5DJTB

Crystal structure of lov2 (c450a) domain in complex with zdk2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
59
structure length
59
Chain Sequence
SVDNKFNKEMLSARVEIYGLPNLNWGQRFAFISSLTDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NPH1-2
publication title LOVTRAP: an optogenetic system for photoinduced protein dissociation.
pubmed doi rcsb
source organism Avena sativa
molecule tags Signaling protein
total genus 22
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2015-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5djtB00
2KZJA 1LT1A 2I8DA 4WWIA 1FC2C 1U7MA 2LXCB 2M5AB 4GODA 4BXLA 3FXDA 2KZIA 5C39A 1LP1A 5DJUB 1Y47A 2JWDA 4EYYQ 2K3RA 4HKZH 4GOFA 1EDKA 2M5AA 1DEEG 4ASWA 1EDIA 1JMBA 2HR3A 4K3AA 2QVAA 4ASVA 4NPEA 5CBOA 1EDJA 1OVVA 2QRXA 3QWOC 1EDLA 1SS1A 4ZMDA 3ZDMA 5DJTB 1NVOA 1OVUA 4GOEA 4ZNCA 2B89A 2WMMA 4NPFX 1X0TA 5K5GB 3MHVA 4IOIH 2KS1B 1BDCA 3S1KA 1ZXGA 1JM0A 2P58A 4HB1A 4KJMA 1EC5A 1Q2NA 1S3JA 2M0BA 1U7JA 2B87B 4CPGA 2KUBA 2ZAEB 2KIKA 4K35A 2RKLA 1H0TB 2SPZA 4JBZA 2KI7B 2OTKE 4NPDA 2B87A 5EFWB 3PH0A 3FXEA 4MN4C 2B88A 2LXBA 2UWJE 3MZWB 4HJGH 1H0TA 1ZW0A 2LR2A 1MFTA 5CBNA 1BDDA 3RGUA 1OVRA 2R44A 1LP1B 2Q1KA
chains in the Genus database with same CATH superfamily
3AE4C 3PHLA 1YTZT 2N1TA 3HE5B 3U1AA 4UB8E 2JJLA 5CJ4A 1RHZB 3C8VA 5AVYB 2Z5IA 1J2JB 3AEFC 5DJUB 3D71A 2IBZG 2OYHA 2HLOA 4PD4E 3IF4A 1RF1A 2QVAA 3TGUD 2N9BA 1JTHB 1J1DC 3AE8C 1GTWA 2QRXA 1AQTA 1SS1A 2N1TC 2WSCH 2E75D 1QVGO 1K8AQ 5AW7B 2WVRA 2B89A 3L70D 4H0LC 1VQOP 2ZYDA 1AQ5A 2WWWA 1VQPP 2OYHC 5KAFE 3L73J 1SP4A 1NTZG 1NTKG 1RF1C 4HYTB 2OARA 3BCCE 1FU1A 1GK4A 5AW4B 2YKPA 1CSBA 3F89A 5KLIB 3AE7C 1KILD 3BVHA 1ZR2A 5KLVE 1BE3G 2V7QJ 1W2BO 3EWKA 1BCCJ 1BSNA 3G4SP 2ZVNB 1JY2P 2P2UA 4C7NB 2LXBA 3PTZA 3H1ID 2XZRA 1VQ4P 1EZVD 3HD7A 3CWBJ 1GD2E 3BCCD 3L74G 1A02J 2XU6A 3A2AA 3H6PA 1PIXA 2YNYA 2IZ1A 4GODA 4OGQD 1NTZE 4BRYA 1URQB 3KQGA 4IFFA 4IFDK 2HODB 1Y47A 1VQNP 3U1CA 3HD7C 3H1HE 3H1LD 1KORA 1M1JA 3CXHI 3USSA 4RO0A 1Q86Q 2A06D 4W7ZA 5KAIE 3ITKA 2FY8A 1W5CE 3L74E 3FX0A 1GW3A 2XKMA 3L35A 1NTZJ 1NTKJ 1RQVA 3D6ZA 2Y9ZA 2E74C 1M1JC 4TT3H 2M0BA 2A45I 3B5NB 2BCCG 1P84I 1BGYG 1BE3J 5BU8B 3OA7A 2WPQA 1USEA 4Z1MH 2HFED 4TLFA 4UB8H 2ZYAA 3HUSB 2IYPA 2L91A 4MN4C 1IC2A 4WY4A 2JEEA 3QH9A 4OGQB 5BU5A 1OW7A 3M9BA 4PD4H 1PZQA 2QSIA 4JPZB 1NKNA 3P8CE 3NTNA 2FYUE 1W2EA 3WMM0 1TU3F 1K9MQ 1L4AB 1VDFA 4UB6E 4Y99C 1OX3A 1AVYA 5B5EE 1FZCB 3VTPC 1NGMB 5C39A 4WY4C 2BCCE 4WB4A 1CI6A 5KAFH 1K73Q 1GMJA 2C0XA 1VL2A 3P8CD 1X8YA 1N8RQ 2FYUD 2NZ2A 1ZOYC 3PJSK 2FYNC 2YXQB 1LT9A 1AV1A 3V2QA 3H1KD 1R8EA 1FJPA 3H32B 4IL6X 4N78D 3KPEA 1NAFA 5E79E 1KB9I 4HB1A 2BCCJ 1BGYJ 3PRJA 3I56P 1MV8A 3CXHE 3T97B 1LT9C 4DOJA 2JR8A 3MGNA 4NPDA 3RBXA 1PV3A 5AVSB 5AW0B 1WRGA 2D2CC 2K37A 1L0NE 2M3EA 3HTKB 1S5LX 3B8EB 2WTYA 2C9LY 4PJ0E 1N7SA 2H7HA 1BDDA 1OVRA 2E76C 3KZIH 3VMZA 3CXHD 1OIPA 2GUVA 1U7MA 1IJDB 1QX8A 5KAIH 5AW1B 1LTJB 3L72D 1VQ9P 2QG4A 2WITA 1KMIZ 4EI2A 1L0ND 2WT7A 1IFMA 3BASA 1Q81Q 3RK3C 1JY3O 3CCUP 1FZAA 1YJWP 2HR3A 1MFZA 2KP8A 1YITP 2B9BA 1AFOA 1SQPD 1NU1G 