5DJTB

Crystal structure of lov2 (c450a) domain in complex with zdk2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
59
structure length
59
Chain Sequence
SVDNKFNKEMLSARVEIYGLPNLNWGQRFAFISSLTDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title LOVTRAP: an optogenetic system for photoinduced protein dissociation.
pubmed doi rcsb
source organism Avena sativa
molecule tags Signaling protein
molecule keywords NPH1-2
total genus 22
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2015-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5djtB00
4NPFX 2B87A 2RKLA 1EDIA 2KIKA 2B87B 2OTKE 1DEEG 5DJUB 1MFTA 4K3AA 1JM0A 4ZNCA 2K3RA 2KZIA 2I8DA 2B88A 4BXLA 2QVAA 2KS1B 2HR3A 1Q2NA 4EYYQ 4GODA 2LXCB 4HB1A 1JMBA 1OVVA 4NPDA 5CBOA 1Y47A 3MZWB 1SS1A 3FXDA 1BDCA 4NPEA 3QWOC 1ZW0A 3ZDMA 4CPGA 1H0TA 4ZMDA 1ZXGA 1H0TB 1EC5A 2KZJA 1EDJA 1X0TA 2P58A 4MN4C 2KUBA 2M5AA 1BDDA 2B89A 4GOFA 1OVUA 3MHVA 3RGUA 1S3JA 4HKZH 4GOEA 2QRXA 1LP1B 2SPZA 2UWJE 4IOIH 5DJTB 2KI7B 1LP1A 2LR2A 2M0BA 4JBZA 2M5AB 1EDLA 2LXBA 2JWDA 4WWIA 4HJGH 1OVRA 2WMMA 3FXEA 5CBNA 5EFWB 2Q1KA 4K35A 1LT1A 4KJMA 1U7JA 1NVOA 3S1KA 5K5GB 1EDKA 1FC2C 5C39A 2R44A 2ZAEB 3PH0A 4ASVA 4ASWA 1U7MA
chains in the Genus database with same CATH superfamily
3PTZA 2B87A 2RKLA 3MP7B 1EDIA 2Y9YA 1FOSF 1HF9A 1KN7A 5KKZB 3L74G 1IFPA 1G2CB 1NJIQ 2OTKE 5APXA 1KTMA 1T6AA 1U57A 3PJSK 2W8ZA 2BASA 1EZVI 2ZYAA 2AXTE 3CC4P 1HJ0A 2N1TB 4DCKA 1LT9B 1PGPA 2O3JA 2JR8A 2WSFJ 4L73A 1GU5A 1S4XA 1LT9A 2I8DA 2QJKC 2YNYA 3V5BA 1SFCB 5TJHA 1JCCA 3L36A 1IFJA 5BU8B 1SFCA 4H13B 3TNUB 3U1AA 4DT0A 1HUCA 2NZ2A 3M0AA 2FYUE 3CX5D 3L70G 3LW5H 5AW3B 3AE2C 3SSUA 4BRYB 1FZCB 1W5CE 2FXMA 2KLVA 1A02F 1FZFA 5KLIC 3H1JE 4BWNA 1KYOE 1LTJB 1OVVA 4N3YB 1RQVA 3H25A 2FXPA 1N2DC 1NU1G 2N1TC 2WSEJ 2KP8A 3F5HA 3L71G 4NPDA 1LTJA 2GUSA 4ZKPA 2H8PD 3AE8C 1RE3A 1KFMA 2ZJSE 2GM4A 1FBMA 2W6BA 2YO3A 2P10A 3TGUE 1BE3E 2JEEA 2A45G 3JCUE 1YITP 1LTSC 3P8CE 4KT0J 3V6IA 5B66E 1LWUA 1BGYJ 5H2FH 3FGAD 3RK2B 3RL0C 1NTKE 1KFNA 5KLIB 3ABVC 1KILA 3HTKB 1L0LE 1YTZI 1RF0C 5AW4B 1YHQP 1AQ5A 2KZJA 3L75D 3RK2D 1JY2O 5AVRB 2IFMA 1ZLLA 5L8RJ 3NFQA 1NHLA 1NKNA 3A0HE 3GHGB 1BGYD 3HUSC 5AW2B 2J5UA 2Q5UA 1L0NK 1NTKD 3H1JJ 1L4AC 5AVVB 1T2KD 4N78E 3CCUP 1R5LA 1IFNA 3TK1A 1BDDA 3TYYA 1IK9A 1E5WA 1JY2P 1URQA 1H8AA 2C9NY 5GTIE 1OVUA 3TGUD 1GL2C 3VMZA 2K9YA 3V4WA 1KQFB 3M0DA 2KLUA 2GUVA 3L70J 3EQ2A 3L70D 2JWAA 4PD4I 4XA4A 3VMAA 1FOSE 4Y99B 1J2JB 3A7OA 4GIFA 3IR9A 3TGUJ 1FZGA 2QRXA 3CCEP 1FE6A 4N78D 1J1EC 1NO4A 1PPJE 1KYOD 2W83C 4IFDK 1AJYA 1SLQA 2N9YB 5KLVD 5DJTB 3A2AA 4DZOA 2BCCE 4KHXA 1LP1A 1RF1B 3WUVA 3A0BH 3U59A 4GKGA 3LIEA 2K37A 1S9KE 2R5DA 1S5LE 3VP9A 2N9BA 1KQSO 1PP9E 3E7KA 2QM7A 3A5TA 2LXBA 5AW6B 1EDLA 1PGOA 2WSSH 1VQ8P 5KAFE 3VMYA 1CSBA 1GL2B 2BEQD 1KQGB 4EOTA 1NYHA 2QE7H 2QG4A 3W68A 1PV3A 3SWFA 3CCVP 1JY3P 3B5NA 4HH2A 2JDIH 2MJZA 1BE3G 3CC2P 1VQ4P 1SQPG 3MUDA 4AYCA 2WSEH 1BE3D 4WWIA 2WT7A 5KKZC 2ZVNB 2E74B 1H89A 1NAFA 5E79E 4I7ZB 1HTLC 3KPEA 2IZ1A 1IO4A 1U7JA 3L35A 4UB8H 1NVOA 3O8ZA 1ZR2A 2IBZD 1CI6A 3U1CA 4AUWA 1T8ZA 2E74D 