3B5NB

Structure of the yeast plasma membrane snare complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
69
structure length
69
Chain Sequence
ALAEVQARHQELLKLEKSMAELTQLFNDMEELVIEQQENVDVIDKNVEDAQLDVEQGVGHTDKAVKSAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Synaptobrevin homolog 1
publication title The Structure of the Yeast Plasma Membrane SNARE Complex Reveals Destabilizing Water-filled Cavities.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
total genus 32
structure length 69
sequence length 69
chains with identical sequence F, J
ec nomenclature
pdb deposition date 2007-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3b5nB00
2NPSA 2N1TA 1T3JA 4N78E 3RK2D 1N7SB 3RK3D 4W7ZA 2YMYA 1GL2D 4W80A 4LGDE 3RK2C 3B5NA 4W7YA 3RK3C 1GL2C 2H8PD 2NPSD 2N1TD 2NPSC 1N7SA 2N1TC 3M0DC 1KILB 3B5ND 3HD7B 2HG5D 1HVVA 2KOGA 1NHLA 1URQB 5CCHA 1SFCA 1L4AB 3B5NC 1JTHB 3RL0D 3TSIA 2M8RA 3P8CE 1N7SD 3RL0C 1N7SC 3HD7A 5CCHD 1SFCD 3HTKB 1URQA 3RK2B 3KYQA 5CCHC 1SFCC 3RK3B 1GL2B 4WY4B 3HD7D 1URQD 2NPSB 2PP6A 1L4AD 2WZ7A 3HD7C 1URQC 1KILA 4WY4A 4JF7A 2XDJA 3PP5A 1L4AA 1JTHA 5KJ7A 5CCGA 3RL0B 2HFED 1KILD 4OH8B 4WY4D 1KILC 3VOPA 2N1TB 4WY4C 1SFCB 5KJ7D 1XTGB 5CCGD 1L4AC 1GL2A 5KJ7C 5CCGC 3B5NB
chains in the Genus database with same CATH superfamily
1YHQP 4UB6E 4L76A 4I2LC 2ZYGA 3M0DA 2KYVA 2I1KA 2O1KA 3RK2C 2WSFH 4W7YA 2I1JA 1SQBE 1FDIA 1BCCJ 3KPEA 2NPSC 3AE3C 5E79H 2K9YA 3QH9A 3H1LE 3B8EB 1G2CA 1HUCA 2Q5UA 1VQ9P 4N78D 3CWBG 1Q90D 5KAIH 4CPGA 3HE5A 2B89A 3KXDA 2FFDA 4DT0A 3GG2A 2LXCB 3ABVC 3PRJA 1J1EC 2KSJA 4GOEA 1DEEG 1KFNA 2WZ7A 3L37A 1AA0A 5DJTB 3H1KJ 5AW3B 1KILA 4L75A 2AXCA 5BU5A 1N8RQ 3LW5H 2E5YA 1LGHB 1M1JC 1VQ8P 1GW3A 1JOCA 1PGPA 1KYOI 5AVTB 5KLVD 4EOTA 3VOPA 2VRSA 1SFCB 5GTIH 1RE4C 4GDOA 3E7KA 1EDKA 2E76B 1NU1J 2IPPA 1FZCA 3JCUH 1FZAA 3HUSB 2H43A 3BRVB 4D6TD 3TGUJ 5AW2B 2HODB 3SWFA 1L0LK 2FXMA 2Y9YA 2CK3H 1L0LD 2A45H 1VF5B 2W90A 1JM0A 1S9KE 2KP8A 4HH2A 2IBZE 1GTWA 2K37A 1Q81Q 1BSNA 1Y9BA 3M91A 2M8RA 1SQQK 3II6A 3GW6A 1X8YA 1YTZT 2Y9ZA 2QJPB 5KLIB 2FY8A 1NTZE 2FYNC 3AEFC 1KTMA 1RF0A 2FYUD 1SFCC 1E79H 3AEGC 4WY4B 2QJYB 2Y0EA 1BDDA 1FZEA 3T97B 1URQD 1FZFA 1KQSO 1LWUA 1N2DC 1MZ9A 1PIXA 3CI9A 4RJTA 2K1AA 2JO1A 3L4FA 2FKWB 2QJKB 1SLQA 4EYYQ 1UIXA 2HFED 1X22A 4IFFA 4OH8B 3L75E 4DOJA 2WPSA 2AEFA 1YTZI 2G8YA 3MP7B 4PJ0H 3SFDC 2BCCJ 4YXDC 3G6EP 1SQPE 3RK3D 2QJPC 1GL2D 5B66H 1VL2A 5KLIC 3C9IA 1N86A 5AW6B 1T2KC 4LGDE 1IZNB 3VMYA 1LNQA 1OX3A 3BCCE 2RKLA 5H2FH 5L8RJ 2HG5D 5CCHA 1L4AB 2C0XA 2KLVA 2LKMA 2O3JA 1SQXE 3AEBC 1ZW0A 3OA7A 2LXBA 2KLUA 3HE4A 5APTA 1L0NE 2WSCH 1VQ5P 3VYIA 3HD7D 3IAOA 2AXTE 1Q82Q 1Q86Q 2LR2A 1W5CE 1A02J 2O1JA 4H13C 3VP8A 3A7OA 2XNXA 2PAJA 3P8CD 2OYOA 1P84E 1GDTA 1SVFA 5KAIE 2M5AB 2W8ZA 1SQQJ 1L4AC 3GF3A 1AVOA 3IR9A 1D7MA 3WUUA 4ZKPA 2OYHA 1S5LH 4UB8H 3PTZA 1N73A 1VQNP 1YQ3C 3L73E 3CX5D 2H8PD 2KS1B 3H1ID 1IC2A 1YBKA 2UWJE 1ZR2A 3WU2E 3A0HH 3B5ND 5GTIE 1EZVE 1SQBK 1LJ2A 1GD2E 2HR3A 1T6AA 1SQVE 1OXZA 2V7QJ 3V4QA 4IL6E 2E75D 1E5WA 5KLVG 4XA4A 2YO3A 5BVZA 3L71E 5CJ0A 3GMAA 4K35A 2XU6A 3SSUA 3H1JD 1IK9A 1NTME 4RKUJ 4AQRD 2E5TA 2OARA 1LTSC 5AVQB 3VTPC 4H44D 4D6TG 5AVWB 2E43A 5KKZB 1BGYJ 5CCGD 1BCCD 2YXQB 1L0LG 3NFQA 4IFDK 3O6QB 2KB7P 2WTYA 1FZGA 5AVXB 3L70J 1NO4A 2C0WA 2O01H 2JKVA 3A0BE 2ZVOB 2OGUA 4W7ZA 4WBAA 3EQ2A 1RE3A 1SS1A 3Q5PA 1KB9E 1KORA 1LTIC 2N1TD 3CMEP 3HUSA 1BE3D 1K8AQ 2FYUG 4H0LD 1JMMA 2HODA 4PJ0E 3IFMA 1OVVA 1N7SD 3EFFK 3VMZA 3H1KD 5AVUB 2B87A 3H1HJ 4OVNF 1FU1A 2IDBA 5KKZC 1RQVA 2J58A 3NMDA 3RK3B 1GL2B 4GOFA 1IJDB 1NTKE 1FS0E 1NTZK 2CPBA 3L74E 3S4RA 1W2EA 1URQC 4WY4A 1EXIA 1PP9E 3UIAA 1NU1D 1HJBA 5AVZB 3AE9C 4C7RA 3TGUD 3D6ZA 3Q5SA 2XZRA 3RGUA 1RY3A 2ZT9D 2FYZA 1VQ6P 1AQ5A 4QMAA 5KJ7D 4EIJA 1RF1A 2Z5IA 3A3YB 2HPCA 1YI2P 3H1HE 5APQA 1JY3N 1HGVA 1H0TB 1VDFA 2QA4P 3FGAD 3H1LJ 3OAKA 2KI7B 2JJLA 3RK3C 3Q2YA 1GL2C 1IO4A 1IFNA 5CHXA 3V5BA 2YXRB 4JBZA 4L74A 5CJ4A 3D71A 2K88A 1NAFA 1PPJD 1JTHB 3CWBE 3MUDA 3CCUP 4RESB 