2W6BA 3KYQA 1GU4A 1ZRTE 1P84D 2RN0A 1GL2D 2R3SA 2JWAA 4H13D 5BVZA 2XNXA 3AE6C 1ZP0C 5M1BA 1YYCA 3NMDA 1KFMA 2Z5HA 4M3LA 3H1JJ 3WUVA 1IFDA 1Q2NA 2GM4A 5GTHE 2H8PD 4CPGA 1S2EA 2BASA 1ZRTD 3CCQP 4UB6H 1R5LA 4AYCA 2QJKC 2OTKE 1G2CB 2ZVOB 5B5EH 4Y28J 1QVFO 1MZ9A 4RESB 3RL0D 1SVFA 4R4MA 4ZKUA 4L75A 1KV4A 1PPJG 2KLUA 1QL2A 3RGUA 1G1IA 2KNCB 2AEJA 1AVOA 1FOSE 5CCGD 3S9OA 1VQLP 1HF9A 4PD4I 3FXDA 5KJ7D 3Q5RA 1SQXG 2QJPC 2KYVA 5AW5B 2OYIB 1L0LD 1J1EB 1JY3N 2NPSD 2M5AA 3GLMA 1T6AA 1YBKA 2FXPA 1M57D 5E79H 1NU1J 2YMYA 5APVA 1YI2P 1KB9D 5APSA 4A7PA 4PV1C 1LTTC 3CXHH 1QLED 2YIUB 1FAVA 5APXA 3UIAA 4PJ0H 1X9VA 4KJMA 2I1KA 1SQXE 1GDTA 5AVVB 3V2RA 5KKZC 1JNMA 1LTGC 2A45H 1G1JA 2QJYB 3AE5C 2WPVB 4EIJA 1SQBK 2O01N 4JYCA 1NKZB 1HTLC 1JOCA 1SFCD 1SQQK 4GKGA 4C7RA 4RJTA 3MD0A 3M0DA 1NH4A 3VMYA 3M91A 1OW6A 3L71G 4QMAA 1SQVD 1FC2C 1VF5B 5L8RJ 1K04A 2AXTE 3L70G 4XFJA 4BWNA 5AW9B 5AW3B 1T3UA 2Q5UA 3M0DC 3V5BA 1IK9A 1VQ6P 5GTHH 2R5BA 2G8YA 1SQVK 3QWOC 1EDLA 3KHUA 1FZGA 3WU2E 3L73E 3RBZA 2ZT9C 1JCDA 3IR9A 3RK2C 3HE4B 3TYYA 1NTMK 3L71E 1X0TA 2AEMA 1URQD 3S4RA 4GDOA 1VQMP 1BCCE 3AE1C 3O8ZA 1EC5A 2KSEA 4D6TG 1FZBA 3E7KA 4AUWA 2WSEH 1KB9H 3L73D 3G9RA 1H0TB 3BATA 2KS1A 1SFCB 1RE3C 2Y0CA 3CWBE 3D6YA 2NRGA 1PP9G 1E5WA 3L4FA 1WMKA 3CCMP 3CCVP 5EFWB 4PD4D 2W27A 1J1DB 3IAOA 2QM7A 2N1TB 1BCCD 3LW5J 3L71J 1OXZA 2V4HA 2IBZE 1S72P 4H0LB 3SWYA 2WSSH 4W80A 2OYHB 3L70J 1D7MA 3CWBD 3B5ND 1RF1B 4L73A 2ZJSE 1LWUA 1YTZI 3LIDA 2CK3H 4GOFA 1EDKA 3CD6P 2ZYGA 5AVZB 4DCKA 5CBOA 1EDJA 5KLVD 1NTKE 3TSIA 1HBWA 1IFJA 3TDKA 1S9KE 2BEZF 4C46A 2E75C 4ZMDA 2YO2A 1KILA 3H1IJ 5APYA 1LWUC 2WMMA 1L4AD 1BE3E 2HPCA 3B71A 4D6TJ 5AVXB 5AW6B 5KLVK 2W6AA 1NTZD 3SSUA 4EOTA 1HJBA 3Q5PA 3AECC 1PP9J 1KILC 3AE3C 3HD7B 1JY3P 1VQ8P 2B87A 2AXTH 3H1HD 2POHA 1NOHA 1JUNA 1MFTA 2H88C 4JF7A 4BRYB 3G71P 1CZQA 2JDIH 1LTIC 4U3FG 4WWIA 2FKWB 2ZFCA 1M8OB 3GG2A 3CC4P 3L74D 3HRNA 2E74B 1T2KD 4I7ZC 4OGQC 2I1JA 3L36A 2JWDA 3LW5H 2PRRA 5TISE 1SLQA 1JMBA 1OFCX 2V7QH 4K3AA 3MIWA 2XV5A 2Y9YA 3AEGC 3L75G 3V4QA 1JEKA 4JYBA 2JO1A 2M8RA 1NVOA 1BGYE 3G3ZA 1NO4A 1YQ4C 4NPFX 3SFEC 2O01J 1YIJP 3KXDA 2L5GB 1ZXGA 1JM0A 4N3YB 1Q90D 4WY4B 2WQYC 3A0HE 3V2PA 3CI9A 5KTBA 1VPCA 2H43A 2KI7B 2BCCD 2W90A 1BGYD 4YTPC 3LIEA 3FXEA 3ABVC 1ZMEC 1KQSO 2J59M 2OQQA 3L75E 1T3JA 2FYNB 1Q7YQ 1H88A 3H1JG 4GIFA 2FYUK 1QEXA 5CBNA 2XDJA 3N7NA 1N7SD 2KB7P 2XNDH 4U3FJ 1T8ZA 1JY2O 1KN7A 2CPSA 1CI6B 2R3CA 2DW3A 1GK6A 4BXLA 2KZIA 1JB0J 2HG5D 1UIIA 4I6MC 1HVVA 1DH3A 1LP1A 3I55P 2RMZA 2HYNA 1LT9B 3B4SA 1R5SA 1QL1A 3L75J 1OMIA 1LTJC 1OVVA 3CX5I 2D2CB 3H1JE 2WZ7A 3OJAB 1LGHB 1JMMA 2E76B 1DD3A 1M56D 2W8ZA 3OAKA 4H44D 4YXWH 1U7JA 2PFXA 2K9JA 2KIKA 1NWQA 3II6A 5CMZA 2KSJA 1L0NK 1N7LA 1N7SB 3GHGA 2ITAA 2IPPA 2Y0EA 2IFNA 4W7YA 3PH0A 2ZXXA 3MZWB 1HJ0A 1SQPJ 1SQPK 1ZV8A 2OTJP 1YJ9P 5CCHD 3W67A 1YJNP 3MTUE 3AE9C 2WT7B 5TJHA 1IFPA 1CW5A 3GHGC 1NU1E 3A7OA 3CC2P 1GL2A 1SQBG 1PGPA 2W6JH 2K1AA 1LTBC 3VYIA 4HKZH 1FDMA 1SQQG 3EFFK 1HGVA 1VQ7P 1USDA 5CHXA 2QJKB 1NAYA 2OGUA 2OYIC 1AJYA 3A0HH 3Q1MA 4H44B 1UIXA 5GTIE 1NU1D 1OZHA 1GL2C 4H13C 1VF5D 5K5GB 