;  1RHZ B;  4M3L A;  3L75 E;  3BCC D;  2NPS B;  3TYY A;  3LIE A;  3L70 D;  2WWW A;  4H44 D;  2HLO A;  2FXM A;  1NTK D;  4C7N B;  3AEC C;  1JNM A;  1BSN A;  4YXW H;  2PGD A;  4N6J A;  4LGD E;  1EDJ A;  2AEJ A;  1Y9B A;  2KNC A;  5CJ4 A;  4H13 D;  5CCH A;  1S3J A;  2GM4 A;  2KLV A;  1L0L D;  2W27 A;  3GG2 A;  2K9Y A;  1JMB A;  3PRJ A;  3H1H J;  4NPE A;  2QEX P;  1PP9 J;  1OVV A;  2KIK A;  2LXC B;  4HH2 A;  1FU1 A;  2WPQ A;  3H1L D;  1YIJ P;  4H44 C;  2ZFC A;  3V6I A;  1EDK A;  3R2P A;  2HPC A;  2KS1 B;  1X79 B;  2ZXX A;  1USD A;  2RMZ A;  4TLF A;  1JO5 A;  4EIJ A;  2O1J A;  2ZYA A;  4H13 C;  1PGQ A;  4I6M C;  1KIL D;  1OVR A;  5C39 A;  3H1J E;  1JY3 O;  2QE7 H;  2JWA A;  4AQR D;  1YQ3 C;  1S5L X;  4O9B A;  3RL0 D;  4I2L C;  3CXH E;  3HE4 B;  3PHL A;  1CI6 B;  5AVU B;  1CSB A;  5APT A;  1YI2 P;  3RK2 B;  1FZC A;  5B66 E;  4U3F J;  3A0H E;  2P67 A;  2KZI A;  4W80 A;  4PV1 D;  3VTP C;  2P58 A;  1D7M A;  1SQX K;  1FZF A;  2IX7 C;  3Q5P A;  4GIF A;  1LT9 B;  5L8R J;  1PPJ G;  3FGA D;  1L4A B;  1NWQ A;  1FZA A;  3H6P A;  3RL0 C;  5KLV K;  3PLN A;  4L76 A;  5K5G B;  4YTP C;  4OH8 B;  2YMK A;  2Q9I A;  1SQX G;  2NZ2 A;  3A5T A;  3NXS A;  5CMZ A;  2KXP B;  1PV3 A;  3N4X A;  4PV1 C;  1NTM D;  5KLV G;  1N7S D;  1G2C A;  2FFD C;  3PP5 A;  5AVZ B;  2ZVO B;  1S9K E;  3I56 P;  3CPW O;  3G6E P;  1BE3 E;  2VRS A;  3TNU A;  2JO1 A;  1NU1 D;  3M9Q A;  2E74 B;  4HB1 A;  3LW5 J;  1EZV D;  1QEX A;  1PIX A;  3BRT B;  2BCC D;  3CC4 P;  1RE3 C;  5TIS E;  4K35 A;  4WVZ A;  2A45 G;  3V4W A;  2B89 A;  2P2U A;  3PH0 A;  1N7S C;  2YO3 A;  2M5A B;  1BDC A;  1K9M Q;  2AEM A;  4CPG A;  1M57 D;  1WMK A;  2CK3 H;  3O6Q B;  5KAF H;  3L70 G;  3CX5 I;  3OW2 O;  1L0L K;  1CW5 A;  4GOF A;  3P8M C;  5KAI E;  4I1L A;  3N7N A;  1WRG A;  2DW3 A;  3KYQ A;  3RBX A;  2R3S A;  4KJM A;  1SQV D;  4A7P A;  1LT1 A;  1YJN P;  1Q2N A;  1IK7 A;  4UB6 E;  1L0L G;  1NHL A;  3A2A A;  1FC2 C;  4PD4 D;  3GF3 A;  1M8O B;  2JKV A;  3M9B A;  1IC2 A;  1RQV A;  3RGU A;  2KOG A;  3CCJ P;  1SQX J;  3H1L G;  4B86 A;  3L74 D;  1LP1 B;  3CCR P;  2QRX A;  1EXJ A;  5KKZ C;  2XNX A;  2IBZ D;  2FFD A;  5KLV J;  5GTI H;  2KUB A;  