3V2NA 2V7QH 1SP4A 1FC2C 3H1JG 5C39A 5TISE 1OX3A 2QJKB 4YTPC 1EZVG 4ASVA 2G3AA 1S9KD 1G1JA 2Y0CA 1M1JB 2P7JA 1K04A 4LGDE 4WY4D 2XZRA 3WUUA 2KNCA 1M1JA 1SQBJ 2RMZA 2KK7A 1LTGC 2KIKA 2XDJA 4NPFX 1CW5A 1DX7A 1YTZT 2E74C 2W90A 1MKMA 3K5BA 2B87B 5KLVK 1OXZA 2O01N 3D71A 2H43A 3AEEC 5CCGA 2VRSA 1G2CA 1MFTA 3GW6A 1Q7YQ 2YMYA 1NAYA 2O01H 1Q86Q 1ZRTE 1BCCD 2IZ0A 2JO1A 3RL0D 2YO2A 3HE4B 4ZNCA 4YXDC 3D70A 3KZIH 2N1TA 2R32A 1VF5B 3GG2A 3H1LD 1QVGO 1DIPA 2IBZI 2ZT9D 3S9OA 3PLNA 2B88A 1WMKA 3NXSA 1SQXK 4OGQB 4PD4E 2FYUK 4PJ0E 1NTZD 2E5YA 4QMAA 4U3FJ 4YPCA 3RBXA 1SQBK 1KD1Q 3CD6P 3KDPB 1GMJA 4RJTA 3JSVC 2WWWA 4U3FG 2XKMA 1BSNA 3CX5H 5CBNA 1SQVE 2ZT9B 4IL6H 5APTA 3BVHA 2IPPA 1FZCA 1AQTA 4L74A 1QVFO 1RE4C 3R4YA 1DD3A 1JMBA 1FS0E 1KILC 4XFJA 2R3CA 3BCCD 1P84I 3CI9A 3GF3A 5B5EH 3EFGA 4JF7A 1FZEA 5APYA 1GU4A 1UIIA 3FXDA 2AXTH 5AW1B 1PL5A 3I55P 3AEBC 2R5BA 4OGQC 2OYHC 2QJPC 2AEMA 2E42A 3CMAP 4D6TE 1ZW0A 2YIUC 1SQQE 4CPGA 1KB9E 1FZBA 3HUSA 3B8EB 1LTAC 4DJGA 1MFZA 3C1LA 3HRNA 3CXHD 3H1HD 1KILE 3P32A 1ZXGA 2FYUJ 5APUA 1WRGA 3AE4C 2L91A 2WSCH 2IYPA 2KS1A 5KJ7D 3CX5I 1RH5B 2C0XA 3HTKA 1VQPP 3H1IJ 4W80A 2A45H 2E75B 4H44C 2K1AA 3S4RA 2KSEA 3OAKA 5APSA 1ZV8A 3GMAA 1NU1J 3CWBE 5M1BA 2Y0EA 2NRGA 2P58A 3L71E 2FBWC 4MN4C 1QGKB 1QEXA 2OGUA 3L72E 1CZQA 3M9HA 2Y9ZA 1SQVJ 2OYIA 1HJBA 2Z5IA 2J58A 2YMKA 2YIUB 2YKQA 2R3SA 1KILD 3L75G 4N6JA 3Q2YA 1VQ6P 1OW7A 3MIWA 1EXIA 2H7HA 1KB9D 1L0LG 1BGYG 1IFMA 1NTKJ 3MHVA 2NPSA 2WTYA 3WU2E 2E43A 2A06D 2Z4EA 3AEFC 1L0LJ 1K73Q 1S3JA 1FDMA 4GOEA 2NPSB 1SQXJ 2E75C 3IF4A 2JKVA 1RHZB 1S5LX 1LTTC 2E76B 3B5NC 4D6TJ 1Q82Q 2K9JB 5KJ7A 3BCCE 3V2QA 2FKWB 5AVYB 3E1IA 2WSFH 1W2BO 4IOIH 2KI7B 1S72P 1ZR4A 1RF1A 2QM8A 1NTMD 1TU3F 4JBZA 3H1KD 2I1KA 3IFMA 2M5AB 5APWA 5AVUB 1NTZK 1JCDA 3G3ZA 3H1IE 1NU1D 1OVRA 3B5ND 1E79H 1FDIA 3RK2C 3CXHH 4EIJA 2Q9IA 2WMMA 1NTZE 5AW8B 3OA7A 1ZMEC 2OQQA 2P1JA 1QX8A 5GTIH 3FXEA 1L2PA 1ZOYC 3H1LE 2FYUG 1JY3N 2HODA 3BRVB 3L72J 1X9VA 3L70E 1N86A 2ITAA 3TF5A 2E76C 3B5NB 3Q1MA 1N7SB 2C0WA 3L72G 1ZRTD 1LT1A 2HODB 3II6A 3HE5B 2QEXP 1PGJA 1XTCC 1N73B 5GTHE 2WT7B 3NMDA 3E1RA 4KJMA 1HVVA 1IJDB 1EQ7A 1KYOI 1LTJC 2XNXA 3C8VA 3HE4A 2P67A 4WBAA 5CJ0A 5CCGC 3PHLA 1NTMK 2H89C 1RE3C 3S1KA 4Y28J 1YQ4C 2IDBA 3H32B 1M56D 1PP9J 1SQXE 4RESB 2WPRA 1VF5C 3TNUA 3BCCJ 5CMZA 2HPCB 1KV4A 1SQPD 1NWQA 1LWUC 1UIXA 2KYVA 5KAIH 2IX7C 1A02J 2XU6A 2CPSA 1N7SC 4IFFA 2O01J 4PJ0H 5APQA 3PRJA 3RK3D 1N73C 4C46A 5BVZA 1JY3O 2ZT9C 1H88A 2WVRA 5CCHA 1FJKA 1P84H 1M90Q 3VTPC 1N8RQ 3OJAB 1PIXA 1K05A 4K3AA 4O9BA 4UB6E 2Y0DA 2A06G 4WY4C 3I5CA 1T2KC 1IZNB 2KSJA 1VL2A 4JYCA 1JB0J 1JM0A 1KYOH 3L4FA 3LIDA 1YJ9P 1BSHA 2KZIA 3T97B 1KQLA 2RH0A 3V2RA 4RKUJ 1W2EA 2YXQB 3AEAC 3HUSB 3NTNA 5B66H 3N7NA 1HH0A 1SQPK 3O6QA 5B5EE 2QJPB 1LWUB 4BXLA 4TLFA 2NPSD 2QVAA 1LNQA 3L72D 1SQPE 3FX0A 3RL0g 3L71D 2KS1B 2KB7P 2LKMA 1OIPA 1Q2NA 1SQBE 3AEDC 1NH4A 4H0LC 1SQQG 1R5SA 5AVXB 4GODA 2LXCB 2FYNC 1X79B 5H2FE 3AE1C 4HB1A 5KTBA 1KMIZ 1VQLP 2ZFCA 5AVQB 1PP9G 1PPJD 2AXCA 2BCCG 1D7MA 1JNMA 1Y47A 4H44B 4AQRD 1X8YA 4ZKUA 1EZVD 1YBKA 1L0NE 3BCCG 3QH9A 4HYTB 1VQ5P 