1LJ2A 2Y0DA 1BDCA 1LTAC 2P7JA 3O6QA 1RQUA 2P58A 2YKOA 3SWKA 1HH0A 1N73A 2KUBA 1SQBE 2QJPB 1SQVG 1KYOI 1PPJE 3JCUE 1SQQE 3CX5E 3TNUA 1L0LK 4LLHA 1NTMG 4U7JA 2QE7H 5KJ7A 4HH2A 2K9YA 2IBZI 2IDBA 2B88A 3H25A 1X79B 3RL0C 4PV1B 5AW2B 1VQKP 2NPSA 2FFDA 1M7LA 1N73C 5APUA 2E42A 4OH8B 2Q1KA 1PPJD 1N2DC 3VMXA 1EQ7A 1LT1A 2PP6A 2Q7CA 5CCGC 2M5AB 3CX5D 1E79H 3CPWO 1SQBJ 3L37A 2P67A 3V4WA 3FWLA 5KJ7C 2P1JA 1SQQJ 3CCJP 3TGUG 2K3RA 1SQXD 3HE5A 2NPSC 2FFDC 5APTA 1EDIA 1GU5A 1FE6A 2J5UA 1NTME 1HWTC 2O3JA 2N1TD 4EDFA 3F5HA 2YXRB 3AE2C 3TK1A 1KQLA 3M9QA 1M90Q 1YHQP 4H0LD 1JTHA 1ZLLA 2N9YB 3S1KA 1L2PA 1SQVJ 2P10A 5AVTB 3FWNA 1RE3A 4KT0J 3TGUE 1M1KQ 2FXMA 1NTMJ 2IZ0A 2FXOA 3H1IG 1A02F 1EZVG 2AXCA 2QEXP 3AEDC 3AEBC 3D70A 3BCCG 1ZW0A 2Q9IA 1RH5B 3L70E 2ZT9B 1SFCC 3NFQA 2YKQA 4I2LC 5KLVG 3RK2B 4C7NA 3RL0g 1FS0E 5APWA 3L71D 1KYOE 1JO5A 3CCSP 3K5BA 5GTIH 1KILE 1RF0A 3TGUJ 2E5TA 1FDIA 3H1LG 3CL3D 5KLIC 4EYYQ 3HD7D 4R4LA 2A06G 2QA4P 1URQA 4ASWA 2ZXEB 3H1IE 4IL6E 2BEQD 4KHXA 1EZVE 2HODA 2WSFJ 4D6TE 3EFGA 1KYOD 2IX7C 3JCUH 3GMAA 2FBWC 1KTMA 3CX5H 1RF0C 2R5DA 4GOEA 3H1HG 3N4XA 2PAJA 1GZLA 2E74D 1PP9E 2KS1B 3FGAD 4GT1A 1H8AA 2IBZD 1URQC 2KK7A 4XA4A 2OTLP 3IN6A 1S5LE 3H1LE 2ZAEB 4K35A 3JSVC 3MUDA 1XTCC 1QGKB 4D6TD 2SPZA 2A06E 1NYHA 3SFDC 4RKUJ 2E5YA 4I1LA 2C0WA 3B5NA 3BCCJ 3V2NA 1K05A 4WBAA 1PP9D 2VRSA 5KLVJ 2JKVA 1NTKD 2E75B 3HUSA 4WVZA 3KDPB 4N6JA 1S9KD 1LWUB 3CMAP 3MUDC 2KZJA 3KZIE 2I8DA 4L74A 1OWAA 2KOGA 3Q5SA 3H1LJ 1BE3D 3B5NC 3E1RA 4WY4D 2KLVA 1RY3A 2MJZA 2O1KA 1KQFB 1L4AA 3VOPA 2FYUG 3GF7A 2K88A 1FBMA 1NTZK 1NTKK 5CJ0A 1KILB 3HUSC 3OW2O 1DIPA 1FZCA 4L76A 4AQRD 3WU2H 2AEFA 2HPCB 1M1JB 3H1KG 3H1HJ 3CMEP 1Q82Q 3ZDMA 1OVUA 3G6EP 3Q2YA 3BRTB 3MHVA 1L4AC 1DX7A 1U57A 2M3BA 1FZCC 4I7ZB 2WSFH 2B87B 3L74J 3H32A 5AW8B 2OYOA 2YMKA 3CCRP 4DJGA 4LGDE 1KYOH 2D2CD 4U3FE 5AVQB 4Y99B 3P8MC 3T97A 3RK3E 1XTGB 2QIWA 3H1KE 4ZKPA 1FZEA 2H89C 3IFMA 3V6IA 5H2FE 3EQ2A 2E76D 3E1IA 4N78E 4IL6H 2R44A 2IYOA 3A5TA 3L72G 1Y9BA 3HTKA 2LXCB 1L0NG 4U3FD 1T2KC 3U59A 2G3AA 3BRVB 1PFIA 1FDOA 2FYUJ 3CCEP 3RK3D 2RH0A 1SQPG 3NXSA 1DD4A 2A45G 1LTJA 4ASVA 2E43A 3H1KJ 1S5LH 3AEEC 1YQ3C 4IFMA 1AA0A 1RE4A 3L75D 4ZNCA 2WPSA 3CLQA 3L72E 4IOIH 1PGOA 1IK7A 3P32A 2C9NY 1LNQA 1S3JA 3SWFA 1FJKA 2MKVA 1PL5A 1LTSC 1SQPE 1RE4C 1FZFA 4DZOA 1P84E 3AEAC 3Q3DA 5AVWB 2LR2A 3VP9A 2JP3A 1S1CX 1S4XA 1G2CA 3L72J 1N7SC 4OWFA 3RK3B 1LP1B 3H1JD 1L0NJ 2CPBA 2Q3EA 2WPRA 2O01H 3CCLP 5B66E 1L0LG 2QM8A 2O1JA 3PP5A 3WUTA 4B86A 1KFNA 2KNCA 1KQGB 1KC8Q 1JCCA 3VP8A 3PLNA 5TISH 1JY2N 5AVRB 1FOSF 3A0BE 4YPCA 1EXIA 3CC7P 1N86A 1IFIA 4NPEA 2OYIA 4PV1D 1HUCA 3R2PA 5AVUB 5DJTB 2Q6QA 2K9JB 1Y8AA 3M0AA 1OW8A 1NHLA 3W68A 3GF3A 3I5CA 1L0LE 4H44C 3GHGB 5H2FH 4LC1A 1J1EC 3JC22 5CCHA 1VQ5P 4XE5B 1H89A 4JQ0D 1KB9E 4JBZA 1Z56A 2YO3A 3MP7B 1KD1Q 2UWJE 4HJGH 2Q3IA 4OVNF 2KXPB 2W83C 1KZUB 1MUUA 1IZNB 5CCHC 1GL2B 2IFMA 5CCGA 4H13B 4DT0A 2YIUC 1L0LJ 1NU1K 4O9BA 2GUSA 3GW6A 1GW4A 2WSCJ 2WSEJ 1EZVI 2QJYC 3C9IA 1DEBA 1DEEG 1SQBD 3M9HA 2LKMA 1SQQD 2R32A 2Z4EA 3P7KA 2ZT9D 2J58A 1BSHA 3RL0B 3TF5A 3O6QB 1SQVE 5KKZB 3RK2D 1X22A 1EXJA 3R4YA 1N73B 1PGQA 1MKMA 1P84H 1VF5C 1IFNA 1HGZA 3TNUB 1PGJA 1NJIQ 3L73G 1WT6A 3HE4A 1IO4A 3VMAA 2PGDA 2RKLA 4YXDC 2FYZA 3VN0A 2NPSB 2FFDB 5B66H 1ZN5A 1SQXJ 1SQXK 1BCCG 3C1LA 3M06A 1H0TA 1SFCA 1NTMD 2GA1A 1ZR4A 3A3YB 3WUUA 3A0BH 3CWBG 5APQA
