3B5NB

Structure of the yeast plasma membrane snare complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
69
structure length
69
Chain Sequence
ALAEVQARHQELLKLEKSMAELTQLFNDMEELVIEQQENVDVIDKNVEDAQLDVEQGVGHTDKAVKSAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Synaptobrevin homolog 1
publication title The Structure of the Yeast Plasma Membrane SNARE Complex Reveals Destabilizing Water-filled Cavities.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 32
structure length 69
sequence length 69
chains with identical sequence F, J
ec nomenclature
pdb deposition date 2007-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3b5nB00
1SFCD 4WY4D 1N7SC 3RK2B 4W7YA 3RK2D 4OH8B 2HG5D 3P8CE 3RL0B 4WY4C 1N7SD 1URQA 1URQB 1NHLA 1GL2A 3RL0C 1GL2B 3HD7A 3B5NA 3HD7B 2WZ7A 3HD7D 3B5NB 1URQC 2HFED 2N1TA 3RL0D 1GL2C 3TSIA 3HD7C 3PP5A 1URQD 3B5NC 3RK3C 4LGDE 2YMYA 3HTKB 5CCGC 1GL2D 2NPSA 2N1TC 1L4AA 3B5ND 4W80A 1KILA 3RK3B 5CCGA 1L4AB 3RK3D 5CCHA 5CCGD 2KOGA 2N1TB 2N1TD 1SFCA 4W7ZA 2M8RA 2NPSC 1SFCB 1HVVA 1L4AC 1KILC 2PP6A 5KJ7C 4N78E 5CCHC 2NPSB 1N7SA 2NPSD 1SFCC 1XTGB 4JF7A 1N7SB 3M0DC 1L4AD 5KJ7A 2XDJA 1KILB 1JTHA 1KILD 3RK2C 3VOPA 5KJ7D 1JTHB 5CCHD 4WY4A 2H8PD 3KYQA 4WY4B 1T3JA
chains in the Genus database with same CATH superfamily
4WY4D 1BCCD 3VN0A 2H89C 1FZCC 1D7MA 1EDJA 1SQXJ 4XA4A 4GT1A 4BXLA 2YIUC 3B8EB 3ITKA 3MUDA 1M7LA 4PV1C 3CCVP 3CCQP 5GTHE 2ZXEB 1YQ4C 1AQ5A 4PD4H 4KT0J 2Y9ZA 1ZMEC 3H1LJ 1VQ6P 1JB0J 3AE7C 1FC2C 2E5TA 1Q81Q 2N1TA 2QJPB 3Q2YA 1GL2C 1IO4A 3JCUH 1LGHB 1FBMA 3I56P 2A06E 4Y99C 3CC7P 1RHZB 1NTZK 2RMZA 2ZVNB 2N1TD 1OFCX 1MFTA 2Q6QA 1FJKA 2FYUG 1ZR2A 4IL6E 2OYHC 1IFPA 4RKUJ 2A45I 1FS0E 1L0LG 1NWQA 3CX5I 4RESB 3CWBD 3F89A 1FZCA 3RK2C 3V2RA 1FZCB 1EXJA 1PP9G 1Q86Q 1SQBJ 2H8PD 2YIUB 2QVAA 1T2KD 3E7KA 4WBAA 2A45G 4L73A 5KLIC 1ZV8A 2XNXA 1LTJC 3D70A 1DEEG 3CCRP 3B4SA 4C46A 2K9JA 1GL2A 1KB9E 3L74J 1HBWA 2K9JB 1GL2B 1KYOE 3CL3D 4PV1D 2BCCE 3TGUG 3K5BA 1NU1K 3E1IA 3GMAA 3U1CA 1K05A 2Y0EA 1IJDB 1NYHA 2JEEA 4Y99B 1BE3J 1PGOA 2AXTH 3H1JG 1GL2D 2AEJA 2FYZA 4N3YB 3AEBC 2OYHA 2M5AA 3CMEP 1IFMA 3A0BE 2OYHB 2M5AB 1L0NK 1SQVG 1RF1C 1HVVA 1SQQK 2NRGA 4RO0A 1NTKG 1JY3O 2FYUD 1SS1A 2NPSB 2KSJA 5B5EH 3FX0A 1SLQA 3VMAA 5KJ7A 2OYIC 5KLIB 2B88A 1CI6A 1L0LD 1LTJA 1CI6B 1NTMG 2JWDA 2BCCJ 1LTJB 3MD0A 1BSNA 1JY3P 1VQ8P 1PP9D 1LTIC 5AW9B 4HH2A 3RK2D 5L8RJ 3H6PA 1KTMA 2OTJP 3CXHI 3AE5C 2RN0A 3CX5D 1PGPA 1LTAC 3L71D 5AW3B 4D6TD 3CWBJ 1U7MA 5KLVK 3RL0C 3R4YA 3SFDC 5AW7B 1LJ2A 2KLVA 1VQMP 1CSBA 1GU4A 3KZIH 3W68A 3RBZA 3BCCG 1Y9BA 3VMZA 1QGKB 1YJWP 1K9MQ 1RF1A 3SFEC 5AVSB 1X8YA 1RF1B 1TU3F 4U7JA 1RQUA 2QIWA 2XV5A 3LIEA 2IZ1A 2KIKA 3GG2A 3VP8A 2OYIA 2ZAEB 1SQVD 1N2DC 3O6QA 2OYIB 1QL2A 3O6QB 2V4HA 4GOEA 2J58A 3A0HH 4AQRD 2R44A 1KILB 2K37A 3MP7B 2JR8A 3L73G 1RH5B 3FGAD 1OXZA 1KZUB 4BRYA 4W7YA 4BRYB 4IL6H 1HF9A 3L70E 3RL0B 3WUTA 3B71A 1PPJE 5TJHA 4YXDC 2PAJA 2QM8A 2DW3A 3FXEA 1L0LJ 1ZLLA 1VQ9P 2CPBA 4PD4E 1VQ7P 1NTZD 2ZYAA 4ZKPA 1S3JA 4EYYQ 3CXHD 3RL0D 3AEDC 2HLOA 3D6YA 3RGUA 3JCUE 1JM0A 3BVHA 3L71J 1P84E 3B5NC 4D6TJ 2KYVA 3M9QA 5APYA 1FZAA 2IBZE 3V2QA 2IPPA 1S5LE 3Q5PA 3Q5SA 1M1KQ 3WMM0 1SQPG 1K04A 4JQ0D 4UB6H 3BCCD 3HE5A 3OJAB 1FJPA 4EI2A 1N8RQ 3HE5B 1ZOYC 3CCLP 3IN6A 4K3AA 2M3EA 4XFJA 4CPGA 1KILE 3G3ZA 4OVNF 5APVA 2V7QJ 1JTHA 3VOPA 3U59A 1JTHB 5AVZB 4N6JA 1FZBA 3I5CA 1QVFO 2SPZA 1RY3A 2GUSA 4GIFA 1OX3A 3MGNA 3L4FA 1VF5C 4QMAA 4WY4C 4H44B 3L75G 5AVTB 1FDIA 1ZN5A 3A7OA 2O3JA 4H13B 2W90A 2H7HA 1AVOA 3B5NA 5AVYB 2LKMA 2W27A 3PLNA 3B5NB 2FBWC 4L76A 1JY2P 1DD3A 2FYUK 3PP5A 5KAFH 1JUNA 1NJIQ 3A5TA 1MZ9A 3GLMA 2AXTE 2R5DA 2XU6A 5CBNA 1AFOA 1VDFA 3GF3A 1YI2P 1Q2NA 1NTZJ 1GW3A 3B5ND 3HUSC 1EZVI 2XZRA 1NU1E 1YITP 5BU5A 1IFDA 3LIDA 5KKZC 1N73C 2K88A 1SQXE 3CCMP 2IFMA 2M8RA 1ZR4A 1VL2A 3GHGC 2E75D 1EZVG 1KB9I 3BATA 2WQYC 4JPZB 1WRGA 3H1LE 2FYNC 1IZNB 5KLVD 3NMDA 2E5YA 2KS1A 2ZXXA 4HB1A 1VF5B 2KS1B 1NAYA 4WY4A 3IF4A 1L0NE 4WY4B 1ZRTD 1ZP0C 4LC1A 3O8ZA 1SQQE 