3B5NB

Structure of the yeast plasma membrane snare complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
69
structure length
69
Chain Sequence
ALAEVQARHQELLKLEKSMAELTQLFNDMEELVIEQQENVDVIDKNVEDAQLDVEQGVGHTDKAVKSAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of the Yeast Plasma Membrane SNARE Complex Reveals Destabilizing Water-filled Cavities.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
molecule keywords Synaptobrevin homolog 1
total genus 32
structure length 69
sequence length 69
chains with identical sequence F, J
ec nomenclature
pdb deposition date 2007-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3b5nB00
3HD7C 3RK2B 1N7SD 1L4AA 5CCGC 3HTKB 5CCHA 1XTGB 2NPSC 4WY4D 1N7SB 2HFED 2N1TB 5CCHD 1GL2B 3RK3B 4WY4B 2N1TA 1URQD 1GL2C 1SFCB 3RK2D 4W7YA 4N78E 2NPSB 1URQB 1L4AD 2KOGA 4LGDE 5KJ7C 1URQA 2N1TD 2M8RA 2HG5D 1KILC 4WY4A 1KILD 1SFCA 2XDJA 3VOPA 3B5NB 1L4AB 2N1TC 3B5NA 1GL2A 1KILB 4JF7A 3P8CE 5KJ7D 4W80A 3PP5A 1L4AC 3RK2C 2NPSD 1GL2D 1URQC 2NPSA 2H8PD 5CCGA 1JTHB 3M0DC 3TSIA 1N7SC 5CCHC 3HD7D 4WY4C 2YMYA 1T3JA 5CCGD 3HD7B 3B5ND 5KJ7A 3HD7A 3RL0D 3RK3C 1KILA 3RL0B 3RK3D 2PP6A 1SFCC 1SFCD 4OH8B 3RL0C 1N7SA 2WZ7A 1NHLA 1HVVA 3B5NC 1JTHA 3KYQA 4W7ZA
chains in the Genus database with same CATH superfamily
3P32A 1KN7A 2RH0A 1JCDA 4K3AA 1GK6A 2Q1KA 4C7NB 1N7SD 2HODA 1L0LD 5APYA 1FOSE 2KSJA 3V4QA 3CX5D 3H6PA 1Q7YQ 2R3CA 2Y0EA 1OW7A 2FXOA 3A0HH 1RQUA 2KB7P 3E1IA 4O9BA 3LW5H 3SFEC 3ZDMA 2HODB 4B86A 2C9LY 1Q90D 3V2QA 2W6JH 3GW6A 1N7SB 2KI7B 4WY4D 1K73Q 2V4HA 2CK3H 3L71D 1GU5A 5CCHD 3AE7C 1NGMB 1GL2B 1FOSF 4U3FG 3OW2O 2P1JA 3MTUE 4I1LA 2WSCJ 1GTWA 5DJTB 4ASVA 1QVGO 2LXCB 1BGYD 2FYUG 1BGYE 1OFCX 1GL2C 4I7ZC 3TGUE 3H1LE 1AV1A 2YKPA 1S4XA 4N78E 1LTJB 2YO3A 4H13C 1URQB 5L8RJ 1USEA 2QM7A 3RBZA 2Q5UA 4NPFX 2K9JA 4H0LD 4LGDE 4D6TG 1JOCA 3NXSA 1X79B 2P10A 2WPVB 1L0LE 1LP1B 1VQ7P 1M90Q 4PV1B 1VQKP 2O01J 1IJDB 3N7NA 1RY3A 1HH0A 2E5YA 3Q5SA 3RL0g 3CCUP 1S5LX 1PP9E 3L35A 1RHZB 2ZYGA 4D6TE 1LTGC 1LTIC 3G71P 3CX5I 1FZCA 1RF1A 1SQQE 1JY3O 1S5LH 3V2RA 1FC2C 1DIPA 2FYNC 2IZ1A 2OARA 5APVA 3ITKA 5KKZB 1SFCA 1HWTC 1EQ7A 1KYOI 4U3FD 2FYUJ 3JSVC 3FXEA 1EXIA 2E76B 1VQLP 2BCCJ 1LGHB 3W67A 1EDKA 2QM8A 4WB4A 1KB9D 1VF5D 1DD4A 2ZT9C 1LWUA 2E75B 1KILB 3P8CE 3MUDC 3EFGA 1VQNP 3H1HG 4WWIA 1L4AC 1LJ2A 1YIJP 3NMDA 1IFDA 1DD3A 3R2PA 1KQSO 1HF9A 2MJZA 3AE2C 1KFMA 3L75E 2NPSD 5AVTB 1VPCA 1NOHA 1IK9A 2CPSA 1ZLLA 3TDKA 3WU2E 2OYIA 3TGUD 5E79E 3V2PA 1N73B 3KPEA 2E75C 3TGUG 4R4LA 3Q3DA 1Q2NA 1OW6A 2G8YA 1WT6A 5AW4B 2WSCH 2A06G 1A02J 2YMYA 3G3ZA 2ZVOB 3D70A 4M3LA 2P58A 1OVRA 1WRGA 3PHLA 3VTPC 1AVYA 3L4FA 1SQBJ 1G1IA 2Q3IA 3L70G 3NTNA 3BRVB 3CXHI 3RK3E 1FZCB 3AEEC 2E42A 2B89A 2YXRB 3B5ND 4YTPC 1PV3A 3L71G 3L36A 2WPQA 3RL0D 2FXMA 1S3JA 3CC2P 5AW5B 1PPJG 1GZLA 4IOIH 3B8EB 1VQPP 5KLVK 3BCCE 1KILA 4K35A 1KB9E 1EZVG 1NKZB 2Q6QA 3MGNA 3EQ2A 4N3YB 3V4WA 4GKGA 4EI2A 1OIPA 2YIUB 3RK3D 2PP6A 1JY2P 4JYCA 4H44C 1K04A 2LKMA 3G6EP 1DX7A 2OYHB 2P2UA 2KK7A 2W6AA 1L0NE 2HYNA 1NTMK 3H32A 4AYCA 1P84I 2FKWB 3GF7A 3CL3D 1MFZA 1BE3J 4GOFA 1T6AA 2I1KA 4HYTB 3TYYA 1YHQP 1Q81Q 1ZR2A 1RF1C 1AA0A 1LTBC 2WQYC 5AW3B 1NHLA 1HVVA 3CWBJ 2KSEA 1KC8Q 2HPCA 2K9YA 2PGDA 5KLVJ 1NU1K 1NU1E 4W7ZA 5C39A 1U57A 1PPJD 2WSEJ 3U59A 2ZXEB 3M9BA 1R8EA 4YPCA 2FFDC 3HD7C 2OGUA 5CBNA 1RF1B 4N6JA 5AW6B 1L4AA 2QEXP 1OMIA 1SQXG 2PAJA 3JCUE 2FXPA 4ZKPA 3U1AA 1RE4C 3H1KE 4OWFA 5KLVD 4RESB 1PP9G 5CJ0A 1FZGA 1GDTA 3HTKB 3OA7A 1SQBE 5H2FE 1KYOD 1XTGB 3GF3A 1E5WA 1SQVE 2HR3A 2KYVA 2N9BA 1YTZI 2XNDH 2OYIC 1BE3D 3H1IE 1YJ9P 2J59M 4OGQD 3AEBC 3RK3B 4L75A 1U7JA 3L74D 2A45I 2POHA 4WY4B 5B5EH 1Y9BA 3MHVA 1SVFA 3AE6C 3MIWA 2H43A 2BEQD 1G2CB 1SFCB 2QE7H 3H1LG 4L73A 4DT0A 2QJKC 4DZOA 4YXDC 1AJYA 3T97B 1JUNA 1BGYG 2FYUD 5KLIB 2KLVA 3A0HE 1FZBA 3C1LA 3L75J 3L74J 1KB9H 1L4AD 1KMIZ 1IFPA 2PFXA 3AE3C 4HH2A 2E76D 2WPRA 4I7ZB 4U7JA 2BEZF 5KAFE 3AE1C 4U3FE 2HPCB 1NTMG 2L5GB 1L0NG 3H1IJ 2WWWA 3LIEA 2ZT9D 1Z56A 1NTZK 1LNQA 