chains in the Genus database with same CATH topology
2KZJA 1LT1A 2I8DA 4WWIA 1FC2C 1U7MA 2LXCB 2M5AB 4GODA 4BXLA 3FXDA 2KZIA 5C39A 1LP1A 5DJUB 1Y47A 2JWDA 4EYYQ 2K3RA 4HKZH 4GOFA 1EDKA 2M5AA 1DEEG 4ASWA 1EDIA 1JMBA 2HR3A 4K3AA 2QVAA 4ASVA 4NPEA 5CBOA 1EDJA 1OVVA 2QRXA 3QWOC 1EDLA 1SS1A 4ZMDA 3ZDMA 5DJTB 1NVOA 1OVUA 4GOEA 4ZNCA 2B89A 2WMMA 4NPFX 1X0TA 5K5GB 3MHVA 4IOIH 2KS1B 1BDCA 3S1KA 1ZXGA 1JM0A 2P58A 4HB1A 4KJMA 1EC5A 1Q2NA 1S3JA 2M0BA 1U7JA 2B87B 4CPGA 2KUBA 2ZAEB 2KIKA 4K35A 2RKLA 1H0TB 2SPZA 4JBZA 2KI7B 2OTKE 4NPDA 2B87A 5EFWB 3PH0A 3FXEA 4MN4C 2B88A 2LXBA 2UWJE 3MZWB 4HJGH 1H0TA 1ZW0A 2LR2A 1MFTA 5CBNA 1BDDA 3RGUA 1OVRA 2R44A 1LP1B 2Q1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZJ A;  1LT1 A;  2I8D A;  4WWI A;  1FC2 C;  1U7M A;  2LXC B;  2M5A B;  4GOD A;  4BXL A;  3FXD A;  2KZI A;  5C39 A;  1LP1 A;  5DJU B;  1Y47 A;  2JWD A;  4EYY Q;  2K3R A;  4HKZ H;  4GOF A;  1EDK A;  2M5A A;  1DEE G;  4ASW A;  1EDI A;  1JMB A;  2HR3 A;  4K3A A;  2QVA A;  4ASV A;  4NPE A;  5CBO A;  1EDJ A;  1OVV A;  2QRX A;  3QWO C;  1EDL A;  1SS1 A;  4ZMD A;  3ZDM A;  5DJT B;  1NVO A;  1OVU A;  4GOE A;  4ZNC A;  2B89 A;  2WMM A;  4NPF X;  1X0T A;  5K5G B;  3MHV A;  4IOI H;  2KS1 B;  1BDC A;  3S1K A;  1ZXG A;  1JM0 A;  2P58 A;  4HB1 A;  4KJM A;  1EC5 A;  1Q2N A;  1S3J A;  2M0B A;  1U7J A;  2B87 B;  4CPG A;  2KUB A;  2ZAE B;  2KIK A;  4K35 A;  2RKL A;  1H0T B;  2SPZ A;  4JBZ A;  2KI7 B;  2OTK E;  4NPD A;  2B87 A;  5EFW B;  3PH0 A;  3FXE A;  4MN4 C;  2B88 A;  2LXB A;  2UWJ E;  3MZW B;  4HJG H;  1H0T A;  1ZW0 A;  2LR2 A;  1MFT A;  5CBN A;  1BDD A;  3RGU A;  1OVR A;  2R44 A;  1LP1 B;  2Q1K A; 
#chains in the Genus database with same CATH topology
 3AE4 C;  3PHL A;  1YTZ T;  2N1T A;  3HE5 B;  3U1A A;  4UB8 E;  2JJL A;  5CJ4 A;  1RHZ B;  3C8V A;  5AVY B;  2Z5I A;  1J2J B;  3AEF C;  5DJU B;  3D71 A;  2IBZ G;  2OYH A;  2HLO A;  4PD4 E;  3IF4 A;  1RF1 A;  2QVA A;  3TGU D;  2N9B A;  1JTH B;  1J1D C;  3AE8 C;  1GTW A;  2QRX A;  1AQT A;  1SS1 A;  2N1T C;  2WSC H;  2E75 D;  1QVG O;  1K8A Q;  5AW7 B;  2WVR A;  2B89 A;  3L70 D;  4H0L C;  1VQO P;  2ZYD A;  1AQ5 A;  2WWW A;  1VQP P;  2OYH C;  5KAF E;  3L73 J;  1SP4 A;  1NTZ G;  1NTK G;  1RF1 C;  4HYT B;  2OAR A;  3BCC E;  1FU1 A;  1GK4 A;  5AW4 B;  2YKP A;  1CSB A;  3F89 A;  5KLI B;  3AE7 C;  1KIL D;  3BVH A;  1ZR2 A;  5KLV E;  1BE3 G;  2V7Q J;  1W2B O;  3EWK A;  1BCC J;  1BSN A;  3G4S P;  2ZVN B;  1JY2 P;  2P2U A;  4C7N B;  2LXB A;  3PTZ A;  3H1I D;  2XZR A;  1VQ4 P;  1EZV D;  3HD7 A;  3CWB J;  1GD2 E;  3BCC D;  3L74 G;  1A02 J;  2XU6 A;  3A2A A;  3H6P A;  1PIX A;  2YNY A;  2IZ1 A;  4GOD A;  4OGQ D;  1NTZ E;  4BRY A;  1URQ B;  3KQG A;  4IFF A;  4IFD K;  2HOD B;  1Y47 A;  1VQN P;  3U1C A;  3HD7 C;  3H1H E;  3H1L D;  1KOR A;  1M1J