3CX5H 3C1LA 2I8DA 3AECC 3P8CE 1GD2E 5APWA 5APQA 2C0XA 1GU5A 1CW5A 2N9YB 4IFFA 3L75D 1VF5D 1S72P 1YYCA 2G3AA 1KC8Q 3WUUA 4ZKUA 3HD7D 1NU1J 4YPCA 3AE1C 2HFED 1SQVK 1FOSF 3V5BA 2ZYGA 2FXPA 2QM7A 1NH4A 3QH9A 1KFMA 1NTKK 3KZIE 1KFNA 3RK3C 2V7QH 2YMYA 2E76C 2Y0DA 1S9KE 1SQBE 2J59M 3G71P 2Z5IA 3QWOC 4LLHA 1NO4A 4W80A 1NTMK 1L0NJ 2P1JA 1QEXA 2N1TB 2QSIA 4IL6X 1AVYA 1KORA 1SQQJ 2W8ZA 1M56D 3PJSK 1P84H 3CCEP 1L4AC 4U3FG 2YXRB 3PTZA 2PP6A 1S5LH 3L74E 2M0BA 3A0HE 3GF7A 4JF7A 1BCCE 1EZVD 1JY3N 2WITA 2K1AA 3JC22 4IFMA 2D2CD 4H0LC 2MJZA 1LP1A 1N7SC 2ZFCA 2KI7B 1GZLA 1LP1B 1BE3E 1KB9D 1RE4C 2CPSA 4GOFA 5KLVJ 1MV8A 3M9BA 3CXHH 4PV1B 2H88C 4YTPC 1USDA 5C39A 2E76B 2C0WA 3M91A 1SVFA 1KQFB 3MIWA 3NFQA 3V6IA 3HTKA 5AW6B 3HTKB 1GDTA 4UB6E 1BCCJ 2G8YA 1L4AA 4YXWH 3OA7A 1L4AB 3RK3D 4EDFA 2R3CA 4EOTA 4I6MC 1BDCA 2E76D 4A7PA 1SP4A 2NZ2A 5APXA 1YBKA 3VMYA 3CWBE 4IFDK 2W6JH 1OWAA 4U3FD 1KD1Q 1N7SA 3G6EP 1N7SB 3M0DC 1L4AD 1BSHA 3L70G 3H1HG 2XDJA 2KUBA 2KP8A 4N78D 2KLUA 1VQKP 1OW8A 1Q7YQ 3EFGA 1LNQA 3RK2B 1JCCA 4H0LD 1N7SD 1VQPP 2K9YA 4HYTB 1DD4A 4DOJA 2O1JA 1UIXA 1SQPK 2P58A 2AEFA 2WPSA 5AVXB 1DIPA 2YNYA 2O1KA 1NKNA 1KN7A 2KK7A 1GK4A 5KAFE 3AEGC 2WSFJ 3EQ2A 5CBOA 4GODA 5AW5B 2FY8A 5CCGC 1UIIA 4GDOA 1PGQA 3TGUD 2GM4A 2WSCJ 2KOGA 2H43A 4W7ZA 1YHQP 2FKWB 3M0DA 4AUWA 2FYUE 3FWNA 4OWFA 1N7LA 5CJ0A 2AEMA 1HGVA 1L0LE 2IX7C 4ASWA 3H1JD 5K5GB 3AE4C 3CCUP 1U57A 1PP9E 3MHVA 1HJBA 1T6AA 1NOHA 4BWNA 3G9RA 3H1HD 2R3SA 4DT0A 2IYOA 2CK3H 1BGYG 3CX5E 3L71E 1HTLC 4D6TE 1M57D 3L72G 2YO2A 2HYNA 2RH0A 4U3FJ 2Q9IA 3JSVC 1NTKD 3N7NA 3H1IG 4TLFA 1IFJA 3VTPC 2HODA 1HJ0A 2QJKC 2HODB 2WSEJ 3CC4P 3II6A 1NTMD 3U1AA 1JY2N 2WZ7A 3H1KG 1J1EC 1KMIZ 3SSUA 3CD6P 1FOSE 2FYUJ 1M90Q 1S5LX 4M3LA 1X22A 1SQXG 4NPEA 1JO5A 3P8MC 1PP9J 3CI9A 1SQVE 2QE7H 5CCGD 1J1DC 2P67A 3E1RA 2JKVA 1X79B 1VQ4P 5E79H 4RJTA 3KDPB 3CC2P 1S2EA 3NXSA 3WUVA 2E74C 2E75C 3TGUJ 3AE3C 3W67A 1WMKA 3L37A 1AJYA 2YKOA 1LT9C 4KJMA 3NTNA 2W6BA 2QJKB 2ZJSE 3EWKA 1BGYD 2GUVA 3VMXA 2Y0CA 3H1JJ 1NTZE 3L72D 1J1EB 1R5LA 3GW6A 3CXHE 1VQOP 3H1ID 2WSCH 1FE6A 4UB8H 3WU2H 3L73D 2JDIH 1SQVJ 5AW8B 1KQGB 3A2AA 5BU8B 5AVQB 1PFIA 3EFFK 2QRXA 1OVUA 3H1KD 1DX7A 3TSIA 3M9HA 1NTKJ 3HD7C 3FXDA 3BCCE 4ZNCA 2OGUA 1OW7A 1J1DB 1MKMA 3UIAA 5AW2B 2A06G 1NTMJ 1Y47A 5AW4B 3CCJP 2JJLA 4JBZA 2JO1A 2WWWA 5GTIE 1AA0A 1N86A 2KB7P 5KTBA 2E74B 3OW2O 2E75B 3KHUA 2C9LY 1H89A 2P2UA 1BE3G 2WSEH 1LT9A 1SQPD 4O9BA 3BRVB 1LT9B 1JMBA 2KXPB 1GMJA 2WTYA 1S1CX 2B87A 2B87B 2E74D 2IFNA 4OH8B 3KPEA 4IOIH 2Q5UA 2P10A 1KYOI 2D2CC 3BCCJ 3RBXA 1W2EA 5TISH 1YTZI 2WPVB 1PGJA 3HD7A 2QJPC 2A45H 2I1JA 4GKGA 2KZJA 3HD7B 2YO3A 3KXDA 2BCCG 2ITAA 4WVZA 3CPWO 1VQNP 2W6AA 1LWUC 2KSEA 1DH3A 5EFWB 4PJ0H 4I1LA 5B66H 2IZ0A 2OQQA 4LGDE 1QL1A 1AQTA 2ZYDA 3H1IJ 4WB4A 1MFZA 2L91A 1OW6A 3L73J 1JEKA 2JP3A 1IK9A 2A06D 4DCKA 1E79H 3HUSA 3USSA 2IYPA 3HUSB 1N73A 1S4XA 1J2JB 1YQ3C 5KKZB 5KLVE 1N73B 3MZWB 3GHGA 2Q3IA 1OZHA 1ZRTE 3Q1MA 3GHGB 1BE3D 2PGDA 1W2BO 4HJGH 2D2CB 2FYNB 1GW4A 1FDMA 2HG5D 4JYBA 3AEAC 3L75E 5KAIH 3D71A 3SWYA 3TYYA 3TK1A 3IR9A 2QJYC 1SQPJ 1T8ZA 2IDBA 2N9BA 3S4RA 1LWUA 1LWUB 4JYCA 1OVRA 4C7NA 4C7NB 1KYOD 3AE8C 3CMAP 3G4SP 2BCCD 2O01N 3D6ZA 5CMZA 2Q3EA 1RQVA 3R2PA 3C8VA 1G1IA 1PIXA 3RL0g 1W5CE 3CLQA 3RK3B 4DZOA 1EDKA 1RE3C 1BDDA 1X0TA 1X9VA 2FXOA 2NPSC 2HPCA 5E79E 1M8OB 2AXCA 1K73Q 2HPCB 2WT7A 1EZVE 3L75J 2WT7B 3A3YB 5KJ7C 3L71G 4D6TG 1HWTC 1JMMA 5BVZA 1VQ5P 2KZIA 3I55P 5GTIH 1T3JA 4AYCA 2QJYB 2L5GB 2VRSA 3M06A 2B9BA 1T3UA 2FFDC 3VYIA 4PD4I 2QEXP 5APUA 4H0LB 1SQXK 1PZQA 1OVVA 1PPJG 1RE4A 1NHLA 1HUCA 4UB8E 1NAFA 3WU2E 1NGMB 1P84I 2QA4P 2UWJE 2R32A 2IBZI 1KV4A 4ASVA 3H32A 3TDKA 1RE3A 3RK3E 1NKZB 3H32B 3V4QA 4R4LA 2NPSA 1Q82Q 2IBZG 4ZMDA 3TF5A 3ZDMA 2OYOA 3AE6C 4HKZH 1EDLA 5APTA 4EIJA 2K3RA 1IK7A 4U3FE 2E43A 1G2CA 4I7ZC 1KILC 1G2CB 4N78E 2NPSD 1SFCC 3OAKA 1Q90D 2FFDA 5H2FE 5KJ7D 2FFDB 1NTZG 3LW5J 2OARA 1SQBK 3H25A 2OTKE 1G1JA 2XNDH 1GK6A 2W83C 1FU1A 4I2LC 2RKLA 1FAVA 1NVOA 4MN4C 5TISE 1E5WA 