1SLQA 2KZIA 2WITA 3HE5A 3LIDA 2WMMA 2M3BA 5B5EE 2HG5D 3FXDA 1PP9D 3BRTB 4JBZA 4TLFA 1XTCC 1NTKJ 1KILC 1NU1D 2FFDB 3PJSK 1GW3A 1KZUB 2FYUE 4WY4A 4IL6E 5AW2B 4KT0J 1PPJE 3L37A 5AW7B 3SWYA 4C7NA 1CSBA 3FWLA 2FBWC 1KILD 4IL6X 2FY8A 2N9YB 3TF5A 1PGOA 1NTKD 2K3RA 2QIWA 2OTKE 2VRSA 1LTJA 1KV4A 1NKNA 1R5LA 1QL1A 2IBZD 1QX8A 1TU3F 1JEKA 4H0LB 3RBXA 1VDFA 1JY2N 1OVUA 5EFWB 1GL2A 3L74G 2WSFH 1HBWA 1SQVD 3F89A 2KUBA 2E76C 1JY3N 3II6A 3P8MC 5AVWB 2L91A 1UIXA 2GUSA 1LWUB 2SPZA 1R5SA 2YIUC 4PJ0H 1GU4A 3CCEP 4ZKUA 2P67A 2FFDA 1RE3A 2IFMA 4RKUJ 1GL2D 3A3YB 3BCCD 4JPZB 3CXHE 2Y9ZA 2NPSA 2C9NY 1FE6A 2BCCD 1SQPG 1LTSC 1RE4A 3WUVA 2IBZE 1VQ8P 4Y28J 1JM0A 2XV5A 3BATA 2O3JA 2M5AB 3M0DC 3TSIA 1OW8A 2C0XA 4WVZA 1SP4A 1UIIA 2KNCA 1VQ5P 1FZCC 1ZRTD 4RO0A 1T3JA 1NTKE 2C0WA 5AW8B 3A5TA 5KAFH 2B87B 3B4SA 1T3UA 3VMXA 2YKQA 4DJGA 3CXHD 2CPBA 1FZEA 3JC22 3U1CA 5KJ7A 1SQVK 1SQBK 2XKMA 4GODA 1NYHA 1SS1A 5B66E 4Y99B 1KQGB 3RGUA 3L75D 2JJLA 1SQQG 4R4MA 1J2JB 1W2EA 1USDA 2KXPB 1KYOH 1NTKK 2E74B 2O01H 2ZXXA 4GT1A 1JY3P 2BASA 5TJHA 2AXTH 4HJGH 2KP8A 1RQVA 4IFFA 1S9KE 2ZVNB 3I5CA 1ZN5A 1PGJA 3TK1A 2H89C 1SFCD 2Z4EA 1YYCA 4LLHA 3VMYA 4ZMDA 1BE3G 3OJAB 4OH8B 1IO4A 3SWKA 1SQVJ 2FYNB 5E79H 2WZ7A 1L2PA 2RMZA 3H25A 4EIJA 1X0TA 4PJ0E 5KLVG 1YI2P 1SQBD 5CJ4A 3M06A 3EWKA 3KYQA 2BCCE 1FU1A 3AEDC 1L0NK 3CC4P 2WSFJ 1BCCG 3V2NA 1KD1Q 4H44B 1IC2A 2MKVA 1NAYA 2R5DA 1OX3A 2Q3EA 2H7HA 4EOTA 1SQQJ 2JWDA 1ZRTE 2KS1A 4I2LC 1NU1J 4D6TJ 3QWOC 2WSEH 1PP9J 1FDOA 5CCGC 3FGAD 4IFDK 1KORA 2KS1B 3AE4C 3CWBD 1GD2E 4Y99C 5KKZC 5CCHA 1ZMEC 4PD4D 2NPSC 1BE3E 3H1ID 1PZQA 3TNUB 1EDJA 1VF5B 2E75D 1P84E 2YO2A 3M9HA 3D71A 3GMAA 2N1TA 2KZJA 5H2FH 2YKOA 1NTZE 2R32A 3AEGC 3E1RA 1M56D 1SQQK 3AE9C 1K05A 1VF5C 2JO1A 1J1DC 1JMBA 3BCCJ 1BGYJ 3C8VA 3RK2D 4LC1A 3EFFK 1PFIA 2NPSB 1LP1A 1JO5A 4XFJA 3R4YA 3O6QB 5AW9B 3VMAA 1VQOP 5KAIE 3T97A 5KJ7C 1BDDA 2JP3A 2QJKB 3Q5RA 2GUVA 1NU1G 1L0LK 1URQA 1ZW0A 3H1HJ 2ZYDA 1LT9A 1S5LE 2M8RA 2N1TD 3AECC 2A45H 4DOJA 1MUUA 1YJWP 1JY2O 1AQ5A 1PGQA 1MKMA 1N7LA 2A06D 2GA1A 4GOEA 4U3FJ 5KLIC 3CC7P 4AUWA 3UIAA 5APSA 1T2KD 2WSSH 2IYOA 1MZ9A 1IFMA 3L74E 3M91A 4H0LC 2JDIH 2IBZG 1HUCA 1NTZD 2Q7CA 3VOPA 1YJNP 3IF4A 2AEJA 2OTLP 3VP9A 3BASA 1M1JA 1L4AB 2V7QH 3GLMA 2IBZI 1T8ZA 1RF0A 3O6QA 4BWNA 3GHGB 2M0BA 1S9KD 1E79H 1D7MA 2B87A 2FYUK 5GTIE 1EC5A 4BRYB 1H0TA 3HE5B 2Y0CA 2W83C 1FBMA 3PP5A 3L71E 2WTYA 4H13D 2QSIA 4OGQC 3W68A 1X9VA 5BU8B 1JMMA 1JB0J 1WMKA 3O8ZA 1G2CA 4BRYA 2YMKA 3A0BH 3PRJA 3CCMP 3CCLP 2ZYAA 2D2CB 2QJYB 2QG4A 1PGPA 1QGKB 3H1KJ 1KTMA 1P84H 2FYZA 3M9QA 2WT7B 2H8PD 1NTME 1N8RQ 2ZT9B 3D6YA 5CCGA 1YQ4C 1NWQA 2JKVA 3VP8A 1NO4A 1N7SC 1J1EC 2XU6A 3KQGA 3M0AA 1N2DC 2R44A 3V6IA 1FZAA 3HD7D 5CCHC 1KFNA 3HRNA 4WY4C 2BCCG 1VQ4P 1LTTC 5APXA 3HTKA 5KLVE 3AEFC 1S1CX 3CWBE 4IL6H 2K88A 3L72D 1HGZA 2KIKA 1GMJA 1LTJC 3A0BE 4H13B 1HTLC 4PD4E 1L0LJ 3CXHH 3L73G 1L0NJ 3H1IG 2QJPB 2P7JA 3CMAP 1BDCA 3PLNA 3I55P 1CI6A 3A7OA 5GTHE 4JYBA 1NH4A 1MFTA 4H44D 4PV1C 5GTIH 3IFMA 3RK3C 3TGUJ 1SQXE 1K8AQ 2J58A 1VL2A 1RE3C 3NFQA 3PTZA 4ZNCA 1Y8AA 5KAIH 1NVOA 5M1BA 2K9JB 1M1JB 2PRRA 5BU5A 4N78D 2B88A 1PIXA 2D2CD 3KZIH 3CCQP 1J1DB 2E43A 2D2CC 2QJYC 5APQA 4DCKA 1M57D 2KLUA 3M0DA 1FDIA 2AXTE 1KQFB 1SQBG 3RL0C 4BXLA 1VQ9P 3AE5C 3FX0A 1H0TB 1M8OB 4GIFA 5AVRB 1H89A 3B5NC 1YITP 2I1JA 1EXJA 2WPSA 1DEBA 1NTMD 1FJKA 1HJ0A 1JTHA 1IFIA 2AEFA 1L0LG 1SQPD 2ZFCA 2R5BA 2O01N 2W6BA 3L73J 3I56P 2O1JA 3GHGC 1VQMP 1RF0C 1NAFA 3S4RA 3VN0A 1ZP0C 1PL5A 2OYHC 2AXCA 2E74D 3IN6A 4ASWA 1HJBA 2A45G 2K1AA 1S2EA 1JNMA 1H8AA 2W8ZA 3RK2B 1EZVD 3WUUA 3KZIE 1T2KC 3HUSC 2O1KA 1OZHA 1YTZT 1YBKA 1IK7A 3B71A 3H1JE 3MP7B 5DJUB 3MZWB 5TISE 2QJPC 3H1KD 2LR2A 3A2AA 5B66H 2IZ0A 3HE4A 5AVSB 1LT9B 3H1JG 5KTBA 3CCJP 1H88A 1AFOA 2HFED 1OVVA 1SQXK 1CZQA 2N1TB 1EDIA 2RN0A 1NTKG 2W27A 2ITAA 2JWAA 3KXDA 3LW5J 4KJMA 3S9OA 4UB6E 5CBOA 1Q82Q 1A02F 1FS0E 3S1KA 3Q2YA 4C7RA 2H88C 3TNUA 1QL2A 5APTA 1X8YA 1LWUC 1URQD 2K37A 4TT3H 4Z1MH 3Q1MA 1ZR4A 1BCCD 4HB1A 1CW5A 1M7LA 