1YITP 4NPFX 1QVFO 1M1JB 1MV8A 1BDCA 1LT9B 1FJPA 1HH0A 5AVVB 3WUVA 4U3FJ 3I5CA 1JY2O 4ZMDA 1SQXK 2M3EA 1ZRTD 3O8ZA 3GHGB 1OZHA 3A2AA 3HD7C 3PLNA 1L0NK 4KT0J 1LP1B 3SFEC 2BCCD 2XDJA 3CCRP 2FXPA 2R3SA 5GTHH 1KYOE 5APUA 4PD4D 1KILD 3I56P 2ZAEB 2A06D 1SP4A 3H1IG 2XV5A 3RL0g 1G1IA 2HLOA 1DD3A 3M06A 4PV1D 2E75B 3H32B 4L73A 3F5HA 3TDKA 4LC1A 2OTLP 4U3FE 4HJGH 2JR8A 1LT9C 2IFMA 3AE2C 1FZBA 1VQ7P 3CD6P 1VPCA 2FYNB 2Q3EA 2POHA 3D70A 1OW8A 1NTZJ 4H44B 3GHGC 3D6YA 2ZXXA 5CBOA 3G9RA 1FC2C 2MJZA 2QRXA 2GUVA 1U57A 2E74D 4YTPC 3B5NC 3FX0A 4N3YB 2NZ2A 1VQOP 3V4WA 2JEEA 3H1JG 1X79B 1NKNA 1NWQA 1K73Q 2YKQA 3ZDMA 1LTJA 3VP9A 3FXDA 1FDMA 3L75J 2D2CD 1SQVK 1GZLA 1NAYA 2E75C 1BCCG 1CI6B 1SQQD 3BATA 4H0LB 1S5LX 1OVRA 2AEJA 3MTUE 3I55P 1SQPJ 1FAVA 1BSHA 1S4XA 2P58A 4H44C 3TK1A 3CXHH 3BCCJ 1BE3G 1KQLA 3CXHD 3HRNA 1U7JA 5C39A 5CCGC 1QLED 4ZKUA 2IX7C 1AQTA 1T3JA 5AW4B 2AEMA 3H1KG 4GKGA 3O6QA 3LIEA 1SQXJ 4OGQD 4I7ZB 2G3AA 2J59M 1HF9A 1L0NJ 1NGMB 2N1TC 4AUWA 5B5EE 2ZT9B 4H0LC 3Q3DA 3RL0D 1LTAC 4H13B 2OTJP 4Y99B 4DJGA 1N7SC 1NU1G 5CCHD 2K9JB 3TYYA 2Q7CA 1ZXGA 1JB0J 1S2EA 3TGUG 1DX7A 4N6JA 1PGJA 1BGYD 4WB4A 2M3BA 3L70D 5AW7B 1NTKK 1FJKA 4R4MA 4I7ZC 1JUNA 1KMIZ 3LW5J 2W83C 2JWAA 2KNCB 3KZIH 3L73J 1S3JA 3M9QA 2QG4A 2C9NY 2ZT9C 5E79E 2OYIC 1G2CB 1CW5A 5KJ7C 1OWAA 4YXWH 3V2NA 3AE5C 3PJSK 1PZQA 2J5UA 2NPSA 4Y99C 1PPJG 4N78E 5GTHE 3P8MC 2FFDB 1EC5A 3H1HD 1SQVJ 1H0TA 3TNUB 2N9YB 3L72D 3EWKA 3M0DC 1KILB 1EDIA 3L71J 1NOHA 5AW5B 4U7JA 3CX5H 4UB6H 1NTMJ 4DZOA 2BCCG 3AE6C 4PV1B 2IFNA 5KLVE 4PD4I 3KDPB 4JPZB 3Q5RA 2A06G 1M1JA 2DW3A 1SQBD 3H6PA 1OW6A 3AE7C 3NXSA 3M0AA 3JCUE 3M9BA 4D6TE 1WT6A 5APSA 1RE4A 3PP5A 2FFDC 2E74B 3H1LD 1L0LE 1GK6A 1GW4A 2WSEH 3IF4A 1LTGC 5AVSB 1LP1A 1VQ4P 4EDFA 1KILC 5APYA 1EXJA 3N7NA 4DCKA 1HJ0A 1ZP0C 2D2CB 1OFCX 3KQGA 4PV1C 1MKMA 1A02F 2FYUE 1J2JB 2R5BA 1Y8AA 3H32A 5AW0B 1IFMA 2YO2A 1FZCC 4U3FD 2WSSH 1LWUB 2RH0A 3OW2O 1NKZB 2Z5HA 2ZVNB 2FBWC 1OIPA 4C7NB 2E76D 2KOGA 4JYBA 1URQB 1SFCA 1NTKJ 3SWKA 2YMKA 1DEBA 3L74J 1PFIA 3MZWB 1SQQG 1QL2A 4C46A 2E74C 2I8DA 1YYCA 1PP9J 2PFXA 1Q7YQ 2PRRA 5BU8B 5TISH 2YIUC 1VF5D 1GU5A 5KAFH 3W68A 5M1BA 2WSCJ 3C8VA 2KSEA 3CXHI 2D2CC 1FDOA 1YJWP 5AW9B 3RK3E 1GU4A 1S9KD 2IBZD 2JP3A 3CLQA 1RH5B 1RF0C 5B66E 2B9BA 1MFTA 3RL0B 1FE6A 5AW8B 4TLFA 2WMMA 1K9MQ 1NH4A 4WY4D 5H2FE 3V2RA 3CCLP 1S72P 1LWUC 1DD4A 2WPVB 1NTZD 1WMKA 1PGOA 2ITAA 3T97A 3CWBJ 1MFZA 1GMJA 3R2PA 3WMM0 4A7PA 4I6MC 2Q3IA 1IFJA 2WPRA 4OGQC 5K5GB 1HBWA 1KV4A 3L75D 2Q1KA 4IL6X 3HD7B 3B4SA 3BVHA 5CBNA 1BGYG 1M90Q 3AECC 2ZXEB 3TSIA 3P8CE 1WRGA 3RL0C 1LT1A 3L70G 1SQPK 1IFDA 2Y0DA 4AYCA 2QSIA 1QVGO 4B86A 1SQPD 2XNDH 2MKVA 3U59A 5CCHC 1U7MA 2BEQD 1JCDA 2R5DA 2OYHB 3IN6A 1L2PA 3BCCD 1L4AD 1FOSF 1JY2N 2K9JA 2ZJSE 2QM8A 1S5LE 1N73B 1QL1A 4UB8E 1KZUB 3CX5E 4NPDA 1L4AA 3H1IE 4EI2A 3MIWA 2OQQA 2YKOA 2WITA 3H1HG 1SQXD 5EFWB 3A0HE 3CPWO 4YPCA 4MN4C 1L0ND 3L72G 2KZIA 3MHVA 3K5BA 3B5NB 4Y28J 1IFPA 4R4LA 3RBXA 4PD4H 2KNCA 3EFGA 2P2UA 1HWTC 2AXTH 2P7JA 2Q6QA 1JY3P 1YQ4C 3CX5I 3AEAC 2O01J 2SPZA 1IFIA 4GT1A 4NPEA 2OYHC 4IFMA 3SWYA 1P84H 1BE3J 3H1JE 3L36A 3VMAA 1P84D 2GM4A 1N7LA 2M5AA 3U1CA 1HVVA 1NHLA 1SQBG 1N73C 3TNUA 3AE8C 1USEA 3MGNA 2KUBA 1JY2P 3H1LG 1BCCE 3G3ZA 3FXEA 3TF5A 4JQ0D 3E1IA 3FWLA 3L73D 5KLVK 4LLHA 3BRTB 2KS1A 3G71P 1PGQA 1XTCC 2WT7B 3WU2H 1ZN5A 1AJYA 1ZOYC 1EZVD 1QX8A 2BEZF 1EQ7A 1T3UA 1S1CX 1BE3E 2WPQA 2Y0CA 2N9BA 1OVUA 2CPSA 1SQVD 5TISE 2N1TB 4IL6H 1R5LA 2WVRA 5KAFE 4U3FG 3PH0A 5TJHA 1G1JA 2M0BA 3H1KE 2GUSA 3VMXA 2B87B 3CCSP 4TT3H 3L71D 4KHXA 1QEXA 5APVA 1N7SB 1VQLP 1NTMK 1CSBA 4W80A 3E1RA 1NTMD 2C9LY 5DJUB 4BRYB 2Z4EA 3CC7P 2FYUK 1X9VA 4BWNA 1NU1E 1RE3C 1R5SA 1M1KQ 2E76C 2JDIH 2XKMA 2IBZI 1GK4A 1K05A 3TGUE 2IBZG 3QWOC 2ZYDA 3HUSC 2V7QH 1NVOA 3GF7A 3A0BH 4C7NA 1Y47A 2BASA 3HTKB 1URQA 2WSFJ 3WUTA 5AW1B 1MUUA 1RF1B 1KB9H 2HPCB 1IK7A 4ASWA 1KQGB 1KB9D 2OYIB 1VF5C 2FXOA 1DIPA 1NTZG 3A5TA 1J1DB 1EDJA 1ZR4A 3CC2P 2O01N 3S1KA 2JWDA 1M56D 1RQUA 3AE4C 2IYOA 1UIIA 4GODA 