3G4S P;  1JUN A;  2R32 A;  3NTN A;  2B9B A;  1U7M A;  1X22 A;  1U7J A;  3IF4 A;  3RK3 D;  2A06 E;  3HRN A;  2Z4E A;  1LTJ B;  2PP6 A;  1RY3 A;  2H89 C;  3QH9 A;  3AE9 C;  1KOR A;  1H0T B;  1J1D C;  3S4R A;  1RE3 A;  2YKO A;  2QJK C;  1X8Y A;  1NJI Q;  1VQ8 P;  1N7S A;  3CC7 P;  5AW5 B;  3V5B A;  1UII A;  4OGQ B;  4IL6 H;  1VQL P;  1H89 A;  2YXR B;  1GTW A;  3RK3 C;  1EDL A;  1OFC X;  1OZH A;  3CCV P;  3L70 J;  1ZP0 C;  1ZRT D;  2FYN C;  3L72 D;  1N73 B;  2Q6Q A;  1M7L A;  5B5E E;  2Q1K A;  2OYI C;  2O01 H;  4D6T E;  2XND H;  1SFC D;  4PD4 H;  1HJ0 A;  3VMZ A;  3D6Y A;  1JY3 P;  2IYO A;  3TGU E;  1X0T A;  1NOH A;  1L0L J;  1NTZ D;  1SQP D;  3SWY A;  1KB9 D;  2WSE J;  4MN4 C;  3CWB E;  2K37 A;  2KSJ A;  3H1L J;  2Z5I A;  1PFI A;  1OXZ A;  4EI2 A;  2RH0 A;  1JM0 A;  1KC8 Q;  2QSI A;  2E5Y A;  2GUS A;  1LJ2 A;  1DD4 A;  5APU A;  1SFC C;  1KD1 Q;  2BCC G;  1ZV8 A;  3W67 A;  3FWN A;  1NKN A;  2E42 A;  1W2B O;  5CCH D;  1BCC D;  2NPS C;  4LLH A;  2PFX A;  1LNQ A;  3AE4 C;  1OIP A;  3SSU A;  1H8A A;  3H1H E;  1IK9 A;  2B87 A;  1PP9 E;  4JYB A;  3CC2 P;  2IDB A;  3L35 A;  3RBZ A;  1SQB D;  3H1K G;  2YKQ A;  5AW3 B;  2D2C B;  1L0N K;  1PGJ A;  3KPE A;  2I8D A;  2QG4 A;  5AVT B;  1T6A A;  5AVX B;  2ZVN B;  3M06 A;  1ZR4 A;  3HTK B;  1VQO P;  1FZE A;  3H1J D;  2AXT E;  2N1T D;  1L0N G;  2OYI A;  1ZR2 A;  3HUS C;  1S72 P;  1Z56 A;  3CXH D;  2E76 D;  3RL0 g;  1KB9 H;  3CI9 A;  1Q82 Q;  3JCU E;  2IBZ G;  4U3F E;  3CD6 P;  1TU3 F;  2ITA A;  2JR8 A;  1KFM A;  5E79 E;  4GKG A;  4K3A A;  5BU8 B;  1RE4 C;  4DZO A;  2ZT9 D;  2N1T C;  2V4H A;  1K8A Q;  4I7Z C;  3RK2 C;  3VN0 A;  1SFC A;  1JTH B;  5AVS B;  3M0A A;  3CCS P;  3WU2 H;  1OMI A;  2BCC J;  1VQM P;  5CBO A;  3Q3D A;  1LT9 C;  2NPS A;  1M90 Q;  2P7J A;  3AED C;  4Z1M H;  2H43 A;  1KMI Z;  1L4A C;  1FZB A;  1IFP A;  4C7N A;  3KHU A;  1YBK A;  3BAT A;  4JPZ B;  1R8E A;  1U57 A;  3H1I G;  3L72 G;  2ZT9 C;  2E75 B;  1H88 A;  1BE3 D;  3H1K J;  1URQ B;  1A02 F;  1GL2 B;  2FYU K;  2M8R A;  1M1K Q;  4GT1 A;  1EXI A;  4IFM A;  5BVZ A;  3M0D C;  2V7Q H;  1LTS C;  5APS A;  4BXL A;  3CLQ A;  1NTZ G;  3CXH H;  3AEF C;  2R3C A;  