3B5NB

Structure of the yeast plasma membrane snare complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
69
structure length
69
Chain Sequence
b'ALAEVQARHQELLKLEKSMAELTQLFNDMEELVIEQQENVDVIDKNVEDAQLDVEQGVGHTDKAVKSAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Synaptobrevin homolog 1
molecule tags Membrane protein
source organism Saccharomyces cerevisiae
publication title The Structure of the Yeast Plasma Membrane SNARE Complex Reveals Destabilizing Water-filled Cavities.
pubmed doi rcsb
total genus 32
structure length 69
sequence length 69
chains with identical sequence F, J
ec nomenclature
pdb deposition date 2007-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3b5nB00
5KJ7D 4W80A 1L4AC 3B5NC 1URQD 4W7ZA 1KILC 1N7SB 2YMYA 2WZ7A 5CCHC 2N1TB 3RK2D 5KJ7C 5CCHA 2NPSD 1URQC 2HG5D 2NPSB 1GL2A 1JTHB 3RK3D 3RL0D 4OH8B 3HTKB 4N78E 5CCGC 1L4AA 2NPSC 3M0DC 3HD7C 4WY4B 1N7SC 4WY4A 3B5ND 4W7YA 3B5NB 1GL2D 1SFCC 4WY4C 3P8CE 2N1TC 5CCGA 3HD7D 1N7SA 1L4AD 4JF7A 3TSIA 3RL0C 1KILD 3HD7A 1SFCB 2PP6A 3RK3B 1GL2C 1URQA 3RK2B 1KILB 3RL0B 5KJ7A 2N1TA 1L4AB 1NHLA 3HD7B 1SFCA 1SFCD 1N7SD 2XDJA 3RK2C 2N1TD 5CCGD 1T3JA 3RK3C 3B5NA 4WY4D 4LGDE 3PP5A 1HVVA 2M8RA 1GL2B 2H8PD 3KYQA 2NPSA 2HFED 2KOGA 1JTHA 1URQB 1KILA 5CCHD 3VOPA 1XTGB
chains in the Genus database with same CATH superfamily
2Q5UA 5EFWB 1PPJE 4RESB 4NPFX 2O1KA 5GTIH 3B5NC 5AVWB 3CCSP 1SQPD 3G3ZA 3L75J 2KLUA 1S5LH 1NJIQ 4C46A 4W7ZA 4IL6H 2H7HA 1NVOA 2M3BA 1NTZK 2Z4EA 2K37A 1QL2A 1NTKG 2WZ7A 3AEBC 3A7OA 1YQ4C 4GT1A 3Q5SA 3WMM0 1NU1J 1RHZB 2R44A 3BCCG 3M9BA 2M3EA 4JYBA 3VMAA 4JBZA 1JY2N 3GF7A 2N1TB 3RK2D 2WSCH 1H0TA 1EZVI 1KN7A 1HUCA 1USEA 1LTAC 2ZT9D 1KQLA 3V2PA 3CWBJ 2QVAA 1L0NE 4I1LA 1BCCG 1KB9E 2NPSD 2K9JA 1IFNA 2B88A 1BGYD 3MZWB 2BEZF 1GL2A 2I1KA 1UIIA 2K9YA 3L74D 3W67A 1DIPA 2W8ZA 5AW2B 1FJPA 3FWNA 5AVTB 1EDJA 4C7NA 4NPDA 3HTKB 2KIKA 1IC2A 1L0LG 3H1HD 1AJYA 1HJ0A 1GDTA 1RQVA 2PFXA 1OIPA 3AE2C 3H1JG 1PP9E 3PH0A 3NXSA 1OWAA 4GIFA 4OVNF 2BCCJ 2O01H 1JY2P 4PD4I 3WUVA 1P84E 3L71D 4R4LA 1G1IA 1S72P 2QJKC 3HRNA 2WPVB 2DW3A 2OYHC 5CCGC 3CCEP 1BE3G 1EC5A 4I2LC 3P7KA 4PJ0H 5DJUB 2NPSC 3M0DC 1U57A 2L91A 2OGUA 5KLVD 5BU5A 2QJPB 2QJPC 5KKZC 2UWJE 5KKZB 4RJTA 1M56D 4PD4E 3CX5E 2KXPB 4AUWA 4WY4B 1LGHB 1S5LE 2Z5HA 3IR9A 4EI2A 3Q5PA 1AVOA 3E1IA 1XTCC 5AVQB 1VQKP 1N8RQ 1LTJB 1ZN5A 1IK9A 3SWKA 1P84H 1GD2E 3AEFC 3W68A 3E7KA 3B5NB 4M3LA 1PIXA 3H1HJ 1HGVA 4HYTB 4QMAA 3I55P 4JYCA 3WUTA 1K8AQ 1FDIA 1SQXD 3CI9A 2ZVOB 2NZ2A 1ZRTE 2ZYDA 1EZVD 3HD7D 1EXIA 1N7SA 1N73A 1KFNA 1MKMA 1SQVE 2QJYB 3UIAA 4AQRD 5AW5B 5KLVK 2ZYGA 1YI2P 1EZVE 3Q5RA 3H1ID 2YKPA 4HKZH 1SQXE 3U1AA 1YJWP 1JUNA 1J1EC 2HYNA 1JMMA 1NTZD 2ZXXA 3AEAC 3HD7A 1KYOD 2HR3A 3N7NA 3MHVA 5H2FH 2W83C 4WBAA 1K9MQ 2FYUG 2AEJA 3M9HA 1VQLP 1FZGA 2K1AA 1OW6A 3CXHI 3SWFA 2FBWC 2YO2A 3RK3C 5AW8B 1PGPA 2E74B 2IFNA 1M1JB 1SQQD 2G8YA 1NU1K 1VDFA 2FXOA 3FGAD 4PD4D 1NTKJ 5AW3B 5B5EE 1CW5A 5TJHA 2XNXA 1AFOA 3H1LG 5AW9B 4KHXA 3VMZA 3TGUJ 1PV3A 1SFCA 3TYYA 1RF0A 3AE5C 1NTME 1OZHA 5GTIE 3I56P 1DD3A 3L75G 4L73A 3CXHE 3L72E 1FDMA 1ZRTD 3CMAP 1QEXA 2JO1A 3HTKA 1MUUA 1QX8A 5TISH 4L74A 4XFJA 1GK6A 1NU1E 1SQPG 2IPPA 3EFFK 2E5YA 3MIWA 3OJAB 2Y0DA 4UB6H 4JPZB 3CL3D 3TNUA 1BSNA 1SQQK 3G4SP 1Q2NA 2POHA 4YXWH 5C39A 2WT7B 2HFED 1HBWA 3AEGC 2KOGA 5APUA 1URQB 2KS1A 5CCHD 1RH5B 1SP4A 2ZYAA 1H8AA 1U7JA 2KNCA 2FY8A 1XTGB 5K5GB 4ZKPA 1SQQJ 2KZIA 3H1KE 1S5LX 1L4AC 3GF3A 2OQQA 3TDKA 1IFPA 1IFJA 1IFMA 1Y8AA 1URQD 2PAJA 3A0BE 3L70J 3L70E 5CBNA 2ZAEB 3CXHD 4BRYA 3TGUG 1SQBG 3H32B 1LWUA 2B89A 4GODA 2OYOA 1FZAA 3AE9C 4HB1A 1NO4A 2K88A 3H32A 1SQXK 3EQ2A 1IJDB 5H2FE 3S9OA 1NGMB 4H44B 2BCCG 4NPEA 1WRGA 1VQ8P 2FXMA 1YITP 1N7LA 3FWLA 3GHGA 2J58A 2VRSA 4EDFA 2AEMA 1KTMA 1T8ZA 5KJ7C 3L74G 4DJGA 2K9JB 1FAVA 2E75C 4Y99C 3VN0A 3SSUA 2D2CB 1FU1A 2IZ1A 2KNCB 4UB8H 5B5EH 5KLVE 2HG5D 2OYIB 1K05A 1K04A 1RF0C 2H88C 2RMZA 5M1BA 1CSBA 5AVYB 1VQ4P 3OA7A 5AVVB 1VPCA 1PPJG 3S4RA 2XKMA 1KC8Q 1P84D 2QSIA 3RK2B 