4WY4C 1PPJE 2QJYC 2QVAA 1GL2A 3L75G 2ZFCA 1HGZA 3CCVP 3Q1MA 1NTKD 3L74D 3RK2D 4I1LA 1FBMA 2YMYA 1NYHA 1M8OB 2QJKC 3USSA 1PP9D 1RF1C 1VQPP 2H88C 5KLVJ 2IZ1A 2NPSD 1ZRTE 4M3LA 1SQPG 2IYPA 1LTBC 1AFOA 1QGKB 2K3RA 2QIWA 3LIDA 1J1DC 2BCCE 3CCEP 3BCCG 1W2BO 1H88A 3HE5B 4KJMA 1M7LA 4PD4E 1YJNP 3AEDC 4D6TJ 3L35A 1YIJP 2H7HA 1KILE 3KHUA 4HKZH 3CCMP 1KN7A 3HD7A 5AVYB 2A06E 1H89A 1L0LJ 3N4XA 3MUDC 1KQFB 1SQXG 2OTKE 5APXA 3AEEC 3V6IA 2B88A 1L0NG 1JO5A 2L5GB 4HB1A 2W6JH 1JTHA 4OWFA 3CWBD 1X0TA 1LTTC 2FYUJ 2QEXP 2KK7A 2ZYAA 4XFJA 1FZCB 3S9OA 1JEKA 1LT9A 3ITKA 3CMAP 1P84I 4ASVA 5KTBA 1K04A 3GHGA 2KZJA 1KD1Q 1VQKP 1LTJB 1KFMA 1KYOH 4BXLA 3B5NA 2YIUB 4GIFA 1KYOD 2YKPA 4HYTB 1SQQE 4WWIA 3L73G 1NJIQ 2H89C 1EZVI 2HYNA 3W67A 1JCCA 3NTNA 3P32A 4Z1MH 1EZVG 3FWNA 4XE5B 1RHZB 1SFCD 4JYCA 3CXHE 1R8EA 1EDLA 2KXPB 1TU3F 3F89A 1SQVG 5AVRB 2P10A 3H25A 2WQYC 2A45I 3C1LA 3PHLA 4JF7A 1T8ZA 1LTJC 5APWA 3L71G 1M57D 2A45G 2WT7A 1Z56A 5CCGA 3M9HA 1NTMG 1ZMEC 3RBZA 4OGQB 1OW7A 1AV1A 2R44A 2KIKA 1VQMP 1PL5A 4IOIH 1AVYA 3BASA 2N1TA 1CI6A 1T2KD 2QM7A 2WWWA 3P7KA 2QE7H 2W6BA 3B71A 1PV3A 1BGYE 2W6AA 2NRGA 3CCJP 3OJAB 2RN0A 1N7SA 3GLMA 1KB9I 2P1JA 2R32A 1YJ9P 1ZLLA 1JMBA 3L72J 3U1AA 3CL3D 3JC22 4RO0A 3L70E 4BRYA 3HE4B 3V2PA 3G4SP 1USDA 1HTLC 2E42A 1NU1K 1OMIA 3H1IJ 5CMZA 3KZIE 4WVZA 3RK2B 1KC8Q 3KYQA 1DH3A 1Q2NA 3MD0A 1H8AA 1FOSE 2L91A 1CZQA 2R3CA 2NPSB 2PP6A 3HTKA 1SQBJ 2IZ0A 2RMZA 5B5EH 4H13D 3AE1C 4ZNCA 2Q9IA 2OYIA 3R4YA 3CC4P 1NTKG 2YNYA 5KJ7A 3JSVC 3L74G 4O9BA 2GA1A 3L72E 1JNMA 1PP9G 3V2QA 1ZV8A 3CCQP 2PGDA 2V4HA 2WSEJ 1XTGB 1JY3O 2P67A 4K3AA 1J1EB 3H1JJ 3VN0A 2W27A
chains in the Genus database with same CATH topology
2GUSA 3VMXA 1NO4A 2C0WA 4I2LC 2NPSA 4KHXA 2O01H 4Y99C 3M0DA 2KYVA 4N78E 5APVA 2I1KA 1N7SB 4W7ZA 1NTMK 4WBAA 3EQ2A 1CSBA 4W80A 2O1KA 1RE3A 3P8MC 3RK2C 2FFDB 2C9LY 2WSFH 4W7YA 1LTIC 2Z4EA 3TNUB 2I1JA 2N1TD 3KPEA 3HUSA 2FYUK 2NPSC 3M0DC 1X9VA 1KILB 1JMMA 2HODA 1NOHA 1RE3C 3IFMA 5AW5B 3B8EB 1G2CA 2XKMA 1N7SD 1GK4A 3VMZA 1HUCA 5AVUB 3HUSC 4DZOA 2IFNA 2Q5UA 4C7NA 1FU1A 2BASA 3HTKB 1URQA 4N78D 5AW1B 1MUUA 2J58A 3KDPB 3HE5A 1RF1B 3NMDA 3RK3B 2HPCB 1GL2B 2FFDA 1J1EC 2OYIB 2KSJA 1IJDB 1M1JA 1KFNA 3H6PA 2WZ7A 1NTZK 2CPBA 3L37A 3NXSA 1W2EA 3A5TA 1J1DB 3M0AA 1URQC 3M9BA 5AW3B 1KILA 1ZR4A 1WT6A 4WY4A 5APSA 5BU5A 1RE4A 3UIAA 3PP5A 2FFDC 3LW5H 1HJBA 5AVZB 1LGHB 1M1JC 4C7RA 1GK6A 1GW3A 1GW4A 2WSEH 1JOCA 5AVSB 1LTGC 2XZRA 1RY3A 2FYZA 5AVTB 4EOTA 1KILC 5APYA 3VOPA 1AQ5A 4WY4C 2VRSA 1SFCB 5KJ7D 4EIJA 3N7NA 1RE4C 1RF1A 2Z5IA 3A3YB 2HPCA 1GL2A 2ZFCA 5APQA 1JY3N 1HGVA 1VDFA 2IPPA 1HGZA 1FZCA 3KQGA 1FZAA 3HUSB 3RK2D 4I1LA 1A02F 1FBMA 2YMYA 3OAKA 2H43A 1J2JB 3BRVB 5AW2B 2R5BA 2JJLA 1RF1C 2HODB 3RK3C 1GL2C 3H32A 1IO4A 5AW0B 2NPSD 1IFMA 1IFNA 4M3LA 3SWFA 1L0LK 2YO2A 1LTBC 2FXMA 5CHXA 3V5BA 1AFOA 1FZCC 2A45H 1LWUB 1S9KE 2KP8A 4HH2A 1NKZB 5CJ4A 3LIDA 1J1DC 2Z5HA 4C7NB 1GTWA 2KOGA 4JYBA 1URQB 1SFCA 1NAFA 1JTHB 3M91A 1DEBA 1H88A 3HE5B 3MUDA 1PFIA 2M8RA 1SQQK 3II6A 1M7LA 1QL2A 4C46A 3L35A 2H7HA 4RESB 1YYCA 3HD7A 1X8YA 5AVYB 1M1JB 1MV8A 1YTZT 1H89A 1LT9B 1FJPA 1HH0A 5AVVB 5BU8B 1RF0A 1SFCC 3I5CA 3N4XA 4WY4B 1JY2O 1GU5A 1SQXK 1FZEA 1URQD 3O8ZA 3GHGB 5APXA 3A2AA 3HD7C 1FZFA 1L0NK 5AW9B 1LWUA 1N2DC 1GU4A 1S9KD 1JO5A 3CLQA 1MZ9A 3CI9A 2L5GB 1RF0C 2XDJA 3L4FA 1JTHA 2FKWB 1SLQA 5APUA 3RL0B 1LTTC 5AW8B 2HFED 1KILD 4IFFA 4OH8B 1NH4A 4WY4D 3V2RA 4DOJA 1LWUC 2WPSA 1FZCB 1SP4A 1LT9A 2XV5A 1YTZI 1G1IA 2HLOA 3M06A 5KTBA 3H32B 3T97A 3GHGA 4LC1A 1MFZA 5AVXB 3RK3D 1LT9C 1GL2D 3R2PA 2IFMA 1LTJB 3C9IA 1N86A 5AW6B 1T2KC 4LGDE 1KFMA 1FZBA 3B5NA 3VMYA 1VPCA 3WMM0 2POHA 4GIFA 4I6MC 2Q3IA 2YKPA 1IFJA 2WPRA 4HYTB 3GHGC 1HBWA 3HD7B 3BVHA 2MJZA 2HG5D 2GUVA 5CCHA 1L4AB 3B5NC 4N3YB 2ZXEB 3TSIA 3V4WA 3P8CE 2HYNA 2JEEA 1WRGA 1JCCA 3NTNA 2C0XA 3RL0C 2KLVA 3P32A 1X79B 1NKNA 2LKMA 3OA7A 4XE5B 1SQPK 1IFDA 1SFCD 4AYCA 1NWQA 3HE4A 4JYCA 5APTA 4B86A 3U59A 5CCHC 2WSCH 2YKQA 1LTJA 3VP9A 1FDMA 1JCDA 2R5DA 3VYIA 3HD7D 1SQVK 