1J1DC 1SS1A 2CPBA 5AW0B 1HWTC 3CCLP 1BDCA 1JO5A 3PP5A 2KOGA 3MD0A 3HD7A 3KZIE 3A0HH 3G9RA 4H44D 3G4SP 2OYIC 4ZMDA 3AECC 5BU5A 2AEFA 2ZXEB 5AVZB 1LTIC 2QIWA 1LGHB 4A7PA 3P7KA 4I2LC 1FAVA 3MUDC 1NTKK 5CHXA 2H88C 1GK6A 1JUNA 1NTMG 1GW4A 1EC5A 4WVZA 3CCQP 1K9MQ 2NPSC 4L75A 4WB4A 1DH3A 1EDJA 1SQVD 1Y8AA 1X0TA 1OW8A 1SQPJ 3VOPA 2V7QJ 1Q81Q 3V4QA 4PV1D 1VQMP 4H0LD 4W7YA 1GD2E 2KUBA 2M5AA 2G8YA 5KJ7C 3Q5PA 3CL3D 1NGMB 2JP3A 4GOFA 1SQQJ 2WZ7A 3A0BE 3SFDC 1M7LA 1AFOA 1S5LH 1NOHA 2KXPB 4PV1B 1K8AQ 1AVYA 1KB9H 2E5TA 3B4SA 1MUUA 3W67A 2FFDC 1M1JC 2OTJP 1L0ND 1YQ3C 2FY8A 1EZVE 5CCHD 3CLQA 1JOCA 2W6JH 3HE5A 1VDFA 2FXOA 2IYOA 3A3YB 3AE7C 2SPZA 2UWJE 5AVTB 3G6EP 2A45I 5APVA 1YJNP 1NU1E 3CWBJ 2K9JA 2LR2A 1CI6B 3L71J 1RY3A 5AVSB 2D2CC 2M0BA 3H1JD 4H13D 1R8EA 5KLVJ 1ZP0C 3CCSP 1IFIA 3H1KJ 5E79H 3AEGC 4M3LA 4HJGH 2M3EA 2I1JA 2HPCA 1YI2P 1URQB 2FFDB 2IBZE 3CPWO 1YIJP 3D6YA 4JYBA 3FWNA 1FU1A 3EWKA 1USEA 1KB9I 4H13C 5AW9B 2Q1KA 3N4XA 1FZCC 4K35A 3CMEP 1RF0A 4I6MC 5AW5B 1RE4A 1FDOA 1QL2A 1URQD 5KAIE 3TDKA 4LLHA 1PGQA 1N7SA 3GHGC 3BASA 3GLMA 1N73A 3GF7A 2ZYDA 2K88A 2OYOA 3D6ZA 5CCHC 1HGZA 4WY4B 3UIAA 1P84E 1EXJA 1JTHA 1L4AA 1QL1A 2E75D 3O6QB 1EDKA 1IK7A 1OWAA 1URQC 2R44A 1JTHB 3PH0A 3VN0A 2O1KA 4I1LA 2XV5A 3H1LG 1U7MA 2WSCJ 1NTZJ 3SWKA 1GL2A 4Y99C 2D2CD 1GDTA 3M0DC 1BCCG 3H1LJ 3L37A 5KLVE 3RL0B 2WPVB 3Q5SA 2FFDA 2GA1A 3H1IG 4UB8E 2Z5HA 1RQUA 4H0LB 1BCCJ 1VF5D 3BATA 1DEEG 4XE5B 1HBWA 5DJUB 2CK3H 3R2PA 3H1KG 3P8MC 2QA4P 5TISH 4R4LA 1L0NG 1PZQA 2Q7CA 1VQOP 2JJLA 2M3BA 1AVOA 3AE5C 2C9LY 2E76D 2K3RA 3JCUH 3RK3C 2O1JA 1GK4A 3WUTA 1BE3J 1JEKA 2RN0A 1JY2N 3CCMP 2OTLP 5CCGD 1RF1C 3F89A 3CXHI 3H1HG 1M1KQ 1VQKP 1BGYE 1NTKG 4EI2A 1SVFA 3I56P 2W6AA 2XNDH 2HR3A 3HD7C 2IFNA 1OFCX 5AVWB 4EYYQ 2V4HA 1KC8Q 3L75E 1DEBA 2KNCB 1SQXG 4B86A 4D6TG 2WITA 4JPZB 4OGQD 1FZAA 4W7ZA 1WT6A 2Q6QA 1SQXD 1FJPA 3LW5J 3C9IA 4L76A 4DOJA 1LT9C 4JQ0D 5CBOA 3M9BA 1XTGB 2WQYC 3MZWB 1J1EB 1GL2D 1OMIA 1PPJG 2A06E 1N7SD 2PP6A 1HGVA 4C7RA 4EDFA 5CJ4A 2PRRA 1SFCC 3IN6A 3L74E 4NPEA 4U7JA 4LC1A 2M8RA 1YYCA 1ZN5A 3QWOC 3TSIA 5AW7B 2MKVA 1BCCE 5KLVG 1LTBC 3ZDMA 1IC2A 4IFMA 3M06A 1AV1A 1VQNP 1H0TA 3ITKA 1SQQK 1L0LK 1NTZG 3HD7B 3L73D 4PD4H 4C7NA 1H0TB 4PV1C 1OW6A 2QJYC 3M91A 4BRYA 3WMM0 4C7NB 2W27A 3CWBD 1M8OB 1PP9D 1SQVK 2P2UA 3H1ID 1S1CX 4IL6E 1SQBD 2WPSA 1NU1K 3AE3C 3V2PA 2BCCJ 3VMXA 1MV8A 1P84D 3H1HJ 1L0NJ 4R4MA 4I7ZC 3L75J 2HFED 2D2CB 3CXHE 1Y9BA 1T3UA 2B89A 3L73E 1SQVG 2N1TD 1SQQD 1KZUB 3AE6C 1AA0A 2IBZG 3VYIA 4D6TD 3KXDA 1S2EA 2YKPA 1Z56A 1LJ2A 2OARA 2Q3IA 2QJYB 4GDOA 4Z1MH 1SFCD 3RGUA 2FYZA 3SFEC 3L74J 2B9BA 2HG5D 2PAJA 1L4AD 1KILB 3JC22 3L74D 4HKZH 2L5GB 3RK3E 2AEJA 1M57D 1DD4A 1NTMJ 2J59M 3VP8A 3G71P 3CC7P 1LP1B 2QSIA 2WPQA 1J1DB 3Q3DA 4WY4A 4OWFA 1L4AB 4RO0A 3H32A 3USSA 1VQ9P 3GHGA 5GTHH 4U3FD 2ZXXA 2OYHA 2OYIB 2JWDA 1L0LD 1JMMA 1X22A 1MZ9A 2BCCD 2YXRB 2POHA 1OZHA 3H6PA 1T3JA 4GT1A 4PD4D 4OH8B 4YXWH 3IAOA 3KHUA 3OW2O 1IFDA 2BEZF 1USDA 3P8CD 1SQBG 3KQGA 3H1HE 3RBZA 3L73G 5EFWB 3Q5RA 2ZVOB 3MTUE 1QLED 4OVNF 1GZLA 3L73J 3WU2H 4UB6H 3TGUG 3M9QA 2OYHB 2HYNA 3B71A 2ZYGA 3BRTB 2FYNB 1GW3A 1PFIA 3CCRP 1VPCA 3EFFK 3CCJP 3RK3B 5KAFH 3CWBG 3KYQA 1NKZB 4IL6X 3T97A 2HLOA 1KORA 2PFXA 1Q90D 3HD7D 2PGDA 3MGNA 5K5GB 3H1KE 3SWYA 1NTME 4TT3H 2ZAEB 1YJWP 4U3FE 3FWLA 4ASWA 1VQ7P 2FYUD 3AE9C 3CX5E 1G1IA 2YKOA 1GTWA 2DW3A 1N7LA 2Q3EA
