3B5NB

Structure of the yeast plasma membrane snare complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
69
structure length
69
Chain Sequence
ALAEVQARHQELLKLEKSMAELTQLFNDMEELVIEQQENVDVIDKNVEDAQLDVEQGVGHTDKAVKSAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of the Yeast Plasma Membrane SNARE Complex Reveals Destabilizing Water-filled Cavities.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
molecule keywords Synaptobrevin homolog 1
total genus 32
structure length 69
sequence length 69
chains with identical sequence F, J
ec nomenclature
pdb deposition date 2007-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3b5nB00
3TSIA 1N7SA 3KYQA 1N7SD 5KJ7C 1GL2C 1JTHB 3RK3B 1N7SC 4WY4D 3RL0C 5CCHA 1GL2B 3RK3C 4OH8B 1URQA 3RK2D 1L4AA 1GL2A 5KJ7A 2KOGA 3HD7A 2N1TB 1T3JA 5CCGA 4W7ZA 4N78E 5CCGD 3HD7D 2NPSC 1HVVA 1KILB 2N1TA 3HD7B 5CCGC 1URQD 2H8PD 2PP6A 3B5NA 1L4AB 3M0DC 3P8CE 2NPSB 1KILC 1URQB 4WY4A 4LGDE 5CCHC 3RK3D 4W80A 2XDJA 1SFCD 2NPSA 3HTKB 1JTHA 1N7SB 2HG5D 5KJ7D 3RL0B 2HFED 1L4AD 3VOPA 4WY4C 4WY4B 1KILD 4JF7A 2N1TD 2YMYA 4W7YA 2WZ7A 1SFCB 1SFCC 1NHLA 2M8RA 2N1TC 3PP5A 3B5NB 3HD7C 1GL2D 3RK2B 2NPSD 1SFCA 1KILA 1XTGB 3RL0D 1URQC 3B5NC 1L4AC 3RK2C 5CCHD 3B5ND
chains in the Genus database with same CATH superfamily
4EI2A 1VL2A 1LTGC 4HB1A 2J58A 3L73J 2YXQB 3OA7A 1N7SD 3I55P 1SQBJ 1J1EB 3IAOA 2YMKA 3C9IA 1LTTC 3WUVA 2E76B 2IZ1A 1GL2C 2N9BA 2QIWA 2WPVB 4D6TE 4LLHA 1LT9C 4PV1B 5TISE 2K1AA 1ZOYC 1KB9H 4IL6E 3H1JJ 4HKZH 2SPZA 4JYBA 5KLVG 3A2AA 3RL0C 5H2FH 1FZFA 1GD2E 1HJ0A 2E75C 3G3ZA 4GIFA 1OIPA 2ZVNB 1GL2B 3SWFA 1JCCA 3BRTB 2PGDA 4PD4D 1NTZG 1RF0C 1PGPA 4OH8B 4U3FG 2R44A 3W67A 1VQ7P 1LTJC 1UIXA 1URQA 3NTNA 3SSUA 2E5TA 2ZYGA 1SQXJ 2KLVA 2Q1KA 1GL2A 3E7KA 3PH0A 1SQXK 3CXHD 2JO1A 4H13D 4YTPC 5DJUB 1YBKA 3HD7A 4KHXA 4DT0A 2R32A 2O01H 3CPWO 1LP1A 3P7KA 3VYIA 2LR2A 3W68A 1FJPA 2H89C 1SQVG 1NAYA 2MJZA 1KILB 2N1TA 1BGYE 2WSEH 2V7QJ 5AW2B 1N73A 4AQRD 2PP6A 2FYUG 1L4AB 1FAVA 2M5AB 3M0DC 1VQLP 2M3EA 3AE3C 2GUVA 3LIDA 1KQFB 1BGYD 1RF0A 3H1LE 2FKWB 2ZAEB 4Y99B 5AVQB 4DJGA 2Y0DA 2ZJSE 3FGAD 4LGDE 3CC2P 1T2KD 3EQ2A 4TT3H 1L0LD 3LW5H 1N2DC 3UIAA 3WU2E 3JC22 3D6ZA 4UB6H 2VRSA 3L75J 3QH9A 3R2PA 1KN7A 1H0TB 2R5BA 3L70J 1RE3C 1BCCJ 3KDPB 1FDMA 5DJTB 2V4HA 1OXZA 3T97A 2XNXA 3BCCG 3FX0A 3RBXA 2LKMA 1NKZB 2RKLA 2XU6A 3I5CA 1BSNA 3B4SA 1EZVG 4I7ZC 3BCCE 3H1IJ 4PD4E 1LTSC 1RE3A 5KAFE 3VN0A 3M9BA 4D6TG 5B5EH 2IPPA 1A02J 1FBMA 2AEMA 3CCVP 5BU5A 1ZRTE 3Q5PA 1EDLA 3IR9A 1BE3G 1G1IA 3SWKA 3M06A 1AJYA 3TGUD 2R3SA 5CHXA 1M1JC 1SQQK 4H44C 4RKUJ 2IYOA 4XFJA 5APWA 1Y47A 1S5LH 2CPBA 3L74G 3CXHH 3L71G 1FOSE 1NTKD 4AYCA 3PLNA 4JF7A 1Q82Q 2Q7CA 1JCDA 2BCCG 2N1TD 1LGHB 2O1KA 3HE5B 3II6A 2ZT9C 4UB8E 1X22A 5GTIH 4W7YA 2KZIA 1SQPG 2WZ7A 2YXRB 3H1KD 1VF5B 5AVZB 1NHLA 1WMKA 1KFMA 4OWFA 1SQPE 1HWTC 1H0TA 5AW7B 3B5NB 3KZIH 4A7PA 3AEEC 4TLFA 1QVFO 1OW7A 3Q1MA 1USDA 2AXTH 2NPSD 3MUDA 1N7LA 3EFGA 3E1IA 4ASVA 1JNMA 2IBZD 2JWAA 1XTGB 3VMYA 1N8RQ 1GDTA 1JO5A 1EXJA 2L91A 3WMM0 1JY3P 4IFMA 2A45H 2W83C 3GF7A 3N7NA 4YXDC 1MUUA 2E43A 3L73G 1X9VA 2M5AA 1GMJA 5CCHD 3CWBE 4LC1A 1DEBA 2KK7A 1HF9A 1NU1E 2YIUC 1OMIA 3H1KJ 3WUTA 1SQXE 3CWBG 1RH5B 5L8RJ 1YJNP 3S4RA 1IFMA 4NPEA 2C9LY 2ZT9D 1J1EC 3L70D 1KFNA 1IC2A 4GODA 5CJ4A 1R8EA 1GU5A 1PGJA 2BCCJ 3TGUJ 2B87B 3S9OA 3VMAA 2FXPA 3TNUA 5KJ7C 2A06E 2KS1A 3FWLA 1P84D 1Z56A 1DIPA 3O6QA 1PL5A 2K37A 1NU1J 1G2CA 1PPJE 2LXCB 3TK1A 3V2RA 1L0LK 4WY4D 1FZCA 1KQGB 2Q3IA 4HH2A 1LTBC 1VQ8P 1IK7A 1FE6A 1JB0J 5E79E 1SQBG 2KSJA 3AE2C 2N9YB 2ZYAA 3NXSA 5KKZC 1H8AA 3HE4A 1S3JA 4L74A 1SVFA 1T8ZA 2AXCA 2Z4EA 1SQPK 1RQVA 3H1JE 3AECC 5AW5B 3V5BA 3L70G 5TJHA 2FYZA 1LTJB 3SFDC 3V4QA 4ZKUA 4GDOA 1L4AA 3MP7B 3CI9A 3C1LA 2OARA 1JY2P 1SP4A 2QJKB 4BWNA 1R5LA 2N1TB 2FFDC 5CCGA 3G6EP 5AVYB 1VQMP 1SQPJ 3H1IG 4N78E 1S9KD 4IFDK 4AUWA 1LTIC 1PGOA 2WPQA 3K5BA 3HD7D 4IFFA 4OVNF 1M1KQ 1OW6A 1LT1A 4K3AA 3L73D 1AVOA 1MFZA 1SQBK 1JY3N 1Y9BA 1Q86Q 2E5YA 1P84I 3BRVB 3HD7B 