2OYHB 1GZLA 5AVRB 1L4AD 1FOSF 1CI6B 1JY2N 3BATA 2QM8A 1N73B 2A45I 1QL1A 4JF7A 1A02J 1T8ZA 1KZUB 2O1JA 1LTJC 5APWA 2A45G 3VP8A 1L4AA 3A7OA 2XNXA 3MTUE 2WT7A 3MIWA 1Z56A 5CCGA 1FAVA 2PAJA 3P8CD 3M9HA 2YKOA 2WITA 1GDTA 1SVFA 3TK1A 1KQLA 1L4AC 3HRNA 5CCGC 3B5NB 3IR9A 4ZKPA 2OYHA 4ZKUA 3EFGA 2IX7C 2P2UA 1HWTC 3BASA 2N1TA 1CI6A 1T3JA 1T2KD 2P7JA 1JY3P 2QM7A 2WWWA 3P7KA 5AW4B 4GKGA 1N73A 2W6BA 1IFIA 4GT1A 3LIEA 2H8PD 2J59M 2W6AA 1IC2A 2OYHC 4IFMA 3OJAB 3SWYA 1N7SA 2P1JA 1ZR2A 2N1TC 1ZLLA 2R32A 3U1AA 3L36A 3B5ND 2GM4A 3CL3D 4AUWA 1N7LA 3U1CA 1HVVA 1NHLA 3HE4B 1SQBK 1N73C 3TNUA 3V2PA 3RL0D 1LTAC 3MGNA 1GD2E 1HTLC 2E42A 4Y99B 1N7SC 1NU1K 1JY2P 5CCHD 1OXZA 5CMZA 3V4QA 3TYYA 2Q7CA 3G3ZA 3RK2B 3KYQA 1DH3A 3MD0A 1H8AA 3E1IA 1FOSE 1DX7A 4N6JA 1E5WA 5KLVK 4LLHA 1CZQA 3BRTB 4XA4A 2YO3A 5BVZA 5CJ0A 2R3CA 2WT7B 1XTCC 2NPSB 2PP6A 3HTKA 4WB4A 2XU6A 1ZN5A 1IK9A 4AQRD 2M3BA 2OARA 1LTSC 5AW7B 5AVQB 3VTPC 2OYIA 2Q9IA 1EQ7A 1T3UA 1NTKK 2YNYA 5KJ7A 1FJKA 4O9BA 2WPQA 1JUNA 2N9BA 1JNMA 5AVWB 3V2QA 2E43A 2CPSA 3M9QA 1ZV8A 2N1TB 1XTGB 1JY3O 2C9NY 5CCGD 2P67A 3NFQA 2OYIC 1G2CB 1CW5A 1G1JA 4IFDK 1J1EB 2KB7P 5KJ7C 2WTYA 1FZGA 1OWAA 3VN0A 2W27A 3V2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPS A;  2N1T A;  1T3J A;  4N78 E;  3RK2 D;  1N7S B;  3RK3 D;  4W7Z A;  2YMY A;  1GL2 D;  4W80 A;  4LGD E;  3RK2 C;  3B5N A;  4W7Y A;  3RK3 C;  1GL2 C;  2H8P D;  2NPS D;  2N1T D;  2NPS C;  1N7S A;  2N1T C;  3M0D C;  1KIL B;  3B5N D;  3HD7 B;  2HG5 D;  1HVV A;  2KOG A;  1NHL A;  1URQ B;  5CCH A;  1SFC A;  1L4A B;  3B5N C;  1JTH B;  3RL0 D;  3TSI A;  2M8R A;  3P8C E;  1N7S D;  3RL0 C;  1N7S C;  3HD7 A;  5CCH D;  1SFC D;  3HTK B;  1URQ A;  3RK2 B;  3KYQ A;  5CCH C;  1SFC C;  3RK3 B;  1GL2 B;  4WY4 B;  3HD7 D;  1URQ D;  2NPS B;  2PP6 A;  1L4A D;  2WZ7 A;  3HD7 C;  1URQ C;  1KIL A;  4WY4 A;  4JF7 A;  2XDJ A;  3PP5 A;  1L4A A;  1JTH A;  5KJ7 A;  5CCG A;  3RL0 B;  2HFE D;  1KIL D;  4OH8 B;  4WY4 D;  1KIL C;  3VOP A;  2N1T B;  4WY4 C;  1SFC B;  5KJ7 D;  1XTG B;  5CCG D;  1L4A C;  1GL2 A;  5KJ7 C;  5CCG C;  3B5N B; 
#chains in the Genus database with same CATH topology
 1YHQ P;  4UB6 E;  4L76 A;  4I2L C;  2ZYG A;  3M0D A;  2KYV A;  2I1K A;  2O1K A;  3RK2 C;  2WSF H;  4W7Y A;  2I1J A;  1SQB E;  1FDI A;  1BCC J;  3KPE A;  2NPS C;  3AE3 C;  5E79 H;  2K9Y A;  3QH9 A;  3H1L E;  3B8E B;  1G2C A;  1HUC A;  2Q5U A;  1VQ9 P;  4N78 D;  3CWB G;  1Q90 D;  5KAI H;  4CPG A;  3HE5 A;  2B89 A;  3KXD A;  2FFD A;  4DT0 A;  3GG2 A;  2LXC B;  3ABV C;  3PRJ A;  1J1E C;  2KSJ A;  4GOE A;  1DEE G;  1KFN A;  2WZ7 A;  3L37 A;  1AA0 A;  5DJT B;  3H1K J;  5AW3 B;  1KIL A;  4L75 A;  2AXC A;  5BU5 A;  1N8R Q;  3LW5 H;  2E5Y A;  1LGH B;  1M1J C;  1VQ8 P;  1GW3 A;  1JOC A;  1PGP A;  1KYO I;  5AVT B;  5KLV D;  4EOT A;  3VOP A;  2VRS A;  1SFC B;  5GTI H;  1RE4 C;  4GDO A;  3E7K A;  1EDK A;  2E76 B;  1NU1 J;  2IPP A;  1FZC A;  3JCU H;  1FZA A;  3HUS B;  2H43 A;  3BRV B;  4D6T D;  3TGU J;  5AW2 B;  2HOD B;  3SWF A;  1L0L K;  2FXM A;  2Y9Y A;  2CK3 H;  1L0L D;  2A45 H;  1VF5 B;  2W90 A;  1JM0 A;  1S9K E;  2KP8 A;  4HH2 A;  2IBZ E;  1GTW A;  2K37 A;  1Q81 Q;  1BSN A;  1Y9B A;  3M91 A;  2M8R A;  1SQQ K;  3II6 A;  3GW6 A;  1X8Y A;  1YTZ T;  2Y9Z A;  2QJP B;  5KLI B;  2FY8 A;  1NTZ E;  2FYN C;  3AEF C;  1KTM A;  1RF0 A;  2FYU D;  1SFC C;  1E79 H;  3AEG C;  4WY4 B;  2QJY B;  2Y0E A;  1BDD A;  1FZE A;  3T97 B;  1URQ D;  1FZF A;  1KQS O;  1LWU A;  1N2D C;  1MZ9 A;  1PIX A;  3CI9 A;  4RJT A;  2K1A A;  2JO1 A;  3L4F A;  2FKW B;  2QJK B;  1SLQ A;  4EYY Q;  1UIX A;  2HFE D;  1X22 A;  4IFF A;  4OH8 B;  3L75 E;  4DOJ A;  2WPS A;  2AEF A;  1YTZ I;  2G8Y A;  3MP7 B;  4PJ0 H;  3SFD C;  2BCC J;  4YXD C;  3G6E P;  1SQP E;  3RK3 D;  2QJP C;  1GL2 D;  5B66 H;  1VL2 A;  5KLI C;  3C9I A;  1N86 A;  5AW6 B;  1T2K C;  4LGD E;  1IZN B;  3VMY A;  1LNQ A;  1OX3 A;  3BCC E;  2RKL A;  5H2F H;  5L8R J;  2HG5 D;  5CCH A;  1L4A B;  2C0X