3P8C E;  2HYN A;  2O01 J;  1W2E A;  1HTL C;  3HUS A;  1L0N J;  5AW0 B;  2FYU G;  5DJT B;  1IFD A;  5B66 H;  4ZNC A;  2KNC B;  3A0H H;  4YPC A;  2QJY C;  2WSF H;  2O3J A;  3KDP B;  1VDF A;  2K3R A;  2BEZ F;  3FX0 A;  4R4M A;  2QVA A;  2LR2 A;  1USE A;  2N9Y B;  3HE4 A;  1FAV A;  3E1R A;  1SQB K;  1M1J B;  4ZMD A;  1RE4 A;  1BCC G;  2J58 A;  2N1T A;  1PPJ E;  2W6B A;  5DJU B;  2WZ7 A;  1NAY A;  2HOD A;  1K73 Q;  1LTA C;  1SLQ A;  1SQX E;  3VP8 A;  1DIP A;  2M3E A;  1FE6 A;  1LT9 A;  1SQB G;  3L73 G;  1KQF B;  2JP3 A;  3OAK A;  1L4A A;  1QX8 A;  2WSC H;  2KLU A;  1YQ4 C;  4GOE A;  5KLV E;  1R5S A;  2YXQ B;  4KT0 J;  1OWA A;  1EZV I;  3H1I J;  1BGY D;  1YIT P;  2XZR A;  3L72 J;  1FZC B;  3CCL P;  2A06 D;  3H32 A;  1S5L E;  2MKV A;  1S2E A;  5TIS H;  1GK6 A;  2I1K A;  3M0D A;  1VF5 D;  3L71 D;  5AW9 B;  2ZYD A;  3ITK A;  5AW7 B;  4C46 A;  2AEF A;  4Y99 C;  1NTZ J;  1VQ5 P;  1EDI A;  3B5N D;  4ASW A;  5M1B A;  2FYU J;  2FKW B;  1E5W A;  1T3U A;  1Q7Y Q;  5KAI H;  1OW7 A;  2J5U A;  3JC2 2;  3L70 E;  4TT3 H;  3R4Y A;  3PJS K;  1VF5 C;  4UB6 H;  2JWD A;  3KZI E;  5APW A;  4LC1 A;  4PD4 I;  2RN0 A;  1NTK K;  2QJP C;  1A02 J;  4H44 B;  1N2D C;  1S1C X;  3HE5 B;  4D6T D;  4N78 E;  1AQT A;  1BCC J;  3TGU D;  1HWT C;  2KSE A;  1L0L E;  2OAR A;  3AE1 C;  3B5N C;  1BSH A;  4OVN F;  3BCC G;  1RH5 B;  3AEG C;  1VQK P;  4DCK A;  2IBZ I;  4H13 B;  3IAO A;  1DEE G;  3CWB D;  1NTK G;  3H1L E;  5CHX A;  3BAS A;  1HVV A;  2WTY A;  1SQB J;  3L73 J;  2WT7 B;  4H0L D;  2J59 M;  2Q7C A;  2IFM A;  2SPZ A;  2I1J A;  1AV1 A;  4HYT B;  3BVH A;  2RKL A;  1DEB A;  3G9R A;  1KIL E;  1P84 D;  1QVF O;  3IN6 A;  2E5T A;  5H2F H;  1LP1 A;  4WY4 D;  1ZXG A;  2R5D A;  2HFE D;  2OTK E;  4GDO A;  4BRY A;  1KIL B;  2IPP A;  3CL3 D;  3H1H D;  1PZQ A;  1FJP A;  2KK7 A;  4H0L C;  1LWU C;  1MZ9 A;  3FWL A;  5CCG D;  1PP9 D;  4RKU J;  3RL0 B;  1Q90 D;  4EDF A;  5GTH E;  2WMM A;  4JBZ A;  2OYO A;  1FZG A;  1GW3 A;  2W90 A;  3P32 A;  1RF1 B;  2QA4 P;  1G1J A;  1KYO D;  1H0T A;  4WY4 C;  2BEQ D;  2R5B A;  5KLI B;  4PV1 B;  5EFW B;  2IYP A;  1NKZ B;  1DX7 A;  4UB8 E;  1J1E C;  3GHG C;  3VP9 A;  2FFD B;  