1Q7YQ 3JSVC 2N9BA 1L2PA 4ASVA 1GZLA 2IDBA 1NU1D 1PP9D 1NYHA 1T2KC 4IFMA 1GK4A 1Z56A 3N4XA 3PJSK 3V2RA 4N78E 1RF1A 1DH3A 3MUDA 1EXJA 2KP8A 1DX7A 1LWUC 1KQGB 1U7MA 1ZLLA 2GUSA 2N9YB 2B87B 2Q1KA 1NTKE 1JY2O 3CX5I 5CBOA 4GOEA 2Z5IA 1LP1A 2W6AA 2I8DA 3JCUE 1JB0J 2R32A 3EWKA 4PJ0E 1FZBA 1L4AA 1QL1A 1OW8A 1L0LJ 1SQPJ 1T6AA 3L75D 3D6YA 1CI6A 1L0ND 2FYUJ 2FFDB 2QA4P 1LTJA 1ZMEC 2YMKA 2QG4A 3WUUA 3HE4B 3AE4C 5AVSB 5AW4B 1BCCE 1UIXA 3JC22 5BVZA 3G71P 1A02F 1PL5A 4H44C 1QLED 1KB9D 2A45H 1WT6A 2W6JH 2O01N 1GL2D 3CWBD 1BDCA 3RBXA 1VQ5P 4IL6E 2E75B 4K3AA 4Y99B 1KQFB 4BWNA 1S1CX 3F5HA 1NTZE 1L0LE 1M1KQ 4BXLA 1GTWA 3L71E 3H1JE 3AE7C 1KQSO 2H89C 1J1DC 3PTZA 4KJMA 1PGQA 2W27A 2KB7P 1L0NK 2E76B 3TSIA 2HPCA 1L0LD 1KILD 3H1KJ 1BCCJ 2YKQA 1FZCC 3P8CD 3Q1MA 2AXTE 2C0XA 2ZT9C 3LW5H 1LT9B 1P84I 1X79B 3L73G 3P8MC 2WWWA 3R4YA 2OARA 1A02J 1SQVJ 2A45G 3OAKA 4CPGA 1IO4A 4RKUJ 3USSA 4U7JA 1OFCX 4L75A 4OGQC 1FZCB 1HF9A 1NTZJ 1ZR2A 4EYYQ 3V4QA 1PGJA 5AVUB 1RF1C 2R5BA 1FOSE 4WY4D 5AW0B 1KILB 1M90Q 1FZCA 2OTLP 1MFZA 2C9LY 3SWYA 3AE8C 4U3FD 1LTSC 1LJ2A 1X22A 1NHLA 2H43A 2L5GB 1ZR4A 1DEBA 2IBZD 3A0BH 1SFCD 2RN0A 1L0LK 1QVFO 4B86A 2XDJA 2WMMA 1JNMA 1SQVG 1VF5C 2FYNB 1R5SA 2J59M 2WSFJ 3CXHH 1YQ3C 1T3JA 2HLOA 1WMKA 1SQXG 3FXEA 1KV4A 4YPCA 3CC7P 3H1HE 2LXBA 1KB9I 1M8OB 2M0BA 5KTBA 1HVVA 2FKWB 3L36A 3H1LD 1YBKA 3KYQA 2YNYA 4LC1A 2O1JA 3G9RA 5L8RJ 1JTHA 1NWQA 1HGZA 2OYHA 2ZFCA 3A3YB 4H0LB 2GM4A 1KMIZ 3GLMA 1R8EA 2OTJP 1IFIA 3HUSB 1GMJA 3GG2A 3I5CA 1OVUA 4O9BA 3C8VA 1JY3O 3L73J 3NFQA 3MUDC 3GHGB 3IN6A 1VQ6P 2PGDA 3H25A 3A0HH 2FFDA 1Q82Q 1OX3A 3HE5B 1LP1B 1JOCA 3AEDC 4H13D 2WSCJ 3V2NA 3H1IG 1NTMG 3GW6A 1N7SB 1N73B 2KYVA 2YMYA 3GMAA 3L74J 2IYPA 1M7LA 2IYOA 3L72G 5BU8B 1OMIA 3H6PA 1KFMA 1BGYE 1NU1G 1SQPE 1JEKA 5CHXA 3GHGC 3H1JD 2P67A 3PHLA 4PV1D 3D70A 3SFDC 2IBZI 2E74D 2P2UA 2M5AA 3KQGA 2P7JA 3U59A 3BRVB 3CWBE 5KAIH 3HUSA 1SVFA 2FYUD 3C1LA 2OTKE 2WSEH 3JCUH 4H44D 2NPSB 1JM0A 3ZDMA 1JTHB 1GW4A 4OGQD 5APSA 1VQMP 1SQQE 1PGOA 1LT9A 3H1KG 3RL0D 1H88A 1NTKD 1QGKB 4PV1B 2R5DA 3VP8A 1R5LA 1ZOYC 4H0LC 3T97B 5KLIB 3Q2YA 1G2CA 2O3JA 1BE3D 1EDKA 2QRXA 2W6BA 1Q81Q 3TGUE 1ZXGA 5CJ0A 1AA0A 4K35A 2FYNC 1VF5B 2QEXP 4WWIA 1YTZI 1S3JA 2YIUC 3KXDA 2I1JA 1N86A 2IBZE 4H13B 4TLFA 1E79H 2HODB 3HD7C 3K5BA 3H1IJ 3L72J 4HJGH 5AW1B 4H13C 4PD4H 1ZW0A 1K73Q 2YXRB 4U3FE 1SQBJ 2P1JA 4HH2A 5APVA 1LTBC 2E42A 4N3YB 5KAIE 1N7SC 1N73C 2E75D 1YJ9P 2WPSA 2WSEJ 1FOSF 1LNQA 1NKNA 3O8ZA 3AE6C 3O6QB 1AV1A 1Y9BA 5APTA 2PRRA 3A0HE 3ITKA 2WTYA 1VQ7P 1LTTC 2M5AB 2RKLA 5AW7B 1L0NJ 1LTJC 2WT7A 1PZQA 5AVXB 5KLIC 3D71A 4YTPC 1FZFA 1D7MA 1SFCC 5APYA 4WY4C 1VQNP 1J2JB 3P8CE 1FBMA 2N1TC 2A06E 3Q3DA 2B87A 2JWAA 2Q3IA 2R3CA 1LTIC 2HPCB 3CCLP 4I6MC 1SQVK 2Q6QA 4JF7A 3MGNA 3CCQP 2JEEA 4N78D 1FC2C 4D6TG 2OYHB 1AQ5A 1PP9J 4KT0J 3RL0C 1IZNB 1EDIA 3VTPC 2QJKB 2XNDH 3VP9A 5KAFE 3HE5A 1SFCB 3CCUP 2PP6A 3L71J 1X0TA 1KD1Q 3FXDA 3S1KA 2C9NY 2ZJSE 3O6QA 2YO3A 2XU6A 4YXDC 3QH9A 1AVYA 4EOTA 1MV8A 4ZNCA 2WPQA 2QM7A 1X8YA 1NTMK 3CPWO 2JKVA 5APXA 1AQTA 2YXQB 2JP3A 4ZKUA 3D6ZA 1YJNP 5KJ7A 1EDLA 5KAFH 1PFIA 2FYUK 3CC4P 3HD7B 2D2CD 3RL0g 1NTZG 4GDOA 1H89A 1N7SD 1DD4A 1NTMJ 3L71G 1GW3A 3L73D 3MP7B 4LLHA 2WSFH 1NTKK 1LWUB 3BCCD 2J5UA 3CCMP 1NOHA 1HH0A 3CLQA 4BRYB 3TGUD 4JQ0D 3CCJP 1E5WA 1OXZA 2IFMA 2B9BA 3WU2H 1BDDA 2AXCA 1VQ9P 1T3UA 2A06D 3L37A 2SPZA 3L70D 1VQPP 1VQOP 4Z1MH 3BCCE 1IK7A 3H1LJ 1BCCD 1NAFA 3B5NA 3L73E 3QWOC 1JCCA 1NTMD 3BRTB 2M8RA 3PP5A 4PV1C 1GL2B 4ASWA 1JMBA 1W5CE 2NPSA 3M0DA 5GTHE 1S9KE 2E76C 2Y9YA 1RY3A 1KILA 2KUBA 2D2CC 5AVRB 1L0NG 1J1DB 3M91A 3VOPA 2XZRA 3CX5H 2OYIA 2CPSA 2NRGA 3RBZA 2BEQD 1S4XA 2V7QH 2KI7B 1Q90D 4WVZA 2Q7CA 3A5TA 3VMYA 2Y9ZA 2QIWA 3P32A 5KJ7D 4W80A 1FJKA 1KYOI 2XV5A 3R2PA 4RO0A 4XA4A 2AXTH 5AVZB 3IAOA 1GU5A 3CD6P 2LR2A 5APWA 1KILC 1PP9G 2CPBA 4GKGA 2WSSH 4IL6X 5CJ4A 3BATA 4OGQB 4R4MA 3MTUE 2A45I 1BE3E 1BE3J 3IFMA 3H1HG 1RE4C 3TK1A 2QE7H 1G2CB 5CCHC 2ZXEB 1SQVD 2Y0CA 3CC2P 1LT9C 3CCVP 4L76A 2ZT9B 5APQA 2FXPA 3G6EP 