5DJTB

Crystal structure of lov2 (c450a) domain in complex with zdk2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
59
structure length
59
Chain Sequence
SVDNKFNKEMLSARVEIYGLPNLNWGQRFAFISSLTDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title LOVTRAP: an optogenetic system for photoinduced protein dissociation.
pubmed doi rcsb
source organism Avena sativa
molecule tags Signaling protein
molecule keywords NPH1-2
total genus 22
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2015-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5djtB00
5C39A 1JMBA 3FXEA 1EDKA 5EFWB 2UWJE 4CPGA 1NVOA 1X0TA 2JWDA 1S3JA 1BDDA 4MN4C 1SS1A 3ZDMA 4ASWA 4NPDA 1U7JA 4ZNCA 4GOEA 2KS1B 1EC5A 2M5AB 2R44A 2B88A 1EDIA 2M5AA 5CBOA 4WWIA 2LR2A 1MFTA 4HB1A 4K3AA 4ASVA 5DJTB 1Y47A 2OTKE 3FXDA 2B87B 5DJUB 4K35A 1ZW0A 2KZIA 2LXCB 1FC2C 1LP1B 5CBNA 1H0TB 3S1KA 3RGUA 4NPEA 1DEEG 4NPFX 4EYYQ 4KJMA 3PH0A 2KZJA 2SPZA 4HKZH 5K5GB 1LT1A 4BXLA 2P58A 2Q1KA 2WMMA 2LXBA 2KIKA 1OVRA 2KUBA 4GODA 2B87A 3MHVA 2HR3A 2QRXA 1OVUA 2K3RA 2ZAEB 2M0BA 4HJGH 1OVVA 1EDJA 1JM0A 3MZWB 2I8DA 2RKLA 4GOFA 1LP1A 1Q2NA 1H0TA 3QWOC 1BDCA 1U7MA 2KI7B 4IOIH 2B89A 2QVAA 4ZMDA 1EDLA 4JBZA 1ZXGA
chains in the Genus database with same CATH superfamily
2KK7A 1PZQA 1LTJB 1BE3G 1L0LK 1NTZK 1HJ0A 4OGQC 3RK2C 3B5NC 1KB9D 2K9JA 1SQQD 1PPJE 3H1KE 4L76A 1EDKA 2D2CC 3S4RA 2YXQB 4CPGA 1MFZA 1PGOA 2WSSH 1NTZE 2OQQA 3GMAA 2E5TA 5AW0B 4D6TJ 1S5LH 1X8YA 3AE5C 3TNUB 1JTHA 1NWQA 1HUCA 1QEXA 2V4HA 5AW4B 3W67A 1VQ4P 2I1KA 1H8AA 3L73E 3ZDMA 2FYUE 1NU1G 3BRTB 1JY2N 4YXDC 3B5NB 4ZNCA 1YYCA 1T3UA 2L5GB 1EC5A 1PGJA 4N78E 2Q5UA 2YIUB 3KQGA 1WMKA 2B88A 2O3JA 3H1LJ 3CCLP 1ZRTD 3JSVC 3A5TA 2W90A 5CBOA 3G6EP 1J1EC 1USDA 4WWIA 2FBWC 3MGNA 1NJIQ 4HB1A 1KB9E 2WSEH 2Y9ZA 1NTKK 2O01J 4W7ZA 4DZOA 2QA4P 3OW2O 1J2JB 1P84E 1RE3A 1IK9A 2OTKE 4GT1A 1FZCA 2B87B 1L4AA 1IFPA 2IBZE 2HPCB 1SQXK 2OGUA 1SQPJ 3HUSC 3WMM0 3GW6A 5KLIC 1FC2C 1HH0A 2BASA 3KZIH 3P8CE 4RESB 4N78D 3B5ND 3CWBD 2WPSA 2WSCH 4DJGA 2WTYA 1N73A 2KSEA 1JY2P 4WY4A 1DD4A 2KSJA 3S1KA 4BWNA 1H0TB 1URQC 1DEEG 1FDOA 4EYYQ 1NKZB 3O8ZA 3VMYA 4BRYA 3G9RA 1EZVI 1QX8A 1KFNA 2H89C 3EFGA 3MTUE 2E74D 4HKZH 5CCHA 1BSNA 1JUNA 2Q3IA 3WUTA 2OYIC 3UIAA 1Q86Q 1SLQA 4WVZA 1SFCC 4RKUJ 1SQBK 1EZVG 3H1HE 1SQXD 4BXLA 1LNQA 1BE3J 1VF5C 1NOHA 1GZLA 2G3AA 2XU6A 2YO2A 1G1JA 3TGUD 3Q2YA 3CD6P 3L70D 1KILB 1SQXG 3A0BH 5AVTB 1PGQA 2Y9YA 2AEFA 1BSHA 2E5YA 3RBXA 1JY3P 1PGPA 2OYOA 3A0HE 3KYQA 3CCVP 3QH9A 3CWBE 1L4AB 2OYIA 1UIXA 3L74G 2H88C 1OX3A 1IFMA 1KORA 3B71A 1NTMD 3P7KA 1OW6A 5APXA 3D6ZA 1KV4A 3RL0B 2ZAEB 5L8RJ 4UB8H 5GTIE 3CX5D 1MV8A 2ITAA 2WSEJ 3JCUH 1HGVA 1LT9B 3CLQA 3RK3E 2M3EA 3MZWB 2I8DA 1USEA 2P1JA 2OTLP 4XA4A 2V7QJ 4I1LA 1RHZB 5KAFH 2WT7A 1YHQP 1PP9D 2BCCD 1RF0A 2IBZI 3E7KA 2I1JA 1Q2NA 2FYUG 3CL3D 1N73B 3OA7A 1H0TA 3CCJP 2IPPA 3ITKA 1GU5A 2YMKA 1KYOD 3AEBC 1JY3N 1VQMP 1CI6A 1G2CB 2FYUD 2Z5HA 2J5UA 2ZYDA 3IN6A 1L4AD 2WSFH 5AW3B 4AYCA 1FDMA 1S1CX 4WB4A 3B4SA 1EXJA 1JMMA 2O01N 2CPBA 1BGYD 1NTKJ 3L72D 1OXZA 4LLHA 3BASA 3BRVB 2MKVA 1QL2A 3M9HA 1KILD 