1SQPE 3USSA 4W7YA 3H32B 1KQLA 1U7MA 1LT1A 2HLOA 5AVYB 3G4SP 3CCVP 2OYIB 2KOGA 3P7KA 3MD0A 1N73C 3L71J 1FDMA 4EDFA 4A7PA 4L76A 1OWAA 2RKLA 2Z5IA 3H1JD 3L70D 3BVHA 2IYPA 1GW4A 2ZJSE 4UB6H 2NZ2A 1HGVA 3CCSP 3H1JJ 2DW3A 3PH0A 5AVVB 2QRXA 1EZVI 1SQPK 2JR8A 1X22A 3IAOA 1LTAC 1NTZG 2GM4A 2M3EA 3AE8C 1DH3A 1M1KQ 2IX7C 1P84D 2Q9IA 3CI9A 3E7KA 5TISH 5AVQB 5CMZA 1ZXGA 2M5AA 2WVRA 2XDJA 3K5BA 3H1LJ 1KILE 3B5NB 3L73E 5AW1B 4EYYQ 5BVZA 3HE4B 1S72P 1YQ3C 1FJPA 1BCCJ 3Q5PA 1KB9I 1BSNA 2N1TC 3L75G 4UB8H 2AEMA 3IR9A 4OGQB 4YXWH 2XNXA 2NRGA 1Y47A 3B5NA 3CWBG 4I6MC 4GDOA 2QVAA 4JF7A 5KJ7D 1GK4A 3AEAC 3H1HE 4W80A 4AQRD 1RH5B 2J5UA 3GHGA 2IPPA 5AVXB 2OYHA 1OXZA 3HUSB 3N4XA 4IFMA 4NPEA 1Q86Q 3RK2C 3CLQA 3H1KG 1QEXA 3KDPB 2Y0DA 4MN4C 1URQC 5APWA 4QMAA 1BCCE 3HUSA 1SQXJ 3VMZA 1LT9C 2XZRA 2ZAEB 1FZFA 2QA4P 2KNCB 4L74A 1NTZJ 3CPWO 1JTHB 2W90A 2WT7A 3CMEP 4UB8E 1W5CE 3WUTA 4CPGA 4PD4I 3SSUA 1AQTA 4WBAA 5CHXA 4C46A 4NPDA 3L73D 5K5GB 3WMM0 3CX5E 5CCGD 3HD7B 1SQVG 2OQQA 3L72J 2Y9YA 3ABVC 3L70J 5APUA 1VQ6P 1M1JC 1KYOE 3H1HD 2E5TA 1W2BO 3HD7A 1CI6B 3FWNA 1ZOYC 2E74C 1MV8A 2YXQB 2OYOA 4KHXA 3D6ZA 2V7QJ 3GG2A 4JQ0D 1EDLA 3SWFA 1EZVE 1G1JA 1N73A 1QLED 1SQPJ 4PD4H 5AW0B 5AVUB 1NTMJ 1SQXD 3VYIA 5AVZB 3RL0B 1AVOA 3G9RA 4PV1D 1QVFO 3CX5H 1IFNA 1NJIQ 1IZNB 3OAKA 3JCUH 1SFCC 2G3AA 1N86A 3KHUA 3P8CD 2R3SA 2UWJE 1L0ND 1JCCA 1ZV8A 3QH9A 1N7SA 1K9MQ 3F5HA 3L70E 3CCRP 2OTJP 2Z5HA 3L72G 3L72E 2B9BA 4HKZH 4OVNF 4XE5B 1J1EB 2JEEA 1FAVA 3V5BA 2I8DA 3MUDA 2A06E 4XA4A 5GTHH 4D6TD 1BSHA 3H1LD 2YNYA 3SFDC 3BCCG 2IFNA 1SQQD 2IDBA 1DEEG 1IFJA 3WU2H 3CD6P 4RJTA 3C9IA 2LXBA
chains in the Genus database with same CATH topology
3P32A 1JCDA 1GK6A 4C7NB 1N7SD 2HODA 5APYA 2KSJA 3V4QA 3H6PA 2R3CA 3V2QA 4O9BA 3E1IA 4B86A 2KB7P 1HJBA 2C9LY 3LW5H 2HODB 4WY4D 1N7SB 1GU5A 5CCHD 1GL2B 1FOSF 2P1JA 3MTUE 4I1LA 1GTWA 1GL2C 2YKPA 4N78E 1LTJB 2YO3A 1URQB 2QM7A 2Q5UA 4LGDE 1JOCA 3NXSA 1X79B 1IJDB 3N7NA 1RY3A 1HH0A 3L35A 1LTGC 1LTIC 1FZCA 1RF1A 1JY3O 3V2RA 2OARA 5APVA 1HWTC 1SFCA 1EQ7A 1LGHB 2QM8A 4WB4A 1LWUA 1KILB 3P8CE 3EFGA 1L4AC 3NMDA 1IFDA 3R2PA 2MJZA 1KFMA 2NPSD 5AVTB 1VPCA 1NOHA 1IK9A 2CPSA 1ZLLA 2OYIA 3V2PA 1N73B 3KPEA 5AW4B 1WT6A 2WSCH 1A02J 2YMYA 3G3ZA 4M3LA 1WRGA 3VTPC 3L4FA 1G1IA 2Q3IA 3NTNA 3BRVB 1FZCB 2E42A 3B5ND 3L36A 2WPQA 3RL0D 2FXMA 5AW5B 1GZLA 3B8EB 5KLVK 1KILA 1NKZB 3MGNA 4N3YB 3EQ2A 3V4WA 4GKGA 3RK3D 2PP6A 1JY2P 4JYCA 2LKMA 1DX7A 2OYHB 2P2UA 2W6AA 2HYNA 1NTMK 3H32A 4AYCA 2FKWB 3CL3D 1MFZA 3TYYA 4HYTB 1RF1C 2I1KA 1ZR2A 1LTBC 5AW3B 2HPCA 1NHLA 1HVVA 1NU1K 4W7ZA 3U59A 2ZXEB 3M9BA 2FFDC 3HD7C 1RF1B 4N6JA 5AW6B 1L4AA 2PAJA 4ZKPA 3U1AA 1RE4C 4RESB 5CJ0A 1GDTA 1FZGA 3HTKB 3OA7A 3VMZA 1XTGB 1E5WA 2OYIC 2KYVA 2N9BA 1YTZI 2J59M 3RK3B 2A45I 2POHA 4WY4B 1SVFA 3MIWA 2H43A 1G2CB 1SFCB 1HBWA 4DZOA 1JUNA 2KLVA 1FZBA 1L4AD 4HH2A 2WPRA 2HPCB 2L5GB 3LIEA 1T2KC 2WWWA 3LIDA 1Z56A 1NTZK 1SLQA 2WITA 3HE5A 4AUWA 2M3BA 2HG5D 3BRTB 2FFDB 1XTCC 1KILC 1GW3A 1KZUB 4WY4A 5AW7B 5AW2B 4C7NA 1FOSE 3L37A 3SWYA 1CSBA 1KILD 2VRSA 1LTJA 1NKNA 1QL1A 1VDFA 1JY2N 1GL2A 2WSFH 1JY3N 3II6A 3P8MC 5AVWB 1GU4A 2GUSA 1LWUB 4ZKUA 2P67A 2FFDA 1RE3A 2IFMA 1GL2D 3A3YB 2NPSA 1LTSC 1RE4A 2XV5A 3BATA 3M0DC 3TSIA 2C0XA 1SP4A 1FZCC 1T3JA 2C0WA 5AW8B 1T3UA 3VMXA 2YKQA 2CPBA 1FZEA 3U1CA 5KJ7A 1SQVK 1SQBK 2XKMA 4Y99B 2JJLA 1J2JB 1W2EA 1NTKK 4GT1A 2O01H 1JY3P 2BASA 2KP8A 4IFFA 1S9KE 3I5CA 1ZN5A 3TK1A 1SFCD 2Z4EA 1YYCA 4LLHA 3VMYA 1IO4A 3OJAB 4OH8B 2WZ7A 4EIJA 5CJ4A 3M06A 3KYQA 1FU1A 1L0NK 3V2NA 1IC2A 2R5DA 2H7HA 4EOTA 4I2LC 2WSEH 5CCGC 4IFDK 1GD2E 4Y99C 5CCHA 2NPSC 3TNUB 3M9HA 2YO2A 2N1TA 2YKOA 2R32A 1SQQK 1J1DC 3RK2D 4LC1A 1PFIA 2NPSB 1JO5A 5AW9B 3T97A 5KJ7C 2GUVA 1L0LK 1URQA 1LT9A 2N1TD 2M8RA 4DOJA 2A45H 1MUUA 1JY2O 1AQ5A 1N7LA 3UIAA 5APSA 1T2KD 1MZ9A 1IFMA 3M91A 3VOPA 2Q7CA 1HUCA 3VP9A 3BASA 1M1JA 1L4AB 1T8ZA 1RF0A 3GHGB 1S9KD 2FYUK 3HE5B 1FBMA 3PP5A 2WTYA 5BU8B 1X9VA 1JMMA 3O8ZA 1G2CA 3M9QA 2FYZA 2H8PD 5CCGA 1NWQA 3VP8A 1NO4A 1N7SC 