5CCGC 2JP3A 1L0NJ 1H89A 1OFCX 1URQD 2E74D 2H8PD 2QJPC 3AEBC 2RH0A 3KZIE 2FXOA 3P8CE 3H1HG 2OYHC 3HRNA 2C9NY 2NPSB 4KJMA 1IFJA 2XV5A 4IL6X 2E76D 2G8YA 3L73E 4H0LB 1URQB 1FU1A 1M57D 2QJYC 3L72G 1BSHA 2W6AA 2WPRA 3AE5C 4YXWH 1LWUA 4EYYQ 1QLED 1NU1G 2P10A 3EFFK 3MHVA 3R4YA 5GTIE 3CCUP 4W80A 5M1BA 1NTZJ 4D6TJ 1SQPD 3H1KG 3WUUA 2KXPB 1S4XA 2NPSA 2OGUA 3HTKB 4H0LC 4JQ0D 1S5LE 2OYIC 2BCCD 5APTA 2ZVOB 4OGQB 2XKMA 2O01J 1NTKG 4R4MA 3L35A 3L74D 1JY2N 2OYHA 2NRGA 3QWOC 5AVXB 1U7JA 1KB9D 2WTYA 4WBAA 3TGUG 1JUNA 5AW0B 3E1RA 5KTBA 3RL0B 2HFED 1QL2A 2P7JA 2Y9YA 1FS0E 3GF3A 3O8ZA 2QJKC 3ABVC 2OYOA 2BEZF 1Q81Q 4I1LA 2C0XA 1PP9E 1JOCA 3L36A 1X8YA 4WY4B 2E74C 3USSA 3TF5A 4U3FJ 5AVVB 2W90A 2DW3A 3PRJA 4DOJA 1IK9A 1MKMA 2E76C 1NU1D 3A3YB 3BCCD 3MZWB 3D6YA 1CW5A 1NWQA 2KLUA 2Y9ZA 3L72D 1LT9B 4PV1C 3VMZA 1HUCA 5AVWB 3G71P 1FOSF 3T97B 2WVRA 2JJLA 3H1HD 3IN6A 3L4FA 1USEA 1RF1C 2A45G 2IX7C 3H1LJ 2KP8A 1L0LJ 4EIJA 1VQPP 3PTZA 2FFDA 5KLVK 1WT6A 1QX8A 2GUSA 2OTKE 4BRYA 2Y0EA 3CCQP 3M91A 1L0NE 4GOFA 2JWDA 1NTKJ 3H1ID 2BEQD 4GKGA 2Y0CA 2FYUD 1EZVI 3FWNA 4KT0J 4L75A 4N3YB 1RHZB 4O9BA 2QJPB 3GW6A 4DCKA 2OTLP 1HGVA 3HUSB 4C7NB 2B9BA 2YKQA 3L72J 4MN4C 1H88A 1FZCC 1VPCA 3TYYA 1JEKA 1YHQP 4L73A 3B5ND 1M7LA 1J2JB 1Q7YQ 4BRYB 2FYNB 4ASWA 1OVVA 2Q9IA 2I1JA 1SQBD 3KXDA 1OZHA 2E42A 1FZEA 3I56P 1X79B 5AW8B 1IFNA 2R3CA 4K35A 3KYQA 2FYUJ 2ITAA 1VQNP 1NYHA 2OYIB 1YJ9P 1PZQA 5E79H 1R5SA 2B88A 2D2CB 5H2FE 1DD3A 1NTZD 1SS1A 4NPFX 1AQTA 1ZR2A 1EZVE 3AE9C 3RK3B 3B71A 2JEEA 2PRRA 5TISH 2KYVA 1M1JA 2IBZI 2KUBA 2QRXA 3AE1C 5KLVD 3V2QA 3Q3DA 1K73Q 1KYOI 5CBOA 2FBWC 5CCHA 1ZN5A 2P67A 4U3FE 3CL3D 2IZ0A 3RK3C 1UIIA 1KQLA 3CWBD 5KLVE 1SLQA 1NAFA 2W6BA 4I7ZB 5AW9B 4H44D 2QM8A 3M0DA 3RK3E 1M8OB 1YTZT 1FDIA 1GK6A 1Q90D 2KB7P 1NTZE 1Y8AA 1BE3E 1AVYA 1LJ2A 1QGKB 2JDIH 3CX5D 4GOEA 1U57A 4CPGA 1VDFA 1PPJG 2KOGA 1GW3A 3BATA 1SQQJ 2H43A 1T3JA 1NU1K 1YYCA 1XTCC 1KYOH 1KV4A 1L0LE 2J59M 2IYPA 3L37A 5CCGD 3L71E 2FFDB 2IBZG 1LNQA 1GZLA 2CK3H 1IJDB 3Q5SA 3VTPC 4Y99C 2YO3A 5GTHE 2HR3A 1NTME 2O1JA 3H1KE 1WRGA 1S5LX 2AXTE 3CCSP 1LWUB 3B5NA 2ZT9B 5AVUB 3GMAA 1W5CE 5K5GB 1EDJA 2BASA 1FZBA 1KILC 5APVA 1IO4A 2ZXXA 3V4WA 2D2CD 3CX5E 2FYUK 4NPDA 4RESB 4WY4A 5BU8B 3L71D 3A0HH 5CCHC 3B8EB 4UB8H 2Q3EA 4YPCA 2IDBA 3RK3D 4BXLA 1QL1A 1T6AA 1D7MA 2YNYA 3JCUE 5AW4B 3M9HA 1GK4A 4L76A 3CXHE 1E5WA 1KZUB 1ZRTD 3A0BH 4HYTB 3NFQA 4OGQC 3Q5RA 3Q2YA 1BE3D 1OVUA 2LXBA 5AW3B 3VP8A 2WT7B 1JTHA 2J5UA 2W27A 2FXMA 3PJSK 5APUA 1N86A 3ITKA 1AV1A 1OVRA 1SQXG 3F5HA 1A02F 3AEAC 3KPEA 1N7SB 2I8DA 5AW6B 4D6TD 1EZVD 3D71A 2OYHB 5APSA 2HG5D 2A06G 1OX3A 3AE4C 3HTKA 5AVRB 5KJ7D 1NTKK 2PAJA 1W2BO 1L4AD 3HE4B 3U59A 1IFDA 2KZJA 5B5EE 5KAFH 2M3BA 2Z5IA 2E75D 3CCLP 3GHGC 4PD4H 3VOPA 2QEXP 3RBZA 4I6MC 4WY4C 1FZGA 2WMMA 3U1AA 5KLVJ 1SQBE 1LT9A 1G2CB 2WPSA 1L2PA 2M0BA 1L0LG 2KSEA 2YKOA 1QEXA 3U1CA 1KILD 2WSEJ 1NGMB 3CX5I 1NKNA 4UB6E 1JMMA 3FXEA 1DH3A 1HGZA 3V2PA 3WU2H 4H0LD 2KNCA 1BGYG 1W2EA 3AEFC 1K8AQ 1SFCB 3AEDC 3ZDMA 2BCCE 4EDFA 1RF1B 1ZW0A 2YO2A 3HUSA 2FYUE 4PD4I 4C7NA 1M56D 1KYOD 2PFXA 3AE8C 3PP5A 4I2LC 1HBWA 3HD7C 1GL2D 5AVTB 1SQVD 1ZP0C 1BCCG 3A7OA 3JSVC 3RK2B 3S1KA 1RF1A 2KNCB 1VF5C 2QVAA 3CD6P 1SFCA 1KILA 3BCCJ 3H1IE 3RL0D 1LTJA 1URQC 2QJYB 2QE7H 4RJTA 5EFWB 2WSCH 1FC2C 3B5NC 3P8CD 1NJIQ 1L4AC 3RK2C 4H13B 3KQGA 1N73C 1FZAA 1K05A 1EQ7A 3P32A 4JPZB 2QG4A 5APQA 4DZOA 1OW8A 2P2UA 3V2NA 1PGQA 4PJ0H 3IFMA 2K88A 2JR8A 1ZXGA 3MGNA 1BE3J 3C8VA 3H1HE 4U3FD 1YITP 3CCEP 4C7RA 1YJWP 1RQUA 4H13C 2HPCB 1NTZK 3CMEP 3L72E 1S9KE 1Q2NA 1P84H 1FDOA 3TSIA 5C39A 3BASA 2NZ2A 1N7SA 1VQ6P 1PV3A 1ZMEC 1JY3O 3L71J 2CPSA 3HE5A 4H44B 2GA1A 3SFEC 1QVGO 2HODA 3V6IA 1BDCA 1VQ9P 1S72P 1J1DB 1N73B 4IL6H 4GT1A 1KB9E 1BDDA 1JTHB 1PP9D 1PIXA 1X0TA 2WSSH 2ZFCA 2O01N 3L75E 1EC5A 4N6JA 1JY2O 1N7SC 2P58A 1AA0A 3L74E 4QMAA 5APYA 2H7HA 1DD4A 5CBNA 2OTJP 3H32B 3TDKA 1TU3F 1VF5D 2WSCJ 1J1DC 3OW2O 2HODB 1PP9G 1AFOA 1NOHA 3GHGB 5CJ0A 3CC4P 2W6JH 2KI7B 4EOTA 2G3AA 2K9JB 3L75D 1P84E 