A;  3CXH I;  3USS A;  4RO0 A;  1Q86 Q;  2A06 D;  4W7Z A;  5KAI E;  3ITK A;  2FY8 A;  1W5C E;  3L74 E;  3FX0 A;  1GW3 A;  2XKM A;  3L35 A;  1NTZ J;  1NTK J;  1RQV A;  3D6Z A;  2Y9Z A;  2E74 C;  1M1J C;  4TT3 H;  2M0B A;  2A45 I;  3B5N B;  2BCC G;  1P84 I;  1BGY G;  1BE3 J;  5BU8 B;  3OA7 A;  2WPQ A;  1USE A;  4Z1M H;  2HFE D;  4TLF A;  4UB8 H;  2ZYA A;  3HUS B;  2IYP A;  2L91 A;  4MN4 C;  1IC2 A;  4WY4 A;  2JEE A;  3QH9 A;  4OGQ B;  5BU5 A;  1OW7 A;  3M9B A;  4PD4 H;  1PZQ A;  2QSI A;  4JPZ B;  1NKN A;  3P8C E;  3NTN A;  2FYU E;  1W2E A;  3WMM 0;  1TU3 F;  1K9M Q;  1L4A B;  1VDF A;  4UB6 E;  4Y99 C;  1OX3 A;  1AVY A;  5B5E E;  1FZC B;  3VTP C;  1NGM B;  5C39 A;  4WY4 C;  2BCC E;  4WB4 A;  1CI6 A;  5KAF H;  1K73 Q;  1GMJ A;  2C0X A;  1VL2 A;  3P8C D;  1X8Y A;  1N8R Q;  2FYU D;  2NZ2 A;  1ZOY C;  3PJS K;  2FYN C;  2YXQ B;  1LT9 A;  1AV1 A;  3V2Q A;  3H1K D;  1R8E A;  1FJP A;  3H32 B;  4IL6 X;  4N78 D;  3KPE A;  1NAF A;  5E79 E;  1KB9 I;  4HB1 A;  2BCC J;  1BGY J;  3PRJ A;  3I56 P;  1MV8 A;  3CXH E;  3T97 B;  1LT9 C;  4DOJ A;  2JR8 A;  3MGN A;  4NPD A;  3RBX A;  1PV3 A;  5AVS B;  5AW0 B;  1WRG A;  2D2C C;  2K37 A;  1L0N E;  2M3E A;  3HTK B;  1S5L X;  3B8E B;  2WTY A;  2C9L Y;  4PJ0 E;  1N7S A;  2H7H A;  1BDD A;  1OVR A;  2E76 C;  3KZI H;  3VMZ A;  3CXH D;  1OIP A;  2GUV A;  1U7M A;  1IJD B;  1QX8 A;  5KAI H;  5AW1 B;  1LTJ B;  3L72 D;  1VQ9 P;  2QG4 A;  2WIT A;  1KMI Z;  4EI2 A;  1L0N D;  2WT7 A;  1IFM A;  3BAS A;  1Q81 Q;  3RK3 C;  1JY3 O;  3CCU P;  1FZA A;  1YJW P;  2HR3 A;  1MFZ A;  2KP8 A;  1YIT P;  2B9B A;  1AFO A;  1SQP D;  1NU1 G;  2W6B A;  3KYQ A;  1GU4 A;  1ZRT E;  1P84 D;  2RN0 A;  1GL2 D;  2R3S A;  2JWA A;  4H13 D;  5BVZ A;  2XNX A;  3AE6 C;  1ZP0 C;  5M1B A;  1YYC A;  3NMD A;  1KFM A;  2Z5H A;  4M3L A;  3H1J J;  3WUV A;  1IFD A;  1Q2N A;  2GM4 A;  5GTH E;  2H8P D;  4CPG A;  1S2E A;  2BAS A;  1ZRT D;  3CCQ P;  4UB6 H;  1R5L A;  4AYC A;  2QJK C;  2OTK E;  1G2C B;  2ZVO B;  5B5E H;  4Y28 J;  1QVF O;  1MZ9 A;  4RES B;  3RL0 D;  1SVF A;  4R4M A;  4ZKU A;  4L75 A;  1KV4 A;  1PPJ G;  2KLU A;  1QL2 A;  3RGU A;  1G1I A;  2KNC B;  2AEJ A;  1AVO A;  1FOS E;  5CCG D;  3S9O A;  1VQL P;  1HF9 A;  4PD4 I;  3FXD A;  5KJ7 D;  3Q5R A;  1SQX G;  2QJP C;  2KYV A;  5AW5 B;  2OYI B;  1L0L D;  1J1E B;  1JY3 N;  2NPS D;  2M5A A;  3GLM A;  1T6A A;  1YBK A;  2FXP A;  1M57 D;  5E79 H;  1NU1 J;  2YMY A;  5APV A;  1YI2 P;  1KB9 D;  5APS A;  4A7P A;  4PV1 C;  1LTT C;  3CXH H;  1QLE D;  2YIU B;  1FAV A;  5APX A;  3UIA A;  4PJ0 H;  1X9V A;  4KJM A;  2I1K A;  1SQX E;  1GDT A;  5AVV B;  3V2R A;  5KKZ C;  1JNM A;  1LTG C;  2A45 H;  1G1J A;  2QJY B;  3AE5 C;  2WPV B;  4EIJ A;  1SQB K;  2O01 N;  4JYC A;  1NKZ B;  1HTL C;  1JOC A;  1SFC D;  1SQQ K;  4GKG A;  4C7R A;  4RJT A;  3MD0 A;  3M0D A;  1NH4 A;  3VMY A;  3M91 A;  1OW6 A;  3L71 G;  4QMA A;  1SQV D;  1FC2 C;  1VF5 B;  5L8R J;  1K04 A;  2AXT E;  3L70 G;  4XFJ A;  4BWN A;  5AW9 B;  5AW3 B;  1T3U A;  2Q5U A;  3M0D C;  3V5B A;  1IK9 A;  1VQ6 P;  5GTH H;  2R5B A;  2G8Y