5GTHH 2OTLP 3BRTB 1EXIA 2BEQD 1A02J 3L70D 1EDIA 4L75A 1XTCC 1PPJD 4Y28J 3FWLA 3HRNA 2BASA 2LXCB 2C9NY 1URQC 2I1KA 4PD4D 5AVVB 4WWIA 4TT3H 3Q5RA 3C9IA 4PJ0E 5B66E 2M3BA 4OGQC 4R4MA 4NPDA 1LTBC 3TGUE 2PFXA 1P84D 1KILA 5CCGA 4I7ZB 3AEEC 5CHXA 2GA1A 2IBZD 1NU1G 1AV1A 1SFCA 1RF0C 1SFCB 2HR3A 3H1JE 2LR2A 1Y8AA 2J5UA 2YKQA 5CCHC 3H1HE 1YTZT 1IFNA 1PL5A 1KILD 3H1LG 1USEA 1EQ7A 2O01J 1U7JA 1OMIA 1YIJP 2Q1KA 4NPFX 4DJGA 1SFCD 4B86A 3IFMA 1L0NG 4H44C 1ZXGA 1NTKE 3HE4A 3HE4B 2JWAA 2WMMA 1SQQG 2Q7CA 1CZQA 1VQLP 2Z5HA 5KAIE 3TNUA 4H13C 3PHLA 1FZEA 3TNUB 1URQA 2ZT9C 1NTME 3IAOA 1URQB 4K35A 1KB9H 2QG4A 3PRJA 1VPCA 1KYOH 1IFIA 1DEBA 2WSFH 2YKPA 3VP9A 1K8AQ 4OGQB 1FZFA 2KNCA 3N4XA 2WSSH 2KNCB 3BASA 1YJNP 3L36A 1JCDA 1URQD 4KHXA 3L70J 3H1HJ 3LW5H 1RF0A 5KLVG 3PH0A 1LTSC 3S1KA 1L2PA 1SQBG 2BEZF 4OGQD 5CCHA 4Z1MH 2YMKA 3A0BH 1R5SA 3MTUE 2ZVOB 1M1JC 5AW1B 2P7JA 1OIPA 1HH0A 1NU1D 3ABVC 1JOCA 1A02F 3S9OA 1SQXD 1ZW0A 3L74G 1XTGB 5CJ4A 3L35A 1BCCG 1JY2O 3V4WA 5CCHD 3T97A 3KYQA 1IC2A 3H1LD 3T97B 1BGYE 1KQSO 2ZT9B 1R8EA 3L72E 1L0ND 2E42A 3AE2C 1EC5A 3AE9C 5AVRB 1KQLA 1FZGA 3H1IE 4C7RA 2WVRA 4H44D 1LTTC 1SQQD 2WPQA 5DJUB 4L74A 3SWKA 3L73E 5H2FH 3P8CD 2LXBA 1LT1A 1QX8A 4H13D 5M1BA 1L0LK 3H1KE 2ZT9D 3MUDC 4XE5B 2XKMA 1Z56A 1LTGC 1H8AA 3Q3DA 1H0TA 2O01H 3M0AA 2FXMA 1H0TB 1WT6A 1M1JA 2R5BA 5AVWB 2N1TC 3CCSP 3F5HA 1M1JB 2WPRA 3V2NA 5B5EE 3SWFA 2Y9YA 5AVUB 1QVGO 1S9KD 3P32A 1SQBD 1QLED 1BGYJ 3KQGA 1MUUA 2MKVA 1FDOA 3L72J 1JNMA 2Z4EA 1SQPE 5APSA 2PRRA 3CWBG 2B89A 5AW0B 2YXQB 1YJ9P 3AEFC 1T2KC 1GTWA 5DJTB 1PV3A 3P7KA 1H88A 3L74D 3V2PA 3H1KJ 1HGZA 2POHA
chains in the Genus database with same CATH topology
1RY3A 4WY4D 2GUSA 4GIFA 3VN0A 4AYCA 3MGNA 3L4FA 1HTLC 2L5GB 2VRSA 3M06A 1FZCC 1T3UA 2FFDC 3VYIA 4XA4A 4GT1A 5APUA 2YO2A 2HYNA 2Q9IA 4WY4C 3B8EB 1SQXK 3MUDA 1M7LA 3N7NA 5AVTB 1IFJA 2ZXEB 3VTPC 1ZN5A 3A7OA 1RE4A 2HODA 1NHLA 1AQ5A 1HUCA 2HODB 1NAFA 2H7HA 3II6A 3B5NA 3U1AA 1JY2N 5AVYB 2WZ7A 2LKMA 2W27A 3B5NB 1J1EC 2R32A 1FOSE 2N1TA 1JY2P 1GL2C 1IO4A 2FYUK 4M3LA 3PP5A 1JUNA 3H32A 1LGHB 3A5TA 1FBMA 1RE3A 1MZ9A 1NKZB 2R5DA 3H32B 3V4QA 2XU6A 1AFOA 1JO5A 1VDFA 2NPSA 3P8MC 4Y99C 1GW3A 3B5ND 1NTZK 3HUSC 2XZRA 3CI9A 5BU5A 5CCGD 1IFDA 3LIDA 1J1DC 5APTA 1N73C 4EIJA 2P67A 2N1TD 2IFMA 1X79B 2E43A 2M8RA 1ZR4A 1FJKA 1G2CA 3GHGC 1KILC 1G2CB 1ZR2A 2OYHC 4N78E 3BATA 2NPSD 1WRGA 3KDPB 2A45I 1SFCC 3OAKA 1NWQA 4RESB 3NXSA 1FZCA 3NMDA 2FFDA 3RK2C 3V2RA 5KJ7D 1FZCB 2FFDB 4WY4A 2OARA 2H8PD 4WY4B 1SQBK 1T2KD 4LC1A 3O8ZA 3L37A 4WBAA 2A45G 2YKOA 1LT9C 3NTNA 2W6BA 1G1JA 3P8CE 1ZV8A 1GK6A 2XNXA 1FU1A 4I2LC 2GUVA 3VMXA 1GD2E 1LTJC 5APWA 1FAVA 5APQA 2C0XA 1GU5A 1E5WA 4C46A 1CW5A 1J1EB 4IFFA 3BRTB 1A02J 1GL2A 1YYCA 1XTCC 2WSCH 1HBWA 1GL2B 3CL3D 4ZKUA 3HD7D 3HRNA 2BASA 2C9NY 5AW8B 1NU1K 1URQC 2HFED 1SQVK 3E1IA 3A2AA 5BU8B 1FOSF 2I1KA 5AVQB 3U1CA 3V5BA 1PFIA 5AVVB 1IJDB 2QM7A 1DX7A 1NH4A 2JEEA 4Y99B 3TSIA 3M9HA 3C9IA 3HD7C 1KFMA 2M3BA 1NTKK 1KFNA 3RK3C 1LTBC 2YMYA 1J1DB 1GL2D 1S9KE 3UIAA 5AW2B 2J59M 2FYZA 2Z5IA 4LLHA 4N3YB 1NO4A 4W80A 1KILA 5CCGA 5CHXA 1NTMK 5AW4B 2OYHA 2JJLA 1IFMA 2P1JA 2OYHB 2WWWA 1L0NK 2N1TB 1SFCA 1RF0C 1SFCB 1RF1C 1N86A 1HVVA 1SQQK 1L4AC 2KB7P 5KTBA 2PP6A 2YKQA 2C9LY 1JY3O 5CCHC 1H89A 2NPSB 2P2UA 2KSJA 2WSEH 1YTZT 1IFNA 4JF7A 1LT9A 1SLQA 5KJ7A 4O9BA 3BRVB 2OYIC 1KILD 1LT9B 1JY3N 1EQ7A 1CI6A 2WITA 1LTJA 1CI6B 2WTYA 4IFMA 1LTJB 3MD0A 1SFCD 1JY3P 4B86A 3IFMA 2MJZA 1N7SC 2ZFCA 3HE4A 1LTIC 5AW9B 4HH2A 3RK2D 2IFNA 1GZLA 3H6PA 4OH8B 3KPEA 3HE4B 2Q7CA 1CZQA 2Q5UA 2Z5HA 1RE4C 3TNUA 1FZEA 3TNUB 1URQA 1LTAC 1W2EA 5AW3B 2CPSA 1URQB 1YTZI 1MV8A 3M9BA 5KLVK 3RL0C 1VPCA 3HD7A 2A45H 1IFIA 2I1JA 1DEBA 4GKGA 3HD7B 2WSFH 5AW7B 2YO3A 2KLVA 2YKPA 3VP9A 1FZFA 2C0WA 2W6AA 3N4XA 3M91A 1LWUC 1SVFA 3BASA 1DH3A 3L36A 4I1LA 1JCDA 1CSBA 3MIWA 1URQD 3NFQA 1GU4A 3HTKA 5AW6B 4LGDE 4KHXA 3HTKB 1GDTA 1QL1A 3LW5H 3VMZA 4WB4A 1RF0A 1RF1A 1MFZA 5AVSB 1LTSC 1L4AA 1X8YA 1RF1B 3OA7A 1L4AB 2XV5A 3RK3D 2R3CA 3LIEA 