1NTZD 1RY3A 1RF0C 2BEQD 3CCRP 2Q7CA 3BVHA 1ZXGA 1YJWP 1K73Q 2ZT9C 5C39A 1NU1J 3F5HA 3OAKA 3L37A 5KKZB 2HPCA 3V4QA 3B8EB 3FXEA 5EFWB 1LWUB 1Q82Q 2HODB 1PPJD 1L0NG 2GA1A 1NVOA 5KJ7C 3T97B 5KLIB 2E76D 1SQQK 2E74B 3E1IA 3SWYA 2G8YA 1VF5D 3RK2B 1RE4A 1W5CE 2W6JH 5KLVJ 1K04A 3Q1MA 3Q5SA 1K9MQ 1RQUA 1S3JA 1SQBE 3H1ID 3LIDA 2WT7B 2D2CB 5AVWB 1BDDA 3CCMP 1ZOYC 3R4YA 4UB6H 2QEXP 4OGQB 1IFJA 1KD1Q 1GK4A 1A02J 5CMZA 3CXHH 4ZKUA 2WVRA 3H1IJ 3L75J 4GOEA 1Q81Q 1FZGA 3MUDA 2YNYA 3L74J 3CCUP 5B66E 1RF1B 1LTJA 5E79E 4IL6X 2KP8A 3AEDC 3L70E 4YTPC 3RL0g 3HE5B 2FFDA 2M5AA 4W80A 3VTPC 1CW5A 3KXDA 2XNDH 1OMIA 1QL1A 2QJYB 1VQ7P 4WY4B 4K3AA 4R4LA 5CCHC 3SSUA 2XDJA 1RH5B 1L0NE 1FZBA 1ZN5A 3AE9C 1M1JA 3FXDA 3H32A 3CWBG 4PV1C 1N7SA 1S4XA 5KLVG 5DJUB 1S9KD 3PP5A 4K35A 1ZW0A 3SWKA 5TISH 1GDTA 1URQA 1IFNA 2LXCB 2IDBA 1PPJG 1G1IA 2JR8A 2OARA 4KHXA 2OTJP 1DIPA 2P2UA 3E1RA 5B5EH 5KLVE 5AVSB 5CBNA 1AVYA 1SQBJ 4WBAA 3H1JD 1N7SD 2JP3A 3HUSA 4NPEA 4Y99B 4L75A 3RGUA 1HTLC 1OWAA 3WUUA 4M3LA 3G3ZA 5KKZC 1FBMA 2IZ0A 4EIJA 2CPSA 3WU2E 1OIPA 1SVFA 3PH0A 3Q5RA 1KFMA 3BCCJ 3H1IE 2KYVA 2QM8A 3EWKA 1DX7A 2KB7P 2BCCJ 3FGAD 1GMJA 1P84D 2IZ1A 1FZAA 5AVRB 4U3FJ 1LGHB 3L70J 2E75D 1PFIA 5AW9B 2FFDC 5BVZA 1FOSF 5APWA 3H1KJ 2JDIH 5AW6B 2POHA 3H6PA 1E5WA 3CCEP 1NTME 1FAVA 5AVZB 3M0AA 3KDPB 3L71G 5GTHH 4DCKA 3Q5PA 3CXHE 1IO4A 3CC2P 1JO5A 1FDIA 2ZYAA 4D6TE 2LXBA 3CX5H 3L36A 3L75D 1NTKD 2KIKA 1NTMG 1OVRA 1HBWA 3SWFA 2Q3EA 3EQ2A 1GL2A 3JC22 4N3YB 1M1JC 5KLVD 3U59A 2OYHA 2KOGA 2FFDB 2L91A 2FYUJ 3H1JE 1VQOP 3D70A 1FZEA 1QGKB 2YXRB 4PD4D 1EXIA 2HR3A 2DW3A 1KB9H 1M90Q 1OVUA 1K05A 4C7NA 5TJHA 1R5SA 2K3RA 4ZKPA 3LW5J 1QVGO 2M0BA 1P84H 3AEGC 3B5NA 2IYOA 2R3SA 4HJGH 1M8OB 1KYOH 1L0LG 2ZYGA 3RK3C 1JM0A 1T8ZA 3P8MC 5APVA 5TISE 4GOFA 1YBKA 1GW3A 1VL2A 2LKMA 4W7YA 3PHLA 2GM4A 3IFMA 4U3FE 5BU5A 1Q7YQ 3AEEC 1H88A 2R5BA 4PD4H 4JYBA 4WY4D 2XNXA 1S5LX 3I5CA 3G71P 2FKWB 2A45G 1SQPK 1NAYA 1H89A 2HODA 5BU8B 4GIFA 1BGYJ 3L72J 2BCCG 4IFFA 1NTMJ 1SQVE 2IX7C 3AE7C 3GLMA 1SQPE 2E75C 4TT3H 2KI7B 3S9OA 2XV5A 3M9QA 4H13C 1FZCB 1FOSE 1J1DC 2B89A 2V7QH 1NKNA 2N1TC 2NZ2A 4H0LB 2QVAA 2H43A 1LTAC 2AEJA 4Y99C 4DOJA 2OYHC 3EFFK 1KTMA 1DH3A 3CXHD 2YIUC 2NPSD 2H7HA 4LC1A 3CI9A 1ZLLA 3NMDA 4JBZA 4RJTA 3AE3C 1FJPA 1LTJC 2AEMA 2E43A 1J1DB 2YKPA 2XKMA 1FJKA 1AQ5A 1JMBA 1NTZG 3HD7B 2QG4A 1VQ5P 3CX5E 2ZXXA 2KLVA 2UWJE 3H1HJ 4U3FG 2W6AA 2JJLA 1BE3E 1X0TA 2KLUA 2MJZA 1ZRTE 3A0HH 2JWDA 2AXTH 3H1KG 3PJSK 2WITA 5AW1B 3VMAA 2HLOA 2QIWA 2ZT9B 3L73G 1KQSO 2IBZG 2A45H 2E74C 3T97A 3MD0A 3TF5A 1KILE 4MN4C 4QMAA 1NTMK 3CPWO 1JEKA 1NU1K 1VQLP 2FXOA 3D6YA 1Y9BA 2JWAA 2C0XA 2HFED 1SQVJ 3L73D 3HD7C 1U7JA 1KYOE 5AVQB 3CWBJ 3TGUJ 1JOCA 4C7RA 1YITP 1Q90D 2Y0CA 3L35A 1YTZI 2KS1B 1GL2D 2M5AB 4GKGA 3G4SP 1XTGB 1DD3A 1N7LA 1SQXJ 1RQVA 1Z56A 1NYHA 3AE1C 4U7JA 1EDIA 1JY2O 1RF1C 2QSIA 3USSA 3VN0A 1SP4A 2YMYA 2CK3H 1SQBG 4O9BA 4Y28J 3RK3B 1KILA 1KN7A 5AVVB 1A02F 1MUUA 1EQ7A 4PD4I 3PTZA 1G2CA 5M1BA 3RK3D 1AA0A 4ASVA 1W2BO 4GDOA 1NGMB 1Y47A 3C1LA 5KLVK 5APSA 2N1TB 3F89A 4H0LC 1SQQG 2FYZA 2KZIA 1Y8AA 1M1JB 2JO1A 2O01H 4H13B 