A;  1SQV K;  3QWO C;  1EDL A;  3KHU A;  1FZG A;  3WU2 E;  3L73 E;  3RBZ A;  2ZT9 C;  1JCD A;  3IR9 A;  3RK2 C;  3HE4 B;  3TYY A;  1NTM K;  3L71 E;  1X0T A;  2AEM A;  1URQ D;  3S4R A;  4GDO A;  1VQM P;  1BCC E;  3AE1 C;  3O8Z A;  1EC5 A;  2KSE A;  4D6T G;  1FZB A;  3E7K A;  4AUW A;  2WSE H;  1KB9 H;  3L73 D;  3G9R A;  1H0T B;  3BAT A;  2KS1 A;  1SFC B;  1RE3 C;  2Y0C A;  3CWB E;  3D6Y A;  2NRG A;  1PP9 G;  1E5W A;  3L4F A;  1WMK A;  3CCM P;  3CCV P;  5EFW B;  4PD4 D;  2W27 A;  1J1D B;  3IAO A;  2QM7 A;  2N1T B;  1BCC D;  3LW5 J;  3L71 J;  1OXZ A;  2V4H A;  2IBZ E;  1S72 P;  4H0L B;  3SWY A;  2WSS H;  4W80 A;  2OYH B;  3L70 J;  1D7M A;  3CWB D;  3B5N D;  1RF1 B;  4L73 A;  2ZJS E;  1LWU A;  1YTZ I;  3LID A;  2CK3 H;  4GOF A;  1EDK A;  3CD6 P;  2ZYG A;  5AVZ B;  4DCK A;  5CBO A;  1EDJ A;  5KLV D;  1NTK E;  3TSI A;  1HBW A;  1IFJ A;  3TDK A;  1S9K E;  2BEZ F;  4C46 A;  2E75 C;  4ZMD A;  2YO2 A;  1KIL A;  3H1I J;  5APY A;  1LWU C;  2WMM A;  1L4A D;  1BE3 E;  2HPC A;  3B71 A;  4D6T J;  5AVX B;  5AW6 B;  5KLV K;  2W6A A;  1NTZ D;  3SSU A;  4EOT A;  1HJB A;  3Q5P A;  3AEC C;  1PP9 J;  1KIL C;  3AE3 C;  3HD7 B;  1JY3 P;  1VQ8 P;  2B87 A;  2AXT H;  3H1H D;  2POH A;  1NOH A;  1JUN A;  1MFT A;  2H88 C;  4JF7 A;  4BRY B;  3G71 P;  1CZQ A;  2JDI H;  1LTI C;  4U3F G;  4WWI A;  2FKW B;  2ZFC A;  1M8O B;  3GG2 A;  3CC4 P;  3L74 D;  3HRN A;  2E74 B;  1T2K D;  4I7Z C;  4OGQ C;  2I1J A;  3L36 A;  2JWD A;  3LW5 H;  2PRR A;  5TIS E;  1SLQ A;  1JMB A;  1OFC X;  2V7Q H;  4K3A A;  3MIW A;  2XV5 A;  2Y9Y A;  3AEG C;  3L75 G;  3V4Q A;  1JEK A;  4JYB A;  2JO1 A;  2M8R A;  1NVO A;  1BGY E;  3G3Z A;  1NO4 A;  1YQ4 C;  4NPF X;  3SFE C;  2O01 J;  1YIJ P;  3KXD A;  2L5G B;  1ZXG A;  1JM0 A;  4N3Y B;  1Q90 D;  4WY4 B;  2WQY C;  3A0H E;  3V2P A;  3CI9 A;  5KTB A;  1VPC A;  2H43 A;  2KI7 B;  2BCC D;  2W90 A;  1BGY D;  4YTP C;  3LIE A;  3FXE A;  3ABV C;  1ZME C;  1KQS O;  2J59 M;  2OQQ A;  3L75 E;  1T3J A;  2FYN B;  1Q7Y Q;  1H88 A;  3H1J G;  4GIF A;  2FYU K;  1QEX A;  5CBN A;  2XDJ A;  3N7N A;  1N7S D;  2KB7 P;  2XND H;  4U3F J;  1T8Z A;  1JY2 O;  1KN7 A;  2CPS A;  1CI6 B;  2R3C A;  2DW3 A;  1GK6 A;  4BXL A;  2KZI A;  1JB0 J;  2HG5 D;  1UII A;  4I6M C;  1HVV A;  1DH3 A;  1LP1 A;  3I55 P;  2RMZ A;  2HYN A;  1LT9 B;  3B4S A;  1R5S A;  1QL1 A;  3L75 J;  1OMI A;  1LTJ C;  1OVV A;  3CX5 I;  2D2C B;  3H1J E;  2WZ7 A;  3OJA B;  1LGH B;  1JMM A;  2E76 B;  1DD3 A;  1M56 D;  2W8Z A;  3OAK A;  4H44 D;  4YXW H;  1U7J A;  2PFX A;  2K9J A;  2KIK A;  1NWQ A;  3II6 A;  5CMZ A;  2KSJ A;  1L0N K;  1N7L A;  1N7S B;  3GHG A;  2ITA A;  2IPP A;  2Y0E A;  2IFN A;  4W7Y A;  3PH0 A;  2ZXX A;  3MZW B;  1HJ0 A;  1SQP J;  1SQP K;  1ZV8 A;  2OTJ P;  1YJ9 P;  5CCH D;  3W67 A;  1YJN P;  3MTU E;  3AE9 C;  2WT7 B;  5TJH A;  1IFP A;  1CW5 A;  3GHG C;  1NU1 E;  3A7O A;  3CC2 P;  1GL2 A;  1SQB G;  1PGP A;  2W6J H;  2K1A A;  1LTB C;  3VYI A;  4HKZ H;  1FDM A;  1SQQ G;  3EFF K;  1HGV A;  1VQ7 P;  1USD A;  5CHX A;  2QJK B;  1NAY A;  2OGU A;  2OYI C;  1AJY A;  3A0H H;  