1J1EC 2XU6A 3KQGA 3M0AA 1N2DC 5CCHC 1FZAA 3HD7D 1KFNA 3HRNA 4WY4C 1LTTC 5APXA 3HTKA 1HGZA 1LTJC 1HTLC 2P7JA 1CI6A 3A7OA 4JYBA 1NH4A 3IFMA 3RK3C 2J58A 1RE3C 3NFQA 1M1JB 5BU5A 4N78D 1J1DB 2E43A 5APQA 3RL0C 3M0DA 4GIFA 5AVRB 1H89A 3B5NC 2I1JA 2WPSA 1DEBA 3A5TA 1FJKA 1JTHA 2ZFCA 1IFIA 2WT7B 2R5BA 2W6BA 2O1JA 3GHGC 1RF0C 1NAFA 3VN0A 2OYHC 2A45G 1JNMA 1H8AA 3RK2B 3HUSC 2O1KA 1YTZT 3A2AA 5AVSB 3HE4A 1LT9B 5KTBA 1H88A 1AFOA 2HFED 1SQXK 1CZQA 2N1TB 2W27A 1A02F 4C7RA 3TNUA 1QL2A 5APTA 1LWUC 1URQD 1X8YA 1ZR4A 1CW5A 1M7LA 4W7YA 3H32B 1KQLA 2HLOA 2OYIB 5AVYB 2KOGA 3P7KA 3MD0A 1N73C 1FDMA 1OWAA 2Z5IA 3BVHA 1GW4A 1HGVA 5AVVB 1SQPK 1LTAC 2GM4A 1DH3A 2IX7C 2Q9IA 3CI9A 5AVQB 5CMZA 2XDJA 5BVZA 5AW1B 3B5NB 1FJPA 3HE4B 2N1TC 2C9NY 3IR9A 2XNXA 3B5NA 4I6MC 4JF7A 5KJ7D 1GK4A 4W80A 4AQRD 3GHGA 2IPPA 5AVXB 2OYHA 1OXZA 3HUSB 3N4XA 4IFMA 3RK2C 3CLQA 3KDPB 5APWA 1URQC 3HUSA 1LT9C 2XZRA 1FZFA 1JTHB 2WT7A 4WBAA 5CHXA 4C46A 3WMM0 5CCGD 3HD7B 5APUA 1M1JC 3HD7A 1CI6B 1MV8A 4KHXA 3SWFA 1G1JA 1N73A 5AW0B 5AVUB 3VYIA 5AVZB 3RL0B 1IFNA 3OAKA 1SFCC 1N86A 3P8CD 1JCCA 1ZV8A 1N7SA 2Z5HA 4XE5B 1J1EB 2JEEA 1FAVA 3V5BA 3MUDA 4XA4A 2YNYA 2IFNA 1IFJA 3C9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HD7 C;  3RK2 B;  1N7S D;  1L4A A;  5CCG C;  3HTK B;  5CCH A;  1XTG B;  2NPS C;  4WY4 D;  1N7S B;  2HFE D;  2N1T B;  5CCH D;  1GL2 B;  3RK3 B;  4WY4 B;  2N1T A;  1URQ D;  1GL2 C;  1SFC B;  3RK2 D;  4W7Y A;  4N78 E;  2NPS B;  1URQ B;  1L4A D;  2KOG A;  4LGD E;  5KJ7 C;  1URQ A;  2N1T D;  2M8R A;  2HG5 D;  1KIL C;  4WY4 A;  1KIL D;  1SFC A;  2XDJ A;  3VOP A;  3B5N B;  1L4A B;  2N1T C;  3B5N A;  1GL2 A;  1KIL B;  4JF7 A;  3P8C E;  5KJ7 D;  4W80 A;  3PP5 A;  1L4A C;  3RK2 C;  2NPS D;  1GL2 D;  1URQ C;  2NPS A;  2H8P D;  5CCG A;  1JTH B;  3M0D C;  3TSI A;  1N7S C;  5CCH C;  3HD7 D;  4WY4 C;  2YMY A;  1T3J A;  5CCG D;  3HD7 B;  3B5N D;  5KJ7 A;  3HD7 A;  3RL0 D;  3RK3 C;  1KIL A;  3RL0 B;  3RK3 D;  2PP6 A;  1SFC C;  1SFC D;  4OH8 B;  3RL0 C;  1N7S A;  2WZ7 A;  1NHL A;  1HVV A;  3B5N C;  1JTH A;  3KYQ A;  4W7Z A; 
#chains in the Genus database with same CATH topology
 3P32 A;  1KN7 A;  2RH0 A;  1JCD A;  4K3A A;  1GK6 A;  2Q1K A;  4C7N B;  1N7S D;  2HOD A;  1L0L D;  5APY A;  1FOS E;  2KSJ A;  3V4Q A;  3CX5 D;  3H6P A;  1Q7Y Q;  2R3C A;  2Y0E A;  1OW7 A;  2FXO A;  3A0H H;  1RQU A;  2KB7 P;  3E1I A;  4O9B A;  3LW5 H;  3SFE C;  3ZDM A;  2HOD B;  4B86 A;  2C9L Y;  1Q90 D;  3V2Q A;  2W6J H;  3GW6 A;  1N7S B;  2KI7 B;  4WY4 D;  1K73 Q;  2V4H A;  2CK3 H;  3L71 D;  1GU5 A;  5CCH D;  3AE7 C;  1NGM B;  1GL2 B;  1FOS F;  4U3F G;  3OW2 O;  2P1J A;  3MTU E;  4I1L A;  2WSC J;  1GTW A;  5DJT B;  4ASV A;  1QVG O;  2LXC B;  1BGY D;  2FYU G;  1BGY E;  1OFC X;  1GL2 C;  4I7Z C;  3TGU E;  3H1L E;  1AV1 A;  2YKP A;  1S4X A;  4N78 E;  1LTJ B;  2YO3 A;  4H13 C;  1URQ B;  5L8R J;  1USE A;  2QM7 A;  3RBZ A;  2Q5U A;  4NPF X;  2K9J A;  4H0L D;  4LGD E;  4D6T G;  1JOC A;  3NXS A;  1X79 B;  2P10 A;  2WPV B;  1L0L E;  1LP1 B;  1VQ7 P;  1M90 Q;  4PV1 B;  1VQK P;  2O01 J;  1IJD B;  3N7N A;  1RY3 A;  1HH0 A;  2E5Y A;  3Q5S A;  3RL0 g;  3CCU P;  1S5L X;  1PP9 E;  3L35 A;  1RHZ B;  2ZYG A;  4D6T E;  1LTG C;  1LTI C;  3G71 P;  3CX5 I;  1FZC A;  1RF1 A;  1SQQ E;  1JY3 O;  1S5L H;  3V2R A;  1FC2 C;  1DIP A;  2FYN C;  2IZ1 A;  2OAR A;  5APV A;  3ITK A;  5KKZ B;  1SFC A;  1HWT C;  1EQ7 A;  1KYO I;  4U3F D;  2FYU J;  3JSV C;  3FXE A;  1EXI A;  2E76 B;  1VQL P;  2BCC J;  1LGH B;  3W67 A;  1EDK A;  2QM8 A;  4WB4 A;  1KB9 D;  1VF5 D;  1DD4 A;  2ZT9 C;  1LWU A;  2E75 B;  1KIL B;  3P8C E;  3MUD C;  3EFG A;  1VQN P;  3H1H G;  4WWI A;  1L4A C;  1LJ2 A;  1YIJ P;  3NMD A;  1IFD A;  1DD3 A;  3R2P A;  1KQS O;  1HF9 A;  2MJZ A;  3AE2 C;  1KFM A;  3L75 E;  2NPS D;  5AVT B;  1VPC A;  1NOH A;  1IK9 A;  2CPS A;  1ZLL A;  3TDK A;  3WU2 E;  2OYI A;  3TGU D;  5E79 E;  3V2P A;  1N73 B;  3KPE A;  2E75 C;  3TGU G;  4R4L A;  3Q3D A;  1Q2N