1FS0E 1BCCE 4JYCA 4WY4C 1PV3A 3H1LD 3I55P 2R3CA 2FYNC 3P8CD 2PFXA 2QJKC 3TDKA 5KTBA 3KZIE 1KB9I 2WWWA 3IAOA 1JB0J 2IBZD 4JPZB 1GD2E 1LT9A 3HE5A 3LW5H 4H13D 4I7ZB 2B9BA 4HH2A 2ZT9D 1EZVD 2N1TD 3TK1A 2R5DA 1VQ9P 4EOTA 1SFCB 2C9LY 2PP6A 2AXTE 2NPSC 2ZVNB 3AE2C 3CX5I 1U57A 2PGDA 2FXPA 3H1HD 1LT1A 2KS1A 4H44D 3HD7D 5APYA 1N86A 2RN0A 3TYYA 1KQLA 2P58A 1FZCC 3A3YB 1VQ8P 3A0BE 1GL2C 1NTKG 3GF7A 4UB6E 1VDFA 1EZVE 3H1HG 3HTKA 4PJ0H 3U1AA 3U1CA 1N2DC 1IC2A 2KNCA 1KQGB 2NPSB 2WMMA 2WZ7A 3P32A 3HD7A 4B86A 3N7NA 2RMZA 4KT0J 1EDJA 1YQ4C 5APTA 2M8RA 1IZNB 2QM7A 3L73J 2J59M 1VPCA 1ZMEC 1AFOA 2KUBA 1X9VA 2WSCJ 2GUSA 2N1TA 4YXWH 1QVFO 1R5LA 2AXCA 1PIXA 3VP8A 4R4MA 2Z5IA 1CSBA 1BE3D 3L75E 3O6QB 5KJ7D 4EI2A 1OW7A 2W27A 1KZUB 1SQQJ 1ZP0C 1BCCD 2FXMA 3L74E 3V5BA 1M1KQ 3RL0C 1JCCA 2K88A 4UB8E 4A7PA 5GTIH 2RKLA 3SFEC 3MUDC 1URQB 1URQD 3JCUE 4IL6E 1LJ2A 4IFMA 4DT0A 1VQKP 1L0NK 2K9YA 3AE4C 3H1IG 3KPEA 1L0NJ 5AW5B 3WUVA 4YPCA 5KAFE 3VOPA 2K9JB 3PLNA 3VP9A 3QWOC 4TLFA 5AW2B 5H2FH 1T6AA 4L74A 3V2RA 1N7SC 1K8AQ 3W68A 2Q6QA 4H0LD 4H44C 1SQPD 2YKOA 1HWTC 3L71D 2ZXEB 1KQFB 3V2QA 5KJ7A 4IOIH 2WPRA 3L71E 5AVYB 1WRGA 3OJAB 2H8PD 5CHXA 1NH4A 3CXHI 1VQ6P 1KMIZ 3RBZA 1EDLA 3A2AA 2IFMA 1PL5A 3AE8C 1CZQA 1M57D 3FWLA 5AVXB 3MIWA 2QE7H 2WQYC 2ZVOB 3BCCE 3HUSB 3CCSP 5AW7B 5GTHE 1SQQE 2BCCE 2K37A 3H1KD 3TSIA 4BRYB 4I6MC 3KHUA 4H44B 4XFJA 4IFDK 1BCCG 1AVOA 1ZV8A 1KC8Q 2QJPC 1SFCD 1L0LD 3TNUA 1JTHB 1S5LE 4OWFA 3IF4A 1FU1A 3I56P 2Y0DA 2R32A 3RL0D 1IK7A 1NU1D 3HRNA 1LTSC 1RE4C 2WPQA 2C9NY 1N8RQ 3CCQP 2HG5D 2YO3A 4JF7A 3R2PA 2A45I 1TU3F 2Q9IA 1SS1A 1AQTA 1IFDA 2A06D 2QJPB 2W83C 4LGDE 1RF1A 3V2PA 4ASWA 4D6TD 4C7NB 3CC4P 4NPDA 1MZ9A 2A06E 1J1EB 5E79H 3II6A 5APUA 1N73C 3H1JJ 2K1AA 3AEAC 1SQBD 2GUVA 1LTTC 2R44A 1DEBA 3L71J 1S2EA 3V6IA 1VQNP 3GHGC 4C46A 4JQ0D 4AUWA 2P10A 1IFIA 1NHLA 1L4AC 1QLED 1RE3C 2NRGA 1YTZT 1HVVA 2KNCB 1X22A 2BEZF 2NPSA 2RH0A 2LR2A 3L70G 1MFTA 2E75B 1S72P 1GU4A 3FWNA 5DJTB 3NXSA 1LTGC 5AW8B 4EDFA 4XE5B 2OYHB 2E42A 4Z1MH 1YJ9P 2XZRA 5AVUB 1LT9C 1GL2B 5B5EE 1OFCX 1LWUA 5KAIH 1LP1B 3M0DC 1BGYE 2N9BA 3L72E 1GW4A 1N7SB 2FY8A 1SQVK 3M0DA 3LIEA 4L73A 1LWUC 4U3FD 5APQA 1D7MA 3GF3A 1NTKE 5CCGD 4NPFX 2JKVA 4KJMA 1JNMA 3HE4A 3V2NA 1SFCA 4AQRD 1AV1A 1VF5B 3RK2D 2KZJA 2HYNA 2SPZA 1HF9A 3WU2H 5K5GB 2C0WA 1NU1E 1PP9J 1W2EA 4RO0A 1KILC 5CJ4A 3K5BA 1T2KC 2Z4EA 2FYNB 2W8ZA 1GTWA 3CMAP 3M9BA 4HYTB 2IFNA 2W6BA 2M3BA 3L75G 2J58A 2FYUK 2Q1KA 3VMZA 3NFQA 1VQPP 1YJNP 2P67A 3L74D 1OW8A 1YQ3C 3IR9A 3AEFC 3M06A 2ZFCA 3M91A 1BGYG 3L72G 2E76C 1SQVG 2QJYC 3TGUG 1E79H 5CCHD 1LTBC 4OGQD 1HGZA 2N9YB 2B87A 3AECC 4GODA 3V4WA 3CC7P 1AJYA 2D2CD 1HJBA 3MHVA 3GHGB 3H1LG 3VMXA 3TGUE 3SFDC 1L0LE 1S9KE 1MKMA 2QRXA 2OYIB 1ZR2A 1UIIA 3D71A 2E76B 3H1JG 3PRJA 3HE4B 3NTNA 1PP9G 1SQXE 2O1KA 1NO4A 1L0ND 1T3JA 1XTCC 1OVVA 2Y0EA 1X79B 3C8VA 3O6QA 3FX0A 4OH8B 2YKQA 2QJKB 2WSFJ 3MP7B 5CCGC 3BCCD 1YIJP 3VYIA 1NTZJ 5KAIE 1PP9E 5B66H 3CMEP 4OVNF 3ABVC 1LP1A 4IL6H 5CCGA 1R8EA 4I7ZC 1M56D 3GG2A 3L4FA 2JEEA 1SQPG 3Q3DA 2A06G 1CI6B 2P7JA 3BCCG 4D6TG 3N4XA 1BDCA 4PD4E 1LTIC 1KYOI 1FE6A 1U7MA 1OZHA 2IYPA 3A7OA 3BATA 1P84I 4PV1D 3H25A 1T2KD 4N6JA 1BCCJ 5H2FE 1IJDB 1JY3O 2VRSA 3C9IA 1ZR4A 3H32B 3AE6C 1YI2P 3HTKB 1FZFA 2O1JA 4PV1B 3H1LE 2ZJSE 4ZMDA 1L2PA 1NAFA 1GK6A 1SQVD 1WT6A 4I2LC 1JCDA 2KXPB 2PRRA 1M7LA 2PAJA 3GHGA 2WPVB 5CJ0A 1L0LJ 4PJ0E