chains in the Genus database with same CATH topology
4NPFX 2B87A 2RKLA 1EDIA 2KIKA 2B87B 2OTKE 1DEEG 5DJUB 1MFTA 4K3AA 1JM0A 4ZNCA 2K3RA 2KZIA 2I8DA 2B88A 4BXLA 2QVAA 2KS1B 2HR3A 1Q2NA 4EYYQ 4GODA 2LXCB 4HB1A 1JMBA 1OVVA 4NPDA 5CBOA 1Y47A 3MZWB 1SS1A 3FXDA 1BDCA 4NPEA 3QWOC 1ZW0A 3ZDMA 4CPGA 1H0TA 4ZMDA 1ZXGA 1H0TB 1EC5A 2KZJA 1EDJA 1X0TA 2P58A 4MN4C 2KUBA 2M5AA 1BDDA 2B89A 4GOFA 1OVUA 3MHVA 3RGUA 1S3JA 4HKZH 4GOEA 2QRXA 1LP1B 2SPZA 2UWJE 4IOIH 5DJTB 2KI7B 1LP1A 2LR2A 2M0BA 4JBZA 2M5AB 1EDLA 2LXBA 2JWDA 4WWIA 4HJGH 1OVRA 2WMMA 3FXEA 5CBNA 5EFWB 2Q1KA 4K35A 1LT1A 4KJMA 1U7JA 1NVOA 3S1KA 5K5GB 1EDKA 1FC2C 5C39A 2R44A 2ZAEB 3PH0A 4ASVA 4ASWA 1U7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NPF X;  2B87 A;  2RKL A;  1EDI A;  2KIK A;  2B87 B;  2OTK E;  1DEE G;  5DJU B;  1MFT A;  4K3A A;  1JM0 A;  4ZNC A;  2K3R A;  2KZI A;  2I8D A;  2B88 A;  4BXL A;  2QVA A;  2KS1 B;  2HR3 A;  1Q2N A;  4EYY Q;  4GOD A;  2LXC B;  4HB1 A;  1JMB A;  1OVV A;  4NPD A;  5CBO A;  1Y47 A;  3MZW B;  1SS1 A;  3FXD A;  1BDC A;  4NPE A;  3QWO C;  1ZW0 A;  3ZDM A;  4CPG A;  1H0T A;  4ZMD A;  1ZXG A;  1H0T B;  1EC5 A;  2KZJ A;  1EDJ A;  1X0T A;  2P58 A;  4MN4 C;  2KUB A;  2M5A A;  1BDD A;  2B89 A;  4GOF A;  1OVU A;  3MHV A;  3RGU A;  1S3J A;  4HKZ H;  4GOE A;  2QRX A;  1LP1 B;  2SPZ A;  2UWJ E;  4IOI H;  5DJT B;  2KI7 B;  1LP1 A;  2LR2 A;  2M0B A;  4JBZ A;  2M5A B;  1EDL A;  2LXB A;  2JWD A;  4WWI A;  4HJG H;  1OVR A;  2WMM A;  3FXE A;  5CBN A;  5EFW B;  2Q1K A;  4K35 A;  1LT1 A;  4KJM A;  1U7J A;  1NVO A;  3S1K A;  5K5G B;  1EDK A;  1FC2 C;  5C39 A;  2R44 A;  2ZAE B;  3PH0 A;  4ASV A;  4ASW A;  1U7M A; 
#chains in the Genus database with same CATH topology
 3PTZ A;  2B87 A;  2RKL A;  3MP7 B;  1EDI A;  2Y9Y A;  1FOS F;  1HF9 A;  1KN7 A;  5KKZ B;  3L74 G;  1IFP A;  1G2C B;  1NJI Q;  2OTK E;  5APX A;  1KTM A;  1T6A A;  1U57 A;  3PJS K;  2W8Z A;  2BAS A;  1EZV I;  2ZYA A;  2AXT E;  3CC4 P;  1HJ0 A;  2N1T B;  4DCK A;  1LT9 B;  1PGP A;  2O3J A;  2JR8 A;  2WSF J;  4L73 A;  1GU5 A;  1S4X A;  1LT9 A;  2I8D A;  2QJK C;  2YNY A;  3V5B A;  1SFC B;  5TJH A;  1JCC A;  3L36 A;  1IFJ A;  5BU8 B;  1SFC A;  4H13 B;  3TNU B;  3U1A A;  4DT0 A;  1HUC A;  2NZ2 A;  3M0A A;  2FYU E;  3CX5 D;  3L70 G;  3LW5 H;  5AW3 B;  3AE2 C;  3SSU A;  4BRY B;  1FZC B;  1W5C E;  2FXM A;  2KLV A;  1A02 F;  1FZF A;  5KLI C;  3H1J E;  4BWN A;  1KYO E;  1LTJ B;  1OVV A;  4N3Y B;  1RQV A;  3H25 A;  2FXP A;  1N2D C;  1NU1 G;  2N1T C;  2WSE J;  2KP8 A;  3F5H A;  3L71 G;  4NPD A;  1LTJ A;  2GUS A;  4ZKP A;  2H8P D;  3AE8 C;  1RE3 A;  1KFM A;  2ZJS E;  2GM4 A;  1FBM A;  2W6B A;  2YO3 A;  2P10 A;  3TGU E;  1BE3 E;  2JEE A;  2A45 G;  3JCU E;  1YIT P;  1LTS C;  3P8C E;  4KT0 J;  3V6I A;  5B66 E;  1LWU A;  1BGY J;  5H2F H;  