A;  1OW6 A;  2G8Y A;  1WT6 A;  5AW4 B;  2WSC H;  2A06 G;  1A02 J;  2YMY A;  3G3Z A;  2ZVO B;  3D70 A;  4M3L A;  2P58 A;  1OVR A;  1WRG A;  3PHL A;  3VTP C;  1AVY A;  3L4F A;  1SQB J;  1G1I A;  2Q3I A;  3L70 G;  3NTN A;  3BRV B;  3CXH I;  3RK3 E;  1FZC B;  3AEE C;  2E42 A;  2B89 A;  2YXR B;  3B5N D;  4YTP C;  1PV3 A;  3L71 G;  3L36 A;  2WPQ A;  3RL0 D;  2FXM A;  1S3J A;  3CC2 P;  5AW5 B;  1PPJ G;  1GZL A;  4IOI H;  3B8E B;  1VQP P;  5KLV K;  3BCC E;  1KIL A;  4K35 A;  1KB9 E;  1EZV G;  1NKZ B;  2Q6Q A;  3MGN A;  3EQ2 A;  4N3Y B;  3V4W A;  4GKG A;  4EI2 A;  1OIP A;  2YIU B;  3RK3 D;  2PP6 A;  1JY2 P;  4JYC A;  4H44 C;  1K04 A;  2LKM A;  3G6E P;  1DX7 A;  2OYH B;  2P2U A;  2KK7 A;  2W6A A;  1L0N E;  2HYN A;  1NTM K;  3H32 A;  4AYC A;  1P84 I;  2FKW B;  3GF7 A;  3CL3 D;  1MFZ A;  1BE3 J;  4GOF A;  1T6A A;  2I1K A;  4HYT B;  3TYY A;  1YHQ P;  1Q81 Q;  1ZR2 A;  1RF1 C;  1AA0 A;  1LTB C;  2WQY C;  5AW3 B;  1NHL A;  1HVV A;  3CWB J;  2KSE A;  1KC8 Q;  2HPC A;  2K9Y A;  2PGD A;  5KLV J;  1NU1 K;  1NU1 E;  4W7Z A;  5C39 A;  1U57 A;  1PPJ D;  2WSE J;  3U59 A;  2ZXE B;  3M9B A;  1R8E A;  4YPC A;  2FFD C;  3HD7 C;  2OGU A;  5CBN A;  1RF1 B;  4N6J A;  5AW6 B;  1L4A A;  2QEX P;  1OMI A;  1SQX G;  2PAJ A;  3JCU E;  2FXP A;  4ZKP A;  3U1A A;  1RE4 C;  3H1K E;  4OWF A;  5KLV D;  4RES B;  1PP9 G;  5CJ0 A;  1FZG A;  1GDT A;  3HTK B;  3OA7 A;  1SQB E;  5H2F E;  1KYO D;  1XTG B;  3GF3 A;  1E5W A;  1SQV E;  2HR3 A;  2KYV A;  2N9B A;  1YTZ I;  2XND H;  2OYI C;  1BE3 D;  3H1I E;  1YJ9 P;  2J59 M;  4OGQ D;  3AEB C;  3RK3 B;  4L75 A;  1U7J A;  3L74 D;  2A45 I;  2POH A;  4WY4 B;  5B5E H;  1Y9B A;  3MHV A;  1SVF A;  3AE6 C;  3MIW A;  2H43 A;  2BEQ D;  1G2C B;  1SFC B;  2QE7 H;  3H1L G;  4L73 A;  4DT0 A;  2QJK C;  4DZO A;  4YXD C;  1AJY A;  3T97 B;  1JUN A;  1BGY G;  2FYU D;  5KLI B;  2KLV A;  3A0H E;  1FZB A;  3C1L A;  3L75 J;  3L74 J;  1KB9 H;  1L4A D;  1KMI Z;  1IFP A;  2PFX A;  3AE3 C;  4HH2 A;  2E76 D;  2WPR A;  4I7Z B;  4U7J A;  2BEZ F;  5KAF E;  3AE1 C;  4U3F E;  2HPC B;  1NTM G;  2L5G B;  1L0N G;  3H1I J;  2WWW A;  3LIE A;  2ZT9 D;  1Z56 A;  1NTZ K;  1LNQ A;  1SLQ A;  2KZI A;  2WIT A;  3HE5 A;  3LID A;  2WMM A;  2M3B A;  5B5E E;  2HG5 D;  3FXD A;  1PP9 D;  3BRT B;  4JBZ A;  4TLF A;  1XTC C;  1NTK J;  1KIL C;  1NU1 D;  2FFD B;  3PJS K;  1GW3 A;  1KZU B;  2FYU E;  4WY4 A;  4IL6 E;  5AW2 B;  4KT0 J;  1PPJ E;  3L37 A;  5AW7 B;  3SWY A;  4C7N A;  1CSB A;  3FWL A;  2FBW C;  1KIL D;  4IL6 X;  2FY8 A;  2N9Y B;  3TF5 A;  1PGO A;  1NTK D;  2K3R A;  2QIW A;  2OTK E;  2VRS A;  1LTJ A;  1KV4 A;  1NKN A;  1R5L A;  1QL1 A;  2IBZ D;  1QX8 A;  1TU3 F;  1JEK A;  4H0L B;  3RBX A;  1VDF A;  1JY2 N;  1OVU A;  5EFW B;  1GL2 A;  3L74 G;  2WSF H;  1HBW A;  1SQV D;  3F89 A;  2KUB A;  2E76 C;  1JY3 N;  3II6 A;  3P8M C;  5AVW B;  2L91 A;  1UIX A;  2GUS A;  1LWU B;  2SPZ A;  1R5S A;  2YIU C;  4PJ0 H;  1GU4 A;  3CCE P;  4ZKU A;  2P67 A;  2FFD A;  1RE3 A;  2IFM A;  4RKU J;  1GL2 D;  3A3Y B;  3BCC D;  4JPZ B;  3CXH E;  2Y9Z A;  2NPS A;  2C9N Y;  1FE6 A;  2BCC D;  1SQP G;  1LTS C;  1RE4 A;  3WUV A;  2IBZ E;  1VQ8 P;  4Y28 J;  1JM0 A;  2XV5 A;  3BAT A;  2O3J A;  2M5A B;  3M0D C;  3TSI A;  1OW8 A;  2C0X A;  4WVZ A;  1SP4 A;  1UII A;  2KNC A;  1VQ5 P;  1FZC C;  1ZRT D;  4RO0 A;  1T3J A;  1NTK E;  2C0W A;  5AW8 B;  3A5T A;  5KAF H;  2B87 B;  3B4S A;  1T3U A;  3VMX A;  2YKQ A;  4DJG A;  3CXH D;  2CPB A;  1FZE A;  3JC2 2;  3U1C A;  5KJ7 A;  1SQV K;  1SQB K;  2XKM A;  4GOD A;  1NYH A;  1SS1 A;  5B66 E;  4Y99 B;  1KQG B;  3RGU A;  3L75 D;  2JJL A;  1SQQ G;  4R4M A;  1J2J B;  1W2E A;  1USD A;  2KXP B;  1KYO H;  1NTK K;  2E74 B;  2O01 H;  2ZXX A;  4GT1 A;  1JY3 P;  2BAS A;  5TJH A;  2AXT H;  4HJG H;  2KP8 A;  1RQV A;  4IFF A;  1S9K E;  2ZVN B;  3I5C A;  1ZN5 A;  1PGJ A;  3TK1 A;  2H89 C;  1SFC D;  2Z4E A;  1YYC A;  4LLH A;  3VMY A;  4ZMD A;  1BE3 G;  3OJA B;  4OH8 B;  1IO4 A;  3SWK A;  