3B5NB

Structure of the yeast plasma membrane snare complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
69
structure length
69
Chain Sequence
ALAEVQARHQELLKLEKSMAELTQLFNDMEELVIEQQENVDVIDKNVEDAQLDVEQGVGHTDKAVKSAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Synaptobrevin homolog 1
publication title The Structure of the Yeast Plasma Membrane SNARE Complex Reveals Destabilizing Water-filled Cavities.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
total genus 32
structure length 69
sequence length 69
chains with identical sequence F, J
ec nomenclature
pdb deposition date 2007-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3b5nB00
1SFCA 2XDJA 3RK2B 5CCGC 1KILB 4WY4A 3B5NA 1JTHA 2HFED 3RL0C 1N7SA 2H8PD 2NPSA 3B5ND 5CCHA 1HVVA 4JF7A 1URQC 2YMYA 4OH8B 3HTKB 1N7SD 2NPSD 2HG5D 3HD7A 3RL0B 1URQB 3RK3C 2N1TC 5KJ7C 1SFCC 1L4AA 3RK3B 1GL2D 2N1TB 1T3JA 4WY4C 1L4AD 3KYQA 3B5NC 2PP6A 1SFCB 1N7SC 3RK2D 2NPSC 5CCHC 1KILD 2WZ7A 4WY4B 3B5NB 1JTHB 3HD7C 1N7SB 2NPSB 5CCGD 1NHLA 4W7ZA 3TSIA 3M0DC 3HD7B 1GL2A 4LGDE 3P8CE 1KILA 1L4AC 4W80A 5CCGA 1L4AB 3RK3D 2N1TD 5KJ7D 4W7YA 1SFCD 3RL0D 1URQA 2KOGA 4WY4D 1URQD 1XTGB 1GL2C 5CCHD 5KJ7A 3PP5A 2M8RA 3VOPA 3HD7D 4N78E 3RK2C 1GL2B 1KILC 2N1TA
chains in the Genus database with same CATH superfamily
2W83C 1RH5B 4U3FJ 2WSEJ 2NRGA 5B66H 4HKZH 4HB1A 5CCHA 2BCCD 2A45G 5TJHA 3Q3DA 2NPSD 5APWA 3RL0B 2R5BA 1GMJA 2M0BA 1EZVD 1P84H 1VQKP 4ZNCA 3SWYA 1L4AD 2IYPA 1RF0A 3SFEC 1LP1B 2E75B 2O1KA 2WPQA 1Q86Q 3H1JG 4D6TJ 1BE3G 1L0NJ 3D6YA 1LT9B 1JO5A 3TNUB 3V6IA 4I7ZC 1LWUA 1SQVJ 4HJGH 5KLVE 1SQPJ 3CWBE 2IBZG 1SVFA 1YBKA 4TT3H 2I1JA 2KOGA 5KAIE 1M56D 3FXEA 4UB8H 1XTGB 2HODA 3BVHA 5E79H 2UWJE 1JM0A 3U1AA 3L72E 2D2CC 3CCLP 1SFCA 4C7RA 3CX5D 2O3JA 3H1LE 1BCCG 1GU4A 4GKGA 3AE3C 1GW4A 1N7SA 5CHXA 1YIJP 2WT7B 1KFMA 1BE3D 2HG5D 1QVFO 1OZHA 2IPPA 2R5DA 2WPSA 1N2DC 1GZLA 5AW5B 1PFIA 2POHA 3C8VA 2PGDA 2WSEH 1T3JA 4EYYQ 3B5NC 3CD6P 2IBZD 5KLVK 3RK2D 3OA7A 1KILD 1EZVI 4PV1D 2J5UA 2FYUG 1MZ9A 3HUSB 3CCSP 2JEEA 2KIKA 2AXCA 1PP9J 4RKUJ 3UIAA 2YXQB 3G4SP 4YXWH 4AUWA 1LT1A 5CCGA 1VQPP 4BRYA 3CC4P 2QJKC 2QM8A 1SQBG 1KORA 1PIXA 1QL2A 4OWFA 3BCCJ 1Y9BA 3H1KG 1D7MA 1Q90D 3V2QA 1USEA 3JSVC 3TGUD 1CZQA 2N9BA 2I8DA 5KAIH 1GK6A 1VF5B 2A45I 3D71A 1JOCA 3L74E 1VDFA 3CCRP 3MHVA 1NTZE 2ZFCA 3H1HJ 2P10A 3L73G 3HTKB 1N7SD 4CPGA 4WWIA 3L70E 3RBXA 2OYHA 3CX5I 3M06A 2OGUA 3BATA 2HYNA 5KJ7C 1RF1B 3CL3D 4IFFA 2W6BA 1NTKG 3GHGC 2ZXXA 3KQGA 4I6MC 3KYQA 4QMAA 2BASA 2NPSC 1U7JA 4MN4C 1SQBD 2AXTE 2Y0EA 3H1KD 3MZWB 5K5GB 4H13D 1LGHB 1FBMA 1NHLA 3SFDC 2BCCE 2IBZI 4KJMA 1NTME 3M91A 1OFCX 1BGYG 2R3CA 1L4AC 1LTAC 3MGNA 5KAFH 1LTBC 2GA1A 2P1JA 1ZXGA 1GW3A 5AW4B 3L73D 2E76D 1QX8A 2DW3A 2WSCH 1KQGB 1USDA 3ITKA 3PRJA 4H44B 2E74B 1NTKD 2W90A 4NPFX 3CPWO 4L73A 1L0LG 1SQXE 2Q3EA 1OVVA 2A06E 4DOJA 3WMM0 1A02F 3NXSA 3HE4B 1KN7A 3S1KA 2N1TC 2QIWA 3E1RA 1NTMK 3RK3B 1S3JA 3OAKA 1ZRTD 2GM4A 1BE3J 4XFJA 4RO0A 5GTHH 4XA4A 5CCHC 3CX5E 1IFDA 4WY4B 3H25A 1X22A 1FZBA 1E79H 2KI7B 1HUCA 5APVA 1GDTA 2ZT9B 2AXTH 2KK7A 3T97B 1RE4A 4L74A 2WSFJ 1UIIA 1YHQP 1RF0C 1H8AA 1IJDB 2O1JA 1FDIA 2KNCB 3L4FA 1N73B 1CI6B 1L0LD 2Q7CA 1SQXK 1X9VA 2LXBA 2PFXA 4PD4D 2ZAEB 1RQVA 3HD7D 2CPSA 1BCCJ 3P8CD 1GL2B 1LWUC 3VTPC 4GDOA 5AVVB 1KC8Q 2QJYC 1AV1A 1NO4A 5APTA 2P58A 3D6ZA 3TDKA 1RHZB 5B66E 3CLQA 2SPZA 3VMYA 1OX3A 3K5BA 3TGUE 1BDDA 1Y8AA 2G8YA 2WQYC 2A45H 1SFCC 1MV8A 1GK4A 1J1DB 1VQOP 5AW8B 2OARA 2KSJA 1N7SC 4JPZB 2O01N 1KV4A 1ZV8A 2KXPB 4C7NA 5AVXB 2KB7P 3BRTB 3CC7P 3U1CA 3CCMP 2O01J 3CX5H 4ASWA 5C39A 2QE7H 1UIXA 1PGJA 5APSA 1PP9D 4RJTA 2J59M 2KS1A 1IFJA 5KKZC 1SQBJ 4HYTB 3PLNA 2QA4P 3H1KJ 3ABVC 4L76A 4EDFA 1MUUA 3PH0A 2K9JB 3BRVB 3Q5PA 3H1IE 3WUTA 1AFOA 2OQQA 1IFMA 4GODA 2CK3H 3PTZA 2WSFH 3R4YA 3KDPB 1FZCA 1VL2A 3L73J 5CCGC 2D2CB 2FYNC 2C9LY 5E79E 4PD4I 1M90Q 2AEMA 3W68A 5H2FH 2IDBA 1GTWA 2H89C 1H0TA 2Q1KA 1KYOD 1KQLA 1ZLLA 1NTKJ 3CCEP 3CC2P 3A0BH 5CMZA 1KQSO 1SQQG 2K1AA 1T8ZA 1XTCC 