2R5DA 1T2KC 4M3LA 1EDIA 1M1JB 2O3JA 3P8MC 4WWIA 1KORA 3RK2D 1NTMG 2FY8A 2OQQA 2YKPA 1JM0A 4RO0A 3GG2A 3H1JG 3D70A 2ZXEB 1CSBA 1S2EA 3PHLA 2AEFA 4PJ0E 5KJ7A 4PV1D 1RE4A 1K04A 1AQ5A 1HTLC 1L0ND 3H1LG 3SWYA 4W7ZA 1U7MA 3VP9A 1MV8A 1YIJP 1M90Q 2WSFJ 3AE7C 4WB4A 1HH0A 1OWAA 2C0WA 2NPSC 1HVVA 1SQQE 4Z1MH 3NMDA 4C46A 3AEGC 1KC8Q 2AEJA 2HLOA 2KIKA 1KB9I 3OAKA 4IOIH 1DX7A 2ZYDA 1IFPA 1JMBA 1LWUC 4U7JA 1SQVK 3M9QA 2K9YA 2B89A 1BCCD 2WWWA 1SQQD 3CCJP 3EWKA 1YTZI 2IFNA 1ZLLA 2IBZE 2WSFH 2Q6QA 1EXIA 2QM7A 4ZKPA 1YQ4C 1PFIA 2FYNC 1GTWA 4N78D 3MIWA 1YQ3C 3F89A 2XDJA 1SFCD 3CCMP 2Q5UA 2WITA 5B66H 1KQSO 4XE5B 3MTUE 5AVSB 5AW1B 3RGUA 5KKZB 2Z5HA 3LIEA 1E79H 1ZR4A 1RE4C 1L0NK 3M0AA 1CZQA 1NTKE 2MKVA 5APXA 3O6QB 5KLIB 2OYIA 1KD1Q 3RL0g 5KAIH 3L74J 3CCRP 1FZCB 1HJBA 2V7QH 1KTMA 2RN0A 2JKVA 5KAIE 2KS1B 1NH4A 2B87A 1VQKP 1VQ4P 1NVOA 2QA4P 3N4XA 1LTAC 1G1JA 1NTMK 2A06D 5KLIC 3G4SP 1IZNB 3AE6C 1MZ9A 1PP9J 2WT7A 1SQXD 1T3UA 2D2CC 3GLMA 2H88C 5B66E 2I1KA 2L5GB 2XZRA 1BCCE 2W8ZA 3A0BE 2WQYC 3L70E 2K9JA 3LW5J 3JCUH 4ZMDA 3H1HJ 5CMZA 1GU4A 1K9MQ 2YMYA 1NTMJ 4JYCA 1SQQG 1VQOP 2E74B 3A0HE 4WVZA 2POHA 1YI2P 4OGQD 3CX5H 1DEEG 1GW4A 1SFCC 1MFTA 2RMZA 2E75B 2QSIA 3A5TA 3MUDC 1FJKA 2M8RA 2GM4A 2N1TC 4B86A 4ZNCA 1RY3A 2UWJE 1LP1B 1SQVE 3G9RA 2K3RA 2XNDH 3BVHA 2A45I 3HUSC 1CI6A 3CC7P 1BGYJ 3FXDA 3MD0A 5GTHH 3VMXA 3CWBJ 3IF4A 5BVZA 1L0NG 2HYNA 3H1LD 3H6PA 2HPCA 3OJAB 3H25A 1VQ5P 3CLQA 2P1JA 3H1JD 1NO4A 1IFIA 1KYOE 3TNUB 3KHUA 4Y28J 1NTMD 4JBZA 1KMIZ 3CXHI 3GHGA 1CI6B 1EDKA 4HJGH 1KILE 1ZV8A 4XA4A 3L75G 2YIUB 4R4LA 1S1CX 3H32A 2IFMA 1SQVJ 3CMAP 1PPJD 3TGUE
chains in the Genus database with same CATH topology
1LTGC 2J58A 3OA7A 1N7SD 1J1EB 3C9IA 1LTTC 2N9BA 1GL2C 4LLHA 1LT9C 4JYBA 1FZFA 3A2AA 3RL0C 1GD2E 3G3ZA 3SWFA 4GIFA 1GL2B 1JCCA 3BRTB 1RF0C 4OH8B 1LTJC 1URQA 3NTNA 2KLVA 1GL2A 1SQXK 3HD7A 4KHXA 2R32A 2O01H 3P7KA 3VYIA 1FJPA 2MJZA 1KILB 2N1TA 2WSEH 5AW2B 1N73A 4AQRD 2PP6A 1L4AB 1FAVA 3M0DC 2GUVA 3LIDA 2OYHB 1RF0A 2FKWB 5AVQB 4Y99B 4LGDE 1T2KD 3EQ2A 3LW5H 1N2DC 3UIAA 2VRSA 3R2PA 2R5BA 1RE3C 3KDPB 1FDMA 1OXZA 3T97A 2XNXA 2LKMA 1NKZB 2XU6A 3I5CA 1AQ5A 1LTSC 1RE3A 3VN0A 1A02J 3M9BA 2IPPA 1FBMA 5BU5A 3IR9A 1G1IA 3M06A 5CHXA 1M1JC 1SQQK 5APWA 2CPBA 1FOSE 4AYCA 4JF7A 2Q7CA 1JCDA 2N1TD 1LGHB 2O1KA 3HE5B 3II6A 4W7YA 2WZ7A 5AVZB 1NHLA 1KFMA 1HWTC 5AW7B 3B5NB 2NPSD 3MUDA 1N7LA 3EFGA 3E1IA 1JNMA 1XTGB 3VMYA 1GDTA 1JO5A 3WMM0 1JY3P 4IFMA 2A45H 3N7NA 1MUUA 2E43A 5CCHD 1X9VA 4LC1A 1DEBA 1IFMA 2C9LY 1J1EC 1KFNA 1IC2A 5CJ4A 1GU5A 5KJ7C 3TNUA 1Z56A 3V2RA 3TK1A 1G2CA 1L0LK 4WY4D 1FZCA 4HH2A 2Q3IA 1LTBC 3TYYA 3V4QA 3NXSA 2KSJA 1H8AA 3HE4A 1SVFA 1T8ZA 2Z4EA 1SQPK 5AW5B 4ZKUA 2FYZA 1LTJB 1L4AA 3CI9A 2OARA 1JY2P 1SP4A 2N1TB 2FFDC 5CCGA 5AVYB 1S9KD 4N78E 4IFDK 4AUWA 1LTIC 2WPQA 4IFFA 3HD7D 1MFZA 1SQBK 1JY3N 3BRVB 3HD7B 5CCGC 1H89A 1URQD 2H8PD 3P8CE 2OYHC 3HRNA 2C9NY 2NPSB 1IFJA 2XV5A 1URQB 1FU1A 2W6AA 2WPRA 1LWUA 4W80A 2NPSA 3HTKB 2OYIC 5APTA 2XKMA 3L35A 1JY2N 5AVXB 2WTYA 4WBAA 1JUNA 5AW0B 5KTBA 3RL0B 2HFED 1QL2A 2P7JA 3O8ZA 4I1LA 2C0XA 1JOCA 3L36A 1X8YA 4WY4B 5AVVB 4DOJA 1IK9A 3A3YB 1CW5A 1NWQA 1LT9B 3VMZA 1HUCA 5AVWB 1FOSF 2JJLA 3L4FA 1RF1C 2A45G 2IX7C 2KP8A 4EIJA 2FFDA 5KLVK 1WT6A 2GUSA 3M91A 4GKGA 1HJBA 4N3YB 4O9BA 1HGVA 3HUSB 4C7NB 2YKQA 1H88A 1FZCC 1VPCA 3B5ND 1M7LA 1J2JB 2Q9IA 2I1JA 2E42A 1FZEA 1X79B 5AW8B 1IFNA 2R3CA 3KYQA 2OYIB 1ZR2A 3RK3B 2JEEA 2KYVA 1M1JA 3V2QA 5CCHA 1ZN5A 2P67A 3CL3D 3RK3C 1KQLA 1SLQA 1NAFA 2W6BA 5AW9B 2QM8A 3M0DA 1YTZT 3V5BA 1GK6A 5AVTB 2KB7P 1DX7A 1VDFA 2H43A 2KOGA 1GW3A 3BATA 1T3JA 1NU1K 1YYCA 1XTCC 2J59M 3L37A 2FFDB 5CCGD 1GZLA 1IJDB 3VTPC 4Y99C 2YO3A 2O1JA 1WRGA 1LWUB 3B5NA 5AVUB 2BASA 1FZBA 1KILC 5APVA 1IO4A 3V4WA 2FYUK 4RESB 4WY4A 5BU8B 5CCHC 3B8EB 3RK3D 1QL1A 2YNYA 5AW4B 3M9HA 1GK4A 1E5WA 1KZUB 4HYTB 3NFQA 5AW3B 3VP8A 2WT7B 1JTHA 2W27A 2FXMA 5APUA 1N86A 1A02F 1N7SB 5AW6B 5APSA 2HG5D 5AVRB 5KJ7D 3HTKA 1NTKK 2PAJA 1L4AD 3HE4B 3U59A 1IFDA 2M3BA 2Z5IA 