A;  2KLV A;  2LKM A;  2O3J A;  1SQX E;  3AEB C;  1ZW0 A;  3OA7 A;  2LXB A;  2KLU A;  3HE4 A;  5APT A;  1L0N E;  2WSC H;  1VQ5 P;  3VYI A;  3HD7 D;  3IAO A;  2AXT E;  1Q82 Q;  1Q86 Q;  2LR2 A;  1W5C E;  1A02 J;  2O1J A;  4H13 C;  3VP8 A;  3A7O A;  2XNX A;  2PAJ A;  3P8C D;  2OYO A;  1P84 E;  1GDT A;  1SVF A;  5KAI E;  2M5A B;  2W8Z A;  1SQQ J;  1L4A C;  3GF3 A;  1AVO A;  3IR9 A;  1D7M A;  3WUU A;  4ZKP A;  2OYH A;  1S5L H;  4UB8 H;  3PTZ A;  1N73 A;  1VQN P;  1YQ3 C;  3L73 E;  3CX5 D;  2H8P D;  2KS1 B;  3H1I D;  1IC2 A;  1YBK A;  2UWJ E;  1ZR2 A;  3WU2 E;  3A0H H;  3B5N D;  5GTI E;  1EZV E;  1SQB K;  1LJ2 A;  1GD2 E;  2HR3 A;  1T6A A;  1SQV E;  1OXZ A;  2V7Q J;  3V4Q A;  4IL6 E;  2E75 D;  1E5W A;  5KLV G;  4XA4 A;  2YO3 A;  5BVZ A;  3L71 E;  5CJ0 A;  3GMA A;  4K35 A;  2XU6 A;  3SSU A;  3H1J D;  1IK9 A;  1NTM E;  4RKU J;  4AQR D;  2E5T A;  2OAR A;  1LTS C;  5AVQ B;  3VTP C;  4H44 D;  4D6T G;  5AVW B;  2E43 A;  5KKZ B;  1BGY J;  5CCG D;  1BCC D;  2YXQ B;  1L0L G;  3NFQ A;  4IFD K;  3O6Q B;  2KB7 P;  2WTY A;  1FZG A;  5AVX B;  3L70 J;  1NO4 A;  2C0W A;  2O01 H;  2JKV A;  3A0B E;  2ZVO B;  2OGU A;  4W7Z A;  4WBA A;  3EQ2 A;  1RE3 A;  1SS1 A;  3Q5P A;  1KB9 E;  1KOR A;  1LTI C;  2N1T D;  3CME P;  3HUS A;  1BE3 D;  1K8A Q;  2FYU G;  4H0L D;  1JMM A;  2HOD A;  4PJ0 E;  3IFM A;  1OVV A;  1N7S D;  3EFF K;  3VMZ A;  3H1K D;  5AVU B;  2B87 A;  3H1H J;  4OVN F;  1FU1 A;  2IDB A;  5KKZ C;  1RQV A;  2J58 A;  3NMD A;  3RK3 B;  1GL2 B;  4GOF A;  1IJD B;  1NTK E;  1FS0 E;  1NTZ K;  2CPB A;  3L74 E;  3S4R A;  1W2E A;  1URQ C;  4WY4 A;  1EXI A;  1PP9 E;  3UIA A;  1NU1 D;  1HJB A;  5AVZ B;  3AE9 C;  4C7R A;  3TGU D;  3D6Z A;  3Q5S A;  2XZR A;  3RGU A;  1RY3 A;  2ZT9 D;  2FYZ A;  1VQ6 P;  1AQ5 A;  4QMA A;  5KJ7 D;  4EIJ A;  1RF1 A;  2Z5I A;  3A3Y B;  2HPC A;  1YI2 P;  3H1H E;  5APQ A;  1JY3 N;  1HGV A;  1H0T B;  1VDF A;  2QA4 P;  3FGA D;  3H1L J;  3OAK A;  2KI7 B;  2JJL A;  3RK3 C;  3Q2Y A;  1GL2 C;  1IO4 A;  1IFN A;  5CHX A;  3V5B A;  2YXR B;  4JBZ A;  4L74 A;  5CJ4 A;  3D71 A;  2K88 A;  1NAF A;  1PPJ D;  1JTH B;  3CWB E;  3MUD A;  3CCU P;  4RES B;  1YIT P;  4NPF X;  1QVF O;  1M1J B;  1MV8 A;  1BDC A;  1LT9 B;  1FJP A;  1HH0 A;  5AVV B;  3WUV A;  4U3F J;  3I5C A;  1JY2 O;  4ZMD A;  1SQX K;  2M3E A;  1ZRT D;  3O8Z A;  3GHG B;  1OZH A;  3A2A A;  3HD7 C;  3PLN A;  1L0N K;  4KT0 J;  1LP1 B;  3SFE C;  2BCC D;  2XDJ A;  3CCR P;  2FXP A;  2R3S A;  5GTH H;  1KYO E;  5APU A;  4PD4 D;  1KIL D;  3I56 P;  2ZAE B;  2A06 D;  1SP4 A;  3H1I G;  2XV5 A;  3RL0 g;  1G1I A;  2HLO A;  1DD3 A;  3M06 A;  4PV1 D;  2E75 B;  3H32 B;  4L73 A;  3F5H A;  3TDK A;  4LC1 A;  2OTL P;  4U3F E;  4HJG H;  2JR8 A;  1LT9 C;  2IFM A;  3AE2 C;  1FZB A;  1VQ7 P;  3CD6 P;  1VPC A;  2FYN B;  2Q3E A;  2POH A;  3D70 A;  1OW8 A;  1NTZ J;  4H44 B;  3GHG C;  3D6Y A;  2ZXX A;  5CBO A;  3G9R A;  1FC2 C;  2MJZ A;  2QRX A;  2GUV A;  1U57 A;  2E74 D;  4YTP C;  3B5N C;  3FX0 A;  4N3Y B;  2NZ2 A;  1VQO P;  3V4W A;  2JEE A;  3H1J G;  1X79 B;  1NKN A;  1NWQ A;  1K73 Q;  2YKQ A;  3ZDM A;  1LTJ A;  3VP9 A;  3FXD A;  1FDM A;  3L75 J;  2D2C D;  1SQV K;  1GZL A;  1NAY A;  2E75 C;  1BCC G;  1CI6 B;  1SQQ D;  3BAT A;  4H0L B;  1S5L X;  1OVR A;  2AEJ A;  3MTU E;  3I55 P;  1SQP J;  1FAV A;  1BSH A;  1S4X A;  2P58 A;  4H44 C;  3TK1 A;  3CXH H;  3BCC J;  1BE3 G;  1KQL A;  3CXH D;  3HRN A;  1U7J A;  5C39 A;  5CCG C;  1QLE D;  4ZKU A;  2IX7 C;  1AQT A;  1T3J A;  5AW4 B;  2AEM A;  3H1K G;  4GKG A;  3O6Q A;  3LIE A;  1SQX J;  4OGQ D;  4I7Z B;  2G3A A;  2J59 M;  1HF9 A;  1L0N J;  1NGM B;  2N1T C;  4AUW A;  5B5E E;  2ZT9 B;  4H0L C;  3Q3D A;  3RL0 D;  1LTA C;  4H13 B;  2OTJ P;  4Y99 B;  4DJG A;  1N7S C;  1NU1 G;  5CCH D;  2K9J B;  3TYY A;  2Q7C A;  1ZXG A;  1JB0 J;  1S2E A;  3TGU G;  1DX7 A;  4N6J A;  1PGJ A;  1BGY D;  4WB4 A;  2M3B A;  3L70 D;  5AW7 B;  1NTK K;  1FJK A;  4R4M A;  4I7Z C;  1JUN A;  1KMI Z;  3LW5 J;  