chains in the Genus database with same CATH topology
5C39A 1JMBA 3FXEA 1EDKA 5EFWB 2UWJE 4CPGA 1NVOA 1X0TA 2JWDA 1S3JA 1BDDA 4MN4C 1SS1A 3ZDMA 4ASWA 4NPDA 1U7JA 4ZNCA 4GOEA 2KS1B 1EC5A 2M5AB 2R44A 2B88A 1EDIA 2M5AA 5CBOA 4WWIA 2LR2A 1MFTA 4HB1A 4K3AA 4ASVA 5DJTB 1Y47A 2OTKE 3FXDA 2B87B 5DJUB 4K35A 1ZW0A 2KZIA 2LXCB 1FC2C 1LP1B 5CBNA 1H0TB 3S1KA 3RGUA 4NPEA 1DEEG 4NPFX 4EYYQ 4KJMA 3PH0A 2KZJA 2SPZA 4HKZH 5K5GB 1LT1A 4BXLA 2P58A 2Q1KA 2WMMA 2LXBA 2KIKA 1OVRA 2KUBA 4GODA 2B87A 3MHVA 2HR3A 2QRXA 1OVUA 2K3RA 2ZAEB 2M0BA 4HJGH 1OVVA 1EDJA 1JM0A 3MZWB 2I8DA 2RKLA 4GOFA 1LP1A 1Q2NA 1H0TA 3QWOC 1BDCA 1U7MA 2KI7B 4IOIH 2B89A 2QVAA 4ZMDA 1EDLA 4JBZA 1ZXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C39 A;  1JMB A;  3FXE A;  1EDK A;  5EFW B;  2UWJ E;  4CPG A;  1NVO A;  1X0T A;  2JWD A;  1S3J A;  1BDD A;  4MN4 C;  1SS1 A;  3ZDM A;  4ASW A;  4NPD A;  1U7J A;  4ZNC A;  4GOE A;  2KS1 B;  1EC5 A;  2M5A B;  2R44 A;  2B88 A;  1EDI A;  2M5A A;  5CBO A;  4WWI A;  2LR2 A;  1MFT A;  4HB1 A;  4K3A A;  4ASV A;  5DJT B;  1Y47 A;  2OTK E;  3FXD A;  2B87 B;  5DJU B;  4K35 A;  1ZW0 A;  2KZI A;  2LXC B;  1FC2 C;  1LP1 B;  5CBN A;  1H0T B;  3S1K A;  3RGU A;  4NPE A;  1DEE G;  4NPF X;  4EYY Q;  4KJM A;  3PH0 A;  2KZJ A;  2SPZ A;  4HKZ H;  5K5G B;  1LT1 A;  4BXL A;  2P58 A;  2Q1K A;  2WMM A;  2LXB A;  2KIK A;  1OVR A;  2KUB A;  4GOD A;  2B87 A;  3MHV A;  2HR3 A;  2QRX A;  1OVU A;  2K3R A;  2ZAE B;  2M0B A;  4HJG H;  1OVV A;  1EDJ A;  1JM0 A;  3MZW B;  2I8D A;  2RKL A;  4GOF A;  1LP1 A;  1Q2N A;  1H0T A;  3QWO C;  1BDC A;  1U7M A;  2KI7 B;  4IOI H;  2B89 A;  2QVA A;  4ZMD A;  1EDL A;  4JBZ A;  1ZXG A; 
#chains in the Genus database with same CATH topology
 2KK7 A;  1PZQ A;  1LTJ B;  1BE3 G;  1L0L K;  1NTZ K;  1HJ0 A;  4OGQ C;  3RK2 C;  3B5N C;  1KB9 D;  2K9J A;  1SQQ D;  1PPJ E;  3H1K E;  4L76 A;  1EDK A;  2D2C C;  3S4R A;  2YXQ B;  4CPG A;  1MFZ A;  1PGO A;  2WSS H;  1NTZ E;  2OQQ A;  3GMA A;  2E5T A;  5AW0 B;  4D6T J;  1S5L H;  1X8Y A;  3AE5 C;  3TNU B;  1JTH A;  1NWQ A;  1HUC A;  1QEX A;  2V4H A;  5AW4 B;  3W67 A;  1VQ4 P;  2I1K A;  1H8A A;  3L73 E;  3ZDM A;  2FYU E;  1NU1 G;  3BRT B;  1JY2 N;  4YXD C;  3B5N B;  4ZNC A;  1YYC A;  1T3U A;  2L5G B;  1EC5 A;  1PGJ A;  4N78 E;  2Q5U A;  2YIU B;  3KQG A;  1WMK A;  2B88 A;  2O3J A;  3H1L J;  3CCL P;  1ZRT D;  3JSV C;  3A5T A;  2W90 A;  5CBO A;  3G6E P;  1J1E C;  1USD A;  4WWI A;  2FBW C;  3MGN A;  1NJI Q;  4HB1 A;  1KB9 E;  2WSE H;  2Y9Z A;  1NTK K;  2O01 J;  4W7Z A;  4DZO A;  2QA4 P;  3OW2 O;  1J2J B;  1P84 E;  1RE3 A;  1IK9 A;  2OTK E;  4GT1 A;  1FZC A;  2B87 B;  1L4A A;  1IFP A;  2IBZ E;  2HPC B;  1SQX K;  2OGU A;  1SQP J;  3HUS C;  3WMM 0;  3GW6 A;  5KLI C;  1FC2 C;  1HH0 A;  2BAS A;  3KZI H;  3P8C E;  4RES B;  4N78 D;  