4EOTA 4I6MC 5CCHA 1IK9A 1SP4A 3MTUE 3HUSA 1M1JC 5AW1B 3VP8A 2OYIA 2P7JA 3HUSB 1HH0A 5APXA 1N73A 1N2DC 1J2JB 1JOCA 2OYIB 1A02F 3VMYA 1QL2A 1N73B 4IFDK 1OWAA 1N7SA 2J58A 3GHGA 2Q3IA 4AQRD 1XTGB 1N7SB 3M0DC 5CJ4A 1L4AD 3GHGB 2XDJA 1KILB 2KP8A 3L35A 4N78D 1JY2O 3V4WA 5CCHD 3T97A 3KYQA 1IC2A 1GW4A 1OXZA 3EFGA 1KZUB 4N6JA 3RK2B 4W7YA 1FDMA 2HG5D 2E42A 4JYBA 5AVRB 1JCCA 1KQLA 1FZGA 3RL0B 4C7RA 3SWYA 1LTTC 3TYYA 1N7SD 2WPQA 3TK1A 3IR9A 4HYTB 4DOJA 2PAJA 3P8CD 1T8ZA 2O1JA 2N9BA 2QM8A 1SQPK 1LWUA 1ZLLA 2CPBA 1LWUB 4JYCA 1L0LK 4ZKPA 2WPSA 5AVXB 4C7NA 2YNYA 4XE5B 2O1KA 4C7NB 1NKNA 3RL0D 2XKMA 2HLOA 1GK4A 1Z56A 1LTGC 3EQ2A 3BVHA 1H8AA 5CMZA 3B5NC 2KYVA 5AW5B 3R2PA 3M9QA 5APYA 1FZAA 2O01H 5CCGC 3V2QA 3M0AA 2IPPA 2FXMA 1G1IA 1WT6A 1M1JA 2R5BA 5AVWB 3CLQA 2N1TC 3WMM0 1M1JB 2WPRA 3HE5A 3V2NA 3SWFA 3OJAB 1FJPA 3HE5B 3RK3B 5AVUB 4DZOA 1S9KD 3P32A 2GM4A 2KOGA 1RE3C 2H43A 4W7ZA 3KQGA 1MUUA 2FKWB 3M0DA 4AUWA 1X9VA 2NPSC 2HPCA 1JNMA 2Z4EA 2HPCB 2WT7A 1N7LA 5CJ0A 1HGVA 5APSA 2WT7B 3A3YB 3G3ZA 5KJ7C 2IX7C 5APVA 5AW0B 1T2KC 1HWTC 1JMMA 1GTWA 5BVZA 1JTHA 3P7KA 3VOPA 1H88A 3U59A 1HJBA 1JTHB 3V2PA 5AVZB 1NOHA 1FZBA 1HGZA 3I5CA 2POHA 1T3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SFC D;  4WY4 D;  1N7S C;  3RK2 B;  4W7Y A;  3RK2 D;  4OH8 B;  2HG5 D;  3P8C E;  3RL0 B;  4WY4 C;  1N7S D;  1URQ A;  1URQ B;  1NHL A;  1GL2 A;  3RL0 C;  1GL2 B;  3HD7 A;  3B5N A;  3HD7 B;  2WZ7 A;  3HD7 D;  3B5N B;  1URQ C;  2HFE D;  2N1T A;  3RL0 D;  1GL2 C;  3TSI A;  3HD7 C;  3PP5 A;  1URQ D;  3B5N C;  3RK3 C;  4LGD E;  2YMY A;  3HTK B;  5CCG C;  1GL2 D;  2NPS A;  2N1T C;  1L4A A;  3B5N D;  4W80 A;  1KIL A;  3RK3 B;  5CCG A;  1L4A B;  3RK3 D;  5CCH A;  5CCG D;  2KOG A;  2N1T B;  2N1T D;  1SFC A;  4W7Z A;  2M8R A;  2NPS C;  1SFC B;  1HVV A;  1L4A C;  1KIL C;  2PP6 A;  5KJ7 C;  4N78 E;  5CCH C;  2NPS B;  1N7S A;  2NPS D;  1SFC C;  1XTG B;  4JF7 A;  1N7S B;  3M0D C;  1L4A D;  5KJ7 A;  2XDJ A;  1KIL B;  1JTH A;  1KIL D;  3RK2 C;  3VOP A;  5KJ7 D;  1JTH B;  5CCH D;  4WY4 A;  2H8P D;  3KYQ A;  4WY4 B;  1T3J A; 
#chains in the Genus database with same CATH topology
 4WY4 D;  1BCC D;  3VN0 A;  2H89 C;  1FZC C;  1D7M A;  1EDJ A;  1SQX J;  4XA4 A;  4GT1 A;  4BXL A;  2YIU C;  3B8E B;  3ITK A;  3MUD A;  1M7L A;  4PV1 C;  3CCV P;  3CCQ P;  5GTH E;  2ZXE B;  1YQ4 C;  1AQ5 A;  4PD4 H;  4KT0 J;  2Y9Z A;  1ZME C;  3H1L J;  1VQ6 P;  1JB0 J;  3AE7 C;  1FC2 C;  2E5T A;  1Q81 Q;  2N1T A;  2QJP B;  3Q2Y A;  1GL2 C;  1IO4 A;  3JCU H;  1LGH B;  1FBM A;  3I56 P;  2A06 E;  4Y99 C;  3CC7 P;  1RHZ B;  1NTZ K;  2RMZ A;  2ZVN B;  2N1T D;  1OFC X;  1MFT A;  2Q6Q A;  1FJK A;  2FYU G;  1ZR2 A;  4IL6 E;  2OYH C;  1IFP A;  4RKU J;  2A45 I;  1FS0 E;  1L0L G;  1NWQ A;  3CX5 I;  4RES B;  3CWB D;  3F89 A;  1FZC A;  3RK2 C;  3V2R A;  1FZC B;  1EXJ A;  1PP9 G;  1Q86 Q;  1SQB J;  2H8P D;  2YIU B;  2QVA A;  1T2K D;  3E7K A;  4WBA A;  2A45 G;  4L73 A;  5KLI C;  1ZV8 A;  2XNX A;  1LTJ C;  3D70 A;  1DEE G;  3CCR P;  3B4S A;  4C46 A;  2K9J A;  1GL2 A;  1KB9 E;  3L74 J;  1HBW A;  2K9J B;  1GL2 B;  1KYO E;  3CL3 D;  4PV1 D;  2BCC E;  3TGU G;  3K5B A;  1NU1 K;  3E1I A;  3GMA A;  3U1C A;  1K05 A;  2Y0E A;  1IJD B;  1NYH A;  2JEE A;  4Y99 B;  1BE3 J;  1PGO A;  2AXT H;  3H1J G;  1GL2 D;  2AEJ A;  2FYZ A;  4N3Y B;  3AEB C;  2OYH A;  2M5A A;  3CME P;  1IFM A;  3A0B E;  2OYH B;  2M5A B;  1L0N K;  1SQV G;  1RF1 C;  1HVV A;  1SQQ K;  2NRG A;  4RO0 A;  1NTK G;  1JY3 O;  2FYU D;  1SS1 A;  2NPS B;  2KSJ A;  5B5E H;  3FX0 A;  1SLQ A;  3VMA A;  5KJ7 A;  2OYI C;  5KLI B;  2B88 A;  1CI6 A;  1L0L D;  1LTJ A;  1CI6 B;  1NTM G;  2JWD A;  2BCC J;  1LTJ B;  3MD0 A;  1BSN A;  1JY3 P;  1VQ8 P;  1PP9 D;  1LTI C;  5AW9 B;  4HH2 A;  3RK2 D;  5L8R J;  3H6P A;  1KTM A;  2OTJ P;  3CXH I;  3AE5 C;  2RN0 A;  3CX5 D;  1PGP A;  1LTA C;  3L71 D;  5AW3 B;  4D6T D;  3CWB J;  1U7M A;  5KLV K;  3RL0 C;  3R4Y A;  3SFD C;  5AW7 B;  1LJ2 A;  2KLV A;  1VQM