1G1IA 3L71G 3L75E 1M1JA 2OYIB 3AE9C 3VP8A 1U7MA 1JY2P 3B5NB 4U3FE 2P7JA 1BGYJ 3TK1A 2JWAA 2OYHC 1J1DC 1KILA 1LTIC 1KMIZ 1NOHA 2HPCA 4GIFA 4H0LD 1ZRTE 1PPJG 3KHUA 1URQA 2QRXA 2QJKB 3MIWA 1J2JB 2QJPC 1OXZA 4D6TE 3S9OA 1FZAA 3EWKA 1L0NE 2KLUA 1L0LJ 3KXDA 2LR2A 3L71D 1Z56A 2PAJA 2WPRA 4WVZA 1FJKA 1JTHA 1NU1G 1HGVA 2JJLA 3OW2O 1N86A 3AE2C 1SQVE 1RQUA 3A7OA 2KUBA 1IFPA 1S9KD 1SQPE 4GT1A 3H32A 5APQA 1YJNP 2ITAA 5CJ4A 1JCDA 1LTGC 1M57D 1FDMA 1FJPA 4PD4E 4PJ0E 3V4QA 1EDKA 2Y9ZA 3H1JD 3AECC 5AVRB 1VF5D 4N6JA 2Z4EA 1KYOI 2QSIA 3GHGB 1PPJD 1JMMA 3AE6C 4LLHA 1IC2A 2V4HA 2NPSB 1J1EC 3B71A 1S5LE 1BDCA 1PZQA 1EDIA 2Q9IA 2OYIC 2FFDA 3N7NA 1L0NK 3KZIH 5KLIC 3S4RA 3F5HA 1L4AB 1NU1D 4Z1MH 2WMMA 1YJ9P 3V2PA 1SQVK 1YYCA 5KAFE 1NKZB 2FYZA 5APXA 1URQD 1FZGA 4IL6H 1SQPK 3M0AA 1K04A 3V4WA 5CJ0A 1LTJA 1RE4C 1G2CA 1MKMA 1BCCD 4OGQD 1PP9E 3HE5A 4DJGA 3MTUE 1MFTA 4GOFA 3FWNA 2H8PD 2B87B 1JY3N 2M5AB 1A02J 3A0HH 2JDIH 1SLQA 3M0DA 1NH4A 1KQFB 3WU2H 1AQ5A 1FOSE 2KYVA 1FAVA 3BCCE 1H89A 2FBWC 1W2EA 1QEXA 1SP4A 4WB4A 1R8EA 4IFDK 4H44D 2N1TB 4AYCA 2RH0A 1IFIA 2PP6A 2E74D 4PD4H 2FYUD 4PJ0H 1AVOA 2YKQA 2WPVB 2L5GB 2AEJA 3IAOA 2W6AA 3CMEP 5GTHE 2JP3A 2Y9YA 1E5WA 3H1HE 1ZR2A 1KYOE 1S5LH 2AEFA 3Q5SA 1TU3F 3RK3D 3D70A 2K37A 4LC1A 1OIPA 2RMZA 2W27A 3MP7B 3AE1C 4WY4D 1EZVE 3PP5A 3USSA 4RESB 3A5TA 3PJSK 3A3YB 4H0LC 3L37A 1LWUB 2E5YA 3CXHD 1NTZK 4ZKUA 3CCJP 3HD7A 3JC22 4XE5B 3LIEA 2QJYB 1EDJA 1QLED 1SQQJ 3IF4A 2C9NY 1JY3P 4ASVA 2R44A 2WTYA 3L71J 4HH2A 1IO4A 1RY3A 1K05A 2HODB 2W8ZA 1JNMA 1FZCC 1GL2D 3SSUA 5KLVG 3CWBG 2XNDH 2PRRA 1SFCB 4YTPC 4A7PA 2OTJP 2HR3A 4Y99C 1FU1A 4DT0A 1IK7A 1N7SB 3PHLA 3P32A 3O6QA 1BGYD 3V5BA 1M7LA 3H1JJ 3L72G 2FKWB 1YQ3C 2YIUC 1S4XA 1K73Q 3Q1MA 1M1JC 3H1LG 5KKZB 1KYOH 3E1IA 2Y0CA 4ZKPA 2R32A 2Q3IA 1BE3E 1X0TA 3WUUA 4BWNA 4AQRD 2IZ0A 1VQ5P 1S2EA 2JWDA 3RK2C 1NU1J 1KILC 4PV1C 1LP1A 2ZVOB 2K9YA 1JCCA 3CWBD 1OVRA 2IBZE 1KILE 1VPCA 4JF7A 1LT9A 1NAYA 4BRYB 1URQC 2FYNB 3TNUA 2LKMA 2E43A 2FXOA 1AA0A 3I5CA 2YXRB 5H2FE 3CXHI 4OGQC 3L72D 1YJWP 2P2UA 2CPBA 1OMIA 1ZW0A 2E5TA 3H1LD 1R5SA 2YNYA 3A0BE 5AVSB 1BCCE 1S5LX 1FE6A 1FZEA 1ZOYC 5CBOA 3NMDA 2QG4A 3AE8C 3Q5RA 2OYHB 2FYUJ 1JY2N 3L74G 2WT7A 3AEAC 4I2LC 1DEEG 1NTZG 3GF7A 1DD4A 2IFMA 3RL0D 2H43A 2JKVA 1WMKA 2JO1A 1HJ0A 2FXPA 3L70G 2XZRA 2XV5A 2QJPB 2FFDC 5KTBA 2FXMA 3E7KA 4H13C 1KB9D 2E75D 3HUSA 2QM7A 1SQBE 2YMYA 3G3ZA 1PGQA 3H1KE 1DEBA 1RE3A 1T6AA 2BCCG 3CCUP 4IOIH 1LTJC 1FS0E 1PV3A 1NTMG 2YKOA 1OW6A 1EZVG 3VP9A 2E76C 3L74D 2KSEA 3ZDMA 1IK9A 1W5CE 1Q81Q 3M9HA 2B9BA 3EFFK 2IZ1A 3L73E 3LIDA 1QL1A 5AW9B 3HRNA 1QGKB 4W7ZA 3L70D 1AJYA 2H7HA 3M0DC 1G1JA 1W2BO 2Z5IA 1NJIQ 4WBAA 1J1EB 4GOEA 2IX7C 2YKPA 4B86A 4JYBA 3U59A 1NTKE 4JQ0D 3AEDC 1NWQA 3HTKA 5KJ7D 5KLIB 1SQXG 2A06G 1SQBK 1EDLA 1U57A 2I1KA 3KZIE 5M1BA 3FWLA 3EFGA 1NGMB 3VN0A 1RF1A 2M8RA 2C0XA 3I56P 1NTMD 2Z5HA 3QH9A 1BGYE 1YTZI 2JR8A 1YI2P 2XDJA 4IL6E 2B88A 1HBWA 5AW7B 3L35A 1ZN5A 4K3AA 2XKMA 2HLOA 2O01H 3QWOC 4OH8B 3RL0g 3JCUH 1ZR4A 1SQQD 5KLVJ 1S1CX 1EC5A 3CWBJ 2NZ2A 1KB9I 5APUA 5GTIH 2RN0A 1Q82Q 3A0HE 1S72P 3WU2E 1VQMP 1NTKK 2XU6A 1SQXD 1L0LE 1ZMEC 2A06D 3OJAB 3HD7C 3L72J 3SWKA 1HWTC 1VQ4P 1Y47A 2YO2A 3CXHH 4N3YB 3AEEC 3H1LJ 3P8CE 5CBNA 3P7KA 1WRGA 4UB6E 4W80A 2L91A 4IFMA 1CSBA 2N1TD 1R5LA 3HE4A 3SWFA 3GG2A 1BSHA 1OVUA 3P8MC 5B5EE 3GF3A 4C7NB 3FGAD 5CCHD 4EI2A 1ZP0C 3TGUG 5APYA 3VMAA 4NPDA 3V2RA 5L8RJ 2K88A 1PGOA 2KS1B 4WY4A 3C9IA 3RL0C 4H0LB 2OTLP 3IFMA 4YPCA 1L0LK 1NAFA 3MUDA 3II6A 3T97A 2ZYGA 2WITA 3FX0A 1K9MQ 2WSCJ 1T2KD 2BEQD 2C0WA 1FZFA 2E75C 2KNCA 1L2PA 1N73A 1CI6A 2Q5UA 4R4LA 1FZCB 2WZ7A 1LT9C 3H1IG 1VQ8P 1EXIA 1VQ9P 1KD1Q 1KB9E 4Y99B 4N78D 2M3BA 5AVTB 1H0TB 4DCKA 1GL2A 3L74J 4KHXA 4LGDE 1OWAA 1NTZJ 4ZMDA 1YITP 1P84D 4O9BA 1DIPA 1PGPA 1LTSC 2YIUB 3L70J 2KLVA 4W7YA 4UB6H 1SFCD 1M1JB 2ZVNB 3AEGC 2ZYAA 3VMXA 1QVGO 5AW2B 1GD2E 1K8AQ 5AW1B 3EQ2A 2MKVA 5B5EH 1JY2O 1N7LA 3R2PA 1HJBA 3RK2B 1KILB 3A2AA 3AE5C 3AEBC 4PV1B 5DJUB 3L75G 3N4XA 1SS1A 5TISE 2BCCJ 