3B5N D;  3CWB D;  2WPS A;  2WSC H;  4DJG A;  2WTY A;  1N73 A;  2KSE A;  1JY2 P;  4WY4 A;  1DD4 A;  2KSJ A;  3S1K A;  4BWN A;  1H0T B;  1URQ C;  1DEE G;  1FDO A;  4EYY Q;  1NKZ B;  3O8Z A;  3VMY A;  4BRY A;  3G9R A;  1EZV I;  1QX8 A;  1KFN A;  2H89 C;  3EFG A;  3MTU E;  2E74 D;  4HKZ H;  5CCH A;  1BSN A;  1JUN A;  2Q3I A;  3WUT A;  2OYI C;  3UIA A;  1Q86 Q;  1SLQ A;  4WVZ A;  1SFC C;  4RKU J;  1SQB K;  1EZV G;  3H1H E;  1SQX D;  4BXL A;  1LNQ A;  1BE3 J;  1VF5 C;  1NOH A;  1GZL A;  2G3A A;  2XU6 A;  2YO2 A;  1G1J A;  3TGU D;  3Q2Y A;  3CD6 P;  3L70 D;  1KIL B;  1SQX G;  3A0B H;  5AVT B;  1PGQ A;  2Y9Y A;  2AEF A;  1BSH A;  2E5Y A;  3RBX A;  1JY3 P;  1PGP A;  2OYO A;  3A0H E;  3KYQ A;  3CCV P;  3QH9 A;  3CWB E;  1L4A B;  2OYI A;  1UIX A;  3L74 G;  2H88 C;  1OX3 A;  1IFM A;  1KOR A;  3B71 A;  1NTM D;  3P7K A;  1OW6 A;  5APX A;  3D6Z A;  1KV4 A;  3RL0 B;  2ZAE B;  5L8R J;  4UB8 H;  5GTI E;  3CX5 D;  1MV8 A;  2ITA A;  2WSE J;  3JCU H;  1HGV A;  1LT9 B;  3CLQ A;  3RK3 E;  2M3E A;  3MZW B;  2I8D A;  1USE A;  2P1J A;  2OTL P;  4XA4 A;  2V7Q J;  4I1L A;  1RHZ B;  5KAF H;  2WT7 A;  1YHQ P;  1PP9 D;  2BCC D;  1RF0 A;  2IBZ I;  3E7K A;  2I1J A;  1Q2N A;  2FYU G;  3CL3 D;  1N73 B;  3OA7 A;  1H0T A;  3CCJ P;  2IPP A;  3ITK A;  1GU5 A;  2YMK A;  1KYO D;  3AEB C;  1JY3 N;  1VQM P;  1CI6 A;  1G2C B;  2FYU D;  2Z5H A;  2J5U A;  2ZYD A;  3IN6 A;  1L4A D;  2WSF H;  5AW3 B;  4AYC A;  1FDM A;  1S1C X;  4WB4 A;  3B4S A;  1EXJ A;  1JMM A;  2O01 N;  2CPB A;  1BGY D;  1NTK J;  3L72 D;  1OXZ A;  4LLH A;  3BAS A;  3BRV B;  2MKV A;  1QL2 A;  3M9H A;  1KIL D;  1NTZ D;  1RY3 A;  1RF0 C;  2BEQ D;  3CCR P;  2Q7C A;  3BVH A;  1ZXG A;  1YJW P;  1K73 Q;  2ZT9 C;  5C39 A;  1NU1 J;  3F5H A;  3OAK A;  3L37 A;  5KKZ B;  2HPC A;  3V4Q A;  3B8E B;  3FXE A;  5EFW B;  1LWU B;  1Q82 Q;  2HOD B;  1PPJ D;  1L0N G;  2GA1 A;  1NVO A;  5KJ7 C;  3T97 B;  5KLI B;  2E76 D;  1SQQ K;  2E74 B;  3E1I A;  3SWY A;  2G8Y A;  1VF5 D;  3RK2 B;  1RE4 A;  1W5C E;  2W6J H;  5KLV J;  1K04 A;  3Q1M A;  3Q5S A;  1K9M Q;  1RQU A;  1S3J A;  1SQB E;  3H1I D;  3LID A;  2WT7 B;  2D2C B;  5AVW B;  1BDD A;  3CCM P;  1ZOY C;  3R4Y A;  4UB6 H;  2QEX P;  4OGQ B;  1IFJ A;  1KD1 Q;  1GK4 A;  1A02 J;  5CMZ A;  3CXH H;  4ZKU A;  2WVR A;  3H1I J;  3L75 J;  4GOE A;  1Q81 Q;  1FZG A;  3MUD A;  2YNY A;  3L74 J;  3CCU P;  5B66 E;  1RF1 B;  1LTJ A;  5E79 E;  4IL6 X;  2KP8 A;  3AED C;  3L70 E;  4YTP C;  3RL0 g;  3HE5 B;  2FFD A;  2M5A A;  4W80 A;  3VTP C;  1CW5 A;  3KXD A;  2XND H;  1OMI A;  1QL1 A;  2QJY B;  1VQ7 P;  4WY4 B;  4K3A A;  4R4L A;  5CCH C;  3SSU A;  2XDJ A;  1RH5 B;  1L0N E;  1FZB A;  1ZN5 A;  3AE9 C;  1M1J A;  3FXD A;  3H32 A;  3CWB G;  4PV1 C;  1N7S A;  1S4X A;  5KLV G;  5DJU B;  1S9K D;  3PP5 A;  4K35 A;  1ZW0 A;  3SWK A;  5TIS H;  1GDT A;  1URQ A;  1IFN A;  2LXC B;  2IDB A;  1PPJ G;  1G1I A;  2JR8 A;  2OAR A;  4KHX A;  2OTJ P;  1DIP A;  2P2U A;  3E1R A;  5B5E H;  5KLV E;  5AVS B;  5CBN A;  1AVY A;  1SQB J;  4WBA A;  3H1J D;  1N7S D;  2JP3 A;  3HUS A;  4NPE A;  4Y99 