3FGA D;  3RK2 B;  3RL0 C;  1NTK E;  1KFN A;  5KLI B;  3ABV C;  1KIL A;  3HTK B;  1L0L E;  1YTZ I;  1RF0 C;  5AW4 B;  1YHQ P;  1AQ5 A;  2KZJ A;  3L75 D;  3RK2 D;  1JY2 O;  5AVR B;  2IFM A;  1ZLL A;  5L8R J;  3NFQ A;  1NHL A;  1NKN A;  3A0H E;  3GHG B;  1BGY D;  3HUS C;  5AW2 B;  2J5U A;  2Q5U A;  1L0N K;  1NTK D;  3H1J J;  1L4A C;  5AVV B;  1T2K D;  4N78 E;  3CCU P;  1R5L A;  1IFN A;  3TK1 A;  1BDD A;  3TYY A;  1IK9 A;  1E5W A;  1JY2 P;  1URQ A;  1H8A A;  2C9N Y;  5GTI E;  1OVU A;  3TGU D;  1GL2 C;  3VMZ A;  2K9Y A;  3V4W A;  1KQF B;  3M0D A;  2KLU A;  2GUV A;  3L70 J;  3EQ2 A;  3L70 D;  2JWA A;  4PD4 I;  4XA4 A;  3VMA A;  1FOS E;  4Y99 B;  1J2J B;  3A7O A;  4GIF A;  3IR9 A;  3TGU J;  1FZG A;  2QRX A;  3CCE P;  1FE6 A;  4N78 D;  1J1E C;  1NO4 A;  1PPJ E;  1KYO D;  2W83 C;  4IFD K;  1AJY A;  1SLQ A;  2N9Y B;  5KLV D;  5DJT B;  3A2A A;  4DZO A;  2BCC E;  4KHX A;  1LP1 A;  1RF1 B;  3WUV A;  3A0B H;  3U59 A;  4GKG A;  3LIE A;  2K37 A;  1S9K E;  2R5D A;  1S5L E;  3VP9 A;  2N9B A;  1KQS O;  1PP9 E;  3E7K A;  2QM7 A;  3A5T A;  2LXB A;  5AW6 B;  1EDL A;  1PGO A;  2WSS H;  1VQ8 P;  5KAF E;  3VMY A;  1CSB A;  1GL2 B;  2BEQ D;  1KQG B;  4EOT A;  1NYH A;  2QE7 H;  2QG4 A;  3W68 A;  1PV3 A;  3SWF A;  3CCV P;  1JY3 P;  3B5N A;  4HH2 A;  2JDI H;  2MJZ A;  1BE3 G;  3CC2 P;  1VQ4 P;  1SQP G;  3MUD A;  4AYC A;  2WSE H;  1BE3 D;  4WWI A;  2WT7 A;  5KKZ C;  2ZVN B;  2E74 B;  1H89 A;  1NAF A;  5E79 E;  4I7Z B;  1HTL C;  3KPE A;  2IZ1 A;  1IO4 A;  1U7J A;  3L35 A;  4UB8 H;  1NVO A;  3O8Z A;  1ZR2 A;  2IBZ D;  1CI6 A;  3U1C A;  4AUW A;  1T8Z A;  2E74 D;  3V2N A;  2V7Q H;  1SP4 A;  1FC2 C;  3H1J G;  5C39 A;  5TIS E;  1OX3 A;  2QJK B;  4YTP C;  1EZV G;  4ASV A;  2G3A A;  1S9K D;  1G1J A;  2Y0C A;  1M1J B;  2P7J A;  1K04 A;  4LGD E;  4WY4 D;  2XZR A;  3WUU A;  2KNC A;  1M1J A;  1SQB J;  2RMZ A;  2KK7 A;  1LTG C;  2KIK A;  2XDJ A;  4NPF X;  1CW5 A;  1DX7 A;  1YTZ T;  2E74 C;  2W90 A;  1MKM A;  3K5B A;  2B87 B;  5KLV K;  1OXZ A;  2O01 N;  3D71 A;  2H43 A;  3AEE C;  5CCG A;  2VRS A;  1G2C A;  1MFT A;  3GW6 A;  1Q7Y Q;  2YMY A;  1NAY A;  2O01 H;  1Q86 Q;  1ZRT E;  1BCC D;  2IZ0 A;  2JO1 A;  3RL0 D;  2YO2 A;  3HE4 B;  4ZNC A;  4YXD C;  3D70 A;  3KZI H;  2N1T A;  2R32 A;  1VF5 B;  3GG2 A;  3H1L D;  1QVG O;  1DIP A;  2IBZ I;  2ZT9 D;  3S9O A;  3PLN A;  2B88 A;  1WMK A;  3NXS A;  1SQX K;  4OGQ B;  4PD4 E;  2FYU K;  4PJ0 E;  1NTZ D;  2E5Y A;  4QMA A;  4U3F J;  4YPC A;  3RBX A;  1SQB K;  1KD1 Q;  3CD6 P;  3KDP B;  1GMJ A;  4RJT A;  3JSV C;  2WWW A;  4U3F G;  2XKM A;  1BSN A;  3CX5 H;  5CBN A;  1SQV E;  2ZT9 B;  4IL6 H;  5APT A;  3BVH A;  2IPP A;  1FZC A;  1AQT A;  4L74 A;  1QVF O;  1RE4 C;  3R4Y A;  1DD3 A;  1JMB A;  1FS0 E;  1KIL C;  4XFJ A;  2R3C A;  3BCC D;  1P84 I;  3CI9 A;  3GF3 A;  5B5E H;  3EFG A;  4JF7 A;  1FZE A;  5APY A;  1GU4 A;  1UII A;  3FXD A;  2AXT H;  5AW1 B;  1PL5 A;  3I55 P;  3AEB C;  2R5B A;  4OGQ C;  2OYH C;  2QJP C;  2AEM A;  2E42 A;  3CMA P;  4D6T E;  1ZW0 A;  2YIU C;  1SQQ E;  4CPG A;  1KB9 E;  1FZB A;  3HUS