4OVNF 2BEZF 2HPCB 3B4SA 3H1ID 4U3FG 2IYOA 1NTMJ 2V7QJ 1URQB 2ZT9D 1VQ7P 1HF9A 1OW8A 1NYHA 1Q7YQ 5AVQB 4M3LA 1JMBA 1M8OB 3NFQA 4OGQB 1LNQA 2B89A 2K9JA 3HUSC 2E42A 3L36A 1HTLC 4C46A 3CCVP 1JTHB 1RE3C 1JEKA 5CCGD 1FC2C 1LTTC 1BSNA 1GU5A 3GW6A 3B8EB 2OYOA 4D6TG 3H32B 4EOTA 1VQNP 1L0NG 1H88A 3F89A 1KB9H 2RKLA 1WT6A 1SQQE 2G3AA 1SQXJ 2XNXA 1HH0A 1YQ4C 3L71E 3L75D 2QEXP 1DH3A 3WUVA 3G6EP 1JB0J 3VYIA 1SQVG 1IZNB 5BU8B 1FOSF 4U3FD 1SQPG 1S9KE 3CCQP 1P84I 2IFNA 4IL6X 1CW5A 3VOPA 1VF5C 1N8RQ 3LW5J 4NPEA 2J58A 4TLFA 2KP8A 3NTNA 2FFDB 2OYIA 3I55P 3H1JE 4KT0J 3B5NA 4I1LA 3G9RA 1AQTA 2HFED 4H13B 1M1KQ 1PPJE 1HVVA 4JBZA 2R3SA 3H6PA 2M3EA 5TISH 1RF1C 3AE4C 4D6TD 1L0ND 2ZJSE 5KLVD 3C1LA 3BASA 1EQ7A 1LTJB 2K3RA 1SQQK 1G2CB 1JUNA 3Q2YA 4U7JA 2E76B 3MD0A 1NU1E 1SQVD 5AVYB 1Q2NA 3HE5B 1OW7A 4K35A 1KTMA 2VRSA 3CI9A 1SQPD 2V7QH 3RGUA 3TSIA 5BVZA 1X79B 1T2KC 2ZXEB 3AEFC 5EFWB 1PP9G 2QVAA 2D2CD 5AVWB 3O8ZA 3KPEA 2KZIA 2ZYDA 2GUVA 5AW0B 3GMAA 3TGUJ 4JYCA 4L75A 4H44C 3BCCG 2E74C 2H88C 2YO3A 4N78E 2OTKE 5KJ7A 4Y28J 1NVOA 3GHGA 3FXDA 3GLMA 2FY8A 5AW6B 1P84E 2FYUE 2NPSA 3B5ND 1NU1K 2WVRA 1DD3A 3IN6A 3IR9A 4YXDC 3H1HG 5AVZB 3LW5H 3V2NA 3RK3C 1PL5A 1X8YA 2KZJA 4R4MA 3M9QA 1FDOA 2WWWA 1L4AA 1YTZT 3H1IJ 2WSSH 3JCUE 4WY4C 4DZOA 4EIJA 2N9YB 3G71P 3RK3E 4I7ZB 3VMZA 2YMKA 1VQ6P 2MJZA 5GTIE 2GUSA 3MUDC 2ZT9C 1LJ2A 1MFZA 1KFNA 3TF5A 3HD7B 1VQLP 3BCCD 1HGZA 5AW3B 1N73C 1T3UA 1AVYA 1NTZD 1KZUB 4UB8E 5AVUB 3CXHE 3W67A 2LXCB 2B87A 1JY3O 2Y0DA 2M5AA 1NKNA 5BU5A 1IFNA 2FYUK 3RBZA 4BXLA 3CMAP 1EXJA 2P67A 2W6JH 3TYYA 1GL2C 2Q6QA 3H1HD 3L75J 3O6QB 3AE7C 3M9BA 1DX7A 5DJTB 2N1TA
chains in the Genus database with same CATH topology
3A3YB 5AVVB 3L37A 1LWUB 4WY4A 1NTZK 3C9IA 3RL0C 4ZKUA 3IFMA 5CCHA 2A45G 1L0LK 1NAFA 1NO4A 5APTA 2NPSD 3HD7A 3MUDA 3II6A 5APWA 3RL0B 2R5BA 4XE5B 3LIEA 3CLQA 2C9NY 3T97A 1JY3P 3VMYA 2WTYA 4HH2A 1IO4A 1RY3A 2HODB 2WITA 1JNMA 1T2KD 2A45H 1SFCC 2C0WA 1FZCC 1FZFA 1MV8A 1GK4A 1GL2D 1N73A 3SWYA 1CI6A 1J1DB 5AW8B 1L4AD 1RF0A 2Q5UA 1SFCB 2OARA 1FZCB 2KSJA 1N7SC 2O1KA 2WPQA 2WZ7A 4Y99C 1LT9C 1FU1A 1ZV8A 1N7SB 4C7NA 4Y99B 5AVXB 1LT9B 4N78D 2KB7P 3BRTB 3P32A 1JO5A 3U1CA 2M3BA 3TNUB 5AVTB 1GL2A 3V5BA 4KHXA 1M7LA 5APSA 4LGDE 2FKWB 2J59M 1OWAA 1IFJA 1LWUA 4HYTB 4O9BA 1LTSC 1M1JC 1SVFA 1MUUA 2KLVA 3E1IA 4W7YA 3BRVB 1SFCD 1M1JB 4ZKPA 2R32A 2I1JA 2KOGA 2Q3IA 3VMXA 1XTGB 2HODA 5AW2B 1GD2E 4AQRD 1AFOA 1IFMA 5AW1B 3EQ2A 3BVHA 2WSFH 3RK2C 3U1AA 1KILC 1JY2O 1N7LA 3R2PA 3KDPB 1HJBA 1SFCA 4C7RA 1FZCA 3RK2B 5CCGC 1JCCA 1KILB 3A2AA 3N4XA 1GU4A 2C9LY 4GKGA 1GW4A 1N7SA 5CHXA 1VPCA 2WT7B 1KFMA 2HPCB 4JF7A 1LT9A 1URQC 1GTWA 3TNUA 2HG5D 2LKMA 2E43A 2IPPA 1URQB 2R5DA 1KQLA 2WPSA 1ZLLA 1N2DC 3I5CA 1GZLA 5AW5B 1PFIA 5AVQB 2P2UA 4M3LA 5CMZA 2CPBA 2POHA 3NFQA 1T8ZA 1XTCC 2WSEH 1G1IA 1T3JA 3B5NC 5KLVK 1M1JA 2YNYA 5AVSB 2OYIB 3RK2D 3VP8A 3HUSC 3OA7A 1KILD 2E42A 3L36A 1HTLC 1JY2P 4C46A 3B5NB 1FZEA 1JTHB 2P7JA 1RE3C 3NMDA 1MZ9A 3HUSB 5CCGD 1LTTC 3TK1A 1GU5A 2OYHC 3B8EB 2JEEA 1J1DC 3H32B 4EOTA 1H88A 3UIAA 2OYHB 1WT6A 1KILA 1JY2N 1LTIC 2XNXA 1HH0A 4AUWA 5CCGA 1NOHA 2WT7A 2HPCA 1DH3A 4GIFA 4I2LC 3VYIA 2IFMA 2QM8A 5BU8B 1FOSF 1QL2A 3RL0D 1URQA 2H43A 3MIWA 1S9KE 1J2JB 3V2QA 2XZRA 1CZQA 2N9BA 1OXZA 2XV5A 2IFNA 1CW5A 3VOPA 1FZAA 2FFDC 2J58A 5KTBA 2KP8A 1GK6A 2FXMA 2A45I 3NTNA 2FFDB 2OYIA 1JOCA 1Z56A 2PAJA 2WPRA 1VDFA 1FJKA 3B5NA 4I1LA 1JTHA 2HFED 1HGVA 2JJLA 1N86A 3HUSA 2QM7A 1HVVA 2ZFCA 2YMYA 3G3ZA 3HTKB 1N7SD 3A7OA 1S9KD 1DEBA 3H6PA 1RE3A 4GT1A 3H32A 5APQA 2OYHA 5CJ4A 1RF1C 1JCDA 1LTGC 1LTJC 3M06A 1FDMA 3BATA 1FJPA 2HYNA 2YKOA 5KJ7C 1RF1B 3BASA 1EQ7A 3CL3D 1LTJB 3VP9A 3V4QA 4IFFA 1SQQK 2W6BA 1G2CB 3GHGC 3KQGA 4I6MC 1JUNA 5AVRB 3KYQA 1IK9A 2BASA 3MD0A 4N6JA 2Z4EA 2NPSC 3GHGB 3M9HA 5AVYB 1JMMA 3HE5B 4LLHA 1IC2A 2VRSA 3CI9A 3LIDA 2NPSB 1LGHB 1QL1A 5AW9B 1FBMA 1J1EC 3HRNA 1NHLA 4W7ZA 2H7HA 3TSIA 3M0DC 5BVZA 1G1JA 2Z5IA 4WBAA 1X79B 2Q9IA 1J1EB 1T2KC 2ZXEB 2OYIC 3M91A 3N7NA 2FFDA 1L0NK 2IX7C 2R3CA 1L4AC 