B;  4L75 A;  3RGU A;  1HTL C;  1OWA A;  3WUU A;  4M3L A;  3G3Z A;  5KKZ C;  1FBM A;  2IZ0 A;  4EIJ A;  2CPS A;  3WU2 E;  1OIP A;  1SVF A;  3PH0 A;  3Q5R A;  1KFM A;  3BCC J;  3H1I E;  2KYV A;  2QM8 A;  3EWK A;  1DX7 A;  2KB7 P;  2BCC J;  3FGA D;  1GMJ A;  1P84 D;  2IZ1 A;  1FZA A;  5AVR B;  4U3F J;  1LGH B;  3L70 J;  2E75 D;  1PFI A;  5AW9 B;  2FFD C;  5BVZ A;  1FOS F;  5APW A;  3H1K J;  2JDI H;  5AW6 B;  2POH A;  3H6P A;  1E5W A;  3CCE P;  1NTM E;  1FAV A;  5AVZ B;  3M0A A;  3KDP B;  3L71 G;  5GTH H;  4DCK A;  3Q5P A;  3CXH E;  1IO4 A;  3CC2 P;  1JO5 A;  1FDI A;  2ZYA A;  4D6T E;  2LXB A;  3CX5 H;  3L36 A;  3L75 D;  1NTK D;  2KIK A;  1NTM G;  1OVR A;  1HBW A;  3SWF A;  2Q3E A;  3EQ2 A;  1GL2 A;  3JC2 2;  4N3Y B;  1M1J C;  5KLV D;  3U59 A;  2OYH A;  2KOG A;  2FFD B;  2L91 A;  2FYU J;  3H1J E;  1VQO P;  3D70 A;  1FZE A;  1QGK B;  2YXR B;  4PD4 D;  1EXI A;  2HR3 A;  2DW3 A;  1KB9 H;  1M90 Q;  1OVU A;  1K05 A;  4C7N A;  5TJH A;  1R5S A;  2K3R A;  4ZKP A;  3LW5 J;  1QVG O;  2M0B A;  1P84 H;  3AEG C;  3B5N A;  2IYO A;  2R3S A;  4HJG H;  1M8O B;  1KYO H;  1L0L G;  2ZYG A;  3RK3 C;  1JM0 A;  1T8Z A;  3P8M C;  5APV A;  5TIS E;  4GOF A;  1YBK A;  1GW3 A;  1VL2 A;  2LKM A;  4W7Y A;  3PHL A;  2GM4 A;  3IFM A;  4U3F E;  5BU5 A;  1Q7Y Q;  3AEE C;  1H88 A;  2R5B A;  4PD4 H;  4JYB A;  4WY4 D;  2XNX A;  1S5L X;  3I5C A;  3G71 P;  2FKW B;  2A45 G;  1SQP K;  1NAY A;  1H89 A;  2HOD A;  5BU8 B;  4GIF A;  1BGY J;  3L72 J;  2BCC G;  4IFF A;  1NTM J;  1SQV E;  2IX7 C;  3AE7 C;  3GLM A;  1SQP E;  2E75 C;  4TT3 H;  2KI7 B;  3S9O A;  2XV5 A;  3M9Q A;  4H13 C;  1FZC B;  1FOS E;  1J1D C;  2B89 A;  2V7Q H;  1NKN A;  2N1T C;  2NZ2 A;  4H0L B;  2QVA A;  2H43 A;  1LTA C;  2AEJ A;  4Y99 C;  4DOJ A;  2OYH C;  3EFF K;  1KTM A;  1DH3 A;  3CXH D;  2YIU C;  2NPS D;  2H7H A;  4LC1 A;  3CI9 A;  1ZLL A;  3NMD A;  4JBZ A;  4RJT A;  3AE3 C;  1FJP A;  1LTJ C;  2AEM A;  2E43 A;  1J1D B;  2YKP A;  2XKM A;  1FJK A;  1AQ5 A;  1JMB A;  1NTZ G;  3HD7 B;  2QG4 A;  1VQ5 P;  3CX5 E;  2ZXX A;  2KLV A;  2UWJ E;  3H1H J;  4U3F G;  2W6A A;  2JJL A;  1BE3 E;  1X0T A;  2KLU A;  2MJZ A;  1ZRT E;  3A0H H;  2JWD A;  2AXT H;  3H1K G;  3PJS K;  2WIT A;  5AW1 B;  3VMA A;  2HLO A;  2QIW A;  2ZT9 B;  3L73 G;  1KQS O;  2IBZ G;  2A45 H;  2E74 C;  3T97 A;  3MD0 A;  3TF5 A;  1KIL E;  4MN4 C;  4QMA A;  1NTM K;  3CPW O;  1JEK A;  1NU1 K;  1VQL P;  2FXO A;  3D6Y A;  1Y9B A;  2JWA A;  2C0X A;  2HFE D;  1SQV J;  3L73 D;  3HD7 C;  1U7J A;  1KYO E;  5AVQ B;  3CWB J;  3TGU J;  1JOC A;  4C7R A;  1YIT P;  1Q90 D;  2Y0C A;  3L35 A;  1YTZ I;  2KS1 B;  1GL2 D;  2M5A B;  4GKG A;  3G4S P;  1XTG B;  1DD3 A;  1N7L A;  1SQX J;  1RQV A;  1Z56 A;  1NYH A;  3AE1 C;  4U7J A;  1EDI A;  1JY2 O;  1RF1 C;  2QSI A;  3USS A;  3VN0 A;  1SP4 A;  2YMY A;  2CK3 H;  1SQB G;  4O9B A;  4Y28 J;  3RK3 B;  1KIL A;  1KN7 A;  5AVV B;  1A02 F;  1MUU A;  1EQ7 A;  4PD4 I;  3PTZ A;  1G2C A;  5M1B A;  3RK3 D;  1AA0 A;  4ASV A;  1W2B O;  4GDO A;  1NGM B;  1Y47 A;  3C1L A;  5KLV K;  5APS A;  2N1T B;  3F89 A;  