3Q1M A;  4H44 B;  1UIX A;  5GTI E;  1NU1 D;  1OZH A;  1GL2 C;  4H13 C;  1VF5 D;  5K5G B;  1LJ2 A;  2Y0D A;  1BDC A;  1LTA C;  2P7J A;  3O6Q A;  1RQU A;  2P58 A;  2YKO A;  3SWK A;  1HH0 A;  1N73 A;  2KUB A;  1SQB E;  2QJP B;  1SQV G;  1KYO I;  1PPJ E;  3JCU E;  1SQQ E;  3CX5 E;  3TNU A;  1L0L K;  4LLH A;  1NTM G;  4U7J A;  2QE7 H;  5KJ7 A;  4HH2 A;  2K9Y A;  2IBZ I;  2IDB A;  2B88 A;  3H25 A;  1X79 B;  3RL0 C;  4PV1 B;  5AW2 B;  1VQK P;  2NPS A;  2FFD A;  1M7L A;  1N73 C;  5APU A;  2E42 A;  4OH8 B;  2Q1K A;  1PPJ D;  1N2D C;  3VMX A;  1EQ7 A;  1LT1 A;  2PP6 A;  2Q7C A;  5CCG C;  2M5A B;  3CX5 D;  1E79 H;  3CPW O;  1SQB J;  3L37 A;  2P67 A;  3V4W A;  3FWL A;  5KJ7 C;  2P1J A;  1SQQ J;  3CCJ P;  3TGU G;  2K3R A;  1SQX D;  3HE5 A;  2NPS C;  2FFD C;  5APT A;  1EDI A;  1GU5 A;  1FE6 A;  2J5U A;  1NTM E;  1HWT C;  2O3J A;  2N1T D;  4EDF A;  3F5H A;  2YXR B;  3AE2 C;  3TK1 A;  1KQL A;  3M9Q A;  1M90 Q;  1YHQ P;  4H0L D;  1JTH A;  1ZLL A;  2N9Y B;  3S1K A;  1L2P A;  1SQV J;  2P10 A;  5AVT B;  3FWN A;  1RE3 A;  4KT0 J;  3TGU E;  1M1K Q;  2FXM A;  1NTM J;  2IZ0 A;  2FXO A;  3H1I G;  1A02 F;  1EZV G;  2AXC A;  2QEX P;  3AED C;  3AEB C;  3D70 A;  3BCC G;  1ZW0 A;  2Q9I A;  1RH5 B;  3L70 E;  2ZT9 B;  1SFC C;  3NFQ A;  2YKQ A;  4I2L C;  5KLV G;  3RK2 B;  4C7N A;  3RL0 g;  1FS0 E;  5APW A;  3L71 D;  1KYO E;  1JO5 A;  3CCS P;  3K5B A;  5GTI H;  1KIL E;  1RF0 A;  3TGU J;  2E5T A;  1FDI A;  3H1L G;  3CL3 D;  5KLI C;  4EYY Q;  3HD7 D;  4R4L A;  2A06 G;  2QA4 P;  1URQ A;  4ASW A;  2ZXE B;  3H1I E;  4IL6 E;  2BEQ D;  4KHX A;  1EZV E;  2HOD A;  2WSF J;  4D6T E;  3EFG A;  1KYO D;  2IX7 C;  3JCU H;  3GMA A;  2FBW C;  1KTM A;  3CX5 H;  1RF0 C;  2R5D A;  4GOE A;  3H1H G;  3N4X A;  2PAJ A;  1GZL A;  2E74 D;  1PP9 E;  2KS1 B;  3FGA D;  4GT1 A;  1H8A A;  2IBZ D;  1URQ C;  2KK7 A;  4XA4 A;  2OTL P;  3IN6 A;  1S5L E;  3H1L E;  2ZAE B;  4K35 A;  3JSV C;  3MUD A;  1XTC C;  1QGK B;  4D6T D;  2SPZ A;  2A06 E;  1NYH A;  3SFD C;  4RKU J;  2E5Y A;  4I1L A;  2C0W A;  3B5N A;  3BCC J;  3V2N A;  1K05 A;  4WBA A;  1PP9 D;  2VRS A;  5KLV J;  2JKV A;  1NTK D;  2E75 B;  3HUS A;  4WVZ A;  3KDP B;  4N6J A;  1S9K D;  1LWU B;  3CMA P;  3MUD C;  2KZJ A;  3KZI E;  2I8D A;  4L74 A;  1OWA A;  2KOG A;  3Q5S A;  3H1L J;  1BE3 D;  3B5N C;  3E1R A;  4WY4 D;  2KLV A;  1RY3 A;  2MJZ A;  2O1K A;  1KQF B;  1L4A A;  3VOP A;  2FYU G;  3GF7 A;  2K88 A;  1FBM A;  1NTZ K;  1NTK K;  5CJ0 A;  1KIL B;  3HUS C;  3OW2 O;  1DIP A;  1FZC A;  4L76 A;  4AQR D;  3WU2 H;  2AEF A;  2HPC B;  1M1J B;  3H1K G;  3H1H J;  3CME P;  1Q82 Q;  3ZDM A;  1OVU A;  3G6E P;  3Q2Y A;  3BRT B;  3MHV A;  1L4A C;  1DX7 A;  1U57 A;  2M3B A;  1FZC C;  4I7Z B;  2WSF H;  2B87 B;  3L74 J;  3H32 A;  5AW8 B;  2OYO A;  2YMK A;  3CCR P;  4DJG A;  4LGD E;  1KYO H;  2D2C D;  4U3F E;  5AVQ B;  4Y99 B;  3P8M C;  3T97 A;  3RK3 E;  1XTG B;  2QIW A;  3H1K E;  4ZKP A;  1FZE A;  2H89 C;  3IFM A;  3V6I A;  5H2F E;  3EQ2 A;  2E76 D;  3E1I A;  4N78 E;  4IL6 H;  2R44 A;  2IYO A;  3A5T A;  3L72 G;  1Y9B A;  3HTK