3HD7 D;  2OYH C;  3ZDM A;  2G3A A;  2D2C C;  2W83 C;  3AE3 C;  1AFO A;  1KB9 I;  5CCG C;  1GMJ A;  3GW6 A;  3D70 A;  1DD3 A;  3B5N A;  2ZJS E;  1JCC A;  1AA0 A;  1VQ6 P;  1NO4 A;  4WBA A;  3BCC J;  4NPD A;  1LTT C;  2CPB A;  4L75 A;  1YHQ P;  1NTM K;  1GU4 A;  1BGY G;  4IL6 X;  1NTK J;  1KN7 A;  1N7S B;  2E43 A;  3CCM P;  1P84 H;  3HD7 C;  3C9I A;  4JYC A;  1K04 A;  2POH A;  1RQU A;  2YMY A;  3L71 G;  2IFN A;  2FXP A;  4IFD K;  1NU1 K;  2JJL A;  4DT0 A;  3MP7 B;  2BCC E;  1NTM G;  2NPS D;  1JB0 J;  3FXD A;  3C1L A;  2Z5H A;  1SQQ D;  5AW6 B;  2Y9Y A;  3L75 D;  2WIT A;  4AUW A;  5KTB A;  3Q5S A;  1QLE D;  1NU1 G;  1LWU A;  2H7H A;  1KYO H;  3S1K A;  3CMA P;  1EZV G;  3H1K E;  1MV8 A;  1KV4 A;  2FXO A;  1AVO A;  1ZN5 A;  2KP8 A;  4WY4 A;  2AXT H;  3CXH I;  1SQV K;  2Q3I A;  3GHG A;  2JEE A;  2OYH A;  4PD4 E;  3U1C A;  1L0N E;  2Q5U A;  2FBW C;  3JSV C;  5CCG A;  1DH3 A;  3H25 A;  1EC5 A;  3A0B E;  3MGN A;  3V2N A;  1SQV G;  1LTG C;  2B88 A;  2K9J A;  3CX5 E;  2IBZ E;  5E79 H;  1Q86 Q;  1J1D B;  3PTZ A;  4QMA A;  1JY2 N;  1QGK B;  2C9L Y;  3CCU P;  2K1A A;  1BGY J;  2Y0C A;  5APQ A;  3HD7 A;  3RK2 D;  1PPJ D;  2L91 A;  3L74 G;  1Q81 Q;  3RK3 B;  1YTZ T;  3L71 J;  4ASV A;  2BAS A;  3TSI A;  2OTJ P;  1NTM J;  2FYN B;  4YXD C;  1SQX D;  4WWI A;  3EWK A;  1KQS O;  2Q3E A;  3A3Y B;  1M1J C;  3U1A A;  1VQ9 P;  1L4A D;  1N7L A;  1GZL A;  2PRR A;  3EFF K;  1HF9 A;  3Q5R A;  2W6J H;  3Q1M A;  1VL2 A;  3MD0 A;  1NYH A;  3T97 A;  5KLV D;  1NU1 J;  1K05 A;  4HJG H;  3H1I E;  1ZRT E;  3L72 E;  1AVY A;  2QM8 A;  1FJK A;  3LW5 H;  1T2K C;  5AVW B;  2P1J A;  2Y0E A;  3L4F A;  4RES B;  3W68 A;  3OA7 A;  1QL2 A;  4GOD A;  2YIU B;  5AW4 B;  5AVQ B;  1FDI A;  1NTZ E;  3M9H A;  3WUV A;  3U59 A;  1SFC B;  4RO0 A;  1NTZ K;  1S9K D;  1SQP K;  1VQ7 P;  2FYU E;  3BRV B;  2E74 D;  1FOS F;  3MUD C;  4PJ0 E;  1SQQ K;  1X9V A;  1SQV J;  5APV A;  2KI7 B;  4EOT A;  4AYC A;  1HGV A;  1GDT A;  1SQP G;  1FOS E;  4XA4 A;  3EFG A;  3AEB C;  2W8Z A;  1IFM A;  2KS1 A;  1AJY A;  4N78 D;  2JDI H;  1BCC E;  3AEA C;  3WU2 E;  3S9O A;  2AXC A;  1SQQ G;  5BU5 A;  3I5C A;  3L75 G;  1WT6 A;  2O01 N;  3NFQ A;  3L74 J;  2E74 C;  2MJZ A;  2NRG A;  3CCE P;  2FY8 A;  3A7O A;  2QM7 A;  1M1J A;  3GLM A;  1SQB E;  3L73 E;  3Q2Y A;  2G8Y A;  3F5H A;  5AVV B;  1L2P A;  4OWF A;  2W6A A;  1ZME C;  1G1I A;  1CI6 A;  3HUS B;  1ZOY C;  1N86 A;  1NAF A;  2HPC B;  1M56 D;  1S5L H;  3AE5 C;  2ZXE B;  3KQG A;  3II6 A;  3CCQ P;  4DJG A;  4W7Y A;  3AE7 C;  2UWJ E;  1PGO A;  2OQQ A;  2A45 H;  2ZYG A;  4L74 A;  3B8E B;  2WPR A;  3VYI A;  2N1T B;  4I7Z B;  3I55 P;  1HH0 A;  1OVU A;  2HOD B;  4RJT A;  5TJH A;  3USS A;  2LXB A;  4DOJ A;  2E76 B;  2C0X A;  3IR9 A;  3UIA A;  4L73 A;  3H1J G;  3MUD A;  1MUU A;  1KIL C;  2IZ1 A;  2HG5 D;  1VQ4 P;  3SFD C;  1QL1 A;  3AEE C;  3KZI H;  1JCD A;  3TF5 A;  1T3J A;  1T8Z A;  5KJ7 D;  3G71 P;  3B4S A;  4OGQ D;  3GF7 A;  3C8V A;  2ZT9 B;  2XU6 A;  1RF1 C;  1KQG B;  1SQP J;  3FXE A;  1HUC A;  3V2Q A;  1LTJ C;  2WSE H;  1VQN P;  3H32 B;  3G3Z A;  3NMD A;  2M3B A;  1JY2 O;  5AW8 B;  5KLI C;  1SQQ J;  1XTC C;  2WPV B;  2Y9Z A;  1UIX A;  3BCC E;  3L75 J;  3VMX A;  5AW1 B;  2YNY A;  2L5G B;  1YTZ I;  1FDO A;  1LGH B;  4XE5 B;  1RF0 C;  1NTK E;  3HE5 A;  2M5A A;  1G2C B;  5KJ7 C;  1P84 I;  5AVY B;  5APX A;  4OGQ C;  3O6Q A;  4R4L A;  1KFN A;  3TNU B;  1S4X A;  3WMM 0;  1GW4 A;  4N3Y B;  3SWK A;  2QJY B;  1EQ7 A;  1N73 C;  1JOC A;  2XDJ A;  2WT7 A;  3F89 A;  5GTH H;  1GD2 E;  1BE3 G;  1YJ9 P;  2GA1 A;  3E1I A;  3P7K A;  1KYO I;  1LTB C;  2LKM A;  2OGU A;  3O8Z A;  3TDK A;  1AQ5 A;  3V2R A;  1VQP P;  3H1K D;  1FBM A;  1KIL A;  3H1J J;  4UB8 H;  2V7Q J;  2WQY C;  2O1K A;  4WB4 A;  3L37 A;  2D2C D;  2CPS A;  1YJW P;  1RF1 A;  1L0N D;  3K5B A;  1OW8 A;  1HBW A;  1HGZ A;  1GK4 A;  1LTJ A;  5KAF E;  1N8R Q;  2IZ0 A;  2WSF J;  4BRY B;  3CX5 D;  3VOP A;  5B5E H;  1RF0 A;  2P10 A;  4Y99 B;  1BDD A;  1BGY E;  5KJ7 A;  3V2P A;  1NH4 A;  1CZQ A;  2Y0D A;  1IFI A;  3E7K A;  4KHX A;  2K88 A;  1MFT A;  5H2F E;  3L71 E;  1ZLL A;  4EYY Q;  1NTM E;  1N73 A;  4U3F D;  3D71 A;  1VF5 B;  2N9B A;  1FS0 E;  2WSC J;  2OTL P;  2QJP B;  2A06 G;  5GTI E;  1BE3 J;  1OX3 A;  3MHV A;  1NU1 E;  3AE6 C;  1JEK A;  1E79 H;  1KQL A;  3B5N B;  3H1I D;  1ZW0 A;  1EZV E;  3D6Z A;  5APY