4H0L C;  1SQQ G;  2FYZ A;  2KZI A;  1Y8A A;  1M1J B;  2JO1 A;  2O01 H;  4H13 B;  1FS0 E;  1BCC E;  4JYC A;  4WY4 C;  1PV3 A;  3H1L D;  3I55 P;  2R3C A;  2FYN C;  3P8C D;  2PFX A;  2QJK C;  3TDK A;  5KTB A;  3KZI E;  1KB9 I;  2WWW A;  3IAO A;  1JB0 J;  2IBZ D;  4JPZ B;  1GD2 E;  1LT9 A;  3HE5 A;  3LW5 H;  4H13 D;  4I7Z B;  2B9B A;  4HH2 A;  2ZT9 D;  1EZV D;  2N1T D;  3TK1 A;  2R5D A;  1VQ9 P;  4EOT A;  1SFC B;  2C9L Y;  2PP6 A;  2AXT E;  2NPS C;  2ZVN B;  3AE2 C;  3CX5 I;  1U57 A;  2PGD A;  2FXP A;  3H1H D;  1LT1 A;  2KS1 A;  4H44 D;  3HD7 D;  5APY A;  1N86 A;  2RN0 A;  3TYY A;  1KQL A;  2P58 A;  1FZC C;  3A3Y B;  1VQ8 P;  3A0B E;  1GL2 C;  1NTK G;  3GF7 A;  4UB6 E;  1VDF A;  1EZV E;  3H1H G;  3HTK A;  4PJ0 H;  3U1A A;  3U1C A;  1N2D C;  1IC2 A;  2KNC A;  1KQG B;  2NPS B;  2WMM A;  2WZ7 A;  3P32 A;  3HD7 A;  4B86 A;  3N7N A;  2RMZ A;  4KT0 J;  1EDJ A;  1YQ4 C;  5APT A;  2M8R A;  1IZN B;  2QM7 A;  3L73 J;  2J59 M;  1VPC A;  1ZME C;  1AFO A;  2KUB A;  1X9V A;  2WSC J;  2GUS A;  2N1T A;  4YXW H;  1QVF O;  1R5L A;  2AXC A;  1PIX A;  3VP8 A;  4R4M A;  2Z5I A;  1CSB A;  1BE3 D;  3L75 E;  3O6Q B;  5KJ7 D;  4EI2 A;  1OW7 A;  2W27 A;  1KZU B;  1SQQ J;  1ZP0 C;  1BCC D;  2FXM A;  3L74 E;  3V5B A;  1M1K Q;  3RL0 C;  1JCC A;  2K88 A;  4UB8 E;  4A7P A;  5GTI H;  2RKL A;  3SFE C;  3MUD C;  1URQ B;  1URQ D;  3JCU E;  4IL6 E;  1LJ2 A;  4IFM A;  4DT0 A;  1VQK P;  1L0N K;  2K9Y A;  3AE4 C;  3H1I G;  3KPE A;  1L0N J;  5AW5 B;  3WUV A;  4YPC A;  5KAF E;  3VOP A;  2K9J B;  3PLN A;  3VP9 A;  3QWO C;  4TLF A;  5AW2 B;  5H2F H;  1T6A A;  4L74 A;  3V2R A;  1N7S C;  1K8A Q;  3W68 A;  2Q6Q A;  4H0L D;  4H44 C;  1SQP D;  2YKO A;  1HWT C;  3L71 D;  2ZXE B;  1KQF B;  3V2Q A;  5KJ7 A;  4IOI H;  2WPR A;  3L71 E;  5AVY B;  1WRG A;  3OJA B;  2H8P D;  5CHX A;  1NH4 A;  3CXH I;  1VQ6 P;  1KMI Z;  3RBZ A;  1EDL A;  3A2A A;  2IFM A;  1PL5 A;  3AE8 C;  1CZQ A;  1M57 D;  3FWL A;  5AVX B;  3MIW A;  2QE7 H;  2WQY C;  2ZVO B;  3BCC E;  3HUS B;  3CCS P;  5AW7 B;  5GTH E;  1SQQ E;  2BCC E;  2K37 A;  3H1K D;  3TSI A;  4BRY B;  4I6M C;  3KHU A;  4H44 B;  4XFJ A;  4IFD K;  1BCC G;  1AVO A;  1ZV8 A;  1KC8 Q;  2QJP C;  1SFC D;  1L0L D;  3TNU A;  1JTH B;  1S5L E;  4OWF A;  3IF4 A;  1FU1 A;  3I56 P;  2Y0D A;  2R32 A;  3RL0 D;  1IK7 A;  1NU1 D;  3HRN A;  1LTS C;  1RE4 C;  2WPQ A;  2C9N Y;  1N8R Q;  3CCQ P;  2HG5 D;  2YO3 A;  4JF7 A;  3R2P A;  2A45 I;  1TU3 F;  2Q9I A;  1SS1 A;  1AQT A;  1IFD A;  2A06 D;  2QJP B;  2W83 C;  4LGD E;  1RF1 A;  3V2P A;  4ASW A;  4D6T D;  4C7N B;  3CC4 P;  4NPD A;  1MZ9 A;  2A06 E;  1J1E B;  5E79 H;  3II6 A;  5APU A;  1N73 C;  3H1J J;  2K1A A;  3AEA C;  1SQB D;  2GUV A;  1LTT C;  2R44 A;  1DEB A;  3L71 J;  1S2E A;  3V6I A;  1VQN P;  3GHG C;  4C46 A;  4JQ0 D;  4AUW A;  2P10 A;  1IFI A;  1NHL A;  1L4A C;  1QLE D;  1RE3 C;  2NRG A;  1YTZ T;  1HVV A;  2KNC B;  1X22 A;  2BEZ F;  2NPS A;  2RH0 A;  2LR2 A;  3L70 G;  1MFT A;  2E75 B;  1S72 P;  1GU4 A;  3FWN A;  5DJT B;  3NXS A;  1LTG C;  5AW8 B;  4EDF A;  4XE5 B;  2OYH B;  