1RE3A 1YYCA 4DOJA 4I7ZB 3SFEC 3PLNA 1KB9H 1JO5A 3AE3C 5CCHA 3CCRP 3HUSC 3KHUA 1KZUB 1M1JA 1M57D 2RH0A 1URQC 2G3AA 3HE4A 3KZIE 5KLVJ 2JWDA 4N6JA 1H0TB 1RQUA 4D6TJ 3RK3D 2Q3EA 1S9KD 2KSJA 2WITA 1LT1A 3C9IA 3M06A 4WB4A 4C7RA 1QVGO 1CI6B 1RE4A 2MJZA 2BCCD 4OH8B 3TNUB 2LXCB 3TF5A 1OVVA 2E76D 1YHQP 2GUVA 2LKMA 3H1IE 1W2BO 2JJLA 3MD0A 2MKVA 3L72D 3V6IA 4C7NB 4IOIH 1DEEG 4MN4C 1SQBK 1S2EA 1EZVG 4IFFA 2P58A 2Q9IA 1BGYG 2KZJA 1GU4A 2FFDC 2CK3H 3FX0A 1NKZB 2C0WA 2E5TA 1HTLC 1FE6A 2FYUE 5CMZA 5DJTB 4DZOA 1YIJP 3E1RA 1PPJD 4A7PA 1RF1B 2KK7A 2W90A 3AEEC 1JY3N 1X9VA 2E74C 4TT3H 3CWBG 3OW2O 2K3RA 2R3SA 3ABVC 3F89A 3KZIH 1MZ9A 4UB8E 2WQYC 1SQPK 3B5ND 4WY4A 3LIEA 4W7YA 3PRJA 1SQQG 1USDA 2KSEA 1KORA 3BCCJ 3H1LE 1NAYA 1SS1A 1J1EB 2AEFA 2HODA 4I7ZC 4H0LD 3V5BA 3H1JJ 5CCGA 1MFTA 2JDIH 2Y0EA 3BVHA 1L4AD 3B4SA 3U1CA 2IZ0A 1LTGC 2QJYC 3KPEA 3L75E 4Y28J 3RGUA 1HJBA 3AECC 3H1KD 1ZV8A 1FDOA 1JY3P 2GA1A 2IBZG 3B71A 2WVRA 2KLVA 3LW5J 3RK3B 1T2KD 1VF5D 4XE5B 2P10A 4U3FG 1BGYJ 1GL2C 1FZEA 3A2AA 1SLQA 5AW6B 2KS1B 2O01J 3KDPB 1URQA 2FYZA 3NTNA 1KYOE 3VMXA 4DT0A 3CMEP 3RL0B 3B8EB 3CX5D 1OW7A 2ZVNB 2N1TA 4UB6E 4D6TD 3L4FA 3M9QA 4IFDK 1L4AB 3LIDA 2IX7C 2BASA 1FS0E 1TU3F 2JR8A 3EFGA 5TISE 3L70G 3V2QA 3BASA 2E43A 5E79E 5KLVG 2WPRA 1KILE 2A06G 3AE1C 1M1JC 3RK2C 1SQBE 2N1TD 1CZQA 1NH4A 2YKOA 4OWFA 1G1JA 5CCGD 1BSHA 1VL2A 2ITAA 3L35A 3M0AA 3V4WA 4D6TE 1RE3C 2V7QJ 1JCDA 1KYOH 4EIJA 1HWTC 1N2DC 4DCKA 2BCCE 1Q86Q 5B66E 1Y47A 3T97A 2V4HA 4AYCA 1W2EA 1SQBD 4LGDE 1ZP0C 3II6A 1OVRA 5GTHH 3RK3E 2QM8A 2H8PD 1YTZT 3L74E 5E79H 3IF4A 4ZMDA 1EQ7A 3VYIA 2OYIC 5B66H 3NMDA 1IFDA 1SQXJ 4U3FJ 2YIUB 4GOFA 3WU2E
chains in the Genus database with same CATH topology
2Q5UA 4RESB 2O1KA 3B5NC 5AVWB 3G3ZA 4C46A 4W7ZA 2H7HA 2M3BA 1NTZK 2Z4EA 1QL2A 2WZ7A 4GT1A 3A7OA 3WMM0 3M9BA 4JYBA 1JY2N 2N1TB 3RK2D 2WSCH 1HUCA 1LTAC 1KQLA 3V2PA 4I1LA 2NPSD 1IFNA 1GL2A 2I1KA 5AW2B 1FJPA 5AVTB 4C7NA 3HTKB 1IC2A 1GDTA 3NXSA 1OWAA 4GIFA 2O01H 1JY2P 1G1IA 3HRNA 2OYHC 5CCGC 4I2LC 3P7KA 2NPSC 3M0DC 5BU5A 4AUWA 4WY4B 1LGHB 3IR9A 2Z5HA 3E1IA 1XTCC 5AVQB 1LTJB 1ZN5A 1IK9A 1GD2E 3B5NB 4M3LA 1HGVA 4HYTB 4JYCA 3CI9A 3HD7D 1N7SA 1N73A 1KFNA 4AQRD 3UIAA 5KLVK 5AW5B 2YKPA 3U1AA 1JUNA 1J1EC 2HYNA 1JMMA 3HD7A 3N7NA 1RF1B 2E42A 4WBAA 3M9HA 1FZGA 3SWFA 2YO2A 5AW8B 2IFNA 1M1JB 3RK2B 1NU1K 1VDFA 5AW3B 1CW5A 2XNXA 1AFOA 5AW9B 4KHXA 3VMZA 1SFCA 3TYYA 1RF0A 1FDMA 3HTKA 1MUUA 3RK3C 1GK6A 2IPPA 3OJAB 4C7NB 3TNUA 3MIWA 3CL3D 1SQQK 2POHA 2WT7B 2HFED 1HBWA 2KOGA 5APUA 1URQB 5CCHD 1SP4A 1H8AA 1XTGB 4ZKPA 1L4AC 2PAJA 1IFJA 1IFMA 1URQD 3H32B 1LWUA 1FZAA 1NO4A 3H32A 1SQXK 3EQ2A 1IJDB 1WRGA 2FXMA 1N7LA 3GHGA 2J58A 2VRSA 1T8ZA 5KJ7C 1FAVA 4Y99C 3VN0A 1FU1A 1DH3A 2OYIB 2HG5D 1RF0C 1CSBA 5AVYB 3OA7A 5AVVB 1VPCA 2XKMA 2N9BA 1GZLA 1T2KC 1FZCC 4IFMA 1GK4A 1Z56A 3N4XA 3V2RA 1RF1A 4N78E 3MUDA 2KP8A 1DX7A 1LWUC 1ZLLA 2GUSA 1JY2O 2Z5IA 2W6AA 2R32A 1FZBA 1L4AA 1QL1A 1CI6A 2FFDB 1LTJA 3HE4B 5AVSB 5AW4B 5BVZA 1A02F 2A45H 1WT6A 1GL2D 4Y99B 1GTWA 1J1DC 2W27A 2KB7P 1L0NK 3TSIA 2HPCA 1KILD 2YKQA 3P8CD 2C0XA 3LW5H 1LT9B 1X79B 3P8MC 2WWWA 2OARA 1A02J 2A45G 3OAKA 1IO4A 1FZCB 1ZR2A 3V4QA 5AVUB 1RF1C 2R5BA 1FOSE 5AW0B 1KILB 1FZCA 1MFZA 2C9LY 3SWYA 1LTSC 1NHLA 2H43A 2L5GB 1ZR4A 1DEBA 1SFCD 1L0LK 4B86A 2XDJA 1JNMA 2J59M 1T3JA 2HLOA 5KTBA 1HVVA 2FKWB 3L36A 3KYQA 4LC1A 2YNYA 2O1JA 1JTHA 1NWQA 1HGZA 2OYHA 2ZFCA 3A3YB 2GM4A 1IFIA 3HUSB 2OYHB 3I5CA 4O9BA 3NFQA 1JY3O 3GHGB 2FFDA 3HE5B 1JOCA 3V2NA 1N7SB 1N73B 2KYVA 2YMYA 1M7LA 5BU8B 3H6PA 1KFMA 5CHXA 3GHGC 2P67A 2P2UA 3KQGA 2P7JA 3U59A 3BRVB 3HUSA 1SVFA 2WSEH 2NPSB 1JTHB 1GW4A 5APSA 1LT9A 3RL0D 1H88A 3VP8A 2R5DA 1G2CA 2W6BA 5CJ0A 1YTZI 2I1JA 1N86A 5AW1B 2HODB 3HD7C 2P1JA 4HH2A 5APVA 1LTBC 4N3YB 1N7SC 1N73C 2WPSA 1FOSF 1NKNA 3O8ZA 5APTA 3BVHA 2WTYA 1LTTC 5AW7B 1LTJC 2WT7A 5AVXB 1FZFA 1SFCC 5APYA 4WY4C 1J2JB 3P8CE 1FBMA 2N1TC 2R3CA 2Q3IA 1LTIC 2HPCB 4I6MC 1SQVK 4JF7A 3MGNA 2JEEA 4N78D 1AQ5A 3RL0C 3VTPC 3VP9A 3HE5A 1SFCB 2PP6A 2C9NY 2YO3A 2XU6A 4EOTA 1MV8A 2WPQA 2QM7A 1NTMK 1X8YA 5APXA 4ZKUA 5KJ7A 1PFIA 2FYUK 3HD7B 1H89A 1N7SD 1GW3A 2WSFH 1NTKK 1LWUB 1NOHA 1HH0A 3CLQA 1E5WA 1OXZA 2IFMA 1T3UA 3L37A 4LLHA 3B5NA 1NAFA 4WY4D 1JCCA 3BRTB 3PP5A 2M8RA 1GL2B 1S9KE 2NPSA 3M0DA 1RY3A 1KILA 5AVRB 1J1DB 3M91A 3VOPA 2XZRA 2OYIA 2CPSA 3A5TA 2Q7CA 3VMYA 5KJ7D 3P32A 4W80A 1FJKA 3R2PA 2XV5A 4XA4A 5AVZB 1GU5A 5APWA 1KILC 2CPBA 4GKGA 5CJ4A 3BATA 3MTUE 2A45I 3IFMA 3TK1A 5CCHC 1RE4C 1G2CB 2ZXEB 1LT9C 5APQA 1RE3A 1YYCA 4DOJA 1JO5A 5CCHA 3HUSC 1KZUB 1M1JA 1URQC 3HE4A 4N6JA 3RK3D 1S9KD 2KSJA 2WITA 4WB4A 3C9IA 3M06A 4C7RA 1CI6B 1RE4A 2MJZA 4OH8B 3TNUB 2GUVA 2LKMA 2JJLA 3MD0A 1SQBK 4IFFA 2Q9IA 1GU4A 2FFDC 1NKZB 2C0WA 5CMZA 1HTLC 4DZOA 1JY3N 1X9VA 1MZ9A 1SQPK 3B5ND 4WY4A 3LIEA 4W7YA 1J1EB 2HODA 3V5BA 5CCGA 1L4AD 3U1CA 1LTGC 3KPEA 1HJBA 1ZV8A 1JY3P 2KLVA 1T2KD 3RK3B 4XE5B 1GL2C 1FZEA 3A2AA 1SLQA 5AW6B 3KDPB 1URQA 2FYZA 3NTNA 3VMXA 3RL0B 3B8EB 2N1TA 4IFDK 3L4FA 3M9QA 1L4AB 3LIDA 2IX7C 2BASA 3EFGA 3V2QA 3BASA 2E43A 2WPRA 1M1JC 3RK2C 2N1TD 2YKOA 1CZQA 1NH4A 5CCGD 1G1JA 3L35A 3M0AA 3V4WA 1RE3C 1JCDA 4EIJA 1HWTC 1N2DC 3T97A 4AYCA 1W2EA 4LGDE 3II6A 2QM8A 2H8PD 1YTZT 1EQ7A 3VYIA 2OYIC 3NMDA 1IFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KJ7 D;  4W80 A;  1L4A C;  3B5N C;  1URQ D;  4W7Z A;  1KIL C;  1N7S B;  2YMY A;  2WZ7 A;  5CCH C;  2N1T B;  3RK2 D;  5KJ7 C;  5CCH A;  2NPS D;  1URQ C;  2HG5 D;  2NPS B;  1GL2 A;  1JTH B;  3RK3 D;  3RL0 D;  4OH8 B;  3HTK B;  4N78 E;  5CCG C;  1L4A A;  2NPS C;  3M0D C;  3HD7 C;  4WY4 B;  1N7S C;  4WY4 A;  3B5N D;  4W7Y A;  3B5N B;  1GL2 D;  1SFC C;  4WY4 C;  3P8C E;  2N1T C;  5CCG A;  3HD7 D;  1N7S A;  1L4A D;  4JF7 A;  3TSI A;  3RL0 C;  1KIL D;  3HD7 A;  1SFC B;  2PP6 A;  3RK3 B;  1GL2 C;  1URQ A;  3RK2 B;  1KIL B;  3RL0 B;  5KJ7 A;  2N1T A;  1L4A B;  1NHL A;  3HD7 B;  1SFC A;  1SFC D;  1N7S D;  2XDJ A;  3RK2 C;  2N1T D;  5CCG D;  1T3J A;  3RK3 C;  3B5N A;  4WY4 D;  4LGD E;  3PP5 A;  1HVV A;  2M8R A;  1GL2 B;  2H8P D;  3KYQ A;  2NPS A;  2HFE D;  2KOG A;  1JTH A;  1URQ B;  1KIL A;  5CCH D;  3VOP A;  1XTG B; 
#chains in the Genus database with same CATH topology
 2Q5U A;  5EFW B;  1PPJ E;  4RES B;  4NPF X;  2O1K A;  5GTI H;  3B5N C;  5AVW B;  3CCS P;  1SQP D;  3G3Z A;  3L75 J;  2KLU A;  1S5L H;  1NJI Q;  4C46 A;  4W7Z A;  4IL6 H;  2H7H A;  1NVO A;  2M3B A;  1NTZ K;  2Z4E A;  2K37 A;  1QL2 A;  1NTK G;  2WZ7 A;  3AEB C;  3A7O A;  1YQ4 C;  4GT1 A;  3Q5S A;  3WMM 0;  1NU1 J;  1RHZ B;  2R44 A;  3BCC G;  3M9B A;  2M3E A;  4JYB A;  3VMA A;  4JBZ A;  1JY2 N;  3GF7 A;  2N1T B;  3RK2 D;  2WSC H;  1H0T A;  1EZV I;  1KN7 A;  1HUC A;  1USE A;  1LTA C;  2ZT9 D;  1KQL A;  3V2P A;  3CWB J;  2QVA A;  1L0N E;  4I1L A;  1BCC G;  1KB9 E;  2NPS D;  2K9J A;  1IFN A;  2B88 A;  1BGY D;  3MZW B;  2BEZ F;  1GL2 A;  2I1K A;  1UII A;  2K9Y A;  3L74 D;  3W67 A;  1DIP A;  2W8Z A;  5AW2 B;  1FJP A;  3FWN A;  5AVT B;  1EDJ A;  4C7N A;  4NPD A;  3HTK B;  2KIK A;  1IC2 A;  1L0L G;  3H1H D;  1AJY A;  1HJ0 A;  1GDT A;  1RQV A;  2PFX A;  1OIP A;  3AE2 C;  3H1J G;  1PP9 E;  3PH0 A;  3NXS A;  1OWA A;  4GIF A;  4OVN F;  2BCC J;  2O01 H;  1JY2 P;  4PD4 I;  3WUV A;  1P84 E;  3L71 D;  4R4L A;  1G1I A;  1S72 P;  2QJK C;  3HRN A;  2WPV B;  2DW3 A;  2OYH C;  5CCG C;  3CCE P;  1BE3 G;  1EC5 A;  4I2L C;  3P7K A;  4PJ0 H;  5DJU B;  2NPS C;  3M0D C;  1U57 A;  2L91 A;  2OGU A;  5KLV D;  5BU5 A;  2QJP B;  2QJP C;  5KKZ C;  2UWJ E;  5KKZ B;  4RJT A;  1M56 D;  4PD4 E;  3CX5 E;  2KXP B;  4AUW A;  4WY4 B;  1LGH B;  1S5L E;  2Z5H A;  3IR9 A;  4EI2 A;  3Q5P A;  1AVO A;  3E1I A;  1XTC C;  5AVQ B;  1VQK P;  1N8R Q;  1LTJ B;  1ZN5 A;  1IK9 A;  3SWK A;  1P84 H;  1GD2 E;  3AEF C;  3W68 A;  3E7K A;  3B5N B;  4M3L A;  1PIX A;  3H1H J;  1HGV A;  4HYT B;  4QMA A;  3I55 P;  4JYC A;  3WUT A;  1K8A Q;  1FDI A;  1SQX D;  3CI9 A;  2ZVO B;  2NZ2 A;  1ZRT E;  2ZYD A;  1EZV D;  3HD7 D;  1EXI A;  1N7S A;  1N73 A;  1KFN