1LTAC 2YKPA 4B86A 4JYBA 3U59A 3MGNA 1LTBC 2P1JA 1L4AB 5AVWB 1NWQA 1GW3A 3O8ZA 3HTKA 3KPEA 5KJ7D 3V2PA 2GUVA 5AW0B 5AW4B 1SQVK 1SQBK 1YYCA 2I1KA 1NKZB 4JYCA 2FYZA 5APXA 3EFGA 1URQD 1FZGA 1SQPK 2WSCH 3M0AA 3VN0A 3V4WA 1RF1A 5CJ0A 2M8RA 1LTJA 2C0XA 1RE4C 2YO3A 4N78E 2Z5HA 1G2CA 5KJ7A 1YTZI 2XDJA 1HBWA 3GHGA 5AW7B 3HE5A 3MTUE 3L35A 1ZN5A 5AW6B 2H8PD 2NPSA 2XKMA 3B5ND 1NU1K 2HLOA 2O01H 4OH8B 4DOJA 1JY3N 3WMM0 1A02F 3NXSA 3HE4B 1A02J 3IR9A 1SLQA 3M0DA 1NH4A 1ZR4A 5AVZB 1AQ5A 1FOSE 2KYVA 3LW5H 3V2NA 1FAVA 3RK3C 1H89A 2N1TC 1X8YA 1W2EA 3M9QA 5APUA 1NTMK 1SP4A 4WB4A 4IFDK 2WWWA 1L4AA 3RK3B 3OAKA 1YTZT 2GM4A 2N1TB 4WY4C 4DZOA 4AYCA 4EIJA 1IFIA 2PP6A 1NTKK 4XA4A 3VMZA 2XU6A 5CCHC 1IFDA 4WY4B 2MJZA 1FZBA 2YKQA 3OJAB 2GUSA 3HD7C 2L5GB 1MFZA 1HWTC 2W6AA 1HUCA 1KFNA 5APVA 3HD7B 1GDTA 1E5WA 2YO2A 4N3YB 1RE4A 1ZR2A 1HGZA 3P8CE 3P7KA 5AW3B 1WRGA 4W80A 1N73C 1T3UA 1KZUB 1RF0C 5AVUB 1H8AA 1IJDB 2O1JA 4IFMA 3RK3D 1CSBA 3L4FA 1JY3O 1N73B 1CI6B 2N1TD 1NKNA 4LC1A 5BU5A 2Q7CA 1IFNA 3HE4A 2FYUK 3SWFA 2W27A 1SQXK 1X9VA 4WY4D 2P67A 3P8MC 3TYYA 1GL2C 4C7NB 5CCHD 3PP5A 4RESB 3HD7D 3A5TA 5APYA 3M9BA 2CPSA 3P8CD 1GL2B 1DX7A 1LWUC 2N1TA 3VTPC 3V2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SFC A;  2XDJ A;  3RK2 B;  5CCG C;  1KIL B;  4WY4 A;  3B5N A;  1JTH A;  2HFE D;  3RL0 C;  1N7S A;  2H8P D;  2NPS A;  3B5N D;  5CCH A;  1HVV A;  4JF7 A;  1URQ C;  2YMY A;  4OH8 B;  3HTK B;  1N7S D;  2NPS D;  2HG5 D;  3HD7 A;  3RL0 B;  1URQ B;  3RK3 C;  2N1T C;  5KJ7 C;  1SFC C;  1L4A A;  3RK3 B;  1GL2 D;  2N1T B;  1T3J A;  4WY4 C;  1L4A D;  3KYQ A;  3B5N C;  2PP6 A;  1SFC B;  1N7S C;  3RK2 D;  2NPS C;  5CCH C;  1KIL D;  2WZ7 A;  4WY4 B;  3B5N B;  1JTH B;  3HD7 C;  1N7S B;  2NPS B;  5CCG D;  1NHL A;  4W7Z A;  3TSI A;  3M0D C;  3HD7 B;  1GL2 A;  4LGD E;  3P8C E;  1KIL A;  1L4A C;  4W80 A;  5CCG A;  1L4A B;  3RK3 D;  2N1T D;  5KJ7 D;  4W7Y A;  1SFC D;  3RL0 D;  1URQ A;  2KOG A;  4WY4 D;  1URQ D;  1XTG B;  1GL2 C;  5CCH D;  5KJ7 A;  3PP5 A;  2M8R A;  3VOP A;  3HD7 D;  4N78 E;  3RK2 C;  1GL2 B;  1KIL C;  2N1T A; 
#chains in the Genus database with same CATH topology
 2W83 C;  1RH5 B;  4U3F J;  2WSE J;  2NRG A;  5B66 H;  4HKZ H;  4HB1 A;  5CCH A;  2BCC D;  2A45 G;  5TJH A;  3Q3D A;  2NPS D;  5APW A;  3RL0 B;  2R5B A;  1GMJ A;  2M0B A;  1EZV D;  1P84 H;  1VQK P;  4ZNC A;  3SWY A;  1L4A D;  2IYP A;  1RF0 A;  3SFE C;  1LP1 B;  2E75 B;  2O1K A;  2WPQ A;  1Q86 Q;  3H1J G;  4D6T J;  1BE3 G;  1L0N J;  3D6Y A;  1LT9 B;  1JO5 A;  3TNU B;  3V6I A;  4I7Z C;  1LWU A;  1SQV J;  4HJG H;  5KLV E;  1SQP J;  3CWB E;  2IBZ G;  1SVF A;  1YBK A;  4TT3 H;  2I1J A;  2KOG A;  5KAI E;  1M56 D;  3FXE A;  4UB8 H;  1XTG B;  2HOD A;  3BVH A;  5E79 H;  2UWJ E;  1JM0 A;  3U1A A;  3L72 E;  2D2C C;  3CCL P;  1SFC A;  4C7R A;  3CX5 D;  2O3J A;  3H1L E;  1BCC G;  1GU4 A;  4GKG A;  3AE3 C;  1GW4 A;  1N7S A;  5CHX A;  1YIJ P;  2WT7 B;  1KFM A;  1BE3 D;  2HG5 D;  1QVF O;  1OZH A;  2IPP A;  2R5D A;  2WPS A;  1N2D C;  1GZL A;  5AW5 B;  1PFI A;  2POH A;  3C8V A;  2PGD A;  2WSE H;  1T3J A;  4EYY Q;  3B5N C;  3CD6 P;  2IBZ D;  5KLV K;  3RK2 D;  3OA7 A;  1KIL D;  1EZV I;  4PV1 D;  2J5U A;  2FYU G;  1MZ9 A;  3HUS B;  3CCS P;  2JEE A;  2KIK A;  2AXC A;  1PP9 J;  4RKU J;  3UIA A;  2YXQ B;  3G4S P;  4YXW H;  4AUW A;  1LT1 A;  5CCG A;  1VQP P;  4BRY A;  3CC4 P;  2QJK C;  2QM8 A;  1SQB G;  1KOR A;  1PIX A;  1QL2 A;  4OWF A;  3BCC J;  1Y9B A;  3H1K G;  1D7M A;  1Q90 D;  3V2Q A;  1USE A;  3JSV C;  3TGU D;  1CZQ A;  2N9B A;  2I8D A;  5KAI H;  1GK6 A;  1VF5 B;  2A45 I;  3D71 A;  1JOC A;  3L74 E;  1VDF A;  3CCR P;  3MHV A;  1NTZ E;  2ZFC A;  3H1H J;  2P10 A;  3L73 G;  3HTK B;  1N7S D;  4CPG A;  4WWI A;  3L70 E;  3RBX A;  2OYH A;  3CX5 I;  3M06 A;  2OGU A;  3BAT A;  2HYN A;  5KJ7 C;  1RF1 B;  3CL3 D;  4IFF A;  2W6B A;  1NTK G;  3GHG C;  2ZXX A;  3KQG A;  4I6M C;  3KYQ A;  4QMA A;  2BAS A;  2NPS C;  1U7J A;  4MN4 C;  1SQB