2W83 C;  2JWA A;  2KNC B;  3KZI H;  3L73 J;  1S3J A;  3M9Q A;  2QG4 A;  2C9N Y;  2ZT9 C;  5E79 E;  2OYI C;  1G2C B;  1CW5 A;  5KJ7 C;  1OWA A;  4YXW H;  3V2N A;  3AE5 C;  3PJS K;  1PZQ A;  2J5U A;  2NPS A;  4Y99 C;  1PPJ G;  4N78 E;  5GTH E;  3P8M C;  2FFD B;  1EC5 A;  3H1H D;  1SQV J;  1H0T A;  3TNU B;  2N9Y B;  3L72 D;  3EWK A;  3M0D C;  1KIL B;  1EDI A;  3L71 J;  1NOH A;  5AW5 B;  4U7J A;  3CX5 H;  4UB6 H;  1NTM J;  4DZO A;  2BCC G;  3AE6 C;  4PV1 B;  2IFN A;  5KLV E;  4PD4 I;  3KDP B;  4JPZ B;  3Q5R A;  2A06 G;  1M1J A;  2DW3 A;  1SQB D;  3H6P A;  1OW6 A;  3AE7 C;  3NXS A;  3M0A A;  3JCU E;  3M9B A;  4D6T E;  1WT6 A;  5APS A;  1RE4 A;  3PP5 A;  2FFD C;  2E74 B;  3H1L D;  1L0L E;  1GK6 A;  1GW4 A;  2WSE H;  3IF4 A;  1LTG C;  5AVS B;  1LP1 A;  1VQ4 P;  4EDF A;  1KIL C;  5APY A;  1EXJ A;  3N7N A;  4DCK A;  1HJ0 A;  1ZP0 C;  2D2C B;  1OFC X;  3KQG A;  4PV1 C;  1MKM A;  1A02 F;  2FYU E;  1J2J B;  2R5B A;  1Y8A A;  3H32 A;  5AW0 B;  1IFM A;  2YO2 A;  1FZC C;  4U3F D;  2WSS H;  1LWU B;  2RH0 A;  3OW2 O;  1NKZ B;  2Z5H A;  2ZVN B;  2FBW C;  1OIP A;  4C7N B;  2E76 D;  2KOG A;  4JYB A;  1URQ B;  1SFC A;  1NTK J;  3SWK A;  2YMK A;  1DEB A;  3L74 J;  1PFI A;  3MZW B;  1SQQ G;  1QL2 A;  4C46 A;  2E74 C;  2I8D A;  1YYC A;  1PP9 J;  2PFX A;  1Q7Y Q;  2PRR A;  5BU8 B;  5TIS H;  2YIU C;  1VF5 D;  1GU5 A;  5KAF H;  3W68 A;  5M1B A;  2WSC J;  3C8V A;  2KSE A;  3CXH I;  2D2C C;  1FDO A;  1YJW P;  5AW9 B;  3RK3 E;  1GU4 A;  1S9K D;  2IBZ D;  2JP3 A;  3CLQ A;  1RH5 B;  1RF0 C;  5B66 E;  2B9B A;  1MFT A;  3RL0 B;  1FE6 A;  5AW8 B;  4TLF A;  2WMM A;  1K9M Q;  1NH4 A;  4WY4 D;  5H2F E;  3V2R A;  3CCL P;  1S72 P;  1LWU C;  1DD4 A;  2WPV B;  1NTZ D;  1WMK A;  1PGO A;  2ITA A;  3T97 A;  3CWB J;  1MFZ A;  1GMJ A;  3R2P A;  3WMM 0;  4A7P A;  4I6M C;  2Q3I A;  1IFJ A;  2WPR A;  4OGQ C;  5K5G B;  1HBW A;  1KV4 A;  3L75 D;  2Q1K A;  4IL6 X;  3HD7 B;  3B4S A;  3BVH A;  5CBN A;  1BGY G;  1M90 Q;  3AEC C;  2ZXE B;  3TSI A;  3P8C E;  1WRG A;  3RL0 C;  1LT1 A;  3L70 G;  1SQP K;  1IFD A;  2Y0D A;  4AYC A;  2QSI A;  1QVG O;  4B86 A;  1SQP D;  2XND H;  2MKV A;  3U59 A;  5CCH C;  1U7M A;  2BEQ D;  1JCD A;  2R5D A;  2OYH B;  3IN6 A;  1L2P A;  3BCC D;  1L4A D;  1FOS F;  1JY2 N;  2K9J A;  2ZJS E;  2QM8 A;  1S5L E;  1N73 B;  1QL1 A;  4UB8 E;  1KZU B;  3CX5 E;  4NPD A;  1L4A A;  3H1I E;  4EI2 A;  3MIW A;  2OQQ A;  2YKO A;  2WIT A;  3H1H G;  1SQX D;  5EFW B;  3A0H E;  3CPW O;  4YPC A;  4MN4 C;  1L0N D;  3L72 G;  2KZI A;  3MHV A;  3K5B A;  3B5N B;  4Y28 J;  1IFP A;  4R4L A;  3RBX A;  4PD4 H;  2KNC A;  3EFG A;  2P2U A;  1HWT C;  2AXT H;  2P7J A;  2Q6Q A;  1JY3 P;  1YQ4 C;  3CX5 I;  3AEA C;  2O01 J;  2SPZ A;  1IFI A;  4GT1 A;  4NPE A;  2OYH C;  4IFM A;  3SWY A;  1P84 H;  1BE3 J;  3H1J E;  3L36 A;  3VMA A;  1P84 D;  2GM4 A;  1N7L A;  2M5A A;  3U1C A;  1HVV A;  1NHL A;  1SQB G;  1N73 C;  3TNU A;  3AE8 C;  1USE A;  3MGN A;  2KUB A;  1JY2 P;  3H1L G;  1BCC E;  3G3Z A;  3FXE A;  3TF5 A;  4JQ0 D;  3E1I A;  3FWL A;  3L73 D;  5KLV K;  4LLH A;  3BRT B;  2KS1 A;  3G71 P;  1PGQ A;  1XTC C;  2WT7 B;  3WU2 H;  1ZN5 A;  1AJY A;  1ZOY C;  1EZV D;  1QX8 A;  2BEZ F;  1EQ7 A;  1T3U A;  1S1C X;  1BE3 E;  2WPQ A;  2Y0C A;  2N9B A;  1OVU A;  2CPS A;  1SQV D;  5TIS E;  2N1T B;  4IL6 H;  1R5L A;  2WVR A;  5KAF E;  4U3F G;  3PH0 A;  5TJH A;  1G1J A;  2M0B A;  3H1K E;  2GUS A;  3VMX A;  2B87 B;  3CCS P;  4TT3 H;  3L71 D;  4KHX A;  1QEX A;  5APV A;  1N7S B;  1VQL P;  1NTM K;  1CSB A;  4W80 A;  3E1R A;  1NTM D;  2C9L Y;  5DJU B;  4BRY B;  2Z4E A;  3CC7 P;  2FYU K;  1X9V A;  4BWN A;  1NU1 E;  1RE3 C;  1R5S A;  1M1K Q;  2E76 C;  2JDI H;  2XKM A;  2IBZ I;  1GK4 A;  1K05 A;  3TGU E;  2IBZ G;  3QWO C;  2ZYD A;  3HUS C;  2V7Q H;  1NVO A;  3GF7 A;  3A0B H;  4C7N A;  1Y47 A;  2BAS A;  3HTK B;  1URQ A;  2WSF J;  3WUT A;  5AW1 B;  1MUU A;  1RF1 B;  1KB9 H;  2HPC B;  1IK7 A;  4ASW A;  1KQG B;  1KB9 D;  2OYI