A;  3MZW B;  5CJ0 A;  3VMA A;  3QWO C;  4IOI H;  3AE8 C;  1PGP A;  2R44 A;  3ABV C;  1JY3 N;  2E75 D;  4Y28 J;  5CBN A;  3A0B H;  1URQ D;  2WSS H;  1Y8A A;  1GL2 D;  3OJA B;  1SVF A;  1IO4 A;  2XV5 A;  2HR3 A;  4IL6 E;  3CX5 H;  2FYU D;  3SFE C;  4IFF A;  2YO2 A;  1IFN A;  4D6T G;  1SQV E;  3MIW A;  2YIU C;  1QVG O;  2M0B A;  1FDM A;  1NGM B;  1KZU B;  3TGU G;  1SP4 A;  1IJD B;  2WPS A;  2KYV A;  5KKZ B;  4H0L B;  1LWU B;  2H8P D;  1P84 E;  1Y47 A;  3P8C D;  2E75 C;  1XTG B;  2QIW A;  3KXD A;  3M91 A;  1URQ C;  3JCU H;  1GL2 C;  3CWB G;  2YKP A;  3WUU A;  1YYC A;  2ZAE B;  3L74 E;  3MTU E;  1MKM A;  4ZKP A;  3HTK A;  4WY4 B;  4JQ0 D;  1R5L A;  2FYZ A;  3B71 A;  1VPC A;  1W5C E;  1JY2 P;  1J1E B;  3GHG B;  3L73 D;  5AW2 B;  2OYH B;  2QJK B;  2B87 B;  4HKZ H;  3RK3 E;  1IFJ A;  5AVR B;  1KYO E;  4JF7 A;  5CCH C;  1T2K D;  3TK1 A;  3GMA A;  4W7Z A;  1J2J B;  3LID A;  4ZKU A;  2K9J B;  1OW6 A;  3EQ2 A;  2GUV A;  3H1H G;  1HJB A;  2XKM A;  1PP9 G;  2A45 I;  4U7J A;  3IFM A;  1LTI C;  2C9N Y;  2OYI B;  3HD7 B;  2KZJ A;  1JTH A;  1JMM A;  1MFZ A;  4C7R A;  3AE2 C;  3WUT A; 
#chains in the Genus database with same CATH homology
 1X0T A;  1EC5 A;  2UWJ E;  4NPD A;  4NPF X;  2KS1 B;  1LP1 B;  2M0B A;  2SPZ A;  4BXL A;  1NVO A;  2QRX A;  2B88 A;  1MFT A;  2RKL A;  4MN4 C;  1Y47 A;  4EYY Q;  1OVR A;  5C39 A;  2KUB A;  1OVU A;  1LP1 A;  1ZXG A;  2LXB A;  5DJT B;  4ZNC A;  1U7M A;  2OTK E;  1JM0 A;  1U7J A;  4HB1 A;  2ZAE B;  2KI7 B;  4K35 A;  1EDI A;  4ASW A;  2B89 A;  4K3A A;  3FXD A;  1SS1 A;  3PH0 A;  3MHV A;  4ASV A;  2K3R A;  2M5A B;  1H0T B;  1BDC A;  2QVA A;  2WMM A;  2LR2 A;  4JBZ A;  4CPG A;  2B87 B;  4WWI A;  4HKZ H;  1ZW0 A;  2KZI A;  4ZMD A;  2P58 A;  3FXE A;  3MZW B;  5DJU B;  3S1K A;  1H0T A;  5CBO A;  3QWO C;  4GOF A;  2JWD A;  4IOI H;  2B87 A;  1EDJ A;  5EFW B;  1EDL A;  2R44 A;  4HJG H;  5K5G B;  4KJM A;  1S3J A;  3ZDM A;  5CBN A;  1LT1 A;  2I8D A;  1Q2N A;  1JMB A;  2M5A A;  2HR3 A;  1FC2 C;  2KZJ A;  4GOE A;  1DEE G;  2Q1K A;  4NPE A;  1OVV A;  2KIK A;  2LXC B;  1EDK A;  4GOD A;  3RGU A;  1BDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...