A;  1MKM A;  1SQV E;  2QJY B;  3UIA A;  4AQR D;  5AW5 B;  5KLV K;  2ZYG A;  1YI2 P;  1EZV E;  3Q5R A;  3H1I D;  2YKP A;  4HKZ H;  1SQX E;  3U1A A;  1YJW P;  1JUN A;  1J1E C;  2HYN A;  1JMM A;  1NTZ D;  2ZXX A;  3AEA C;  3HD7 A;  1KYO D;  2HR3 A;  3N7N A;  3MHV A;  5H2F H;  2W83 C;  4WBA A;  1K9M Q;  2FYU G;  2AEJ A;  3M9H A;  1VQL P;  1FZG A;  2K1A A;  1OW6 A;  3CXH I;  3SWF A;  2FBW C;  2YO2 A;  3RK3 C;  5AW8 B;  1PGP A;  2E74 B;  2IFN A;  1M1J B;  1SQQ D;  2G8Y A;  1NU1 K;  1VDF A;  2FXO A;  3FGA D;  4PD4 D;  1NTK J;  5AW3 B;  5B5E E;  1CW5 A;  5TJH A;  2XNX A;  1AFO A;  3H1L G;  5AW9 B;  4KHX A;  3VMZ A;  3TGU J;  1PV3 A;  1SFC A;  3TYY A;  1RF0 A;  3AE5 C;  1NTM E;  1OZH A;  5GTI E;  3I56 P;  1DD3 A;  3L75 G;  4L73 A;  3CXH E;  3L72 E;  1FDM A;  1ZRT D;  3CMA P;  1QEX A;  2JO1 A;  3HTK A;  1MUU A;  1QX8 A;  5TIS H;  4L74 A;  4XFJ A;  1GK6 A;  1NU1 E;  1SQP G;  2IPP A;  3EFF K;  2E5Y A;  3MIW A;  3OJA B;  2Y0D A;  4UB6 H;  4JPZ B;  3CL3 D;  3TNU A;  1BSN A;  1SQQ K;  3G4S P;  1Q2N A;  2POH A;  4YXW H;  5C39 A;  2WT7 B;  2HFE D;  1HBW A;  3AEG C;  2KOG A;  5APU A;  1URQ B;  2KS1 A;  5CCH D;  1RH5 B;  1SP4 A;  2ZYA A;  1H8A A;  1U7J A;  2KNC A;  2FY8 A;  1XTG B;  5K5G B;  4ZKP A;  1SQQ J;  2KZI A;  3H1K E;  1S5L X;  1L4A C;  3GF3 A;  2OQQ A;  3TDK A;  1IFP A;  1IFJ A;  1IFM A;  1Y8A A;  1URQ D;  2PAJ A;  3A0B E;  3L70 J;  3L70 E;  5CBN A;  2ZAE B;  3CXH D;  4BRY A;  3TGU G;  1SQB G;  3H32 B;  1LWU A;  2B89 A;  4GOD A;  2OYO A;  1FZA A;  3AE9 C;  4HB1 A;  1NO4 A;  2K88 A;  3H32 A;  1SQX K;  3EQ2 A;  1IJD B;  5H2F E;  3S9O A;  1NGM B;  4H44 B;  2BCC G;  4NPE A;  1WRG A;  1VQ8 P;  2FXM A;  1YIT P;  1N7L A;  3FWL A;  3GHG A;  2J58 A;  2VRS A;  4EDF A;  2AEM A;  1KTM A;  1T8Z A;  5KJ7 C;  3L74 G;  4DJG A;  2K9J B;  1FAV A;  2E75 C;  4Y99 C;  3VN0 A;  3SSU A;  2D2C B;  1FU1 A;  2IZ1 A;  2KNC B;  4UB8 H;  5B5E H;  5KLV E;  2HG5 D;  2OYI B;  1K05 A;  1K04 A;  1RF0 C;  2H88 C;  2RMZ A;  5M1B A;  1CSB A;  5AVY B;  1VQ4 P;  3OA7 A;  5AVV B;  1VPC A;  1PPJ G;  3S4R A;  2XKM A;  1KC8 Q;  1P84 D;  2QSI A;  3RK2 B;  1Q7Y Q;  3JSV C;  2N9B A;  1L2P A;  4ASV A;  1GZL A;  2IDB A;  1NU1 D;  1PP9 D;  1NYH A;  1T2K C;  4IFM A;  1GK4 A;  1Z56 A;  3N4X A;  3PJS K;  3V2R A;  4N78 E;  1RF1 A;  1DH3 A;  3MUD A;  1EXJ A;  2KP8 A;  1DX7 A;  1LWU C;  1KQG B;  1U7M A;  1ZLL A;  2GUS A;  2N9Y B;  2B87 B;  2Q1K A;  1NTK E;  1JY2 O;  3CX5 I;  5CBO A;  4GOE A;  2Z5I A;  1LP1 A;  2W6A A;  2I8D A;  3JCU E;  1JB0 J;  2R32 A;  3EWK A;  4PJ0 E;  1FZB A;  1L4A A;  1QL1 A;  1OW8 A;  1L0L J;  1SQP J;  1T6A A;  3L75 D;  3D6Y A;  1CI6 A;  1L0N D;  2FYU J;  2FFD B;  2QA4 P;  1LTJ A;  1ZME C;  2YMK A;  2QG4 A;  3WUU A;  3HE4 B;  3AE4 C;  5AVS B;  5AW4 B;  1BCC E;  1UIX A;  3JC2 2;  5BVZ A;  3G71 P;  1A02 F;  1PL5 A;  4H44 C;  1QLE D;  1KB9 D;  2A45 H;  1WT6 A;  2W6J H;  2O01 N;  1GL2 D;  3CWB D;  1BDC A;  3RBX A;  1VQ5 P;  4IL6 E;  2E75 B;  4K3A A;  4Y99 B;  1KQF B;  4BWN A;  1S1C X;  3F5H A;  1NTZ E;  1L0L E;  1M1K Q;  4BXL A;  1GTW A;  3L71 E;  3H1J E;  3AE7 C;  1KQS O;  2H89 C;  1J1D C;  3PTZ A;  4KJM A;  1PGQ A;  2W27 A;  2KB7 P;  1L0N K;  2E76 B;  3TSI A;  2HPC A;  1L0L D;  1KIL D;  3H1K J;  1BCC J;  2YKQ A;  1FZC C;  3P8C D;  3Q1M A;  2AXT E;  2C0X A;  2ZT9 C;  3LW5 H;  1LT9 B;  1P84 I;  1X79 B;  3L73 G;  3P8M C;  2WWW A;  3R4Y A;  2OAR A;  1A02 J;  1SQV J;  2A45 G;  3OAK A;  4CPG A;  1IO4 A;  4RKU J;  3USS A;  4U7J A;  1OFC X;  4L75 A;  4OGQ C;  1FZC B;  1HF9 A;  1NTZ J;  1ZR2 A;  4EYY Q;  3V4Q A;  1PGJ A;  5AVU B;  1RF1 C;  2R5B A;  1FOS E;  4WY4 D;  5AW0 B;  1KIL B;  1M90 Q;  1FZC A;  2OTL P;  1MFZ A;  2C9L Y;  3SWY A;  3AE8 C;  4U3F D;  1LTS C;  1LJ2 A;  1X22 A;  1NHL A;  2H43 A;  2L5G B;  1ZR4 A;  1DEB A;  2IBZ D;  3A0B H;  1SFC D;  2RN0 A;  1L0L K;  1QVF O;  4B86 A;  2XDJ A;  2WMM A;  1JNM A;  1SQV G;  1VF5 C;  2FYN B;  1R5S A;  2J59 M;  2WSF J;  3CXH H;  1YQ3 