D;  2AXT E;  2Y0E A;  3H1K D;  3MZW B;  5K5G B;  4H13 D;  1LGH B;  1FBM A;  1NHL A;  3SFD C;  2BCC E;  2IBZ I;  4KJM A;  1NTM E;  3M91 A;  1OFC X;  1BGY G;  2R3C A;  1L4A C;  1LTA C;  3MGN A;  5KAF H;  1LTB C;  2GA1 A;  2P1J A;  1ZXG A;  1GW3 A;  5AW4 B;  3L73 D;  2E76 D;  1QX8 A;  2DW3 A;  2WSC H;  1KQG B;  1USD A;  3ITK A;  3PRJ A;  4H44 B;  2E74 B;  1NTK D;  2W90 A;  4NPF X;  3CPW O;  4L73 A;  1L0L G;  1SQX E;  2Q3E A;  1OVV A;  2A06 E;  4DOJ A;  3WMM 0;  1A02 F;  3NXS A;  3HE4 B;  1KN7 A;  3S1K A;  2N1T C;  2QIW A;  3E1R A;  1NTM K;  3RK3 B;  1S3J A;  3OAK A;  1ZRT D;  2GM4 A;  1BE3 J;  4XFJ A;  4RO0 A;  5GTH H;  4XA4 A;  5CCH C;  3CX5 E;  1IFD A;  4WY4 B;  3H25 A;  1X22 A;  1FZB A;  1E79 H;  2KI7 B;  1HUC A;  5APV A;  1GDT A;  2ZT9 B;  2AXT H;  2KK7 A;  3T97 B;  1RE4 A;  4L74 A;  2WSF J;  1UII A;  1YHQ P;  1RF0 C;  1H8A A;  1IJD B;  2O1J A;  1FDI A;  2KNC B;  3L4F A;  1N73 B;  1CI6 B;  1L0L D;  2Q7C A;  1SQX K;  1X9V A;  2LXB A;  2PFX A;  4PD4 D;  2ZAE B;  1RQV A;  3HD7 D;  2CPS A;  1BCC J;  3P8C D;  1GL2 B;  1LWU C;  3VTP C;  4GDO A;  5AVV B;  1KC8 Q;  2QJY C;  1AV1 A;  1NO4 A;  5APT A;  2P58 A;  3D6Z A;  3TDK A;  1RHZ B;  5B66 E;  3CLQ A;  2SPZ A;  3VMY A;  1OX3 A;  3K5B A;  3TGU E;  1BDD A;  1Y8A A;  2G8Y A;  2WQY C;  2A45 H;  1SFC C;  1MV8 A;  1GK4 A;  1J1D B;  1VQO P;  5AW8 B;  2OAR A;  2KSJ A;  1N7S C;  4JPZ B;  2O01 N;  1KV4 A;  1ZV8 A;  2KXP B;  4C7N A;  5AVX B;  2KB7 P;  3BRT B;  3CC7 P;  3U1C A;  3CCM P;  2O01 J;  3CX5 H;  4ASW A;  5C39 A;  2QE7 H;  1UIX A;  1PGJ A;  5APS A;  1PP9 D;  4RJT A;  2J59 M;  2KS1 A;  1IFJ A;  5KKZ C;  1SQB J;  4HYT B;  3PLN A;  2QA4 P;  3H1K J;  3ABV C;  4L76 A;  4EDF A;  1MUU A;  3PH0 A;  2K9J B;  3BRV B;  3Q5P A;  3H1I E;  3WUT A;  1AFO A;  2OQQ A;  1IFM A;  4GOD A;  2CK3 H;  3PTZ A;  2WSF H;  3R4Y A;  3KDP B;  1FZC A;  1VL2 A;  3L73 J;  5CCG C;  2D2C B;  2FYN C;  2C9L Y;  5E79 E;  4PD4 I;  1M90 Q;  2AEM A;  3W68 A;  5H2F H;  2IDB A;  1GTW A;  2H89 C;  1H0T A;  2Q1K A;  1KYO D;  1KQL A;  1ZLL A;  1NTK J;  3CCE P;  3CC2 P;  3A0B H;  5CMZ A;  1KQS O;  1SQQ G;  2K1A A;  1T8Z A;  1XTC C;  1G1I A;  3L71 G;  3L75 E;  1M1J A;  2OYI B;  3AE9 C;  3VP8 A;  1U7M A;  1JY2 P;  3B5N B;  4U3F E;  2P7J A;  1BGY J;  3TK1 A;  2JWA A;  2OYH C;  1J1D C;  1KIL A;  1LTI C;  1KMI Z;  1NOH A;  2HPC A;  4GIF A;  4H0L D;  1ZRT E;  1PPJ G;  3KHU A;  1URQ A;  2QRX A;  2QJK B;  3MIW A;  1J2J B;  2QJP C;  1OXZ A;  4D6T E;  3S9O A;  1FZA A;  3EWK A;  1L0N E;  2KLU A;  1L0L J;  3KXD A;  2LR2 A;  3L71 D;  1Z56 A;  2PAJ A;  2WPR A;  4WVZ A;  1FJK A;  1JTH A;  1NU1 G;  1HGV A;  2JJL A;  3OW2 O;  1N86 A;  3AE2 C;  1SQV E;  1RQU A;  3A7O A;  2KUB A;  1IFP A;  1S9K D;  1SQP E;  4GT1 A;  3H32 A;  5APQ A;  1YJN P;  2ITA A;  5CJ4 A;  1JCD A;  1LTG C;  1M57 D;  1FDM A;  1FJP A;  4PD4 E;  4PJ0 E;  3V4Q A;  1EDK A;  2Y9Z A;  3H1J D;  3AEC C;  5AVR B;  1VF5 D;  4N6J A;  2Z4E A;  1KYO I;  2QSI A;  3GHG B;  1PPJ D;  1JMM A;  3AE6 C;  4LLH A;  1IC2 A;  2V4H A;  2NPS B;  1J1E C;  3B71 A;  1S5L E;  1BDC A;  1PZQ A;  1EDI A;  2Q9I A;  2OYI C;  2FFD A;  3N7N A;  1L0N K;  3KZI H;  5KLI C;  3S4R A;  3F5H A;  1L4A B;  1NU1 D;  4Z1M H;  2WMM A;  1YJ9 P;  3V2P A;  1SQV K;  1YYC A;  5KAF E;  1NKZ B;  2FYZ A;  5APX A;  1URQ D;  1FZG A;  4IL6 H;  1SQP K;  3M0A A;  1K04 A;  3V4W A;  5CJ0 A;  1LTJ A;  1RE4 C;  1G2C A;  1MKM A;  1BCC D;  4OGQ D;  1PP9 E;  3HE5 A;  4DJG A;  3MTU E;  1MFT A;  4GOF A;  3FWN A;  2H8P D;  2B87 B;  1JY3 N;  2M5A B;  1A02 J;  3A0H H;  2JDI H;  1SLQ A;  3M0D A;  1NH4 A;  1KQF B;  3WU2 H;  1AQ5 A;  1FOS E;  2KYV A;  1FAV A;  3BCC E;  1H89 A;  2FBW C;  1W2E A;  1QEX A;  1SP4 A;  4WB4 A;  1R8E A;  4IFD K;  4H44 D;  2N1T B;  4AYC A;  2RH0 A;  1IFI A;  2PP6 A;  2E74 D;  4PD4 H;  2FYU D;  4PJ0 H;  1AVO A;  2YKQ A;  2WPV B;  2L5G B;  2AEJ A;  3IAO A;  2W6A A;  3CME P;  5GTH E;  2JP3 A;  2Y9Y A;  1E5W A;  3H1H E;  1ZR2 A;  