1SQV J;  2FYN B;  5E79 H;  2WZ7 A;  1L2P A;  2RMZ A;  3H25 A;  4EIJ A;  1X0T A;  4PJ0 E;  5KLV G;  1YI2 P;  1SQB D;  5CJ4 A;  3M06 A;  3EWK A;  3KYQ A;  2BCC E;  1FU1 A;  3AED C;  1L0N K;  3CC4 P;  2WSF J;  1BCC G;  3V2N A;  1KD1 Q;  4H44 B;  1IC2 A;  2MKV A;  1NAY A;  2R5D A;  1OX3 A;  2Q3E A;  2H7H A;  4EOT A;  1SQQ J;  2JWD A;  1ZRT E;  2KS1 A;  4I2L C;  1NU1 J;  4D6T J;  3QWO C;  2WSE H;  1PP9 J;  1FDO A;  5CCG C;  3FGA D;  4IFD K;  1KOR A;  2KS1 B;  3AE4 C;  3CWB D;  1GD2 E;  4Y99 C;  5KKZ C;  5CCH A;  1ZME C;  4PD4 D;  2NPS C;  1BE3 E;  3H1I D;  1PZQ A;  3TNU B;  1EDJ A;  1VF5 B;  2E75 D;  1P84 E;  2YO2 A;  3M9H A;  3D71 A;  3GMA A;  2N1T A;  2KZJ A;  5H2F H;  2YKO A;  1NTZ E;  2R32 A;  3AEG C;  3E1R A;  1M56 D;  1SQQ K;  3AE9 C;  1K05 A;  1VF5 C;  2JO1 A;  1J1D C;  1JMB A;  3BCC J;  1BGY J;  3C8V A;  3RK2 D;  4LC1 A;  3EFF K;  1PFI A;  2NPS B;  1LP1 A;  1JO5 A;  4XFJ A;  3R4Y A;  3O6Q B;  5AW9 B;  3VMA A;  1VQO P;  5KAI E;  3T97 A;  5KJ7 C;  1BDD A;  2JP3 A;  2QJK B;  3Q5R A;  2GUV A;  1NU1 G;  1L0L K;  1URQ A;  1ZW0 A;  3H1H J;  2ZYD A;  1LT9 A;  1S5L E;  2M8R A;  2N1T D;  3AEC C;  2A45 H;  4DOJ A;  1MUU A;  1YJW P;  1JY2 O;  1AQ5 A;  1PGQ A;  1MKM A;  1N7L A;  2A06 D;  2GA1 A;  4GOE A;  4U3F J;  5KLI C;  3CC7 P;  4AUW A;  3UIA A;  5APS A;  1T2K D;  2WSS H;  2IYO A;  1MZ9 A;  1IFM A;  3L74 E;  3M91 A;  4H0L C;  2JDI H;  2IBZ G;  1HUC A;  1NTZ D;  2Q7C A;  3VOP A;  1YJN P;  3IF4 A;  2AEJ A;  2OTL P;  3VP9 A;  3BAS A;  1M1J A;  1L4A B;  2V7Q H;  3GLM A;  2IBZ I;  1T8Z A;  1RF0 A;  3O6Q A;  4BWN A;  3GHG B;  2M0B A;  1S9K D;  1E79 H;  1D7M A;  2B87 A;  2FYU K;  5GTI E;  1EC5 A;  4BRY B;  1H0T A;  3HE5 B;  2Y0C A;  2W83 C;  1FBM A;  3PP5 A;  3L71 E;  2WTY A;  4H13 D;  2QSI A;  4OGQ C;  3W68 A;  1X9V A;  5BU8 B;  1JMM A;  1JB0 J;  1WMK A;  3O8Z A;  1G2C A;  4BRY A;  2YMK A;  3A0B H;  3PRJ A;  3CCM P;  3CCL P;  2ZYA A;  2D2C B;  2QJY B;  2QG4 A;  1PGP A;  1QGK B;  3H1K J;  1KTM A;  1P84 H;  2FYZ A;  3M9Q A;  2WT7 B;  2H8P D;  1NTM E;  1N8R Q;  2ZT9 B;  3D6Y A;  5CCG A;  1YQ4 C;  1NWQ A;  2JKV A;  3VP8 A;  1NO4 A;  1N7S C;  1J1E C;  2XU6 A;  3KQG A;  3M0A A;  1N2D C;  2R44 A;  3V6I A;  1FZA A;  3HD7 D;  5CCH C;  1KFN A;  3HRN A;  4WY4 C;  2BCC G;  1VQ4 P;  1LTT C;  5APX A;  3HTK A;  5KLV E;  3AEF C;  1S1C X;  3CWB E;  4IL6 H;  2K88 A;  3L72 D;  1HGZ A;  2KIK A;  1GMJ A;  1LTJ C;  3A0B E;  4H13 B;  1HTL C;  4PD4 E;  1L0L J;  3CXH H;  3L73 G;  1L0N J;  3H1I G;  2QJP B;  2P7J A;  3CMA P;  1BDC A;  3PLN A;  3I55 P;  1CI6 A;  3A7O A;  5GTH E;  4JYB A;  1NH4 A;  1MFT A;  4H44 D;  4PV1 C;  5GTI H;  3IFM A;  3RK3 C;  3TGU J;  1SQX E;  1K8A Q;  2J58 A;  1VL2 A;  1RE3 C;  3NFQ A;  3PTZ A;  4ZNC A;  1Y8A A;  5KAI H;  1NVO A;  5M1B A;  2K9J B;  1M1J B;  2PRR A;  5BU5 A;  4N78 D;  2B88 A;  1PIX A;  2D2C D;  3KZI H;  3CCQ P;  1J1D B;  2E43 A;  2D2C C;  2QJY C;  5APQ A;  4DCK A;  1M57 D;  2KLU A;  3M0D A;  1FDI A;  2AXT E;  1KQF B;  1SQB G;  3RL0 C;  4BXL A;  1VQ9 P;  3AE5 C;  3FX0 A;  1H0T B;  1M8O B;  4GIF A;  5AVR B;  1H89 A;  3B5N C;  1YIT P;  2I1J A;  1EXJ A;  2WPS A;  1DEB A;  1NTM D;  1FJK A;  1HJ0 A;  1JTH A;  1IFI A;  2AEF A;  1L0L G;  1SQP D;  2ZFC A;  2R5B A;  2O01 N;  2W6B A;  3L73 J;  3I56 P;  2O1J A;  3GHG C;  1VQM P;  1RF0 C;  1NAF A;  3S4R A;  3VN0 A;  1ZP0 C;  1PL5 A;  2OYH C;  2AXC A;  2E74 D;  3IN6 A;  4ASW A;  1HJB A;  2A45 G;  2K1A A;  1S2E A;  1JNM A;  1H8A A;  2W8Z A;  3RK2 B;  1EZV D;  3WUU A;  3KZI E;  1T2K C;  3HUS C;  2O1K A;  1OZH A;  1YTZ T;  1YBK A;  1IK7 A;  3B71 A;  3H1J E;  3MP7 B;  5DJU B;  3MZW B;  5TIS E;  2QJP C;  3H1K D;  2LR2 A;  3A2A A;  5B66 H;  2IZ0 A;  3HE4 A;  5AVS B;  1LT9 B;  3H1J G;  5KTB A;  3CCJ P;  1H88 A;  1AFO A;  2HFE D;  1OVV A;  1SQX K;  1CZQ A;  2N1T B;  1EDI A;  2RN0 A;  1NTK G;  2W27 A;  2ITA A;  2JWA A;  3KXD A;  3LW5 J;  4KJM A;  3S9O A;  4UB6 E;  5CBO A;  1Q82 Q;  1A02 F;  