P;  1CSB A;  1GU4 A;  3KZI H;  3W68 A;  3RBZ A;  3BCC G;  1Y9B A;  3VMZ A;  1QGK B;  1YJW P;  1K9M Q;  1RF1 A;  3SFE C;  5AVS B;  1X8Y A;  1RF1 B;  1TU3 F;  4U7J A;  1RQU A;  2QIW A;  2XV5 A;  3LIE A;  2IZ1 A;  2KIK A;  3GG2 A;  3VP8 A;  2OYI A;  2ZAE B;  1SQV D;  1N2D C;  3O6Q A;  2OYI B;  1QL2 A;  3O6Q B;  2V4H A;  4GOE A;  2J58 A;  3A0H H;  4AQR D;  2R44 A;  1KIL B;  2K37 A;  3MP7 B;  2JR8 A;  3L73 G;  1RH5 B;  3FGA D;  1OXZ A;  1KZU B;  4BRY A;  4W7Y A;  4BRY B;  4IL6 H;  1HF9 A;  3L70 E;  3RL0 B;  3WUT A;  3B71 A;  1PPJ E;  5TJH A;  4YXD C;  2PAJ A;  2QM8 A;  2DW3 A;  3FXE A;  1L0L J;  1ZLL A;  1VQ9 P;  2CPB A;  4PD4 E;  1VQ7 P;  1NTZ D;  2ZYA A;  4ZKP A;  1S3J A;  4EYY Q;  3CXH D;  3RL0 D;  3AED C;  2HLO A;  3D6Y A;  3RGU A;  3JCU E;  1JM0 A;  3BVH A;  3L71 J;  1P84 E;  3B5N C;  4D6T J;  2KYV A;  3M9Q A;  5APY A;  1FZA A;  2IBZ E;  3V2Q A;  2IPP A;  1S5L E;  3Q5P A;  3Q5S A;  1M1K Q;  3WMM 0;  1SQP G;  1K04 A;  4JQ0 D;  4UB6 H;  3BCC D;  3HE5 A;  3OJA B;  1FJP A;  4EI2 A;  1N8R Q;  3HE5 B;  1ZOY C;  3CCL P;  3IN6 A;  4K3A A;  2M3E A;  4XFJ A;  4CPG A;  1KIL E;  3G3Z A;  4OVN F;  5APV A;  2V7Q J;  1JTH A;  3VOP A;  3U59 A;  1JTH B;  5AVZ B;  4N6J A;  1FZB A;  3I5C A;  1QVF O;  2SPZ A;  1RY3 A;  2GUS A;  4GIF A;  1OX3 A;  3MGN A;  3L4F A;  1VF5 C;  4QMA A;  4WY4 C;  4H44 B;  3L75 G;  5AVT B;  1FDI A;  1ZN5 A;  3A7O A;  2O3J A;  4H13 B;  2W90 A;  2H7H A;  1AVO A;  3B5N A;  5AVY B;  2LKM A;  2W27 A;  3PLN A;  3B5N B;  2FBW C;  4L76 A;  1JY2 P;  1DD3 A;  2FYU K;  3PP5 A;  5KAF H;  1JUN A;  1NJI Q;  3A5T A;  1MZ9 A;  3GLM A;  2AXT E;  2R5D A;  2XU6 A;  5CBN A;  1AFO A;  1VDF A;  3GF3 A;  1YI2 P;  1Q2N A;  1NTZ J;  1GW3 A;  3B5N D;  3HUS C;  1EZV I;  2XZR A;  1NU1 E;  1YIT P;  5BU5 A;  1IFD A;  3LID A;  5KKZ C;  1N73 C;  2K88 A;  1SQX E;  3CCM P;  2IFM A;  2M8R A;  1ZR4 A;  1VL2 A;  3GHG C;  2E75 D;  1EZV G;  1KB9 I;  3BAT A;  2WQY C;  4JPZ B;  1WRG A;  3H1L E;  2FYN C;  1IZN B;  5KLV D;  3NMD A;  2E5Y A;  2KS1 A;  2ZXX A;  4HB1 A;  1VF5 B;  2KS1 B;  1NAY A;  4WY4 A;  3IF4 A;  1L0N E;  4WY4 B;  1ZRT D;  1ZP0 C;  4LC1 A;  3O8Z A;  1SQQ E;  3CX5 H;  3C1L A;  2I8D A;  3AEC C;  3P8C E;  1GD2 E;  5APW A;  5APQ A;  2C0X A;  1GU5 A;  1CW5 A;  2N9Y B;  4IFF A;  3L75 D;  1VF5 D;  1S72 P;  1YYC A;  2G3A A;  1KC8 Q;  3WUU A;  4ZKU A;  3HD7 D;  1NU1 J;  4YPC A;  3AE1 C;  2HFE D;  1SQV K;  1FOS F;  3V5B A;  2ZYG A;  2FXP A;  2QM7 A;  1NH4 A;  3QH9 A;  1KFM A;  1NTK K;  3KZI E;  1KFN A;  3RK3 C;  2V7Q H;  2YMY A;  2E76 C;  2Y0D A;  1S9K E;  1SQB E;  2J59 M;  3G71 P;  2Z5I A;  3QWO C;  4LLH A;  1NO4 A;  4W80 A;  1NTM K;  1L0N J;  2P1J A;  1QEX A;  2N1T B;  2QSI A;  4IL6 X;  1AVY A;  1KOR A;  1SQQ J;  2W8Z A;  1M56 D;  3PJS K;  1P84 H;  3CCE P;  1L4A C;  4U3F G;  2YXR B;  3PTZ A;  2PP6 A;  1S5L H;  3L74 E;  2M0B A;  3A0H E;  3GF7 A;  4JF7 A;  1BCC E;  1EZV D;  1JY3 N;  2WIT A;  2K1A A;  3JC2 2;  4IFM A;  2D2C D;  4H0L C;  2MJZ A;  1LP1 A;  1N7S C;  2ZFC A;  2KI7 B;  1GZL A;  1LP1 B;  1BE3 E;  1KB9 D;  1RE4 C;  2CPS A;  4GOF A;  5KLV J;  1MV8 A;  3M9B A;  3CXH H;  4PV1 B;  2H88 C;  4YTP C;  1USD A;  5C39 A;  2E76 B;  2C0W A;  3M91 A;  1SVF A;  1KQF B;  3MIW A;  3NFQ A;  3V6I A;  3HTK A;  5AW6 B;  3HTK B;  1GDT A;  4UB6 E;  1BCC J;  2G8Y A;  1L4A A;  4YXW H;  3OA7 A;  1L4A B;  3RK3 D;  4EDF A;  2R3C A;  4EOT A;  4I6M C;  1BDC A;  2E76 D;  4A7P A;  1SP4 A;  2NZ2 A;  5APX A;  1YBK A;  3VMY A;  3CWB E;  4IFD K;  2W6J H;  1OWA A;  4U3F D;  1KD1 Q;  1N7S A;  3G6E P;  1N7S B;  3M0D C;  1L4A D;  1BSH A;  3L70 G;  3H1H G;  2XDJ A;  2KUB A;  2KP8 A;  4N78 D;  2KLU A;  1VQK P;  1OW8 A;  1Q7Y Q;  3EFG A;  1LNQ A;  3RK2 B;  1JCC A;  4H0L D;  1N7S D;  1VQP P;  2K9Y A;  4HYT B;  1DD4 A;  4DOJ A;  2O1J A;  1UIX A;  1SQP K;  2P58 A;  2AEF A;  2WPS A;  5AVX B;  1DIP A;  2YNY A;  2O1K A;  1NKN A;  1KN7 A;  2KK7 A;  1GK4 A;  5KAF E;  3AEG C;  2WSF J;  3EQ2 