1KYO E;  1S5L H;  2AEF A;  3Q5S A;  1TU3 F;  3RK3 D;  3D70 A;  2K37 A;  4LC1 A;  1OIP A;  2RMZ A;  2W27 A;  3MP7 B;  3AE1 C;  4WY4 D;  1EZV E;  3PP5 A;  3USS A;  4RES B;  3A5T A;  3PJS K;  3A3Y B;  4H0L C;  3L37 A;  1LWU B;  2E5Y A;  3CXH D;  1NTZ K;  4ZKU A;  3CCJ P;  3HD7 A;  3JC2 2;  4XE5 B;  3LIE A;  2QJY B;  1EDJ A;  1QLE D;  1SQQ J;  3IF4 A;  2C9N Y;  1JY3 P;  4ASV A;  2R44 A;  2WTY A;  3L71 J;  4HH2 A;  1IO4 A;  1RY3 A;  1K05 A;  2HOD B;  2W8Z A;  1JNM A;  1FZC C;  1GL2 D;  3SSU A;  5KLV G;  3CWB G;  2XND H;  2PRR A;  1SFC B;  4YTP C;  4A7P A;  2OTJ P;  2HR3 A;  4Y99 C;  1FU1 A;  4DT0 A;  1IK7 A;  1N7S B;  3PHL A;  3P32 A;  3O6Q A;  1BGY D;  3V5B A;  1M7L A;  3H1J J;  3L72 G;  2FKW B;  1YQ3 C;  2YIU C;  1S4X A;  1K73 Q;  3Q1M A;  1M1J C;  3H1L G;  5KKZ B;  1KYO H;  3E1I A;  2Y0C A;  4ZKP A;  2R32 A;  2Q3I A;  1BE3 E;  1X0T A;  3WUU A;  4BWN A;  4AQR D;  2IZ0 A;  1VQ5 P;  1S2E A;  2JWD A;  3RK2 C;  1NU1 J;  1KIL C;  4PV1 C;  1LP1 A;  2ZVO B;  2K9Y A;  1JCC A;  3CWB D;  1OVR A;  2IBZ E;  1KIL E;  1VPC A;  4JF7 A;  1LT9 A;  1NAY A;  4BRY B;  1URQ C;  2FYN B;  3TNU A;  2LKM A;  2E43 A;  2FXO A;  1AA0 A;  3I5C A;  2YXR B;  5H2F E;  3CXH I;  4OGQ C;  3L72 D;  1YJW P;  2P2U A;  2CPB A;  1OMI A;  1ZW0 A;  2E5T A;  3H1L D;  1R5S A;  2YNY A;  3A0B E;  5AVS B;  1BCC E;  1S5L X;  1FE6 A;  1FZE A;  1ZOY C;  5CBO A;  3NMD A;  2QG4 A;  3AE8 C;  3Q5R A;  2OYH B;  2FYU J;  1JY2 N;  3L74 G;  2WT7 A;  3AEA C;  4I2L C;  1DEE G;  1NTZ G;  3GF7 A;  1DD4 A;  2IFM A;  3RL0 D;  2H43 A;  2JKV A;  1WMK A;  2JO1 A;  1HJ0 A;  2FXP A;  3L70 G;  2XZR A;  2XV5 A;  2QJP B;  2FFD C;  5KTB A;  2FXM A;  3E7K A;  4H13 C;  1KB9 D;  2E75 D;  3HUS A;  2QM7 A;  1SQB E;  2YMY A;  3G3Z A;  1PGQ A;  3H1K E;  1DEB A;  1RE3 A;  1T6A A;  2BCC G;  3CCU P;  4IOI H;  1LTJ C;  1FS0 E;  1PV3 A;  1NTM G;  2YKO A;  1OW6 A;  1EZV G;  3VP9 A;  2E76 C;  3L74 D;  2KSE A;  3ZDM A;  1IK9 A;  1W5C E;  1Q81 Q;  3M9H A;  2B9B A;  3EFF K;  2IZ1 A;  3L73 E;  3LID A;  1QL1 A;  5AW9 B;  3HRN A;  1QGK B;  4W7Z A;  3L70 D;  1AJY A;  2H7H A;  3M0D C;  1G1J A;  1W2B O;  2Z5I A;  1NJI Q;  4WBA A;  1J1E B;  4GOE A;  2IX7 C;  2YKP A;  4B86 A;  4JYB A;  3U59 A;  1NTK E;  4JQ0 D;  3AED C;  1NWQ A;  3HTK A;  5KJ7 D;  5KLI B;  1SQX G;  2A06 G;  1SQB K;  1EDL A;  1U57 A;  2I1K A;  3KZI E;  5M1B A;  3FWL A;  3EFG A;  1NGM B;  3VN0 A;  1RF1 A;  2M8R A;  2C0X A;  3I56 P;  1NTM D;  2Z5H A;  3QH9 A;  1BGY E;  1YTZ I;  2JR8 A;  1YI2 P;  2XDJ A;  4IL6 E;  2B88 A;  1HBW A;  5AW7 B;  3L35 A;  1ZN5 A;  4K3A A;  2XKM A;  2HLO A;  2O01 H;  3QWO C;  4OH8 B;  3RL0 g;  3JCU H;  1ZR4 A;  1SQQ D;  5KLV J;  1S1C X;  1EC5 A;  3CWB J;  2NZ2 A;  1KB9 I;  5APU A;  5GTI H;  2RN0 A;  1Q82 Q;  3A0H E;  1S72 P;  3WU2 E;  1VQM P;  1NTK K;  2XU6 A;  1SQX D;  1L0L E;  1ZME C;  2A06 D;  3OJA B;  3HD7 C;  3L72 J;  3SWK A;  1HWT C;  1VQ4 P;  1Y47 A;  2YO2 A;  3CXH H;  4N3Y B;  3AEE C;  3H1L J;  3P8C E;  5CBN A;  3P7K A;  1WRG A;  4UB6 E;  4W80 A;  2L91 A;  4IFM A;  1CSB A;  2N1T D;  1R5L A;  3HE4 A;  3SWF A;  3GG2 A;  1BSH A;  1OVU A;  3P8M C;  5B5E E;  3GF3 A;  4C7N B;  3FGA D;  5CCH D;  4EI2 A;  1ZP0 C;  3TGU G;  5APY A;  3VMA A;  4NPD A;  3V2R A;  5L8R J;  2K88 A;  1PGO A;  2KS1 B;  4WY4 A;  3C9I A;  3RL0 C;  4H0L B;  2OTL P;  3IFM A;  4YPC A;  1L0L K;  1NAF A;  3MUD A;  3II6 A;  3T97 A;  2ZYG A;  2WIT A;  3FX0 A;  1K9M Q;  2WSC J;  1T2K D;  2BEQ D;  2C0W A;  1FZF A;  2E75 C;  2KNC A;  1L2P A;  1N73 A;  1CI6 A;  2Q5U A;  4R4L A;  1FZC B;  2WZ7 A;  1LT9 C;  3H1I G;  1VQ8 P;  1EXI A;  1VQ9 P;  1KD1 Q;  1KB9 E;  4Y99 B;  4N78 D;  2M3B A;  5AVT B;  1H0T B;  4DCK A;  1GL2 A;  3L74 J;  4KHX A;  4LGD E;  1OWA A;  1NTZ J;  4ZMD A;  1YIT P;  1P84 D;  4O9B A;  1DIP A;  1PGP A;  1LTS C;  2YIU B;  3L70 J;  2KLV A;  4W7Y A;  4UB6 H;  1SFC D;  1M1J B;  2ZVN B;  3AEG C;  2ZYA A;  3VMX A;  1QVG O;  5AW2 B;  1GD2 E;  1K8A Q;  5AW1 B;  3EQ2 