3GHGC 3VOPA 1FZGA 4I6MC 4WY4C 3U1AA 1LT9A 1G2CB 2WPSA 2YKOA 3U1CA 1KILD 1NKNA 1JMMA 1DH3A 1HGZA 3V2PA 1W2EA 1SFCB 1RF1B 2YO2A 3HUSA 4C7NA 3PP5A 4I2LC 1HBWA 3HD7C 1GL2D 3RK2B 1N73B 3A7OA 1RF1A 1SFCA 1KILA 3RL0D 1LTJA 1URQC 2WSCH 3B5NC 3P8CD 1L4AC 3RK2C 1N73C 3KQGA 1FZAA 3P32A 1EQ7A 5APQA 4DZOA 2P2UA 3V2NA 3IFMA 3MGNA 4C7RA 2HPCB 1NTZK 1S9KE 3TSIA 3BASA 1N7SA 1JY3O 2CPSA 3HE5A 2HODA 1J1DB 4GT1A 1JTHB 2ZFCA 4N6JA 5APYA 1JY2O 1N7SC 2H7HA 3H32B 1J1DC 2HODB 1AFOA 1NOHA 3GHGB 5CJ0A 4EOTA 2R5DA 1T2KC 4M3LA 1M1JB 3P8MC 3RK2D 2YKPA 2ZXEB 1CSBA 5KJ7A 1RE4A 1HTLC 3SWYA 3VP9A 4W7ZA 1MV8A 4WB4A 1HH0A 1OWAA 2C0WA 2NPSC 1HVVA 3NMDA 4C46A 3OAKA 2HLOA 1LWUC 1SQVK 3M9QA 2WWWA 1YTZI 2IFNA 1ZLLA 2WSFH 2QM7A 4ZKPA 1PFIA 1GTWA 4N78D 3MIWA 2XDJA 1SFCD 2Q5UA 2WITA 4XE5B 3MTUE 5AVSB 5AW1B 2Z5HA 3LIEA 1ZR4A 1RE4C 1L0NK 3M0AA 1CZQA 5APXA 2OYIA 1FZCB 1NH4A 3N4XA 1LTAC 1G1JA 1NTMK 1MZ9A 2WT7A 1T3UA 2I1KA 2L5GB 2XZRA 2OYHA 5CMZA 1GU4A 2YMYA 4JYCA 2POHA 1GW4A 1SFCC 3A5TA 1FJKA 2M8RA 2GM4A 2N1TC 4B86A 1RY3A 3BVHA 2A45I 3HUSC 1CI6A 3MD0A 3VMXA 5BVZA 2HYNA 3H6PA 2HPCA 3OJAB 3CLQA 2P1JA 1NO4A 1IFIA 3TNUB 3GHGA 1CI6B 4XA4A 1ZV8A 3H32A 2IFMA 3KPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TSI A;  1N7S A;  3KYQ A;  1N7S D;  5KJ7 C;  1GL2 C;  1JTH B;  3RK3 B;  1N7S C;  4WY4 D;  3RL0 C;  5CCH A;  1GL2 B;  3RK3 C;  4OH8 B;  1URQ A;  3RK2 D;  1L4A A;  1GL2 A;  5KJ7 A;  2KOG A;  3HD7 A;  2N1T B;  1T3J A;  5CCG A;  4W7Z A;  4N78 E;  5CCG D;  3HD7 D;  2NPS C;  1HVV A;  1KIL B;  2N1T A;  3HD7 B;  5CCG C;  1URQ D;  2H8P D;  2PP6 A;  3B5N A;  1L4A B;  3M0D C;  3P8C E;  2NPS B;  1KIL C;  1URQ B;  4WY4 A;  4LGD E;  5CCH C;  3RK3 D;  4W80 A;  2XDJ A;  1SFC D;  2NPS A;  3HTK B;  1JTH A;  1N7S B;  2HG5 D;  5KJ7 D;  3RL0 B;  2HFE D;  1L4A D;  3VOP A;  4WY4 C;  4WY4 B;  1KIL D;  4JF7 A;  2N1T D;  2YMY A;  4W7Y A;  2WZ7 A;  1SFC B;  1SFC C;  1NHL A;  2M8R A;  2N1T C;  3PP5 A;  3B5N B;  3HD7 C;  1GL2 D;  3RK2 B;  2NPS D;  1SFC A;  1KIL A;  1XTG B;  3RL0 D;  1URQ C;  3B5N C;  1L4A C;  3RK2 C;  5CCH D;  3B5N D; 
#chains in the Genus database with same CATH topology
 4EI2 A;  1VL2 A;  1LTG C;  4HB1 A;  2J58 A;  3L73 J;  2YXQ B;  3OA7 A;  1N7S D;  3I55 P;  1SQB J;  1J1E B;  3IAO A;  2YMK A;  3C9I A;  1LTT C;  3WUV A;  2E76 B;  2IZ1 A;  1GL2 C;  2N9B A;  2QIW A;  2WPV B;  4D6T E;  4LLH A;  1LT9 C;  4PV1 B;  5TIS E;  2K1A A;  1ZOY C;  1KB9 H;  4IL6 E;  3H1J J;  4HKZ H;  2SPZ A;  4JYB A;  5KLV G;  3A2A A;  3RL0 C;  5H2F H;  1FZF A;  1GD2 E;  1HJ0 A;  2E75 C;  3G3Z A;  4GIF A;  1OIP A;  2ZVN B;  1GL2 B;  3SWF A;  1JCC A;  3BRT B;  2PGD A;  4PD4 D;  1NTZ G;  1RF0 C;  1PGP A;  4OH8 B;  4U3F G;  2R44 A;  3W67 A;  1VQ7 P;  1LTJ C;  1UIX A;  1URQ A;  3NTN A;  3SSU A;  2E5T A;  2ZYG A;  1SQX J;  2KLV A;  2Q1K A;  1GL2 A;  3E7K A;  3PH0 A;  1SQX K;  3CXH D;  2JO1 A;  4H13 D;  4YTP C;  5DJU B;  1YBK A;  3HD7 A;  4KHX A;  4DT0 A;  2R32 A;  2O01 H;  3CPW O;  1LP1 A;  3P7K A;  3VYI A;  2LR2 A;  3W68 A;  1FJP A;  2H89 C;  1SQV G;  1NAY A;  2MJZ A;  1KIL B;  2N1T A;  1BGY E;  2WSE H;  2V7Q J;  5AW2 B;  1N73 A;  4AQR D;  2PP6 A;  2FYU G;  1L4A B;  1FAV A;  2M5A B;  3M0D C;  1VQL P;  2M3E A;  3AE3 C;  2GUV A;  3LID A;  1KQF B;  1BGY D;  1RF0 A;  3H1L E;  2FKW B;  2ZAE B;  4Y99 B;  5AVQ B;  4DJG A;  2Y0D A;  2ZJS E;  3FGA D;  4LGD E;  3CC2 P;  1T2K D;  3EQ2 A;  4TT3 H;  1L0L D;  3LW5 H;  1N2D C;  3UIA A;  3WU2 E;  3JC2 2;  3D6Z A;  4UB6 H;  2VRS A;  3L75 J;  3QH9 A;  3R2P A;  1KN7 A;  1H0T B;  2R5B A;  3L70 J;  1RE3 C;  1BCC J;  3KDP B;  1FDM A;  5DJT B;  2V4H A;  1OXZ A;  3T97 A;  2XNX A;  3BCC G;  3FX0 A;  3RBX A;  2LKM A;  1NKZ B;  2RKL A;  2XU6 A;  3I5C A;  1BSN A;  3B4S A;  1EZV G;  4I7Z C;  3BCC E;  3H1I J;  4PD4 E;  1LTS C;  1RE3 A;  5KAF E;  3VN0 A;  3M9B A;  4D6T G;  5B5E H;  2IPP A;  1A02 J;  1FBM A;  2AEM A;  3CCV P;  5BU5 A;  1ZRT E;  3Q5P A;  1EDL A;  3IR9 A;  1BE3 G;  1G1I A;  3SWK