A;  5CBO A;  4GOD A;  5AW5 B;  2FY8 A;  5CCG C;  1UII A;  4GDO A;  1PGQ A;  3TGU D;  2GM4 A;  2WSC J;  2KOG A;  2H43 A;  4W7Z A;  1YHQ P;  2FKW B;  3M0D A;  4AUW A;  2FYU E;  3FWN A;  4OWF A;  1N7L A;  5CJ0 A;  2AEM A;  1HGV A;  1L0L E;  2IX7 C;  4ASW A;  3H1J D;  5K5G B;  3AE4 C;  3CCU P;  1U57 A;  1PP9 E;  3MHV A;  1HJB A;  1T6A A;  1NOH A;  4BWN A;  3G9R A;  3H1H D;  2R3S A;  4DT0 A;  2IYO A;  2CK3 H;  1BGY G;  3CX5 E;  3L71 E;  1HTL C;  4D6T E;  1M57 D;  3L72 G;  2YO2 A;  2HYN A;  2RH0 A;  4U3F J;  2Q9I A;  3JSV C;  1NTK D;  3N7N A;  3H1I G;  4TLF A;  1IFJ A;  3VTP C;  2HOD A;  1HJ0 A;  2QJK C;  2HOD B;  2WSE J;  3CC4 P;  3II6 A;  1NTM D;  3U1A A;  1JY2 N;  2WZ7 A;  3H1K G;  1J1E C;  1KMI Z;  3SSU A;  3CD6 P;  1FOS E;  2FYU J;  1M90 Q;  1S5L X;  4M3L A;  1X22 A;  1SQX G;  4NPE A;  1JO5 A;  3P8M C;  1PP9 J;  3CI9 A;  1SQV E;  2QE7 H;  5CCG D;  1J1D C;  2P67 A;  3E1R A;  2JKV A;  1X79 B;  1VQ4 P;  5E79 H;  4RJT A;  3KDP B;  3CC2 P;  1S2E A;  3NXS A;  3WUV A;  2E74 C;  2E75 C;  3TGU J;  3AE3 C;  3W67 A;  1WMK A;  3L37 A;  1AJY A;  2YKO A;  1LT9 C;  4KJM A;  3NTN A;  2W6B A;  2QJK B;  2ZJS E;  3EWK A;  1BGY D;  2GUV A;  3VMX A;  2Y0C A;  3H1J J;  1NTZ E;  3L72 D;  1J1E B;  1R5L A;  3GW6 A;  3CXH E;  1VQO P;  3H1I D;  2WSC H;  1FE6 A;  4UB8 H;  3WU2 H;  3L73 D;  2JDI H;  1SQV J;  5AW8 B;  1KQG B;  3A2A A;  5BU8 B;  5AVQ B;  1PFI A;  3EFF K;  2QRX A;  1OVU A;  3H1K D;  1DX7 A;  3TSI A;  3M9H A;  1NTK J;  3HD7 C;  3FXD A;  3BCC E;  4ZNC A;  2OGU A;  1OW7 A;  1J1D B;  1MKM A;  3UIA A;  5AW2 B;  2A06 G;  1NTM J;  1Y47 A;  5AW4 B;  3CCJ P;  2JJL A;  4JBZ A;  2JO1 A;  2WWW A;  5GTI E;  1AA0 A;  1N86 A;  2KB7 P;  5KTB A;  2E74 B;  3OW2 O;  2E75 B;  3KHU A;  2C9L Y;  1H89 A;  2P2U A;  1BE3 G;  2WSE H;  1LT9 A;  1SQP D;  4O9B A;  3BRV B;  1LT9 B;  1JMB A;  2KXP B;  1GMJ A;  2WTY A;  1S1C X;  2B87 A;  2B87 B;  2E74 D;  2IFN A;  4OH8 B;  3KPE A;  4IOI H;  2Q5U A;  2P10 A;  1KYO I;  2D2C C;  3BCC J;  3RBX A;  1W2E A;  5TIS H;  1YTZ I;  2WPV B;  1PGJ A;  3HD7 A;  2QJP C;  2A45 H;  2I1J A;  4GKG A;  2KZJ A;  3HD7 B;  2YO3 A;  3KXD A;  2BCC G;  2ITA A;  4WVZ A;  3CPW O;  1VQN P;  2W6A A;  1LWU C;  2KSE A;  1DH3 A;  5EFW B;  4PJ0 H;  4I1L A;  5B66 H;  2IZ0 A;  2OQQ A;  4LGD E;  1QL1 A;  1AQT A;  2ZYD A;  3H1I J;  4WB4 A;  1MFZ A;  2L91 A;  1OW6 A;  3L73 J;  1JEK A;  2JP3 A;  1IK9 A;  2A06 D;  4DCK A;  1E79 H;  3HUS A;  3USS A;  2IYP A;  3HUS B;  1N73 A;  1S4X A;  1J2J B;  1YQ3 C;  5KKZ B;  5KLV E;  1N73 B;  3MZW B;  3GHG A;  2Q3I A;  1OZH A;  1ZRT E;  3Q1M A;  3GHG B;  1BE3 D;  2PGD A;  1W2B O;  4HJG H;  2D2C B;  2FYN B;  1GW4 A;  1FDM A;  2HG5 D;  4JYB A;  3AEA C;  3L75 E;  5KAI H;  3D71 A;  3SWY A;  3TYY A;  3TK1 A;  3IR9 A;  2QJY C;  1SQP J;  1T8Z A;  2IDB A;  2N9B A;  3S4R A;  1LWU A;  1LWU B;  4JYC A;  1OVR A;  4C7N A;  4C7N B;  1KYO D;  3AE8 C;  3CMA P;  3G4S P;  2BCC D;  2O01 N;  3D6Z A;  5CMZ A;  2Q3E A;  1RQV A;  3R2P A;  3C8V A;  1G1I A;  1PIX A;  3RL0 g;  1W5C E;  3CLQ A;  3RK3 B;  4DZO A;  1EDK A;  1RE3 C;  1BDD A;  1X0T A;  1X9V A;  2FXO A;  2NPS C;  2HPC A;  5E79 E;  1M8O B;  2AXC A;  1K73 Q;  2HPC B;  2WT7 A;  1EZV E;  3L75 J;  2WT7 B;  3A3Y B;  5KJ7 C;  3L71 G;  4D6T G;  1HWT C;  1JMM A;  5BVZ A;  1VQ5 P;  2KZI A;  3I55 P;  5GTI H;  1T3J A;  4AYC A;  2QJY B;  2L5G B;  2VRS A;  3M06 A;  2B9B A;  1T3U A;  2FFD C;  3VYI A;  4PD4 I;  2QEX P;  5APU A;  4H0L B;  1SQX K;  1PZQ A;  1OVV A;  1PPJ G;  1RE4 A;  1NHL A;  1HUC A;  4UB8 E;  1NAF A;  3WU2 E;  1NGM B;  1P84 I;  2QA4 P;  2UWJ E;  2R32 A;  2IBZ I;  1KV4 A;  4ASV A;  3H32 A;  3TDK A;  1RE3 A;  3RK3 E;  1NKZ B;  3H32 B;  3V4Q A;  4R4L A;  2NPS A;  1Q82 Q;  2IBZ G;  4ZMD A;  3TF5 A;  3ZDM A;  2OYO A;  3AE6 C;  4HKZ H;  1EDL A;  5APT A;  4EIJ A;  2K3R A;  1IK7 A;  4U3F E;  2E43 A;  1G2C A;  4I7Z C;  1KIL C;  1G2C B;  4N78 E;  2NPS D;  1SFC C;  3OAK A;  1Q90 D;  2FFD A;  5H2F E;  