C;  1T3J A;  2HLO A;  1WMK A;  1SQX G;  3FXE A;  1KV4 A;  4YPC A;  3CC7 P;  3H1H E;  2LXB A;  1KB9 I;  1M8O B;  2M0B A;  5KTB A;  1HVV A;  2FKW B;  3L36 A;  3H1L D;  1YBK A;  3KYQ A;  2YNY A;  4LC1 A;  2O1J A;  3G9R A;  5L8R J;  1JTH A;  1NWQ A;  1HGZ A;  2OYH A;  2ZFC A;  3A3Y B;  4H0L B;  2GM4 A;  1KMI Z;  3GLM A;  1R8E A;  2OTJ P;  1IFI A;  3HUS B;  1GMJ A;  3GG2 A;  3I5C A;  1OVU A;  4O9B A;  3C8V A;  1JY3 O;  3L73 J;  3NFQ A;  3MUD C;  3GHG B;  3IN6 A;  1VQ6 P;  2PGD A;  3H25 A;  3A0H H;  2FFD A;  1Q82 Q;  1OX3 A;  3HE5 B;  1LP1 B;  1JOC A;  3AED C;  4H13 D;  2WSC J;  3V2N A;  3H1I G;  1NTM G;  3GW6 A;  1N7S B;  1N73 B;  2KYV A;  2YMY A;  3GMA A;  3L74 J;  2IYP A;  1M7L A;  2IYO A;  3L72 G;  5BU8 B;  1OMI A;  3H6P A;  1KFM A;  1BGY E;  1NU1 G;  1SQP E;  1JEK A;  5CHX A;  3GHG C;  3H1J D;  2P67 A;  3PHL A;  4PV1 D;  3D70 A;  3SFD C;  2IBZ I;  2E74 D;  2P2U A;  2M5A A;  3KQG A;  2P7J A;  3U59 A;  3BRV B;  3CWB E;  5KAI H;  3HUS A;  1SVF A;  2FYU D;  3C1L A;  2OTK E;  2WSE H;  3JCU H;  4H44 D;  2NPS B;  1JM0 A;  3ZDM A;  1JTH B;  1GW4 A;  4OGQ D;  5APS A;  1VQM P;  1SQQ E;  1PGO A;  1LT9 A;  3H1K G;  3RL0 D;  1H88 A;  1NTK D;  1QGK B;  4PV1 B;  2R5D A;  3VP8 A;  1R5L A;  1ZOY C;  4H0L C;  3T97 B;  5KLI B;  3Q2Y A;  1G2C A;  2O3J A;  1BE3 D;  1EDK A;  2QRX A;  2W6B A;  1Q81 Q;  3TGU E;  1ZXG A;  5CJ0 A;  1AA0 A;  4K35 A;  2FYN C;  1VF5 B;  2QEX P;  4WWI A;  1YTZ I;  1S3J A;  2YIU C;  3KXD A;  2I1J A;  1N86 A;  2IBZ E;  4H13 B;  4TLF A;  1E79 H;  2HOD B;  3HD7 C;  3K5B A;  3H1I J;  3L72 J;  4HJG H;  5AW1 B;  4H13 C;  4PD4 H;  1ZW0 A;  1K73 Q;  2YXR B;  4U3F E;  1SQB J;  2P1J A;  4HH2 A;  5APV A;  1LTB C;  2E42 A;  4N3Y B;  5KAI E;  1N7S C;  1N73 C;  2E75 D;  1YJ9 P;  2WPS A;  2WSE J;  1FOS F;  1LNQ A;  1NKN A;  3O8Z A;  3AE6 C;  3O6Q B;  1AV1 A;  1Y9B A;  5APT A;  2PRR A;  3A0H E;  3ITK A;  2WTY A;  1VQ7 P;  1LTT C;  2M5A B;  2RKL A;  5AW7 B;  1L0N J;  1LTJ C;  2WT7 A;  1PZQ A;  5AVX B;  5KLI C;  3D71 A;  4YTP C;  1FZF A;  1D7M A;  1SFC C;  5APY A;  4WY4 C;  1VQN P;  1J2J B;  3P8C E;  1FBM A;  2N1T C;  2A06 E;  3Q3D A;  2B87 A;  2JWA A;  2Q3I A;  2R3C A;  1LTI C;  2HPC B;  3CCL P;  4I6M C;  1SQV K;  2Q6Q A;  4JF7 A;  3MGN A;  3CCQ P;  2JEE A;  4N78 D;  1FC2 C;  4D6T G;  2OYH B;  1AQ5 A;  1PP9 J;  4KT0 J;  3RL0 C;  1IZN B;  1EDI A;  3VTP C;  2QJK B;  2XND H;  3VP9 A;  5KAF E;  3HE5 A;  1SFC B;  3CCU P;  2PP6 A;  3L71 J;  1X0T A;  1KD1 Q;  3FXD A;  3S1K A;  2C9N Y;  2ZJS E;  3O6Q A;  2YO3 A;  2XU6 A;  4YXD C;  3QH9 A;  1AVY A;  4EOT A;  1MV8 A;  4ZNC A;  2WPQ A;  2QM7 A;  1X8Y A;  1NTM K;  3CPW O;  2JKV A;  5APX A;  1AQT A;  2YXQ B;  2JP3 A;  4ZKU A;  3D6Z A;  1YJN P;  5KJ7 A;  1EDL A;  5KAF H;  1PFI A;  2FYU K;  3CC4 P;  3HD7 B;  2D2C D;  3RL0 g;  1NTZ G;  4GDO A;  1H89 A;  1N7S D;  1DD4 A;  1NTM J;  3L71 G;  1GW3 A;  3L73 D;  3MP7 B;  4LLH A;  2WSF H;  1NTK K;  1LWU B;  3BCC D;  2J5U A;  3CCM P;  1NOH A;  1HH0 A;  3CLQ A;  4BRY B;  3TGU D;  4JQ0 D;  3CCJ P;  1E5W A;  1OXZ A;  2IFM A;  2B9B A;  3WU2 H;  1BDD A;  2AXC A;  1VQ9 P;  1T3U A;  2A06 D;  3L37 A;  2SPZ A;  3L70 D;  1VQP P;  1VQO P;  4Z1M H;  3BCC E;  1IK7 A;  3H1L J;  1BCC D;  1NAF A;  3B5N A;  3L73 E;  3QWO C;  1JCC A;  1NTM D;  3BRT B;  2M8R A;  3PP5 A;  4PV1 C;  1GL2 B;  4ASW A;  1JMB A;  1W5C E;  2NPS A;  3M0D A;  5GTH E;  1S9K E;  2E76 C;  2Y9Y A;  1RY3 A;  1KIL A;  2KUB A;  2D2C C;  5AVR B;  1L0N G;  1J1D B;  3M91 A;  3VOP A;  2XZR A;  3CX5 H;  2OYI A;  2CPS A;  2NRG A;  3RBZ A;  2BEQ D;  1S4X A;  2V7Q H;  2KI7 B;  1Q90 D;  4WVZ A;  2Q7C A;  3A5T A;  3VMY A;  2Y9Z A;  2QIW A;  3P32 A;  5KJ7 D;  4W80 A;  1FJK A;  1KYO I;  2XV5 A;  3R2P A;  4RO0 A;  4XA4 A;  2AXT H;  5AVZ B;  3IAO A;  1GU5 A;  3CD6 P;  2LR2 A;  5APW A;  1KIL C;  1PP9 G;  2CPB A;  4GKG A;  2WSS H;  4IL6 X;  5CJ4 A;  3BAT A;  4OGQ B;  4R4M A;  3MTU E;  2A45 I;  1BE3 E;  1BE3 J;  3IFM A;  3H1H G;  1RE4 