2E42 A;  4Z1M H;  1YJ9 P;  2XZR A;  5AVU B;  1LT9 C;  1GL2 B;  5B5E E;  1OFC X;  1LWU A;  5KAI H;  1LP1 B;  3M0D C;  1BGY E;  2N9B A;  3L72 E;  1GW4 A;  1N7S B;  2FY8 A;  1SQV K;  3M0D A;  3LIE A;  4L73 A;  1LWU C;  4U3F D;  5APQ A;  1D7M A;  3GF3 A;  1NTK E;  5CCG D;  4NPF X;  2JKV A;  4KJM A;  1JNM A;  3HE4 A;  3V2N A;  1SFC A;  4AQR D;  1AV1 A;  1VF5 B;  3RK2 D;  2KZJ A;  2HYN A;  2SPZ A;  1HF9 A;  3WU2 H;  5K5G B;  2C0W A;  1NU1 E;  1PP9 J;  1W2E A;  4RO0 A;  1KIL C;  5CJ4 A;  3K5B A;  1T2K C;  2Z4E A;  2FYN B;  2W8Z A;  1GTW A;  3CMA P;  3M9B A;  4HYT B;  2IFN A;  2W6B A;  2M3B A;  3L75 G;  2J58 A;  2FYU K;  2Q1K A;  3VMZ A;  3NFQ A;  1VQP P;  1YJN P;  2P67 A;  3L74 D;  1OW8 A;  1YQ3 C;  3IR9 A;  3AEF C;  3M06 A;  2ZFC A;  3M91 A;  1BGY G;  3L72 G;  2E76 C;  1SQV G;  2QJY C;  3TGU G;  1E79 H;  5CCH D;  1LTB C;  4OGQ D;  1HGZ A;  2N9Y B;  2B87 A;  3AEC C;  4GOD A;  3V4W A;  3CC7 P;  1AJY A;  2D2C D;  1HJB A;  3MHV A;  3GHG B;  3H1L G;  3VMX A;  3TGU E;  3SFD C;  1L0L E;  1S9K E;  1MKM A;  2QRX A;  2OYI B;  1ZR2 A;  1UII A;  3D71 A;  2E76 B;  3H1J G;  3PRJ A;  3HE4 B;  3NTN A;  1PP9 G;  1SQX E;  2O1K A;  1NO4 A;  1L0N D;  1T3J A;  1XTC C;  1OVV A;  2Y0E A;  1X79 B;  3C8V A;  3O6Q A;  3FX0 A;  4OH8 B;  2YKQ A;  2QJK B;  2WSF J;  3MP7 B;  5CCG C;  3BCC D;  1YIJ P;  3VYI A;  1NTZ J;  5KAI E;  1PP9 E;  5B66 H;  3CME P;  4OVN F;  3ABV C;  1LP1 A;  4IL6 H;  5CCG A;  1R8E A;  4I7Z C;  1M56 D;  3GG2 A;  3L4F A;  2JEE A;  1SQP G;  3Q3D A;  2A06 G;  1CI6 B;  2P7J A;  3BCC G;  4D6T G;  3N4X A;  1BDC A;  4PD4 E;  1LTI C;  1KYO I;  1FE6 A;  1U7M A;  1OZH A;  2IYP A;  3A7O A;  3BAT A;  1P84 I;  4PV1 D;  3H25 A;  1T2K D;  4N6J A;  1BCC J;  5H2F E;  1IJD B;  1JY3 O;  2VRS A;  3C9I A;  1ZR4 A;  3H32 B;  3AE6 C;  1YI2 P;  3HTK B;  1FZF A;  2O1J A;  4PV1 B;  3H1L E;  2ZJS E;  4ZMD A;  1L2P A;  1NAF A;  1GK6 A;  1SQV D;  1WT6 A;  4I2L C;  1JCD A;  2KXP B;  2PRR A;  1M7L A;  2PAJ A;  3GHG A;  2WPV B;  5CJ0 A;  1L0L J;  4PJ0 E; 
#chains in the Genus database with same CATH homology
 5C39 A;  1JMB A;  3FXE A;  1EDK A;  5EFW B;  2UWJ E;  4CPG A;  1NVO A;  1X0T A;  2JWD A;  1S3J A;  1BDD A;  4MN4 C;  1SS1 A;  3ZDM A;  4ASW A;  4NPD A;  1U7J A;  4ZNC A;  4GOE A;  2KS1 B;  1EC5 A;  2M5A B;  2R44 A;  2B88 A;  1EDI A;  2M5A A;  5CBO A;  4WWI A;  2LR2 A;  1MFT A;  4HB1 A;  4K3A A;  4ASV A;  5DJT B;  1Y47 A;  2OTK E;  3FXD A;  2B87 B;  5DJU B;  4K35 A;  1ZW0 A;  2KZI A;  2LXC B;  1FC2 C;  1LP1 B;  5CBN A;  1H0T B;  3S1K A;  3RGU A;  4NPE A;  1DEE G;  4NPF X;  4EYY Q;  4KJM A;  3PH0 A;  2KZJ A;  2SPZ A;  4HKZ H;  5K5G B;  1LT1 A;  4BXL A;  2P58 A;  2Q1K A;  2WMM A;  2LXB A;  2KIK A;  1OVR A;  2KUB A;  4GOD A;  2B87 A;  3MHV A;  2HR3 A;  2QRX A;  1OVU A;  2K3R A;  2ZAE B;  2M0B A;  4HJG H;  1OVV A;  1EDJ A;  1JM0 A;  3MZW B;  2I8D A;  2RKL A;  4GOF A;  1LP1 A;  1Q2N A;  1H0T A;  3QWO C;  1BDC A;  1U7M A;  2KI7 B;  4IOI H;  2B89 A;  2QVA A;  4ZMD A;  1EDL A;  4JBZ A;  1ZXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...