A;  3M06 A;  1AJY A;  3TGU D;  2R3S A;  5CHX A;  1M1J C;  1SQQ K;  4H44 C;  4RKU J;  2IYO A;  4XFJ A;  5APW A;  1Y47 A;  1S5L H;  2CPB A;  3L74 G;  3CXH H;  3L71 G;  1FOS E;  1NTK D;  4AYC A;  3PLN A;  4JF7 A;  1Q82 Q;  2Q7C A;  1JCD A;  2BCC G;  2N1T D;  1LGH B;  2O1K A;  3HE5 B;  3II6 A;  2ZT9 C;  4UB8 E;  1X22 A;  5GTI H;  4W7Y A;  2KZI A;  1SQP G;  2WZ7 A;  2YXR B;  3H1K D;  1VF5 B;  5AVZ B;  1NHL A;  1WMK A;  1KFM A;  4OWF A;  1SQP E;  1HWT C;  1H0T A;  5AW7 B;  3B5N B;  3KZI H;  4A7P A;  3AEE C;  4TLF A;  1QVF O;  1OW7 A;  3Q1M A;  1USD A;  2AXT H;  2NPS D;  3MUD A;  1N7L A;  3EFG A;  3E1I A;  4ASV A;  1JNM A;  2IBZ D;  2JWA A;  1XTG B;  3VMY A;  1N8R Q;  1GDT A;  1JO5 A;  1EXJ A;  2L91 A;  3WMM 0;  1JY3 P;  4IFM A;  2A45 H;  2W83 C;  3GF7 A;  3N7N A;  4YXD C;  1MUU A;  2E43 A;  3L73 G;  1X9V A;  2M5A A;  1GMJ A;  5CCH D;  3CWB E;  4LC1 A;  1DEB A;  2KK7 A;  1HF9 A;  1NU1 E;  2YIU C;  1OMI A;  3H1K J;  3WUT A;  1SQX E;  3CWB G;  1RH5 B;  5L8R J;  1YJN P;  3S4R A;  1IFM A;  4NPE A;  2C9L Y;  2ZT9 D;  1J1E C;  3L70 D;  1KFN A;  1IC2 A;  4GOD A;  5CJ4 A;  1R8E A;  1GU5 A;  1PGJ A;  2BCC J;  3TGU J;  2B87 B;  3S9O A;  3VMA A;  2FXP A;  3TNU A;  5KJ7 C;  2A06 E;  2KS1 A;  3FWL A;  1P84 D;  1Z56 A;  1DIP A;  3O6Q A;  1PL5 A;  2K37 A;  1NU1 J;  1G2C A;  1PPJ E;  2LXC B;  3TK1 A;  3V2R A;  1L0L K;  4WY4 D;  1FZC A;  1KQG B;  2Q3I A;  4HH2 A;  1LTB C;  1VQ8 P;  1IK7 A;  1FE6 A;  1JB0 J;  5E79 E;  1SQB G;  2KSJ A;  3AE2 C;  2N9Y B;  2ZYA A;  3NXS A;  5KKZ C;  1H8A A;  3HE4 A;  1S3J A;  4L74 A;  1SVF A;  1T8Z A;  2AXC A;  2Z4E A;  1SQP K;  1RQV A;  3H1J E;  3AEC C;  5AW5 B;  3V5B A;  3L70 G;  5TJH A;  2FYZ A;  1LTJ B;  3SFD C;  3V4Q A;  4ZKU A;  4GDO A;  1L4A A;  3MP7 B;  3CI9 A;  3C1L A;  2OAR A;  1JY2 P;  1SP4 A;  2QJK B;  4BWN A;  1R5L A;  2N1T B;  2FFD C;  5CCG A;  3G6E P;  5AVY B;  1VQM P;  1SQP J;  3H1I G;  4N78 E;  1S9K D;  4IFD K;  4AUW A;  1LTI C;  1PGO A;  2WPQ A;  3K5B A;  3HD7 D;  4IFF A;  4OVN F;  1M1K Q;  1OW6 A;  1LT1 A;  4K3A A;  3L73 D;  1AVO A;  1MFZ A;  1SQB K;  1JY3 N;  1Y9B A;  1Q86 Q;  2E5Y A;  1P84 I;  3BRV B;  3HD7 B;  5CCG C;  2JP3 A;  1L0N J;  1H89 A;  1OFC X;  1URQ D;  2E74 D;  2H8P D;  2QJP C;  3AEB C;  2RH0 A;  3KZI E;  2FXO A;  3P8C E;  3H1H G;  2OYH C;  3HRN A;  2C9N Y;  2NPS B;  4KJM A;  1IFJ A;  2XV5 A;  4IL6 X;  2E76 D;  2G8Y A;  3L73 E;  4H0L B;  1URQ B;  1FU1 A;  1M57 D;  2QJY C;  3L72 G;  1BSH A;  2W6A A;  2WPR A;  3AE5 C;  4YXW H;  1LWU A;  4EYY Q;  1QLE D;  1NU1 G;  2P10 A;  3EFF K;  3MHV A;  3R4Y A;  5GTI E;  3CCU P;  4W80 A;  5M1B A;  1NTZ J;  4D6T J;  1SQP D;  3H1K G;  3WUU A;  2KXP B;  1S4X A;  2NPS A;  2OGU A;  3HTK B;  4H0L C;  4JQ0 D;  1S5L E;  2OYI C;  2BCC D;  5APT A;  2ZVO B;  4OGQ B;  2XKM A;  2O01 J;  1NTK G;  4R4M A;  3L35 A;  3L74 D;  1JY2 N;  2OYH A;  2NRG A;  3QWO C;  5AVX B;  1U7J A;  1KB9 D;  2WTY A;  4WBA A;  3TGU G;  1JUN A;  5AW0 B;  3E1R A;  5KTB A;  3RL0 B;  2HFE D;  1QL2 A;  2P7J A;  2Y9Y A;  1FS0 E;  3GF3 A;  3O8Z A;  2QJK C;  3ABV C;  2OYO A;  2BEZ F;  1Q81 Q;  4I1L A;  2C0X A;  1PP9 E;  1JOC A;  3L36 A;  1X8Y A;  4WY4 B;  2E74 C;  3USS A;  3TF5 A;  4U3F J;  5AVV B;  2W90 A;  2DW3 A;  3PRJ A;  4DOJ A;  1IK9 A;  1MKM A;  2E76 C;  1NU1 D;  3A3Y B;  3BCC D;  3MZW B;  3D6Y A;  1CW5 A;  1NWQ A;  2KLU A;  2Y9Z A;  3L72 D;  1LT9 B;  4PV1 C;  3VMZ A;  1HUC A;  5AVW B;  3G71 P;  1FOS F;  3T97 B;  2WVR A;  2JJL A;  3H1H D;  3IN6 A;  3L4F A;  1USE A;  1RF1 C;  2A45 G;  2IX7 C;  3H1L J;  2KP8 A;  1L0L J;  4EIJ A;  1VQP P;  3PTZ A;  2FFD A;  5KLV K;  1WT6 A;  1QX8 A;  2GUS A;  2OTK E;  4BRY A;  2Y0E A;  3CCQ P;  3M91 A;  1L0N E;  4GOF A;  2JWD A;  1NTK J;  3H1I D;  2BEQ D;  4GKG A;  2Y0C A;  2FYU D;  1EZV I;  3FWN A;  4KT0 J;  4L75 A;  4N3Y B;  1RHZ B;  4O9B A;  2QJP B;  3GW6 A;  4DCK A;  2OTL P;  1HGV A;  3HUS B;  4C7N B;  2B9B A;  2YKQ A;  3L72 J;  4MN4 C;  1H88 A;  1FZC C;  