A;  3B8E B;  1LTA C;  4DJG A;  1MFZ A;  3C1L A;  3HRN A;  3CXH D;  3H1H D;  1KIL E;  3P32 A;  1ZXG A;  2FYU J;  5APU A;  1WRG A;  3AE4 C;  2L91 A;  2WSC H;  2IYP A;  2KS1 A;  5KJ7 D;  3CX5 I;  1RH5 B;  2C0X A;  3HTK A;  1VQP P;  3H1I J;  4W80 A;  2A45 H;  2E75 B;  4H44 C;  2K1A A;  3S4R A;  2KSE A;  3OAK A;  5APS A;  1ZV8 A;  3GMA A;  1NU1 J;  3CWB E;  5M1B A;  2Y0E A;  2NRG A;  2P58 A;  3L71 E;  2FBW C;  4MN4 C;  1QGK B;  1QEX A;  2OGU A;  3L72 E;  1CZQ A;  3M9H A;  2Y9Z A;  1SQV J;  2OYI A;  1HJB A;  2Z5I A;  2J58 A;  2YMK A;  2YIU B;  2YKQ A;  2R3S A;  1KIL D;  3L75 G;  4N6J A;  3Q2Y A;  1VQ6 P;  1OW7 A;  3MIW A;  1EXI A;  2H7H A;  1KB9 D;  1L0L G;  1BGY G;  1IFM A;  1NTK J;  3MHV A;  2NPS A;  2WTY A;  3WU2 E;  2E43 A;  2A06 D;  2Z4E A;  3AEF C;  1L0L J;  1K73 Q;  1S3J A;  1FDM A;  4GOE A;  2NPS B;  1SQX J;  2E75 C;  3IF4 A;  2JKV A;  1RHZ B;  1S5L X;  1LTT C;  2E76 B;  3B5N C;  4D6T J;  1Q82 Q;  2K9J B;  5KJ7 A;  3BCC E;  3V2Q A;  2FKW B;  5AVY B;  3E1I A;  2WSF H;  1W2B O;  4IOI H;  2KI7 B;  1S72 P;  1ZR4 A;  1RF1 A;  2QM8 A;  1NTM D;  1TU3 F;  4JBZ A;  3H1K D;  2I1K A;  3IFM A;  2M5A B;  5APW A;  5AVU B;  1NTZ K;  1JCD A;  3G3Z A;  3H1I E;  1NU1 D;  1OVR A;  3B5N D;  1E79 H;  1FDI A;  3RK2 C;  3CXH H;  4EIJ A;  2Q9I A;  2WMM A;  1NTZ E;  5AW8 B;  3OA7 A;  1ZME C;  2OQQ A;  2P1J A;  1QX8 A;  5GTI H;  3FXE A;  1L2P A;  1ZOY C;  3H1L E;  2FYU G;  1JY3 N;  2HOD A;  3BRV B;  3L72 J;  1X9V A;  3L70 E;  1N86 A;  2ITA A;  3TF5 A;  2E76 C;  3B5N B;  3Q1M A;  1N7S B;  2C0W A;  3L72 G;  1ZRT D;  1LT1 A;  2HOD B;  3II6 A;  3HE5 B;  2QEX P;  1PGJ A;  1XTC C;  1N73 B;  5GTH E;  2WT7 B;  3NMD A;  3E1R A;  4KJM A;  1HVV A;  1IJD B;  1EQ7 A;  1KYO I;  1LTJ C;  2XNX A;  3C8V A;  3HE4 A;  2P67 A;  4WBA A;  5CJ0 A;  5CCG C;  3PHL A;  1NTM K;  2H89 C;  1RE3 C;  3S1K A;  4Y28 J;  1YQ4 C;  2IDB A;  3H32 B;  1M56 D;  1PP9 J;  1SQX E;  4RES B;  2WPR A;  1VF5 C;  3TNU A;  3BCC J;  5CMZ A;  2HPC B;  1KV4 A;  1SQP D;  1NWQ A;  1LWU C;  1UIX A;  2KYV A;  5KAI H;  2IX7 C;  1A02 J;  2XU6 A;  2CPS A;  1N7S C;  4IFF A;  2O01 J;  4PJ0 H;  5APQ A;  3PRJ A;  3RK3 D;  1N73 C;  4C46 A;  5BVZ A;  1JY3 O;  2ZT9 C;  1H88 A;  2WVR A;  5CCH A;  1FJK A;  1P84 H;  1M90 Q;  3VTP C;  1N8R Q;  3OJA B;  1PIX A;  1K05 A;  4K3A A;  4O9B A;  4UB6 E;  2Y0D A;  2A06 G;  4WY4 C;  3I5C A;  1T2K C;  1IZN B;  2KSJ A;  1VL2 A;  4JYC A;  1JB0 J;  1JM0 A;  1KYO H;  3L4F A;  3LID A;  1YJ9 P;  1BSH A;  2KZI A;  3T97 B;  1KQL A;  2RH0 A;  3V2R A;  4RKU J;  1W2E A;  2YXQ B;  3AEA C;  3HUS B;  3NTN A;  5B66 H;  3N7N A;  1HH0 A;  1SQP K;  3O6Q A;  5B5E E;  2QJP B;  1LWU B;  4BXL A;  4TLF A;  2NPS D;  2QVA A;  1LNQ A;  3L72 D;  1SQP E;  3FX0 A;  3RL0 g;  3L71 D;  2KS1 B;  2KB7 P;  2LKM A;  1OIP A;  1Q2N A;  1SQB E;  3AED C;  1NH4 A;  4H0L C;  1SQQ G;  1R5S A;  5AVX B;  4GOD A;  2LXC B;  2FYN C;  1X79 B;  5H2F E;  3AE1 C;  4HB1 A;  5KTB A;  1KMI Z;  1VQL P;  2ZFC A;  5AVQ B;  1PP9 G;  1PPJ D;  2AXC A;  2BCC G;  1D7M A;  1JNM A;  1Y47 A;  4H44 B;  4AQR D;  