A;  2MKV A;  5B5E H;  1JY2 O;  1N7L A;  3R2P A;  1HJB A;  3RK2 B;  1KIL B;  3A2A A;  3AE5 C;  3AEB C;  4PV1 B;  5DJU B;  3L75 G;  3N4X A;  1SS1 A;  5TIS E;  2BCC J;  4OVN F;  2BEZ F;  2HPC B;  3B4S A;  3H1I D;  4U3F G;  2IYO A;  1NTM J;  2V7Q J;  1URQ B;  2ZT9 D;  1VQ7 P;  1HF9 A;  1OW8 A;  1NYH A;  1Q7Y Q;  5AVQ B;  4M3L A;  1JMB A;  1M8O B;  3NFQ A;  4OGQ B;  1LNQ A;  2B89 A;  2K9J A;  3HUS C;  2E42 A;  3L36 A;  1HTL C;  4C46 A;  3CCV P;  1JTH B;  1RE3 C;  1JEK A;  5CCG D;  1FC2 C;  1LTT C;  1BSN A;  1GU5 A;  3GW6 A;  3B8E B;  2OYO A;  4D6T G;  3H32 B;  4EOT A;  1VQN P;  1L0N G;  1H88 A;  3F89 A;  1KB9 H;  2RKL A;  1WT6 A;  1SQQ E;  2G3A A;  1SQX J;  2XNX A;  1HH0 A;  1YQ4 C;  3L71 E;  3L75 D;  2QEX P;  1DH3 A;  3WUV A;  3G6E P;  1JB0 J;  3VYI A;  1SQV G;  1IZN B;  5BU8 B;  1FOS F;  4U3F D;  1SQP G;  1S9K E;  3CCQ P;  1P84 I;  2IFN A;  4IL6 X;  1CW5 A;  3VOP A;  1VF5 C;  1N8R Q;  3LW5 J;  4NPE A;  2J58 A;  4TLF A;  2KP8 A;  3NTN A;  2FFD B;  2OYI A;  3I55 P;  3H1J E;  4KT0 J;  3B5N A;  4I1L A;  3G9R A;  1AQT A;  2HFE D;  4H13 B;  1M1K Q;  1PPJ E;  1HVV A;  4JBZ A;  2R3S A;  3H6P A;  2M3E A;  5TIS H;  1RF1 C;  3AE4 C;  4D6T D;  1L0N D;  2ZJS E;  5KLV D;  3C1L A;  3BAS A;  1EQ7 A;  1LTJ B;  2K3R A;  1SQQ K;  1G2C B;  1JUN A;  3Q2Y A;  4U7J A;  2E76 B;  3MD0 A;  1NU1 E;  1SQV D;  5AVY B;  1Q2N A;  3HE5 B;  1OW7 A;  4K35 A;  1KTM A;  2VRS A;  3CI9 A;  1SQP D;  2V7Q H;  3RGU A;  3TSI A;  5BVZ A;  1X79 B;  1T2K C;  2ZXE B;  3AEF C;  5EFW B;  1PP9 G;  2QVA A;  2D2C D;  5AVW B;  3O8Z A;  3KPE A;  2KZI A;  2ZYD A;  2GUV A;  5AW0 B;  3GMA A;  3TGU J;  4JYC A;  4L75 A;  4H44 C;  3BCC G;  2E74 C;  2H88 C;  2YO3 A;  4N78 E;  2OTK E;  5KJ7 A;  4Y28 J;  1NVO A;  3GHG A;  3FXD A;  3GLM A;  2FY8 A;  5AW6 B;  1P84 E;  2FYU E;  2NPS A;  3B5N D;  1NU1 K;  2WVR A;  1DD3 A;  3IN6 A;  3IR9 A;  4YXD C;  3H1H G;  5AVZ B;  3LW5 H;  3V2N A;  3RK3 C;  1PL5 A;  1X8Y A;  2KZJ A;  4R4M A;  3M9Q A;  1FDO A;  2WWW A;  1L4A A;  1YTZ T;  3H1I J;  2WSS H;  3JCU E;  4WY4 C;  4DZO A;  4EIJ A;  2N9Y B;  3G71 P;  3RK3 E;  4I7Z B;  3VMZ A;  2YMK A;  1VQ6 P;  2MJZ A;  5GTI E;  2GUS A;  3MUD C;  2ZT9 C;  1LJ2 A;  1MFZ A;  1KFN A;  3TF5 A;  3HD7 B;  1VQL P;  3BCC D;  1HGZ A;  5AW3 B;  1N73 C;  1T3U A;  1AVY A;  1NTZ D;  1KZU B;  4UB8 E;  5AVU B;  3CXH E;  3W67 A;  2LXC B;  2B87 A;  1JY3 O;  2Y0D A;  2M5A A;  1NKN A;  5BU5 A;  1IFN A;  2FYU K;  3RBZ A;  4BXL A;  3CMA P;  1EXJ A;  2P67 A;  2W6J H;  3TYY A;  1GL2 C;  2Q6Q A;  3H1H D;  3L75 J;  3O6Q B;  3AE7 C;  3M9B A;  1DX7 A;  5DJT B;  2N1T A; 
#chains in the Genus database with same CATH homology
 3A3Y B;  5AVV B;  3L37 A;  1LWU B;  4WY4 A;  1NTZ K;  3C9I A;  3RL0 C;  4ZKU A;  3IFM A;  5CCH A;  2A45 G;  1L0L K;  1NAF A;  1NO4 A;  5APT A;  2NPS D;  3HD7 A;  3MUD A;  3II6 A;  5APW A;  3RL0 B;  2R5B A;  4XE5 B;  3LIE A;  3CLQ A;  2C9N Y;  3T97 A;  1JY3 P;  3VMY A;  2WTY A;  4HH2 A;  1IO4 A;  1RY3 A;  2HOD B;  2WIT A;  1JNM A;  1T2K D;  2A45 H;  1SFC C;  2C0W A;  1FZC C;  1FZF A;  1MV8 A;  1GK4 A;  1GL2 D;  1N73 A;  3SWY A;  1CI6 A;  1J1D B;  5AW8 B;  1L4A D;  1RF0 A;  2Q5U A;  1SFC B;  2OAR A;  1FZC B;  2KSJ A;  1N7S C;  2O1K A;  2WPQ A;  2WZ7 A;  4Y99 C;  1LT9 C;  1FU1 A;  1ZV8 A;  1N7S B;  4C7N A;  4Y99 B;  5AVX B;  1LT9 B;  4N78 D;  2KB7 P;  3BRT B;  3P32 A;  1JO5 A;  3U1C A;  2M3B A;  3TNU B;  5AVT B;  1GL2 A;  3V5B A;  4KHX A;  1M7L A;  5APS A;  4LGD E;  2FKW B;  2J59 M;  1OWA A;  1IFJ A;  1LWU A;  4HYT B;  4O9B A;  1LTS C;  1M1J C;  1SVF A;  1MUU A;  2KLV A;  3E1I A;  4W7Y A;  3BRV B;  1SFC D;  1M1J B;  4ZKP A;  2R32 A;  2I1J A;  2KOG A;  2Q3I A;  3VMX A;  1XTG B;  2HOD A;  5AW2 B;  1GD2 E;  4AQR D;  1AFO A;  1IFM A;  5AW1 B;  3EQ2 A;  3BVH A;  2WSF H;  3RK2 C;  3U1A A;  1KIL C;  1JY2 O;  1N7L A;  3R2P A;  3KDP B;  1HJB A;  1SFC A;  4C7R A;  1FZC A;  3RK2 B;  5CCG C;  1JCC A;  1KIL B;  3A2A A;  3N4X A;  1GU4 A;  