C;  3TK1 A;  2QE7 H;  1G2C B;  5CCH C;  2ZXE B;  1SQV D;  2Y0C A;  3CC2 P;  1LT9 C;  3CCV P;  4L76 A;  2ZT9 B;  5APQ A;  2FXP A;  3G6E P;  1RE3 A;  1YYC A;  4DOJ A;  4I7Z B;  3SFE C;  3PLN A;  1KB9 H;  1JO5 A;  3AE3 C;  5CCH A;  3CCR P;  3HUS C;  3KHU A;  1KZU B;  1M1J A;  1M57 D;  2RH0 A;  1URQ C;  2G3A A;  3HE4 A;  3KZI E;  5KLV J;  2JWD A;  4N6J A;  1H0T B;  1RQU A;  4D6T J;  3RK3 D;  2Q3E A;  1S9K D;  2KSJ A;  2WIT A;  1LT1 A;  3C9I A;  3M06 A;  4WB4 A;  4C7R A;  1QVG O;  1CI6 B;  1RE4 A;  2MJZ A;  2BCC D;  4OH8 B;  3TNU B;  2LXC B;  3TF5 A;  1OVV A;  2E76 D;  1YHQ P;  2GUV A;  2LKM A;  3H1I E;  1W2B O;  2JJL A;  3MD0 A;  2MKV A;  3L72 D;  3V6I A;  4C7N B;  4IOI H;  1DEE G;  4MN4 C;  1SQB K;  1S2E A;  1EZV G;  4IFF A;  2P58 A;  2Q9I A;  1BGY G;  2KZJ A;  1GU4 A;  2FFD C;  2CK3 H;  3FX0 A;  1NKZ B;  2C0W A;  2E5T A;  1HTL C;  1FE6 A;  2FYU E;  5CMZ A;  5DJT B;  4DZO A;  1YIJ P;  3E1R A;  1PPJ D;  4A7P A;  1RF1 B;  2KK7 A;  2W90 A;  3AEE C;  1JY3 N;  1X9V A;  2E74 C;  4TT3 H;  3CWB G;  3OW2 O;  2K3R A;  2R3S A;  3ABV C;  3F89 A;  3KZI H;  1MZ9 A;  4UB8 E;  2WQY C;  1SQP K;  3B5N D;  4WY4 A;  3LIE A;  4W7Y A;  3PRJ A;  1SQQ G;  1USD A;  2KSE A;  1KOR A;  3BCC J;  3H1L E;  1NAY A;  1SS1 A;  1J1E B;  2AEF A;  2HOD A;  4I7Z C;  4H0L D;  3V5B A;  3H1J J;  5CCG A;  1MFT A;  2JDI H;  2Y0E A;  3BVH A;  1L4A D;  3B4S A;  3U1C A;  2IZ0 A;  1LTG C;  2QJY C;  3KPE A;  3L75 E;  4Y28 J;  3RGU A;  1HJB A;  3AEC C;  3H1K D;  1ZV8 A;  1FDO A;  1JY3 P;  2GA1 A;  2IBZ G;  3B71 A;  2WVR A;  2KLV A;  3LW5 J;  3RK3 B;  1T2K D;  1VF5 D;  4XE5 B;  2P10 A;  4U3F G;  1BGY J;  1GL2 C;  1FZE A;  3A2A A;  1SLQ A;  5AW6 B;  2KS1 B;  2O01 J;  3KDP B;  1URQ A;  2FYZ A;  3NTN A;  1KYO E;  3VMX A;  4DT0 A;  3CME P;  3RL0 B;  3B8E B;  3CX5 D;  1OW7 A;  2ZVN B;  2N1T A;  4UB6 E;  4D6T D;  3L4F A;  3M9Q A;  4IFD K;  1L4A B;  3LID A;  2IX7 C;  2BAS A;  1FS0 E;  1TU3 F;  2JR8 A;  3EFG A;  5TIS E;  3L70 G;  3V2Q A;  3BAS A;  2E43 A;  5E79 E;  5KLV G;  2WPR A;  1KIL E;  2A06 G;  3AE1 C;  1M1J C;  3RK2 C;  1SQB E;  2N1T D;  1CZQ A;  1NH4 A;  2YKO A;  4OWF A;  1G1J A;  5CCG D;  1BSH A;  1VL2 A;  2ITA A;  3L35 A;  3M0A A;  3V4W A;  4D6T E;  1RE3 C;  2V7Q J;  1JCD A;  1KYO H;  4EIJ A;  1HWT C;  1N2D C;  4DCK A;  2BCC E;  1Q86 Q;  5B66 E;  1Y47 A;  3T97 A;  2V4H A;  4AYC A;  1W2E A;  1SQB D;  4LGD E;  1ZP0 C;  3II6 A;  1OVR A;  5GTH H;  3RK3 E;  2QM8 A;  2H8P D;  1YTZ T;  3L74 E;  5E79 H;  3IF4 A;  4ZMD A;  1EQ7 A;  3VYI A;  2OYI C;  5B66 H;  3NMD A;  1IFD A;  1SQX J;  4U3F J;  2YIU B;  4GOF A;  3WU2 E; 
#chains in the Genus database with same CATH homology
 2Q5U A;  4RES B;  2O1K A;  3B5N C;  5AVW B;  3G3Z A;  4C46 A;  4W7Z A;  2H7H A;  2M3B A;  1NTZ K;  2Z4E A;  1QL2 A;  2WZ7 A;  4GT1 A;  3A7O A;  3WMM 0;  3M9B A;  4JYB A;  1JY2 N;  2N1T B;  3RK2 D;  2WSC H;  1HUC A;  1LTA C;  1KQL A;  3V2P A;  4I1L A;  2NPS D;  1IFN A;  1GL2 A;  2I1K A;  5AW2 B;  1FJP A;  5AVT B;  4C7N A;  3HTK B;  1IC2 A;  1GDT A;  3NXS A;  1OWA A;  4GIF A;  2O01 H;  1JY2 P;  1G1I A;  3HRN A;  2OYH C;  5CCG C;  4I2L C;  3P7K A;  2NPS C;  3M0D C;  5BU5 A;  4AUW A;  4WY4 B;  1LGH B;  3IR9 A;  2Z5H A;  3E1I A;  1XTC C;  5AVQ B;  1LTJ B;  1ZN5 A;  1IK9 A;  1GD2 E;  3B5N B;  4M3L A;  1HGV A;  4HYT B;  4JYC A;  3CI9 A;  3HD7 D;  1N7S A;  1N73 A;  1KFN A;  4AQR D;  3UIA A;  5KLV K;  5AW5 B;  2YKP A;  3U1A A;  1JUN A;  1J1E C;  2HYN A;  1JMM A;  3HD7 A;  3N7N A;  1RF1 B;  2E42 A;  4WBA A;  3M9H A;  1FZG A;  3SWF A;  2YO2 A;  5AW8 B;  2IFN A;  1M1J B;  3RK2 B;  1NU1 K;  1VDF A;  5AW3 B;  1CW5 A;  2XNX A;  1AFO A;  5AW9 B;  4KHX A;  3VMZ A;  1SFC A;  3TYY A;  1RF0 A;  1FDM A;  3HTK A;  1MUU A;  3RK3 C;  1GK6 A;  2IPP A;  3OJA B;  4C7N B;  3TNU A;  3MIW A;  3CL3 D;  1SQQ K;  2POH A;  2WT7 B;  2HFE D;  1HBW A;  2KOG A;  5APU A;  1URQ B;  5CCH D;  1SP4 A;  1H8A A;  1XTG B;  4ZKP A;  1L4A C;  2PAJ A;  1IFJ A;  1IFM