1FS0 E;  3S1K A;  3Q2Y A;  4C7R A;  2H88 C;  3TNU A;  1QL2 A;  5APT A;  1X8Y A;  1LWU C;  1URQ D;  2K37 A;  4TT3 H;  4Z1M H;  3Q1M A;  1ZR4 A;  1BCC D;  4HB1 A;  1CW5 A;  1M7L A;  1SQP E;  3USS A;  4W7Y A;  3H32 B;  1KQL A;  1U7M A;  1LT1 A;  2HLO A;  5AVY B;  3G4S P;  3CCV P;  2OYI B;  2KOG A;  3P7K A;  3MD0 A;  1N73 C;  3L71 J;  1FDM A;  4EDF A;  4A7P A;  4L76 A;  1OWA A;  2RKL A;  2Z5I A;  3H1J D;  3L70 D;  3BVH A;  2IYP A;  1GW4 A;  2ZJS E;  4UB6 H;  2NZ2 A;  1HGV A;  3CCS P;  3H1J J;  2DW3 A;  3PH0 A;  5AVV B;  2QRX A;  1EZV I;  1SQP K;  2JR8 A;  1X22 A;  3IAO A;  1LTA C;  1NTZ G;  2GM4 A;  2M3E A;  3AE8 C;  1DH3 A;  1M1K Q;  2IX7 C;  1P84 D;  2Q9I A;  3CI9 A;  3E7K A;  5TIS H;  5AVQ B;  5CMZ A;  1ZXG A;  2M5A A;  2WVR A;  2XDJ A;  3K5B A;  3H1L J;  1KIL E;  3B5N B;  3L73 E;  5AW1 B;  4EYY Q;  5BVZ A;  3HE4 B;  1S72 P;  1YQ3 C;  1FJP A;  1BCC J;  3Q5P A;  1KB9 I;  1BSN A;  2N1T C;  3L75 G;  4UB8 H;  2AEM A;  3IR9 A;  4OGQ B;  4YXW H;  2XNX A;  2NRG A;  1Y47 A;  3B5N A;  3CWB G;  4I6M C;  4GDO A;  2QVA A;  4JF7 A;  5KJ7 D;  1GK4 A;  3AEA C;  3H1H E;  4W80 A;  4AQR D;  1RH5 B;  2J5U A;  3GHG A;  2IPP A;  5AVX B;  2OYH A;  1OXZ A;  3HUS B;  3N4X A;  4IFM A;  4NPE A;  1Q86 Q;  3RK2 C;  3CLQ A;  3H1K G;  1QEX A;  3KDP B;  2Y0D A;  4MN4 C;  1URQ C;  5APW A;  4QMA A;  1BCC E;  3HUS A;  1SQX J;  3VMZ A;  1LT9 C;  2XZR A;  2ZAE B;  1FZF A;  2QA4 P;  2KNC B;  4L74 A;  1NTZ J;  3CPW O;  1JTH B;  2W90 A;  2WT7 A;  3CME P;  4UB8 E;  1W5C E;  3WUT A;  4CPG A;  4PD4 I;  3SSU A;  1AQT A;  4WBA A;  5CHX A;  4C46 A;  4NPD A;  3L73 D;  5K5G B;  3WMM 0;  3CX5 E;  5CCG D;  3HD7 B;  1SQV G;  2OQQ A;  3L72 J;  2Y9Y A;  3ABV C;  3L70 J;  5APU A;  1VQ6 P;  1M1J C;  1KYO E;  3H1H D;  2E5T A;  1W2B O;  3HD7 A;  1CI6 B;  3FWN A;  1ZOY C;  2E74 C;  1MV8 A;  2YXQ B;  2OYO A;  4KHX A;  3D6Z A;  2V7Q J;  3GG2 A;  4JQ0 D;  1EDL A;  3SWF A;  1EZV E;  1G1J A;  1N73 A;  1QLE D;  1SQP J;  4PD4 H;  5AW0 B;  5AVU B;  1NTM J;  1SQX D;  3VYI A;  5AVZ B;  3RL0 B;  1AVO A;  3G9R A;  4PV1 D;  1QVF O;  3CX5 H;  1IFN A;  1NJI Q;  1IZN B;  3OAK A;  3JCU H;  1SFC C;  2G3A A;  1N86 A;  3KHU A;  3P8C D;  2R3S A;  2UWJ E;  1L0N D;  1JCC A;  1ZV8 A;  3QH9 A;  1N7S A;  1K9M Q;  3F5H A;  3L70 E;  3CCR P;  2OTJ P;  2Z5H A;  3L72 G;  3L72 E;  2B9B A;  4HKZ H;  4OVN F;  4XE5 B;  1J1E B;  2JEE A;  1FAV A;  3V5B A;  2I8D A;  3MUD A;  2A06 E;  4XA4 A;  5GTH H;  4D6T D;  1BSH A;  3H1L D;  2YNY A;  3SFD C;  3BCC G;  2IFN A;  1SQQ D;  2IDB A;  1DEE G;  1IFJ A;  3WU2 H;  3CD6 P;  4RJT A;  3C9I A;  2LXB A; 
#chains in the Genus database with same CATH homology
 3P32 A;  1JCD A;  1GK6 A;  4C7N B;  1N7S D;  2HOD A;  5APY A;  2KSJ A;  3V4Q A;  3H6P A;  2R3C A;  3V2Q A;  4O9B A;  3E1I A;  4B86 A;  2KB7 P;  1HJB A;  2C9L Y;  3LW5 H;  2HOD B;  4WY4 D;  1N7S B;  1GU5 A;  5CCH D;  1GL2 B;  1FOS F;  2P1J A;  3MTU E;  4I1L A;  1GTW A;  1GL2 C;  2YKP A;  4N78 E;  1LTJ B;  2YO3 A;  1URQ B;  2QM7 A;  2Q5U A;  4LGD E;  1JOC A;  3NXS A;  1X79 B;  1IJD B;  3N7N A;  1RY3 A;  1HH0 A;  3L35 A;  1LTG C;  1LTI C;  1FZC A;  1RF1 A;  1JY3 O;  3V2R A;  2OAR A;  5APV A;  1HWT C;  1SFC A;  1EQ7 A;  1LGH B;  2QM8 A;  4WB4 A;  1LWU A;  1KIL B;  3P8C E;  3EFG A;  1L4A C;  3NMD A;  1IFD A;  3R2P A;  2MJZ A;  1KFM A;  2NPS D;  5AVT B;  1VPC A;  1NOH A;  1IK9 A;  2CPS A;  1ZLL A;  2OYI A;  3V2P A;  1N73 B;  3KPE A;  5AW4 B;  1WT6 A;  2WSC H;  1A02 J;  2YMY A;  3G3Z A;  4M3L A;  1WRG A;  3VTP C;  3L4F A;  1G1I A;  2Q3I A;  3NTN A;  3BRV B;  1FZC B;  2E42 A;  3B5N D;  3L36 A;  2WPQ A;  3RL0 D;  2FXM A;  5AW5 B;  1GZL A;  3B8E B;  5KLV K;  1KIL A;  1NKZ B;  3MGN A;  4N3Y B;  3EQ2 A;  3V4W A;  4GKG A;  3RK3 D;  2PP6 A;  1JY2 P;  4JYC A;  2LKM A;  1DX7 A;  2OYH B;  2P2U A;  2W6A A;  2HYN A;  1NTM K;  3H32 A;  4AYC A;  2FKW B;  3CL3 D;  1MFZ A;  3TYY A;  4HYT B;  1RF1 C;  2I1K A;  1ZR2 A;  1LTB C;  5AW3 B;  2HPC A;  