1VPC A;  3TYY A;  1JEK A;  1YHQ P;  4L73 A;  3B5N D;  1M7L A;  1J2J B;  1Q7Y Q;  4BRY B;  2FYN B;  4ASW A;  1OVV A;  2Q9I A;  2I1J A;  1SQB D;  3KXD A;  1OZH A;  2E42 A;  1FZE A;  3I56 P;  1X79 B;  5AW8 B;  1IFN A;  2R3C A;  4K35 A;  3KYQ A;  2FYU J;  2ITA A;  1VQN P;  1NYH A;  2OYI B;  1YJ9 P;  1PZQ A;  5E79 H;  1R5S A;  2B88 A;  2D2C B;  5H2F E;  1DD3 A;  1NTZ D;  1SS1 A;  4NPF X;  1AQT A;  1ZR2 A;  1EZV E;  3AE9 C;  3RK3 B;  3B71 A;  2JEE A;  2PRR A;  5TIS H;  2KYV A;  1M1J A;  2IBZ I;  2KUB A;  2QRX A;  3AE1 C;  5KLV D;  3V2Q A;  3Q3D A;  1K73 Q;  1KYO I;  5CBO A;  2FBW C;  5CCH A;  1ZN5 A;  2P67 A;  4U3F E;  3CL3 D;  2IZ0 A;  3RK3 C;  1UII A;  1KQL A;  3CWB D;  5KLV E;  1SLQ A;  1NAF A;  2W6B A;  4I7Z B;  5AW9 B;  4H44 D;  2QM8 A;  3M0D A;  3RK3 E;  1M8O B;  1YTZ T;  1FDI A;  1GK6 A;  1Q90 D;  2KB7 P;  1NTZ E;  1Y8A A;  1BE3 E;  1AVY A;  1LJ2 A;  1QGK B;  2JDI H;  3CX5 D;  4GOE A;  1U57 A;  4CPG A;  1VDF A;  1PPJ G;  2KOG A;  1GW3 A;  3BAT A;  1SQQ J;  2H43 A;  1T3J A;  1NU1 K;  1YYC A;  1XTC C;  1KYO H;  1KV4 A;  1L0L E;  2J59 M;  2IYP A;  3L37 A;  5CCG D;  3L71 E;  2FFD B;  2IBZ G;  1LNQ A;  1GZL A;  2CK3 H;  1IJD B;  3Q5S A;  3VTP C;  4Y99 C;  2YO3 A;  5GTH E;  2HR3 A;  1NTM E;  2O1J A;  3H1K E;  1WRG A;  1S5L X;  2AXT E;  3CCS P;  1LWU B;  3B5N A;  2ZT9 B;  5AVU B;  3GMA A;  1W5C E;  5K5G B;  1EDJ A;  2BAS A;  1FZB A;  1KIL C;  5APV A;  1IO4 A;  2ZXX A;  3V4W A;  2D2C D;  3CX5 E;  2FYU K;  4NPD A;  4RES B;  4WY4 A;  5BU8 B;  3L71 D;  3A0H H;  5CCH C;  3B8E B;  4UB8 H;  2Q3E A;  4YPC A;  2IDB A;  3RK3 D;  4BXL A;  1QL1 A;  1T6A A;  1D7M A;  2YNY A;  3JCU E;  5AW4 B;  3M9H A;  1GK4 A;  4L76 A;  3CXH E;  1E5W A;  1KZU B;  1ZRT D;  3A0B H;  4HYT B;  3NFQ A;  4OGQ C;  3Q5R A;  3Q2Y A;  1BE3 D;  1OVU A;  2LXB A;  5AW3 B;  3VP8 A;  2WT7 B;  1JTH A;  2J5U A;  2W27 A;  2FXM A;  3PJS K;  5APU A;  1N86 A;  3ITK A;  1AV1 A;  1OVR A;  1SQX G;  3F5H A;  1A02 F;  3AEA C;  3KPE A;  1N7S B;  2I8D A;  5AW6 B;  4D6T D;  1EZV D;  3D71 A;  2OYH B;  5APS A;  2HG5 D;  2A06 G;  1OX3 A;  3AE4 C;  3HTK A;  5AVR B;  5KJ7 D;  1NTK K;  2PAJ A;  1W2B O;  1L4A D;  3HE4 B;  3U59 A;  1IFD A;  2KZJ A;  5B5E E;  5KAF H;  2M3B A;  2Z5I A;  2E75 D;  3CCL P;  3GHG C;  4PD4 H;  3VOP A;  2QEX P;  3RBZ A;  4I6M C;  4WY4 C;  1FZG A;  2WMM A;  3U1A A;  5KLV J;  1SQB E;  1LT9 A;  1G2C B;  2WPS A;  1L2P A;  2M0B A;  1L0L G;  2KSE A;  2YKO A;  1QEX A;  3U1C A;  1KIL D;  2WSE J;  1NGM B;  3CX5 I;  1NKN A;  4UB6 E;  1JMM A;  3FXE A;  1DH3 A;  1HGZ A;  3V2P A;  3WU2 H;  4H0L D;  2KNC A;  1BGY G;  1W2E A;  3AEF C;  1K8A Q;  1SFC B;  3AED C;  3ZDM A;  2BCC E;  4EDF A;  1RF1 B;  1ZW0 A;  2YO2 A;  3HUS A;  2FYU E;  4PD4 I;  4C7N A;  1M56 D;  1KYO D;  2PFX A;  3AE8 C;  3PP5 A;  4I2L C;  1HBW A;  3HD7 C;  1GL2 D;  5AVT B;  1SQV D;  1ZP0 C;  1BCC G;  3A7O A;  3JSV C;  3RK2 B;  3S1K A;  1RF1 A;  2KNC B;  1VF5 C;  2QVA A;  3CD6 P;  1SFC A;  1KIL A;  3BCC J;  3H1I E;  3RL0 D;  1LTJ A;  1URQ C;  2QJY B;  2QE7 H;  4RJT A;  5EFW B;  2WSC H;  1FC2 C;  3B5N C;  3P8C D;  1NJI Q;  1L4A C;  3RK2 C;  4H13 B;  3KQG A;  1N73 C;  1FZA A;  1K05 A;  1EQ7 A;  3P32 A;  4JPZ B;  2QG4 A;  5APQ A;  4DZO A;  1OW8 A;  2P2U A;  3V2N A;  1PGQ A;  4PJ0 H;  3IFM A;  2K88 A;  2JR8 A;  1ZXG A;  3MGN A;  1BE3 J;  3C8V A;  3H1H E;  4U3F D;  1YIT P;  3CCE P;  4C7R A;  1YJW P;  1RQU A;  4H13 C;  2HPC B;  1NTZ K;  3CME P;  3L72 E;  1S9K E;  1Q2N A;  1P84 H;  1FDO A;  3TSI A;  5C39 A;  3BAS A;  2NZ2 A;  1N7S A;  1VQ6 P;  1PV3 A;  1ZME C;  1JY3 O;  3L71 J;  2CPS A;  3HE5 A;  4H44 B;  2GA1 A;  3SFE C;  1QVG O;  2HOD A;  3V6I A;  1BDC A;  1VQ9 P;  1S72 P;  1J1D B;  1N73 B;  4IL6 H;  4GT1 A;  1KB9 E;  1BDD A;  1JTH B;  1PP9 D;  1PIX A;  1X0T A;  2WSS H;  2ZFC A;  2O01 N;  3L75 E;  1EC5 A;  4N6J A;  1JY2 O;  1N7S C;  2P58 A;  1AA0 A;  3L74 E;  4QMA A;  5APY A;  2H7H A;  1DD4 A;  5CBN A;  2OTJ P;  3H32 B;  