A;  2LXC B;  1L0N G;  4U3F D;  1T2K C;  3U59 A;  2G3A A;  3BRV B;  1PFI A;  1FDO A;  2FYU J;  3CCE P;  3RK3 D;  2RH0 A;  1SQP G;  3NXS A;  1DD4 A;  2A45 G;  1LTJ A;  4ASV A;  2E43 A;  3H1K J;  1S5L H;  3AEE C;  1YQ3 C;  4IFM A;  1AA0 A;  1RE4 A;  3L75 D;  4ZNC A;  2WPS A;  3CLQ A;  3L72 E;  4IOI H;  1PGO A;  1IK7 A;  3P32 A;  2C9N Y;  1LNQ A;  1S3J A;  3SWF A;  1FJK A;  2MKV A;  1PL5 A;  1LTS C;  1SQP E;  1RE4 C;  1FZF A;  4DZO A;  1P84 E;  3AEA C;  3Q3D A;  5AVW B;  2LR2 A;  3VP9 A;  2JP3 A;  1S1C X;  1S4X A;  1G2C A;  3L72 J;  1N7S C;  4OWF A;  3RK3 B;  1LP1 B;  3H1J D;  1L0N J;  2CPB A;  2Q3E A;  2WPR A;  2O01 H;  3CCL P;  5B66 E;  1L0L G;  2QM8 A;  2O1J A;  3PP5 A;  3WUT A;  4B86 A;  1KFN A;  2KNC A;  1KQG B;  1KC8 Q;  1JCC A;  3VP8 A;  3PLN A;  5TIS H;  1JY2 N;  5AVR B;  1FOS F;  3A0B E;  4YPC A;  1EXI A;  3CC7 P;  1N86 A;  1IFI A;  4NPE A;  2OYI A;  4PV1 D;  1HUC A;  3R2P A;  5AVU B;  5DJT B;  2Q6Q A;  2K9J B;  1Y8A A;  3M0A A;  1OW8 A;  1NHL A;  3W68 A;  3GF3 A;  3I5C A;  1L0L E;  4H44 C;  3GHG B;  5H2F H;  4LC1 A;  1J1E C;  3JC2 2;  5CCH A;  1VQ5 P;  4XE5 B;  1H89 A;  4JQ0 D;  1KB9 E;  4JBZ A;  1Z56 A;  2YO3 A;  3MP7 B;  1KD1 Q;  2UWJ E;  4HJG H;  2Q3I A;  4OVN F;  2KXP B;  2W83 C;  1KZU B;  1MUU A;  1IZN B;  5CCH C;  1GL2 B;  2IFM A;  5CCG A;  4H13 B;  4DT0 A;  2YIU C;  1L0L J;  1NU1 K;  4O9B A;  2GUS A;  3GW6 A;  1GW4 A;  2WSC J;  2WSE J;  1EZV I;  2QJY C;  3C9I A;  1DEB A;  1DEE G;  1SQB D;  3M9H A;  2LKM A;  1SQQ D;  2R32 A;  2Z4E A;  3P7K A;  2ZT9 D;  2J58 A;  1BSH A;  3RL0 B;  3TF5 A;  3O6Q B;  1SQV E;  5KKZ B;  3RK2 D;  1X22 A;  1EXJ A;  3R4Y A;  1N73 B;  1PGQ A;  1MKM A;  1P84 H;  1VF5 C;  1IFN A;  1HGZ A;  3TNU B;  1PGJ A;  1NJI Q;  3L73 G;  1WT6 A;  3HE4 A;  1IO4 A;  3VMA A;  2PGD A;  2RKL A;  4YXD C;  2FYZ A;  3VN0 A;  2NPS B;  2FFD B;  5B66 H;  1ZN5 A;  1SQX J;  1SQX K;  1BCC G;  3C1L A;  3M06 A;  1H0T A;  1SFC A;  1NTM D;  2GA1 A;  1ZR4 A;  3A3Y B;  3WUU A;  3A0B H;  3CWB G;  5APQ A; 
#chains in the Genus database with same CATH homology
 2KZJ A;  1LT1 A;  2I8D A;  4WWI A;  1FC2 C;  1U7M A;  2LXC B;  2M5A B;  4GOD A;  4BXL A;  3FXD A;  2KZI A;  5C39 A;  1LP1 A;  5DJU B;  1Y47 A;  2JWD A;  4EYY Q;  2K3R A;  4HKZ H;  4GOF A;  1EDK A;  2M5A A;  1DEE G;  4ASW A;  1EDI A;  1JMB A;  2HR3 A;  4K3A A;  2QVA A;  4ASV A;  4NPE A;  5CBO A;  1EDJ A;  1OVV A;  2QRX A;  3QWO C;  1EDL A;  1SS1 A;  4ZMD A;  3ZDM A;  5DJT B;  1NVO A;  1OVU A;  4GOE A;  4ZNC A;  2B89 A;  2WMM A;  4NPF X;  1X0T A;  5K5G B;  3MHV A;  4IOI H;  2KS1 B;  1BDC A;  3S1K A;  1ZXG A;  1JM0 A;  2P58 A;  4HB1 A;  4KJM A;  1EC5 A;  1Q2N A;  1S3J A;  2M0B A;  1U7J A;  2B87 B;  4CPG A;  2KUB A;  2ZAE B;  2KIK A;  4K35 A;  2RKL A;  1H0T B;  2SPZ A;  4JBZ A;  2KI7 B;  2OTK E;  4NPD A;  2B87 A;  5EFW B;  3PH0 A;  3FXE A;  4MN4 C;  2B88 A;  2LXB A;  2UWJ E;  3MZW B;  4HJG H;  1H0T A;  1ZW0 A;  2LR2 A;  1MFT A;  5CBN A;  1BDD A;  3RGU A;  1OVR A;  2R44 A;  1LP1 B;  2Q1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...