B;  1VF5 C;  2FXO A;  1DIP A;  1NTZ G;  3A5T A;  1J1D B;  1EDJ A;  1ZR4 A;  3CC2 P;  2O01 N;  3S1K A;  2JWD A;  1M56 D;  1RQU A;  3AE4 C;  2IYO A;  1UII A;  4GOD A;  4WY4 C;  1PPJ E;  2QJY C;  2QVA A;  1GL2 A;  3L75 G;  2ZFC A;  1HGZ A;  3CCV P;  3Q1M A;  1NTK D;  3L74 D;  3RK2 D;  4I1L A;  1FBM A;  2YMY A;  1NYH A;  1M8O B;  2QJK C;  3USS A;  1PP9 D;  1RF1 C;  1VQP P;  2H88 C;  5KLV J;  2IZ1 A;  2NPS D;  1ZRT E;  4M3L A;  1SQP G;  2IYP A;  1LTB C;  1AFO A;  1QGK B;  2K3R A;  2QIW A;  3LID A;  1J1D C;  2BCC E;  3CCE P;  3BCC G;  1W2B O;  1H88 A;  3HE5 B;  4KJM A;  1M7L A;  4PD4 E;  1YJN P;  3AED C;  4D6T J;  3L35 A;  1YIJ P;  2H7H A;  1KIL E;  3KHU A;  4HKZ H;  3CCM P;  1KN7 A;  3HD7 A;  5AVY B;  2A06 E;  1H89 A;  1L0L J;  3N4X A;  3MUD C;  1KQF B;  1SQX G;  2OTK E;  5APX A;  3AEE C;  3V6I A;  2B88 A;  1L0N G;  1JO5 A;  2L5G B;  4HB1 A;  2W6J H;  1JTH A;  4OWF A;  3CWB D;  1X0T A;  1LTT C;  2FYU J;  2QEX P;  2KK7 A;  2ZYA A;  4XFJ A;  1FZC B;  3S9O A;  1JEK A;  1LT9 A;  3ITK A;  3CMA P;  1P84 I;  4ASV A;  5KTB A;  1K04 A;  3GHG A;  2KZJ A;  1KD1 Q;  1VQK P;  1LTJ B;  1KFM A;  1KYO H;  4BXL A;  3B5N A;  2YIU B;  4GIF A;  1KYO D;  2YKP A;  4HYT B;  1SQQ E;  4WWI A;  3L73 G;  1NJI Q;  2H89 C;  1EZV I;  2HYN A;  3W67 A;  1JCC A;  3NTN A;  3P32 A;  4Z1M H;  1EZV G;  3FWN A;  4XE5 B;  1RHZ B;  1SFC D;  4JYC A;  3CXH E;  1R8E A;  1EDL A;  2KXP B;  1TU3 F;  3F89 A;  1SQV G;  5AVR B;  2P10 A;  3H25 A;  2WQY C;  2A45 I;  3C1L A;  3PHL A;  4JF7 A;  1T8Z A;  1LTJ C;  5APW A;  3L71 G;  1M57 D;  2A45 G;  2WT7 A;  1Z56 A;  5CCG A;  3M9H A;  1NTM G;  1ZME C;  3RBZ A;  4OGQ B;  1OW7 A;  1AV1 A;  2R44 A;  2KIK A;  1VQM P;  1PL5 A;  4IOI H;  1AVY A;  3BAS A;  2N1T A;  1CI6 A;  1T2K D;  2QM7 A;  2WWW A;  3P7K A;  2QE7 H;  2W6B A;  3B71 A;  1PV3 A;  1BGY E;  2W6A A;  2NRG A;  3CCJ P;  3OJA B;  2RN0 A;  1N7S A;  3GLM A;  1KB9 I;  2P1J A;  2R32 A;  1YJ9 P;  1ZLL A;  1JMB A;  3L72 J;  3U1A A;  3CL3 D;  3JC2 2;  4RO0 A;  3L70 E;  4BRY A;  3HE4 B;  3V2P A;  3G4S P;  1USD A;  1HTL C;  2E42 A;  1NU1 K;  1OMI A;  3H1I J;  5CMZ A;  3KZI E;  4WVZ A;  3RK2 B;  1KC8 Q;  3KYQ A;  1DH3 A;  1Q2N A;  3MD0 A;  1H8A A;  1FOS E;  2L91 A;  1CZQ A;  2R3C A;  2NPS B;  2PP6 A;  3HTK A;  1SQB J;  2IZ0 A;  2RMZ A;  5B5E H;  4H13 D;  3AE1 C;  4ZNC A;  2Q9I A;  2OYI A;  3R4Y A;  3CC4 P;  1NTK G;  2YNY A;  5KJ7 A;  3JSV C;  3L74 G;  4O9B A;  2GA1 A;  3L72 E;  1JNM A;  1PP9 G;  3V2Q A;  1ZV8 A;  3CCQ P;  2PGD A;  2V4H A;  2WSE J;  1XTG B;  1JY3 O;  2P67 A;  4K3A A;  1J1E B;  3H1J J;  3VN0 A;  2W27 A; 
#chains in the Genus database with same CATH homology
 2GUS A;  3VMX A;  1NO4 A;  2C0W A;  4I2L C;  2NPS A;  4KHX A;  2O01 H;  4Y99 C;  3M0D A;  2KYV A;  4N78 E;  5APV A;  2I1K A;  1N7S B;  4W7Z A;  1NTM K;  4WBA A;  3EQ2 A;  1CSB A;  4W80 A;  2O1K A;  1RE3 A;  3P8M C;  3RK2 C;  2FFD B;  2C9L Y;  2WSF H;  4W7Y A;  1LTI C;  2Z4E A;  3TNU B;  2I1J A;  2N1T D;  3KPE A;  3HUS A;  2FYU K;  2NPS C;  3M0D C;  1X9V A;  1KIL B;  1JMM A;  2HOD A;  1NOH A;  1RE3 C;  3IFM A;  5AW5 B;  3B8E B;  1G2C A;  2XKM A;  1N7S D;  1GK4 A;  3VMZ A;  1HUC A;  5AVU B;  3HUS C;  4DZO A;  2IFN A;  2Q5U A;  4C7N A;  1FU1 A;  2BAS A;  3HTK B;  1URQ A;  4N78 D;  5AW1 B;  1MUU A;  2J58 A;  3KDP B;  3HE5 A;  1RF1 B;  3NMD A;  3RK3 B;  2HPC B;  1GL2 B;  2FFD A;  1J1E C;  2OYI B;  2KSJ A;  1IJD B;  1M1J A;  1KFN A;  3H6P A;  2WZ7 A;  1NTZ K;  2CPB A;  3L37 A;  3NXS A;  1W2E A;  3A5T A;  1J1D B;  3M0A A;  1URQ C;  3M9B A;  5AW3 B;  1KIL A;  1ZR4 A;  1WT6 A;  4WY4 A;  5APS A;  5BU5 A;  1RE4 A;  3UIA A;  3PP5 A;  2FFD C;  3LW5 H;  1HJB A;  5AVZ B;  1LGH B;  1M1J C;  4C7R A;  1GK6 A;  1GW3 A;  1GW4 A;  2WSE H;  1JOC A;  5AVS B;  1LTG C;  2XZR A;  1RY3 A;  2FYZ A;  5AVT B;  4EOT A;  1KIL C;  5APY A;  3VOP A;  1AQ5 A;  4WY4 C;  2VRS A;  1SFC B;  5KJ7 D;  4EIJ A;  3N7N A;  1RE4 C;  1RF1 A;  2Z5I A;  3A3Y B;  2HPC A;  