1X8Y A;  4ZKU A;  1EZV D;  1YBK A;  1L0N E;  3BCC G;  3QH9 A;  4HYT B;  1VQ5 P;  1J1D C;  1SS1 A;  2CPB A;  5AW0 B;  1HWT C;  3CCL P;  1BDC A;  1JO5 A;  3PP5 A;  2KOG A;  3MD0 A;  3HD7 A;  3KZI E;  3A0H H;  3G9R A;  4H44 D;  3G4S P;  2OYI C;  4ZMD A;  3AEC C;  5BU5 A;  2AEF A;  2ZXE B;  5AVZ B;  1LTI C;  2QIW A;  1LGH B;  4A7P A;  3P7K A;  4I2L C;  1FAV A;  3MUD C;  1NTK K;  5CHX A;  2H88 C;  1GK6 A;  1JUN A;  1NTM G;  1GW4 A;  1EC5 A;  4WVZ A;  3CCQ P;  1K9M Q;  2NPS C;  4L75 A;  4WB4 A;  1DH3 A;  1EDJ A;  1SQV D;  1Y8A A;  1X0T A;  1OW8 A;  1SQP J;  3VOP A;  2V7Q J;  1Q81 Q;  3V4Q A;  4PV1 D;  1VQM P;  4H0L D;  4W7Y A;  1GD2 E;  2KUB A;  2M5A A;  2G8Y A;  5KJ7 C;  3Q5P A;  3CL3 D;  1NGM B;  2JP3 A;  4GOF A;  1SQQ J;  2WZ7 A;  3A0B E;  3SFD C;  1M7L A;  1AFO A;  1S5L H;  1NOH A;  2KXP B;  4PV1 B;  1K8A Q;  1AVY A;  1KB9 H;  2E5T A;  3B4S A;  1MUU A;  3W67 A;  2FFD C;  1M1J C;  2OTJ P;  1L0N D;  1YQ3 C;  2FY8 A;  1EZV E;  5CCH D;  3CLQ A;  1JOC A;  2W6J H;  3HE5 A;  1VDF A;  2FXO A;  2IYO A;  3A3Y B;  3AE7 C;  2SPZ A;  2UWJ E;  5AVT B;  3G6E P;  2A45 I;  5APV A;  1YJN P;  1NU1 E;  3CWB J;  2K9J A;  2LR2 A;  1CI6 B;  3L71 J;  1RY3 A;  5AVS B;  2D2C C;  2M0B A;  3H1J D;  4H13 D;  1R8E A;  5KLV J;  1ZP0 C;  3CCS P;  1IFI A;  3H1K J;  5E79 H;  3AEG C;  4M3L A;  4HJG H;  2M3E A;  2I1J A;  2HPC A;  1YI2 P;  1URQ B;  2FFD B;  2IBZ E;  3CPW O;  1YIJ P;  3D6Y A;  4JYB A;  3FWN A;  1FU1 A;  3EWK A;  1USE A;  1KB9 I;  4H13 C;  5AW9 B;  2Q1K A;  3N4X A;  1FZC C;  4K35 A;  3CME P;  1RF0 A;  4I6M C;  5AW5 B;  1RE4 A;  1FDO A;  1QL2 A;  1URQ D;  5KAI E;  3TDK A;  4LLH A;  1PGQ A;  1N7S A;  3GHG C;  3BAS A;  3GLM A;  1N73 A;  3GF7 A;  2ZYD A;  2K88 A;  2OYO A;  3D6Z A;  5CCH C;  1HGZ A;  4WY4 B;  3UIA A;  1P84 E;  1EXJ A;  1JTH A;  1L4A A;  1QL1 A;  2E75 D;  3O6Q B;  1EDK A;  1IK7 A;  1OWA A;  1URQ C;  2R44 A;  1JTH B;  3PH0 A;  3VN0 A;  2O1K A;  4I1L A;  2XV5 A;  3H1L G;  1U7M A;  2WSC J;  1NTZ J;  3SWK A;  1GL2 A;  4Y99 C;  2D2C D;  1GDT A;  3M0D C;  1BCC G;  3H1L J;  3L37 A;  5KLV E;  3RL0 B;  2WPV B;  3Q5S A;  2FFD A;  2GA1 A;  3H1I G;  4UB8 E;  2Z5H A;  1RQU A;  4H0L B;  1BCC J;  1VF5 D;  3BAT A;  1DEE G;  4XE5 B;  1HBW A;  5DJU B;  2CK3 H;  3R2P A;  3H1K G;  3P8M C;  2QA4 P;  5TIS H;  4R4L A;  1L0N G;  1PZQ A;  2Q7C A;  1VQO P;  2JJL A;  2M3B A;  1AVO A;  3AE5 C;  2C9L Y;  2E76 D;  2K3R A;  3JCU H;  3RK3 C;  2O1J A;  1GK4 A;  3WUT A;  1BE3 J;  1JEK A;  2RN0 A;  1JY2 N;  3CCM P;  2OTL P;  5CCG D;  1RF1 C;  3F89 A;  3CXH I;  3H1H G;  1M1K Q;  1VQK P;  1BGY E;  1NTK G;  4EI2 A;  1SVF A;  3I56 P;  2W6A A;  2XND H;  2HR3 A;  3HD7 C;  2IFN A;  1OFC X;  5AVW B;  4EYY Q;  2V4H A;  1KC8 Q;  3L75 E;  1DEB A;  2KNC B;  1SQX G;  4B86 A;  4D6T G;  2WIT A;  4JPZ B;  4OGQ D;  1FZA A;  4W7Z A;  1WT6 A;  2Q6Q A;  1SQX D;  1FJP A;  3LW5 J;  3C9I A;  4L76 A;  4DOJ A;  1LT9 C;  4JQ0 D;  5CBO A;  3M9B A;  1XTG B;  2WQY C;  3MZW B;  1J1E B;  1GL2 D;  1OMI A;  1PPJ G;  2A06 E;  1N7S D;  2PP6 A;  1HGV A;  4C7R A;  4EDF A;  