3TDK A;  1TU3 F;  1VF5 D;  2WSC J;  1J1D C;  3OW2 O;  2HOD B;  1PP9 G;  1AFO A;  1NOH A;  3GHG B;  5CJ0 A;  3CC4 P;  2W6J H;  2KI7 B;  4EOT A;  2G3A A;  2K9J B;  3L75 D;  1P84 E;  2R5D A;  1T2K C;  4M3L A;  1EDI A;  1M1J B;  2O3J A;  3P8M C;  4WWI A;  1KOR A;  3RK2 D;  1NTM G;  2FY8 A;  2OQQ A;  2YKP A;  1JM0 A;  4RO0 A;  3GG2 A;  3H1J G;  3D70 A;  2ZXE B;  1CSB A;  1S2E A;  3PHL A;  2AEF A;  4PJ0 E;  5KJ7 A;  4PV1 D;  1RE4 A;  1K04 A;  1AQ5 A;  1HTL C;  1L0N D;  3H1L G;  3SWY A;  4W7Z A;  1U7M A;  3VP9 A;  1MV8 A;  1YIJ P;  1M90 Q;  2WSF J;  3AE7 C;  4WB4 A;  1HH0 A;  1OWA A;  2C0W A;  2NPS C;  1HVV A;  1SQQ E;  4Z1M H;  3NMD A;  4C46 A;  3AEG C;  1KC8 Q;  2AEJ A;  2HLO A;  2KIK A;  1KB9 I;  3OAK A;  4IOI H;  1DX7 A;  2ZYD A;  1IFP A;  1JMB A;  1LWU C;  4U7J A;  1SQV K;  3M9Q A;  2K9Y A;  2B89 A;  1BCC D;  2WWW A;  1SQQ D;  3CCJ P;  3EWK A;  1YTZ I;  2IFN A;  1ZLL A;  2IBZ E;  2WSF H;  2Q6Q A;  1EXI A;  2QM7 A;  4ZKP A;  1YQ4 C;  1PFI A;  2FYN C;  1GTW A;  4N78 D;  3MIW A;  1YQ3 C;  3F89 A;  2XDJ A;  1SFC D;  3CCM P;  2Q5U A;  2WIT A;  5B66 H;  1KQS O;  4XE5 B;  3MTU E;  5AVS B;  5AW1 B;  3RGU A;  5KKZ B;  2Z5H A;  3LIE A;  1E79 H;  1ZR4 A;  1RE4 C;  1L0N K;  3M0A A;  1CZQ A;  1NTK E;  2MKV A;  5APX A;  3O6Q B;  5KLI B;  2OYI A;  1KD1 Q;  3RL0 g;  5KAI H;  3L74 J;  3CCR P;  1FZC B;  1HJB A;  2V7Q H;  1KTM A;  2RN0 A;  2JKV A;  5KAI E;  2KS1 B;  1NH4 A;  2B87 A;  1VQK P;  1VQ4 P;  1NVO A;  2QA4 P;  3N4X A;  1LTA C;  1G1J A;  1NTM K;  2A06 D;  5KLI C;  3G4S P;  1IZN B;  3AE6 C;  1MZ9 A;  1PP9 J;  2WT7 A;  1SQX D;  1T3U A;  2D2C C;  3GLM A;  2H88 C;  5B66 E;  2I1K A;  2L5G B;  2XZR A;  1BCC E;  2W8Z A;  3A0B E;  2WQY C;  3L70 E;  2K9J A;  3LW5 J;  3JCU H;  4ZMD A;  3H1H J;  5CMZ A;  1GU4 A;  1K9M Q;  2YMY A;  1NTM J;  4JYC A;  1SQQ G;  1VQO P;  2E74 B;  3A0H E;  4WVZ A;  2POH A;  1YI2 P;  4OGQ D;  3CX5 H;  1DEE G;  1GW4 A;  1SFC C;  1MFT A;  2RMZ A;  2E75 B;  2QSI A;  3A5T A;  3MUD C;  1FJK A;  2M8R A;  2GM4 A;  2N1T C;  4B86 A;  4ZNC A;  1RY3 A;  2UWJ E;  1LP1 B;  1SQV E;  3G9R A;  2K3R A;  2XND H;  3BVH A;  2A45 I;  3HUS C;  1CI6 A;  3CC7 P;  1BGY J;  3FXD A;  3MD0 A;  5GTH H;  3VMX A;  3CWB J;  3IF4 A;  5BVZ A;  1L0N G;  2HYN A;  3H1L D;  3H6P A;  2HPC A;  3OJA B;  3H25 A;  1VQ5 P;  3CLQ A;  2P1J A;  3H1J D;  1NO4 A;  1IFI A;  1KYO E;  3TNU B;  3KHU A;  4Y28 J;  1NTM D;  4JBZ A;  1KMI Z;  3CXH I;  3GHG A;  1CI6 B;  1EDK A;  4HJG H;  1KIL E;  1ZV8 A;  4XA4 A;  3L75 G;  2YIU B;  4R4L A;  1S1C X;  3H32 A;  2IFM A;  1SQV J;  3CMA P;  1PPJ D;  3TGU E; 
#chains in the Genus database with same CATH homology
 1LTG C;  2J58 A;  3OA7 A;  1N7S D;  1J1E B;  3C9I A;  1LTT C;  2N9B A;  1GL2 C;  4LLH A;  1LT9 C;  4JYB A;  1FZF A;  3A2A A;  3RL0 C;  1GD2 E;  3G3Z A;  3SWF A;  4GIF A;  1GL2 B;  1JCC A;  3BRT B;  1RF0 C;  4OH8 B;  1LTJ C;  1URQ A;  3NTN A;  2KLV A;  1GL2 A;  1SQX K;  3HD7 A;  4KHX A;  2R32 A;  2O01 H;  3P7K A;  3VYI A;  1FJP A;  2MJZ A;  1KIL B;  2N1T A;  2WSE H;  5AW2 B;  1N73 A;  4AQR D;  2PP6 A;  1L4A B;  1FAV A;  3M0D C;  2GUV A;  3LID A;  2OYH B;  1RF0 A;  2FKW B;  5AVQ B;  4Y99 B;  4LGD E;  1T2K D;  3EQ2 A;  3LW5 H;  1N2D C;  3UIA A;  2VRS A;  3R2P A;  2R5B A;  1RE3 C;  3KDP B;  1FDM A;  1OXZ A;  3T97 A;  2XNX A;  2LKM A;  1NKZ B;  2XU6 A;  3I5C A;  1AQ5 A;  1LTS C;  1RE3 A;  3VN0 A;  1A02 J;  3M9B A;  2IPP A;  1FBM A;  5BU5 A;  3IR9 A;  1G1I A;  3M06 A;  5CHX A;  1M1J C;  1SQQ K;  5APW A;  2CPB A;  1FOS E;  4AYC A;  4JF7 A;  2Q7C A;  1JCD A;  2N1T D;  1LGH B;  2O1K A;  3HE5 B;  3II6 A;  4W7Y A;  2WZ7 A;  5AVZ B;  1NHL A;  1KFM A;  1HWT C;  5AW7 B;  3B5N B;  2NPS D;  3MUD A;  1N7L A;  3EFG A;  3E1I A;  1JNM A;  1XTG B;  3VMY A;  1GDT A;  1JO5 A;  3WMM 0;  1JY3 P;  4IFM A;  2A45 H;  3N7N A;  1MUU A;  2E43 A;  5CCH D;  1X9V A;  4LC1 A;  1DEB A;  1IFM A;  2C9L Y;  1J1E C;  1KFN A;  1IC2 A;  5CJ4 A;  1GU5 A;  5KJ7 C;  