5KJ7 D;  2FFD B;  1NTZ G;  3LW5 J;  2OAR A;  1SQB K;  3H25 A;  2OTK E;  1G1J A;  2XND H;  1GK6 A;  2W83 C;  1FU1 A;  4I2L C;  2RKL A;  1FAV A;  1NVO A;  4MN4 C;  5TIS E;  1E5W A;  5GTH H;  2OTL P;  3BRT B;  1EXI A;  2BEQ D;  1A02 J;  3L70 D;  1EDI A;  4L75 A;  1XTC C;  1PPJ D;  4Y28 J;  3FWL A;  3HRN A;  2BAS A;  2LXC B;  2C9N Y;  1URQ C;  2I1K A;  4PD4 D;  5AVV B;  4WWI A;  4TT3 H;  3Q5R A;  3C9I A;  4PJ0 E;  5B66 E;  2M3B A;  4OGQ C;  4R4M A;  4NPD A;  1LTB C;  3TGU E;  2PFX A;  1P84 D;  1KIL A;  5CCG A;  4I7Z B;  3AEE C;  5CHX A;  2GA1 A;  2IBZ D;  1NU1 G;  1AV1 A;  1SFC A;  1RF0 C;  1SFC B;  2HR3 A;  3H1J E;  2LR2 A;  1Y8A A;  2J5U A;  2YKQ A;  5CCH C;  3H1H E;  1YTZ T;  1IFN A;  1PL5 A;  1KIL D;  3H1L G;  1USE A;  1EQ7 A;  2O01 J;  1U7J A;  1OMI A;  1YIJ P;  2Q1K A;  4NPF X;  4DJG A;  1SFC D;  4B86 A;  3IFM A;  1L0N G;  4H44 C;  1ZXG A;  1NTK E;  3HE4 A;  3HE4 B;  2JWA A;  2WMM A;  1SQQ G;  2Q7C A;  1CZQ A;  1VQL P;  2Z5H A;  5KAI E;  3TNU A;  4H13 C;  3PHL A;  1FZE A;  3TNU B;  1URQ A;  2ZT9 C;  1NTM E;  3IAO A;  1URQ B;  4K35 A;  1KB9 H;  2QG4 A;  3PRJ A;  1VPC A;  1KYO H;  1IFI A;  1DEB A;  2WSF H;  2YKP A;  3VP9 A;  1K8A Q;  4OGQ B;  1FZF A;  2KNC A;  3N4X A;  2WSS H;  2KNC B;  3BAS A;  1YJN P;  3L36 A;  1JCD A;  1URQ D;  4KHX A;  3L70 J;  3H1H J;  3LW5 H;  1RF0 A;  5KLV G;  3PH0 A;  1LTS C;  3S1K A;  1L2P A;  1SQB G;  2BEZ F;  4OGQ D;  5CCH A;  4Z1M H;  2YMK A;  3A0B H;  1R5S A;  3MTU E;  2ZVO B;  1M1J C;  5AW1 B;  2P7J A;  1OIP A;  1HH0 A;  1NU1 D;  3ABV C;  1JOC A;  1A02 F;  3S9O A;  1SQX D;  1ZW0 A;  3L74 G;  1XTG B;  5CJ4 A;  3L35 A;  1BCC G;  1JY2 O;  3V4W A;  5CCH D;  3T97 A;  3KYQ A;  1IC2 A;  3H1L D;  3T97 B;  1BGY E;  1KQS O;  2ZT9 B;  1R8E A;  3L72 E;  1L0N D;  2E42 A;  3AE2 C;  1EC5 A;  3AE9 C;  5AVR B;  1KQL A;  1FZG A;  3H1I E;  4C7R A;  2WVR A;  4H44 D;  1LTT C;  1SQQ D;  2WPQ A;  5DJU B;  4L74 A;  3SWK A;  3L73 E;  5H2F H;  3P8C D;  2LXB A;  1LT1 A;  1QX8 A;  4H13 D;  5M1B A;  1L0L K;  3H1K E;  2ZT9 D;  3MUD C;  4XE5 B;  2XKM A;  1Z56 A;  1LTG C;  1H8A A;  3Q3D A;  1H0T A;  2O01 H;  3M0A A;  2FXM A;  1H0T B;  1WT6 A;  1M1J A;  2R5B A;  5AVW B;  2N1T C;  3CCS P;  3F5H A;  1M1J B;  2WPR A;  3V2N A;  5B5E E;  3SWF A;  2Y9Y A;  5AVU B;  1QVG O;  1S9K D;  3P32 A;  1SQB D;  1QLE D;  1BGY J;  3KQG A;  1MUU A;  2MKV A;  1FDO A;  3L72 J;  1JNM A;  2Z4E A;  1SQP E;  5APS A;  2PRR A;  3CWB G;  2B89 A;  5AW0 B;  2YXQ B;  1YJ9 P;  3AEF C;  1T2K C;  1GTW A;  5DJT B;  1PV3 A;  3P7K A;  1H88 A;  3L74 D;  3V2P A;  3H1K J;  1HGZ A;  2POH A; 
#chains in the Genus database with same CATH homology
 1RY3 A;  4WY4 D;  2GUS A;  4GIF A;  3VN0 A;  4AYC A;  3MGN A;  3L4F A;  1HTL C;  2L5G B;  2VRS A;  3M06 A;  1FZC C;  1T3U A;  2FFD C;  3VYI A;  4XA4 A;  4GT1 A;  5APU A;  2YO2 A;  2HYN A;  2Q9I A;  4WY4 C;  3B8E B;  1SQX K;  3MUD A;  1M7L A;  3N7N A;  5AVT B;  1IFJ A;  2ZXE B;  3VTP C;  1ZN5 A;  3A7O A;  1RE4 A;  2HOD A;  1NHL A;  1AQ5 A;  1HUC A;  2HOD B;  1NAF A;  2H7H A;  3II6 A;  3B5N A;  3U1A A;  1JY2 N;  5AVY B;  2WZ7 A;  2LKM A;  2W27 A;  3B5N B;  1J1E C;  2R32 A;  1FOS E;  2N1T A;  1JY2 P;  1GL2 C;  1IO4 A;  2FYU K;  4M3L A;  3PP5 A;  1JUN A;  3H32 A;  1LGH B;  3A5T A;  1FBM A;  1RE3 A;  1MZ9 A;  1NKZ B;  2R5D A;  3H32 B;  3V4Q A;  2XU6 A;  1AFO A;  1JO5 A;  1VDF A;  2NPS A;  3P8M C;  4Y99 C;  1GW3 A;  3B5N D;  1NTZ K;  3HUS C;  2XZR A;  3CI9 A;  5BU5 A;  5CCG D;  1IFD A;  3LID A;  1J1D C;  5APT A;  1N73 C;  4EIJ A;  2P67 A;  2N1T D;  2IFM A;  1X79 B;  2E43 A;  2M8R A;  1ZR4 A;  1FJK A;  1G2C A;  3GHG C;  1KIL C;  1G2C B;  1ZR2 A;  2OYH C;  4N78 E;  3BAT A;  2NPS D;  1WRG A;  3KDP B;  2A45 I;  1SFC C;  3OAK A;  1NWQ A;  4RES B;  3NXS A;  1FZC A;  3NMD A;  2FFD A;  3RK2 C;  3V2R A;  5KJ7 D;  1FZC B;  2FFD B;  4WY4 A;  2OAR A;  2H8P D;  4WY4 B;  1SQB K;  1T2K D;  4LC1 A;  3O8Z A;  3L37 A;  4WBA A;  2A45 G;  2YKO A;  