5CJ4 A;  2PRR A;  1SFC C;  3IN6 A;  3L74 E;  4NPE A;  4U7J A;  4LC1 A;  2M8R A;  1YYC A;  1ZN5 A;  3QWO C;  3TSI A;  5AW7 B;  2MKV A;  1BCC E;  5KLV G;  1LTB C;  3ZDM A;  1IC2 A;  4IFM A;  3M06 A;  1AV1 A;  1VQN P;  1H0T A;  3ITK A;  1SQQ K;  1L0L K;  1NTZ G;  3HD7 B;  3L73 D;  4PD4 H;  4C7N A;  1H0T B;  4PV1 C;  1OW6 A;  2QJY C;  3M91 A;  4BRY A;  3WMM 0;  4C7N B;  2W27 A;  3CWB D;  1M8O B;  1PP9 D;  1SQV K;  2P2U A;  3H1I D;  1S1C X;  4IL6 E;  1SQB D;  2WPS A;  1NU1 K;  3AE3 C;  3V2P A;  2BCC J;  3VMX A;  1MV8 A;  1P84 D;  3H1H J;  1L0N J;  4R4M A;  4I7Z C;  3L75 J;  2HFE D;  2D2C B;  3CXH E;  1Y9B A;  1T3U A;  2B89 A;  3L73 E;  1SQV G;  2N1T D;  1SQQ D;  1KZU B;  3AE6 C;  1AA0 A;  2IBZ G;  3VYI A;  4D6T D;  3KXD A;  1S2E A;  2YKP A;  1Z56 A;  1LJ2 A;  2OAR A;  2Q3I A;  2QJY B;  4GDO A;  4Z1M H;  1SFC D;  3RGU A;  2FYZ A;  3SFE C;  3L74 J;  2B9B A;  2HG5 D;  2PAJ A;  1L4A D;  1KIL B;  3JC2 2;  3L74 D;  4HKZ H;  2L5G B;  3RK3 E;  2AEJ A;  1M57 D;  1DD4 A;  1NTM J;  2J59 M;  3VP8 A;  3G71 P;  3CC7 P;  1LP1 B;  2QSI A;  2WPQ A;  1J1D B;  3Q3D A;  4WY4 A;  4OWF A;  1L4A B;  4RO0 A;  3H32 A;  3USS A;  1VQ9 P;  3GHG A;  5GTH H;  4U3F D;  2ZXX A;  2OYH A;  2OYI B;  2JWD A;  1L0L D;  1JMM A;  1X22 A;  1MZ9 A;  2BCC D;  2YXR B;  2POH A;  1OZH A;  3H6P A;  1T3J A;  4GT1 A;  4PD4 D;  4OH8 B;  4YXW H;  3IAO A;  3KHU A;  3OW2 O;  1IFD A;  2BEZ F;  1USD A;  3P8C D;  1SQB G;  3KQG A;  3H1H E;  3RBZ A;  3L73 G;  5EFW B;  3Q5R A;  2ZVO B;  3MTU E;  1QLE D;  4OVN F;  1GZL A;  3L73 J;  3WU2 H;  4UB6 H;  3TGU G;  3M9Q A;  2OYH B;  2HYN A;  3B71 A;  2ZYG A;  3BRT B;  2FYN B;  1GW3 A;  1PFI A;  3CCR P;  1VPC A;  3EFF K;  3CCJ P;  3RK3 B;  5KAF H;  3CWB G;  3KYQ A;  1NKZ B;  4IL6 X;  3T97 A;  2HLO A;  1KOR A;  2PFX A;  1Q90 D;  3HD7 D;  2PGD A;  3MGN A;  5K5G B;  3H1K E;  3SWY A;  1NTM E;  4TT3 H;  2ZAE B;  1YJW P;  4U3F E;  3FWL A;  4ASW A;  1VQ7 P;  2FYU D;  3AE9 C;  3CX5 E;  1G1I A;  2YKO A;  1GTW A;  2DW3 A;  1N7L A;  2Q3E A; 
#chains in the Genus database with same CATH homology
 4NPF X;  2B87 A;  2RKL A;  1EDI A;  2KIK A;  2B87 B;  2OTK E;  1DEE G;  5DJU B;  1MFT A;  4K3A A;  1JM0 A;  4ZNC A;  2K3R A;  2KZI A;  2I8D A;  2B88 A;  4BXL A;  2QVA A;  2KS1 B;  2HR3 A;  1Q2N A;  4EYY Q;  4GOD A;  2LXC B;  4HB1 A;  1JMB A;  1OVV A;  4NPD A;  5CBO A;  1Y47 A;  3MZW B;  1SS1 A;  3FXD A;  1BDC A;  4NPE A;  3QWO C;  1ZW0 A;  3ZDM A;  4CPG A;  1H0T A;  4ZMD A;  1ZXG A;  1H0T B;  1EC5 A;  2KZJ A;  1EDJ A;  1X0T A;  2P58 A;  4MN4 C;  2KUB A;  2M5A A;  1BDD A;  2B89 A;  4GOF A;  1OVU A;  3MHV A;  3RGU A;  1S3J A;  4HKZ H;  4GOE A;  2QRX A;  1LP1 B;  2SPZ A;  2UWJ E;  4IOI H;  5DJT B;  2KI7 B;  1LP1 A;  2LR2 A;  2M0B A;  4JBZ A;  2M5A B;  1EDL A;  2LXB A;  2JWD A;  4WWI A;  4HJG H;  1OVR A;  2WMM A;  3FXE A;  5CBN A;  5EFW B;  2Q1K A;  4K35 A;  1LT1 A;  4KJM A;  1U7J A;  1NVO A;  3S1K A;  5K5G B;  1EDK A;  1FC2 C;  5C39 A;  2R44 A;  2ZAE B;  3PH0 A;  4ASV A;  4ASW A;  1U7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...