1NHL A;  1HVV A;  1NU1 K;  4W7Z A;  3U59 A;  2ZXE B;  3M9B A;  2FFD C;  3HD7 C;  1RF1 B;  4N6J A;  5AW6 B;  1L4A A;  2PAJ A;  4ZKP A;  3U1A A;  1RE4 C;  4RES B;  5CJ0 A;  1GDT A;  1FZG A;  3HTK B;  3OA7 A;  3VMZ A;  1XTG B;  1E5W A;  2OYI C;  2KYV A;  2N9B A;  1YTZ I;  2J59 M;  3RK3 B;  2A45 I;  2POH A;  4WY4 B;  1SVF A;  3MIW A;  2H43 A;  1G2C B;  1SFC B;  1HBW A;  4DZO A;  1JUN A;  2KLV A;  1FZB A;  1L4A D;  4HH2 A;  2WPR A;  2HPC B;  2L5G B;  3LIE A;  1T2K C;  2WWW A;  3LID A;  1Z56 A;  1NTZ K;  1SLQ A;  2WIT A;  3HE5 A;  4AUW A;  2M3B A;  2HG5 D;  3BRT B;  2FFD B;  1XTC C;  1KIL C;  1GW3 A;  1KZU B;  4WY4 A;  5AW7 B;  5AW2 B;  4C7N A;  1FOS E;  3L37 A;  3SWY A;  1CSB A;  1KIL D;  2VRS A;  1LTJ A;  1NKN A;  1QL1 A;  1VDF A;  1JY2 N;  1GL2 A;  2WSF H;  1JY3 N;  3II6 A;  3P8M C;  5AVW B;  1GU4 A;  2GUS A;  1LWU B;  4ZKU A;  2P67 A;  2FFD A;  1RE3 A;  2IFM A;  1GL2 D;  3A3Y B;  2NPS A;  1LTS C;  1RE4 A;  2XV5 A;  3BAT A;  3M0D C;  3TSI A;  2C0X A;  1SP4 A;  1FZC C;  1T3J A;  2C0W A;  5AW8 B;  1T3U A;  3VMX A;  2YKQ A;  2CPB A;  1FZE A;  3U1C A;  5KJ7 A;  1SQV K;  1SQB K;  2XKM A;  4Y99 B;  2JJL A;  1J2J B;  1W2E A;  1NTK K;  4GT1 A;  2O01 H;  1JY3 P;  2BAS A;  2KP8 A;  4IFF A;  1S9K E;  3I5C A;  1ZN5 A;  3TK1 A;  1SFC D;  2Z4E A;  1YYC A;  4LLH A;  3VMY A;  1IO4 A;  3OJA B;  4OH8 B;  2WZ7 A;  4EIJ A;  5CJ4 A;  3M06 A;  3KYQ A;  1FU1 A;  1L0N K;  3V2N A;  1IC2 A;  2R5D A;  2H7H A;  4EOT A;  4I2L C;  2WSE H;  5CCG C;  4IFD K;  1GD2 E;  4Y99 C;  5CCH A;  2NPS C;  3TNU B;  3M9H A;  2YO2 A;  2N1T A;  2YKO A;  2R32 A;  1SQQ K;  1J1D C;  3RK2 D;  4LC1 A;  1PFI A;  2NPS B;  1JO5 A;  5AW9 B;  3T97 A;  5KJ7 C;  2GUV A;  1L0L K;  1URQ A;  1LT9 A;  2N1T D;  2M8R A;  4DOJ A;  2A45 H;  1MUU A;  1JY2 O;  1AQ5 A;  1N7L A;  3UIA A;  5APS A;  1T2K D;  1MZ9 A;  1IFM A;  3M91 A;  3VOP A;  2Q7C A;  1HUC A;  3VP9 A;  3BAS A;  1M1J A;  1L4A B;  1T8Z A;  1RF0 A;  3GHG B;  1S9K D;  2FYU K;  3HE5 B;  1FBM A;  3PP5 A;  2WTY A;  5BU8 B;  1X9V A;  1JMM A;  3O8Z A;  1G2C A;  3M9Q A;  2FYZ A;  2H8P D;  5CCG A;  1NWQ A;  3VP8 A;  1NO4 A;  1N7S C;  1J1E C;  2XU6 A;  3KQG A;  3M0A A;  1N2D C;  5CCH C;  1FZA A;  3HD7 D;  1KFN A;  3HRN A;  4WY4 C;  1LTT C;  5APX A;  3HTK A;  1HGZ A;  1LTJ C;  1HTL C;  2P7J A;  1CI6 A;  3A7O A;  4JYB A;  1NH4 A;  3IFM A;  3RK3 C;  2J58 A;  1RE3 C;  3NFQ A;  1M1J B;  5BU5 A;  4N78 D;  1J1D B;  2E43 A;  5APQ A;  3RL0 C;  3M0D A;  4GIF A;  5AVR B;  1H89 A;  3B5N C;  2I1J A;  2WPS A;  1DEB A;  3A5T A;  1FJK A;  1JTH A;  2ZFC A;  1IFI A;  2WT7 B;  2R5B A;  2W6B A;  2O1J A;  3GHG C;  1RF0 C;  1NAF A;  3VN0 A;  2OYH C;  2A45 G;  1JNM A;  1H8A A;  3RK2 B;  3HUS C;  2O1K A;  1YTZ T;  3A2A A;  5AVS B;  3HE4 A;  1LT9 B;  5KTB A;  1H88 A;  1AFO A;  2HFE D;  1SQX K;  1CZQ A;  2N1T B;  2W27 A;  1A02 F;  4C7R A;  3TNU A;  1QL2 A;  5APT A;  1LWU C;  1URQ D;  1X8Y A;  1ZR4 A;  1CW5 A;  1M7L A;  4W7Y A;  3H32 B;  1KQL A;  2HLO A;  2OYI B;  5AVY B;  2KOG A;  3P7K A;  3MD0 A;  1N73 C;  1FDM A;  1OWA A;  2Z5I A;  3BVH A;  1GW4 A;  1HGV A;  5AVV B;  1SQP K;  1LTA C;  2GM4 A;  1DH3 A;  2IX7 C;  2Q9I A;  3CI9 A;  5AVQ B;  5CMZ A;  2XDJ A;  5BVZ A;  5AW1 B;  3B5N B;  1FJP A;  3HE4 B;  2N1T C;  2C9N Y;  3IR9 A;  2XNX A;  3B5N A;  4I6M C;  4JF7 A;  5KJ7 D;  1GK4 A;  4W80 A;  4AQR D;  3GHG A;  2IPP A;  5AVX B;  2OYH A;  1OXZ A;  3HUS B;  3N4X A;  4IFM A;  3RK2 C;  3CLQ A;  3KDP B;  5APW A;  1URQ C;  3HUS A;  1LT9 C;  2XZR A;  1FZF A;  1JTH B;  2WT7 A;  4WBA A;  5CHX A;  4C46 A;  3WMM 0;  5CCG D;  3HD7 B;  5APU A;  1M1J C;  3HD7 A;  1CI6 B;  1MV8 A;  4KHX A;  3SWF A;  1G1J A;  1N73 A;  5AW0 B;  5AVU B;  3VYI A;  5AVZ B;  3RL0 B;  1IFN A;  3OAK A;  1SFC C;  1N86 A;  3P8C D;  1JCC A;  1ZV8 A;  1N7S A;  2Z5H A;  4XE5 B;  1J1E B;  2JEE A;  1FAV A;  3V5B A;  3MUD A;  4XA4 A;  2YNY A;  2IFN A;  1IFJ A;  3C9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...