1LT9 C;  3NTN A;  2W6B A;  1G1J A;  3P8C E;  1ZV8 A;  1GK6 A;  2XNX A;  1FU1 A;  4I2L C;  2GUV A;  3VMX A;  1GD2 E;  1LTJ C;  5APW A;  1FAV A;  5APQ A;  2C0X A;  1GU5 A;  1E5W A;  4C46 A;  1CW5 A;  1J1E B;  4IFF A;  3BRT B;  1A02 J;  1GL2 A;  1YYC A;  1XTC C;  2WSC H;  1HBW A;  1GL2 B;  3CL3 D;  4ZKU A;  3HD7 D;  3HRN A;  2BAS A;  2C9N Y;  5AW8 B;  1NU1 K;  1URQ C;  2HFE D;  1SQV K;  3E1I A;  3A2A A;  5BU8 B;  1FOS F;  2I1K A;  5AVQ B;  3U1C A;  3V5B A;  1PFI A;  5AVV B;  1IJD B;  2QM7 A;  1DX7 A;  1NH4 A;  2JEE A;  4Y99 B;  3TSI A;  3M9H A;  3C9I A;  3HD7 C;  1KFM A;  2M3B A;  1NTK K;  1KFN A;  3RK3 C;  1LTB C;  2YMY A;  1J1D B;  1GL2 D;  1S9K E;  3UIA A;  5AW2 B;  2J59 M;  2FYZ A;  2Z5I A;  4LLH A;  4N3Y B;  1NO4 A;  4W80 A;  1KIL A;  5CCG A;  5CHX A;  1NTM K;  5AW4 B;  2OYH A;  2JJL A;  1IFM A;  2P1J A;  2OYH B;  2WWW A;  1L0N K;  2N1T B;  1SFC A;  1RF0 C;  1SFC B;  1RF1 C;  1N86 A;  1HVV A;  1SQQ K;  1L4A C;  2KB7 P;  5KTB A;  2PP6 A;  2YKQ A;  2C9L Y;  1JY3 O;  5CCH C;  1H89 A;  2NPS B;  2P2U A;  2KSJ A;  2WSE H;  1YTZ T;  1IFN A;  4JF7 A;  1LT9 A;  1SLQ A;  5KJ7 A;  4O9B A;  3BRV B;  2OYI C;  1KIL D;  1LT9 B;  1JY3 N;  1EQ7 A;  1CI6 A;  2WIT A;  1LTJ A;  1CI6 B;  2WTY A;  4IFM A;  1LTJ B;  3MD0 A;  1SFC D;  1JY3 P;  4B86 A;  3IFM A;  2MJZ A;  1N7S C;  2ZFC A;  3HE4 A;  1LTI C;  5AW9 B;  4HH2 A;  3RK2 D;  2IFN A;  1GZL A;  3H6P A;  4OH8 B;  3KPE A;  3HE4 B;  2Q7C A;  1CZQ A;  2Q5U A;  2Z5H A;  1RE4 C;  3TNU A;  1FZE A;  3TNU B;  1URQ A;  1LTA C;  1W2E A;  5AW3 B;  2CPS A;  1URQ B;  1YTZ I;  1MV8 A;  3M9B A;  5KLV K;  3RL0 C;  1VPC A;  3HD7 A;  2A45 H;  1IFI A;  2I1J A;  1DEB A;  4GKG A;  3HD7 B;  2WSF H;  5AW7 B;  2YO3 A;  2KLV A;  2YKP A;  3VP9 A;  1FZF A;  2C0W A;  2W6A A;  3N4X A;  3M91 A;  1LWU C;  1SVF A;  3BAS A;  1DH3 A;  3L36 A;  4I1L A;  1JCD A;  1CSB A;  3MIW A;  1URQ D;  3NFQ A;  1GU4 A;  3HTK A;  5AW6 B;  4LGD E;  4KHX A;  3HTK B;  1GDT A;  1QL1 A;  3LW5 H;  3VMZ A;  4WB4 A;  1RF0 A;  1RF1 A;  1MFZ A;  5AVS B;  1LTS C;  1L4A A;  1X8Y A;  1RF1 B;  3OA7 A;  1L4A B;  2XV5 A;  3RK3 D;  2R3C A;  3LIE A;  4EOT A;  4I6M C;  5CCH A;  1IK9 A;  1SP4 A;  3MTU E;  3HUS A;  1M1J C;  5AW1 B;  3VP8 A;  2OYI A;  2P7J A;  3HUS B;  1HH0 A;  5APX A;  1N73 A;  1N2D C;  1J2J B;  1JOC A;  2OYI B;  1A02 F;  3VMY A;  1QL2 A;  1N73 B;  4IFD K;  1OWA A;  1N7S A;  2J58 A;  3GHG A;  2Q3I A;  4AQR D;  1XTG B;  1N7S B;  3M0D C;  5CJ4 A;  1L4A D;  3GHG B;  2XDJ A;  1KIL B;  2KP8 A;  3L35 A;  4N78 D;  1JY2 O;  3V4W A;  5CCH D;  3T97 A;  3KYQ A;  1IC2 A;  1GW4 A;  1OXZ A;  3EFG A;  1KZU B;  4N6J A;  3RK2 B;  4W7Y A;  1FDM A;  2HG5 D;  2E42 A;  4JYB A;  5AVR B;  1JCC A;  1KQL A;  1FZG A;  3RL0 B;  4C7R A;  3SWY A;  1LTT C;  3TYY A;  1N7S D;  2WPQ A;  3TK1 A;  3IR9 A;  4HYT B;  4DOJ A;  2PAJ A;  3P8C D;  1T8Z A;  2O1J A;  2N9B A;  2QM8 A;  1SQP K;  1LWU A;  1ZLL A;  2CPB A;  1LWU B;  4JYC A;  1L0L K;  4ZKP A;  2WPS A;  5AVX B;  4C7N A;  2YNY A;  4XE5 B;  2O1K A;  4C7N B;  1NKN A;  3RL0 D;  2XKM A;  2HLO A;  1GK4 A;  1Z56 A;  1LTG C;  3EQ2 A;  3BVH A;  1H8A A;  5CMZ A;  3B5N C;  2KYV A;  5AW5 B;  3R2P A;  3M9Q A;  5APY A;  1FZA A;  2O01 H;  5CCG C;  3V2Q A;  3M0A A;  2IPP A;  2FXM A;  1G1I A;  1WT6 A;  1M1J A;  2R5B A;  5AVW B;  3CLQ A;  2N1T C;  3WMM 0;  1M1J B;  2WPR A;  3HE5 A;  3V2N A;  3SWF A;  3OJA B;  1FJP A;  3HE5 B;  3RK3 B;  5AVU B;  4DZO A;  1S9K D;  3P32 A;  2GM4 A;  2KOG A;  1RE3 C;  2H43 A;  4W7Z A;  3KQG A;  1MUU A;  2FKW B;  3M0D A;  4AUW A;  1X9V A;  2NPS C;  2HPC A;  1JNM A;  2Z4E A;  2HPC B;  2WT7 A;  1N7L A;  5CJ0 A;  1HGV A;  5APS A;  2WT7 B;  3A3Y B;  3G3Z A;  5KJ7 C;  2IX7 C;  5APV A;  5AW0 B;  1T2K C;  1HWT C;  1JMM A;  1GTW A;  5BVZ A;  1JTH A;  3P7K A;  3VOP A;  1H88 A;  3U59 A;  1HJB A;  1JTH B;  3V2P A;  5AVZ B;  1NOH A;  1FZB A;  1HGZ A;  3I5C A;  2POH A;  1T3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...