A;  1URQ D;  3H32 B;  1LWU A;  1FZA A;  1NO4 A;  3H32 A;  1SQX K;  3EQ2 A;  1IJD B;  1WRG A;  2FXM A;  1N7L A;  3GHG A;  2J58 A;  2VRS A;  1T8Z A;  5KJ7 C;  1FAV A;  4Y99 C;  3VN0 A;  1FU1 A;  1DH3 A;  2OYI B;  2HG5 D;  1RF0 C;  1CSB A;  5AVY B;  3OA7 A;  5AVV B;  1VPC A;  2XKM A;  2N9B A;  1GZL A;  1T2K C;  1FZC C;  4IFM A;  1GK4 A;  1Z56 A;  3N4X A;  3V2R A;  1RF1 A;  4N78 E;  3MUD A;  2KP8 A;  1DX7 A;  1LWU C;  1ZLL A;  2GUS A;  1JY2 O;  2Z5I A;  2W6A A;  2R32 A;  1FZB A;  1L4A A;  1QL1 A;  1CI6 A;  2FFD B;  1LTJ A;  3HE4 B;  5AVS B;  5AW4 B;  5BVZ A;  1A02 F;  2A45 H;  1WT6 A;  1GL2 D;  4Y99 B;  1GTW A;  1J1D C;  2W27 A;  2KB7 P;  1L0N K;  3TSI A;  2HPC A;  1KIL D;  2YKQ A;  3P8C D;  2C0X A;  3LW5 H;  1LT9 B;  1X79 B;  3P8M C;  2WWW A;  2OAR A;  1A02 J;  2A45 G;  3OAK A;  1IO4 A;  1FZC B;  1ZR2 A;  3V4Q A;  5AVU B;  1RF1 C;  2R5B A;  1FOS E;  5AW0 B;  1KIL B;  1FZC A;  1MFZ A;  2C9L Y;  3SWY A;  1LTS C;  1NHL A;  2H43 A;  2L5G B;  1ZR4 A;  1DEB A;  1SFC D;  1L0L K;  4B86 A;  2XDJ A;  1JNM A;  2J59 M;  1T3J A;  2HLO A;  5KTB A;  1HVV A;  2FKW B;  3L36 A;  3KYQ A;  4LC1 A;  2YNY A;  2O1J A;  1JTH A;  1NWQ A;  1HGZ A;  2OYH A;  2ZFC A;  3A3Y B;  2GM4 A;  1IFI A;  3HUS B;  2OYH B;  3I5C A;  4O9B A;  3NFQ A;  1JY3 O;  3GHG B;  2FFD A;  3HE5 B;  1JOC A;  3V2N A;  1N7S B;  1N73 B;  2KYV A;  2YMY A;  1M7L A;  5BU8 B;  3H6P A;  1KFM A;  5CHX A;  3GHG C;  2P67 A;  2P2U A;  3KQG A;  2P7J A;  3U59 A;  3BRV B;  3HUS A;  1SVF A;  2WSE H;  2NPS B;  1JTH B;  1GW4 A;  5APS A;  1LT9 A;  3RL0 D;  1H88 A;  3VP8 A;  2R5D A;  1G2C A;  2W6B A;  5CJ0 A;  1YTZ I;  2I1J A;  1N86 A;  5AW1 B;  2HOD B;  3HD7 C;  2P1J A;  4HH2 A;  5APV A;  1LTB C;  4N3Y B;  1N7S C;  1N73 C;  2WPS A;  1FOS F;  1NKN A;  3O8Z A;  5APT A;  3BVH A;  2WTY A;  1LTT C;  5AW7 B;  1LTJ C;  2WT7 A;  5AVX B;  1FZF A;  1SFC C;  5APY A;  4WY4 C;  1J2J B;  3P8C E;  1FBM A;  2N1T C;  2R3C A;  2Q3I A;  1LTI C;  2HPC B;  4I6M C;  1SQV K;  4JF7 A;  3MGN A;  2JEE A;  4N78 D;  1AQ5 A;  3RL0 C;  3VTP C;  3VP9 A;  3HE5 A;  1SFC B;  2PP6 A;  2C9N Y;  2YO3 A;  2XU6 A;  4EOT A;  1MV8 A;  2WPQ A;  2QM7 A;  1NTM K;  1X8Y A;  5APX A;  4ZKU A;  5KJ7 A;  1PFI A;  2FYU K;  3HD7 B;  1H89 A;  1N7S D;  1GW3 A;  2WSF H;  1NTK K;  1LWU B;  1NOH A;  1HH0 A;  3CLQ A;  1E5W A;  1OXZ A;  2IFM A;  1T3U A;  3L37 A;  4LLH A;  3B5N A;  1NAF A;  4WY4 D;  1JCC A;  3BRT B;  3PP5 A;  2M8R A;  1GL2 B;  1S9K E;  2NPS A;  3M0D A;  1RY3 A;  1KIL A;  5AVR B;  1J1D B;  3M91 A;  3VOP A;  2XZR A;  2OYI A;  2CPS A;  3A5T A;  2Q7C A;  3VMY A;  5KJ7 D;  3P32 A;  4W80 A;  1FJK A;  3R2P A;  2XV5 A;  4XA4 A;  5AVZ B;  1GU5 A;  5APW A;  1KIL C;  2CPB A;  4GKG A;  5CJ4 A;  3BAT A;  3MTU E;  2A45 I;  3IFM A;  3TK1 A;  5CCH C;  1RE4 C;  1G2C B;  2ZXE B;  1LT9 C;  5APQ A;  1RE3 A;  1YYC A;  4DOJ A;  1JO5 A;  5CCH A;  3HUS C;  1KZU B;  1M1J A;  1URQ C;  3HE4 A;  4N6J A;  3RK3 D;  1S9K D;  2KSJ A;  2WIT A;  4WB4 A;  3C9I A;  3M06 A;  4C7R A;  1CI6 B;  1RE4 A;  2MJZ A;  4OH8 B;  3TNU B;  2GUV A;  2LKM A;  2JJL A;  3MD0 A;  1SQB K;  4IFF A;  2Q9I A;  1GU4 A;  2FFD C;  1NKZ B;  2C0W A;  5CMZ A;  1HTL C;  4DZO A;  1JY3 N;  1X9V A;  1MZ9 A;  1SQP K;  3B5N D;  4WY4 A;  3LIE A;  4W7Y A;  1J1E B;  2HOD A;  3V5B A;  5CCG A;  1L4A D;  3U1C A;  1LTG C;  3KPE A;  1HJB A;  1ZV8 A;  1JY3 P;  2KLV A;  1T2K D;  3RK3 B;  4XE5 B;  1GL2 C;  1FZE A;  3A2A A;  1SLQ A;  5AW6 B;  3KDP B;  1URQ A;  2FYZ A;  3NTN A;  3VMX A;  3RL0 B;  3B8E B;  2N1T A;  4IFD K;  3L4F A;  3M9Q A;  1L4A B;  3LID A;  2IX7 C;  2BAS A;  3EFG A;  3V2Q A;  3BAS A;  2E43 A;  2WPR A;  1M1J C;  3RK2 C;  2N1T D;  2YKO A;  1CZQ A;  1NH4 A;  5CCG D;  1G1J A;  3L35 A;  3M0A A;  3V4W A;  1RE3 C;  1JCD A;  4EIJ A;  1HWT C;  1N2D C;  3T97 A;  4AYC A;  1W2E A;  4LGD E;  3II6 A;  2QM8 A;  2H8P D;  1YTZ T;  1EQ7 A;  3VYI A;  2OYI C;  3NMD A;  1IFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...