3TNU A;  1Z56 A;  3V2R A;  3TK1 A;  1G2C A;  1L0L K;  4WY4 D;  1FZC A;  4HH2 A;  2Q3I A;  1LTB C;  3TYY A;  3V4Q A;  3NXS A;  2KSJ A;  1H8A A;  3HE4 A;  1SVF A;  1T8Z A;  2Z4E A;  1SQP K;  5AW5 B;  4ZKU A;  2FYZ A;  1LTJ B;  1L4A A;  3CI9 A;  2OAR A;  1JY2 P;  1SP4 A;  2N1T B;  2FFD C;  5CCG A;  5AVY B;  1S9K D;  4N78 E;  4IFD K;  4AUW A;  1LTI C;  2WPQ A;  4IFF A;  3HD7 D;  1MFZ A;  1SQB K;  1JY3 N;  3BRV B;  3HD7 B;  5CCG C;  1H89 A;  1URQ D;  2H8P D;  3P8C E;  2OYH C;  3HRN A;  2C9N Y;  2NPS B;  1IFJ A;  2XV5 A;  1URQ B;  1FU1 A;  2W6A A;  2WPR A;  1LWU A;  4W80 A;  2NPS A;  3HTK B;  2OYI C;  5APT A;  2XKM A;  3L35 A;  1JY2 N;  5AVX B;  2WTY A;  4WBA A;  1JUN A;  5AW0 B;  5KTB A;  3RL0 B;  2HFE D;  1QL2 A;  2P7J A;  3O8Z A;  4I1L A;  2C0X A;  1JOC A;  3L36 A;  1X8Y A;  4WY4 B;  5AVV B;  4DOJ A;  1IK9 A;  3A3Y B;  1CW5 A;  1NWQ A;  1LT9 B;  3VMZ A;  1HUC A;  5AVW B;  1FOS F;  2JJL A;  3L4F A;  1RF1 C;  2A45 G;  2IX7 C;  2KP8 A;  4EIJ A;  2FFD A;  5KLV K;  1WT6 A;  2GUS A;  3M91 A;  4GKG A;  1HJB A;  4N3Y B;  4O9B A;  1HGV A;  3HUS B;  4C7N B;  2YKQ A;  1H88 A;  1FZC C;  1VPC A;  3B5N D;  1M7L A;  1J2J B;  2Q9I A;  2I1J A;  2E42 A;  1FZE A;  1X79 B;  5AW8 B;  1IFN A;  2R3C A;  3KYQ A;  2OYI B;  1ZR2 A;  3RK3 B;  2JEE A;  2KYV A;  1M1J A;  3V2Q A;  5CCH A;  1ZN5 A;  2P67 A;  3CL3 D;  3RK3 C;  1KQL A;  1SLQ A;  1NAF A;  2W6B A;  5AW9 B;  2QM8 A;  3M0D A;  1YTZ T;  3V5B A;  1GK6 A;  5AVT B;  2KB7 P;  1DX7 A;  1VDF A;  2H43 A;  2KOG A;  1GW3 A;  3BAT A;  1T3J A;  1NU1 K;  1YYC A;  1XTC C;  2J59 M;  3L37 A;  2FFD B;  5CCG D;  1GZL A;  1IJD B;  3VTP C;  4Y99 C;  2YO3 A;  2O1J A;  1WRG A;  1LWU B;  3B5N A;  5AVU B;  2BAS A;  1FZB A;  1KIL C;  5APV A;  1IO4 A;  3V4W A;  2FYU K;  4RES B;  4WY4 A;  5BU8 B;  5CCH C;  3B8E B;  3RK3 D;  1QL1 A;  2YNY A;  5AW4 B;  3M9H A;  1GK4 A;  1E5W A;  1KZU B;  4HYT B;  3NFQ A;  5AW3 B;  3VP8 A;  2WT7 B;  1JTH A;  2W27 A;  2FXM A;  5APU A;  1N86 A;  1A02 F;  1N7S B;  5AW6 B;  5APS A;  2HG5 D;  5AVR B;  5KJ7 D;  3HTK A;  1NTK K;  2PAJ A;  1L4A D;  3HE4 B;  3U59 A;  1IFD A;  2M3B A;  2Z5I A;  3GHG C;  3VOP A;  1FZG A;  4I6M C;  4WY4 C;  3U1A A;  1LT9 A;  1G2C B;  2WPS A;  2YKO A;  3U1C A;  1KIL D;  1NKN A;  1JMM A;  1DH3 A;  1HGZ A;  3V2P A;  1W2E A;  1SFC B;  1RF1 B;  2YO2 A;  3HUS A;  4C7N A;  3PP5 A;  4I2L C;  1HBW A;  3HD7 C;  1GL2 D;  3RK2 B;  1N73 B;  3A7O A;  1RF1 A;  1SFC A;  1KIL A;  3RL0 D;  1LTJ A;  1URQ C;  2WSC H;  3B5N C;  3P8C D;  1L4A C;  3RK2 C;  1N73 C;  3KQG A;  1FZA A;  3P32 A;  1EQ7 A;  5APQ A;  4DZO A;  2P2U A;  3V2N A;  3IFM A;  3MGN A;  4C7R A;  2HPC B;  1NTZ K;  1S9K E;  3TSI A;  3BAS A;  1N7S A;  1JY3 O;  2CPS A;  3HE5 A;  2HOD A;  1J1D B;  4GT1 A;  1JTH B;  2ZFC A;  4N6J A;  5APY A;  1JY2 O;  1N7S C;  2H7H A;  3H32 B;  1J1D C;  2HOD B;  1AFO A;  1NOH A;  3GHG B;  5CJ0 A;  4EOT A;  2R5D A;  1T2K C;  4M3L A;  1M1J B;  3P8M C;  3RK2 D;  2YKP A;  2ZXE B;  1CSB A;  5KJ7 A;  1RE4 A;  1HTL C;  3SWY A;  3VP9 A;  4W7Z A;  1MV8 A;  4WB4 A;  1HH0 A;  1OWA A;  2C0W A;  2NPS C;  1HVV A;  3NMD A;  4C46 A;  3OAK A;  2HLO A;  1LWU C;  1SQV K;  3M9Q A;  2WWW A;  1YTZ I;  2IFN A;  1ZLL A;  2WSF H;  2QM7 A;  4ZKP A;  1PFI A;  1GTW A;  4N78 D;  3MIW A;  2XDJ A;  1SFC D;  2Q5U A;  2WIT A;  4XE5 B;  3MTU E;  5AVS B;  5AW1 B;  2Z5H A;  3LIE A;  1ZR4 A;  1RE4 C;  1L0N K;  3M0A A;  1CZQ A;  5APX A;  2OYI A;  1FZC B;  1NH4 A;  3N4X A;  1LTA C;  1G1J A;  1NTM K;  1MZ9 A;  2WT7 A;  1T3U A;  2I1K A;  2L5G B;  2XZR A;  2OYH A;  5CMZ A;  1GU4 A;  2YMY A;  4JYC A;  2POH A;  1GW4 A;  1SFC C;  3A5T A;  1FJK A;  2M8R A;  2GM4 A;  2N1T C;  4B86 A;  1RY3 A;  3BVH A;  2A45 I;  3HUS C;  1CI6 A;  3MD0 A;  3VMX A;  5BVZ A;  2HYN A;  3H6P A;  2HPC A;  3OJA B;  3CLQ A;  2P1J A;  1NO4 A;  1IFI A;  3TNU B;  3GHG A;  1CI6 B;  4XA4 A;  1ZV8 A;  3H32 A;  2IFM A;  3KPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...