1GL2 A;  2ZFC A;  5APQ A;  1JY3 N;  1HGV A;  1VDF A;  2IPP A;  1HGZ A;  1FZC A;  3KQG A;  1FZA A;  3HUS B;  3RK2 D;  4I1L A;  1A02 F;  1FBM A;  2YMY A;  3OAK A;  2H43 A;  1J2J B;  3BRV B;  5AW2 B;  2R5B A;  2JJL A;  1RF1 C;  2HOD B;  3RK3 C;  1GL2 C;  3H32 A;  1IO4 A;  5AW0 B;  2NPS D;  1IFM A;  1IFN A;  4M3L A;  3SWF A;  1L0L K;  2YO2 A;  1LTB C;  2FXM A;  5CHX A;  3V5B A;  1AFO A;  1FZC C;  2A45 H;  1LWU B;  1S9K E;  2KP8 A;  4HH2 A;  1NKZ B;  5CJ4 A;  3LID A;  1J1D C;  2Z5H A;  4C7N B;  1GTW A;  2KOG A;  4JYB A;  1URQ B;  1SFC A;  1NAF A;  1JTH B;  3M91 A;  1DEB A;  1H88 A;  3HE5 B;  3MUD A;  1PFI A;  2M8R A;  1SQQ K;  3II6 A;  1M7L A;  1QL2 A;  4C46 A;  3L35 A;  2H7H A;  4RES B;  1YYC A;  3HD7 A;  1X8Y A;  5AVY B;  1M1J B;  1MV8 A;  1YTZ T;  1H89 A;  1LT9 B;  1FJP A;  1HH0 A;  5AVV B;  5BU8 B;  1RF0 A;  1SFC C;  3I5C A;  3N4X A;  4WY4 B;  1JY2 O;  1GU5 A;  1SQX K;  1FZE A;  1URQ D;  3O8Z A;  3GHG B;  5APX A;  3A2A A;  3HD7 C;  1FZF A;  1L0N K;  5AW9 B;  1LWU A;  1N2D C;  1GU4 A;  1S9K D;  1JO5 A;  3CLQ A;  1MZ9 A;  3CI9 A;  2L5G B;  1RF0 C;  2XDJ A;  3L4F A;  1JTH A;  2FKW B;  1SLQ A;  5APU A;  3RL0 B;  1LTT C;  5AW8 B;  2HFE D;  1KIL D;  4IFF A;  4OH8 B;  1NH4 A;  4WY4 D;  3V2R A;  4DOJ A;  1LWU C;  2WPS A;  1FZC B;  1SP4 A;  1LT9 A;  2XV5 A;  1YTZ I;  1G1I A;  2HLO A;  3M06 A;  5KTB A;  3H32 B;  3T97 A;  3GHG A;  4LC1 A;  1MFZ A;  5AVX B;  3RK3 D;  1LT9 C;  1GL2 D;  3R2P A;  2IFM A;  1LTJ B;  3C9I A;  1N86 A;  5AW6 B;  1T2K C;  4LGD E;  1KFM A;  1FZB A;  3B5N A;  3VMY A;  1VPC A;  3WMM 0;  2POH A;  4GIF A;  4I6M C;  2Q3I A;  2YKP A;  1IFJ A;  2WPR A;  4HYT B;  3GHG C;  1HBW A;  3HD7 B;  3BVH A;  2MJZ A;  2HG5 D;  2GUV A;  5CCH A;  1L4A B;  3B5N C;  4N3Y B;  2ZXE B;  3TSI A;  3V4W A;  3P8C E;  2HYN A;  2JEE A;  1WRG A;  1JCC A;  3NTN A;  2C0X A;  3RL0 C;  2KLV A;  3P32 A;  1X79 B;  1NKN A;  2LKM A;  3OA7 A;  4XE5 B;  1SQP K;  1IFD A;  1SFC D;  4AYC A;  1NWQ A;  3HE4 A;  4JYC A;  5APT A;  4B86 A;  3U59 A;  5CCH C;  2WSC H;  2YKQ A;  1LTJ A;  3VP9 A;  1FDM A;  1JCD A;  2R5D A;  3VYI A;  3HD7 D;  1SQV K;  2OYH B;  1GZL A;  5AVR B;  1L4A D;  1FOS F;  1CI6 B;  1JY2 N;  3BAT A;  2QM8 A;  1N73 B;  2A45 I;  1QL1 A;  4JF7 A;  1A02 J;  1T8Z A;  1KZU B;  2O1J A;  1LTJ C;  5APW A;  2A45 G;  3VP8 A;  1L4A A;  3A7O A;  2XNX A;  3MTU E;  2WT7 A;  3MIW A;  1Z56 A;  5CCG A;  1FAV A;  2PAJ A;  3P8C D;  3M9H A;  2YKO A;  2WIT A;  1GDT A;  1SVF A;  3TK1 A;  1KQL A;  1L4A C;  3HRN A;  5CCG C;  3B5N B;  3IR9 A;  4ZKP A;  2OYH A;  4ZKU A;  3EFG A;  2IX7 C;  2P2U A;  1HWT C;  3BAS A;  2N1T A;  1CI6 A;  1T3J A;  1T2K D;  2P7J A;  1JY3 P;  2QM7 A;  2WWW A;  3P7K A;  5AW4 B;  4GKG A;  1N73 A;  2W6B A;  1IFI A;  4GT1 A;  3LIE A;  2H8P D;  2J59 M;  2W6A A;  1IC2 A;  2OYH C;  4IFM A;  3OJA B;  3SWY A;  1N7S A;  2P1J A;  1ZR2 A;  2N1T C;  1ZLL A;  2R32 A;  3U1A A;  3L36 A;  3B5N D;  2GM4 A;  3CL3 D;  4AUW A;  1N7L A;  3U1C A;  1HVV A;  1NHL A;  3HE4 B;  1SQB K;  1N73 C;  3TNU A;  3V2P A;  3RL0 D;  1LTA C;  3MGN A;  1GD2 E;  1HTL C;  2E42 A;  4Y99 B;  1N7S C;  1NU1 K;  1JY2 P;  5CCH D;  1OXZ A;  5CMZ A;  3V4Q A;  3TYY A;  2Q7C A;  3G3Z A;  3RK2 B;  3KYQ A;  1DH3 A;  3MD0 A;  1H8A A;  3E1I A;  1FOS E;  1DX7 A;  4N6J A;  1E5W A;  5KLV K;  4LLH A;  1CZQ A;  3BRT B;  4XA4 A;  2YO3 A;  5BVZ A;  5CJ0 A;  2R3C A;  2WT7 B;  1XTC C;  2NPS B;  2PP6 A;  3HTK A;  4WB4 A;  2XU6 A;  1ZN5 A;  1IK9 A;  4AQR D;  2M3B A;  2OAR A;  1LTS C;  5AW7 B;  5AVQ B;  3VTP C;  2OYI A;  2Q9I A;  1EQ7 A;  1T3U A;  1NTK K;  2YNY A;  5KJ7 A;  1FJK A;  4O9B A;  2WPQ A;  1JUN A;  2N9B A;  1JNM A;  5AVW B;  3V2Q A;  2E43 A;  2CPS A;  3M9Q A;  1ZV8 A;  2N1T B;  1XTG B;  1JY3 O;  2C9N Y;  5CCG D;  2P67 A;  3NFQ A;  2OYI C;  1G2C B;  1CW5 A;  1G1J A;  4IFD K;  1J1E B;  2KB7 P;  5KJ7 C;  2WTY A;  1FZG A;  1OWA A;  3VN0 A;  2W27 A;  3V2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...