2C9L Y;  4GKG A;  1GW4 A;  1N7S A;  5CHX A;  1VPC A;  2WT7 B;  1KFM A;  2HPC B;  4JF7 A;  1LT9 A;  1URQ C;  1GTW A;  3TNU A;  2HG5 D;  2LKM A;  2E43 A;  2IPP A;  1URQ B;  2R5D A;  1KQL A;  2WPS A;  1ZLL A;  1N2D C;  3I5C A;  1GZL A;  5AW5 B;  1PFI A;  5AVQ B;  2P2U A;  4M3L A;  5CMZ A;  2CPB A;  2POH A;  3NFQ A;  1T8Z A;  1XTC C;  2WSE H;  1G1I A;  1T3J A;  3B5N C;  5KLV K;  1M1J A;  2YNY A;  5AVS B;  2OYI B;  3RK2 D;  3VP8 A;  3HUS C;  3OA7 A;  1KIL D;  2E42 A;  3L36 A;  1HTL C;  1JY2 P;  4C46 A;  3B5N B;  1FZE A;  1JTH B;  2P7J A;  1RE3 C;  3NMD A;  1MZ9 A;  3HUS B;  5CCG D;  1LTT C;  3TK1 A;  1GU5 A;  2OYH C;  3B8E B;  2JEE A;  1J1D C;  3H32 B;  4EOT A;  1H88 A;  3UIA A;  2OYH B;  1WT6 A;  1KIL A;  1JY2 N;  1LTI C;  2XNX A;  1HH0 A;  4AUW A;  5CCG A;  1NOH A;  2WT7 A;  2HPC A;  1DH3 A;  4GIF A;  4I2L C;  3VYI A;  2IFM A;  2QM8 A;  5BU8 B;  1FOS F;  1QL2 A;  3RL0 D;  1URQ A;  2H43 A;  3MIW A;  1S9K E;  1J2J B;  3V2Q A;  2XZR A;  1CZQ A;  2N9B A;  1OXZ A;  2XV5 A;  2IFN A;  1CW5 A;  3VOP A;  1FZA A;  2FFD C;  2J58 A;  5KTB A;  2KP8 A;  1GK6 A;  2FXM A;  2A45 I;  3NTN A;  2FFD B;  2OYI A;  1JOC A;  1Z56 A;  2PAJ A;  2WPR A;  1VDF A;  1FJK A;  3B5N A;  4I1L A;  1JTH A;  2HFE D;  1HGV A;  2JJL A;  1N86 A;  3HUS A;  2QM7 A;  1HVV A;  2ZFC A;  2YMY A;  3G3Z A;  3HTK B;  1N7S D;  3A7O A;  1S9K D;  1DEB A;  3H6P A;  1RE3 A;  4GT1 A;  3H32 A;  5APQ A;  2OYH A;  5CJ4 A;  1RF1 C;  1JCD A;  1LTG C;  1LTJ C;  3M06 A;  1FDM A;  3BAT A;  1FJP A;  2HYN A;  2YKO A;  5KJ7 C;  1RF1 B;  3BAS A;  1EQ7 A;  3CL3 D;  1LTJ B;  3VP9 A;  3V4Q A;  4IFF A;  1SQQ K;  2W6B A;  1G2C B;  3GHG C;  3KQG A;  4I6M C;  1JUN A;  5AVR B;  3KYQ A;  1IK9 A;  2BAS A;  3MD0 A;  4N6J A;  2Z4E A;  2NPS C;  3GHG B;  3M9H A;  5AVY B;  1JMM A;  3HE5 B;  4LLH A;  1IC2 A;  2VRS A;  3CI9 A;  3LID A;  2NPS B;  1LGH B;  1QL1 A;  5AW9 B;  1FBM A;  1J1E C;  3HRN A;  1NHL A;  4W7Z A;  2H7H A;  3TSI A;  3M0D C;  5BVZ A;  1G1J A;  2Z5I A;  4WBA A;  1X79 B;  2Q9I A;  1J1E B;  1T2K C;  2ZXE B;  2OYI C;  3M91 A;  3N7N A;  2FFD A;  1L0N K;  2IX7 C;  2R3C A;  1L4A C;  1LTA C;  2YKP A;  4B86 A;  4JYB A;  3U59 A;  3MGN A;  1LTB C;  2P1J A;  1L4A B;  5AVW B;  1NWQ A;  1GW3 A;  3O8Z A;  3HTK A;  3KPE A;  5KJ7 D;  3V2P A;  2GUV A;  5AW0 B;  5AW4 B;  1SQV K;  1SQB K;  1YYC A;  2I1K A;  1NKZ B;  4JYC A;  2FYZ A;  5APX A;  3EFG A;  1URQ D;  1FZG A;  1SQP K;  2WSC H;  3M0A A;  3VN0 A;  3V4W A;  1RF1 A;  5CJ0 A;  2M8R A;  1LTJ A;  2C0X A;  1RE4 C;  2YO3 A;  4N78 E;  2Z5H A;  1G2C A;  5KJ7 A;  1YTZ I;  2XDJ A;  1HBW A;  3GHG A;  5AW7 B;  3HE5 A;  3MTU E;  3L35 A;  1ZN5 A;  5AW6 B;  2H8P D;  2NPS A;  2XKM A;  3B5N D;  1NU1 K;  2HLO A;  2O01 H;  4OH8 B;  4DOJ A;  1JY3 N;  3WMM 0;  1A02 F;  3NXS A;  3HE4 B;  1A02 J;  3IR9 A;  1SLQ A;  3M0D A;  1NH4 A;  1ZR4 A;  5AVZ B;  1AQ5 A;  1FOS E;  2KYV A;  3LW5 H;  3V2N A;  1FAV A;  3RK3 C;  1H89 A;  2N1T C;  1X8Y A;  1W2E A;  3M9Q A;  5APU A;  1NTM K;  1SP4 A;  4WB4 A;  4IFD K;  2WWW A;  1L4A A;  3RK3 B;  3OAK A;  1YTZ T;  2GM4 A;  2N1T B;  4WY4 C;  4DZO A;  4AYC A;  4EIJ A;  1IFI A;  2PP6 A;  1NTK K;  4XA4 A;  3VMZ A;  2XU6 A;  5CCH C;  1IFD A;  4WY4 B;  2MJZ A;  1FZB A;  2YKQ A;  3OJA B;  2GUS A;  3HD7 C;  2L5G B;  1MFZ A;  1HWT C;  2W6A A;  1HUC A;  1KFN A;  5APV A;  3HD7 B;  1GDT A;  1E5W A;  2YO2 A;  4N3Y B;  1RE4 A;  1ZR2 A;  1HGZ A;  3P8C E;  3P7K A;  5AW3 B;  1WRG A;  4W80 A;  1N73 C;  1T3U A;  1KZU B;  1RF0 C;  5AVU B;  1H8A A;  1IJD B;  2O1J A;  4IFM A;  3RK3 D;  1CSB A;  3L4F A;  1JY3 O;  1N73 B;  1CI6 B;  2N1T D;  1NKN A;  4LC1 A;  5BU5 A;  2Q7C A;  1IFN A;  3HE4 A;  2FYU K;  3SWF A;  2W27 A;  1SQX K;  1X9V A;  4WY4 D;  2P67 A;  3P8M C;  3TYY A;  1GL2 C;  4C7N B;  5CCH D;  3PP5 A;  4RES B;  3HD7 D;  3A5T A;  5APY A;  3M9B A;  2CPS A;  3P8C D;  1GL2 B;  1DX7 A;  1LWU C;  2N1T A;  3VTP C;  3V2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...