3MUDC

Structure of the tropomyosin overlap complex from chicken smooth muscle
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
41
structure length
41
Chain Sequence
GASMDAIKKKMQMLKLDKENALDRAEQAEADKDFYFGKLRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Contractile protein
molecule keywords DNA repair protein XRCC4,Tropomyosin alpha-1 chain
publication title Structure of the tropomyosin overlap complex from chicken smooth muscle: insight into the diversity of N-terminal recognition .
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 41
sequence length 41
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1160 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Vasodilator-stimulated phosphoprotein 3mudC00
4YPCA 3SSUA 1USEA 3MUDC 3QH9A 3S4RA 1USDA 3SWKA
chains in the Genus database with same CATH superfamily
3R2PA 4GDOA 1NAFA 3GF3A 2M0BA 1ZRTE 4KJMA 1A02J 2BCCJ 3QH9A 5GTIE 4NPFX 4EIJA 1Q82Q 3RL0B 1SQBG 2B88A 5E79E 1S4XA 2R3SA 5KTBA 1VQ9P 3KZIH 3Q5RA 1URQA 1N7SC 4HKZH 1OZHA 2YO3A 2HYNA 1YIJP 3A7OA 2P10A 1KN7A 1L2PA 1DH3A 1N73C 5TJHA 1EC5A 1FAVA 1YTZI 3HD7A 1GL2A 1SQVG 1YHQP 1SFCB 3MP7B 1S5LH 1UIIA 5CCGC 3NTNA 3OA7A 2CK3H 1NOHA 2W6AA 2Y0DA 4EI2A 1GU4A 2KSEA 1BDCA 5AVSB 3H1HE 5DJTB 5AVZB 3FX0A 1NTZE 1RY3A 1SS1A 1IFIA 1KILA 2WTYA 5KLVD 3AECC 3TGUG 3H1LJ 1FDMA 1PP9G 3II6A 3TK1A 4D6TE 5AW3B 3LIEA 1YQ4C 3WUTA 3O6QA 1QX8A 1OW6A 1NTZJ 2O01J 5CCHA 2LKMA 1KFNA 2V7QH 1URQB 1KTMA 1AVYA 1NTMJ 4CPGA 3M9QA 1YYCA 1USDA 1AV1A 2HODB 1ZP0C 2FFDA 1RE4C 3AEEC 1H0TB 1IFPA 1GL2B 3HD7B 3GF7A 4N6JA 4D6TJ 2FXMA 4LGDE 3VN0A 3L72J 2WSFH 1JY2P 4YXDC 3RK2D 1SQVE 1HF9A 3E1IA 1QLED 3CCVP 1BE3E 2GA1A 3JCUE 3BCCG 2QJYC 1IC2A 1T8ZA 3RGUA 1IZNB 4IL6E 1SQBJ 3BASA 3U59A 3MD0A 2WQYC 4AYCA 1AFOA 3D70A 2W6BA 1KILB 5CBNA 1PPJD 2AXCA 1KQGB 2YIUB 1SP4A 3G3ZA 1RH5B 1IFDA 5B5EE 3CC2P 4WWIA 3TGUE 5AW7B 5CCGA 1SQVJ 1PP9E 3A0HH 2PRRA 4N78D 3P8CE 1L0LD 1TU3F 3O6QB 2KB7P 4M3LA 1RF0C 5AVWB 3L74E 3OAKA 3LW5J 4K35A 3CC7P 1VF5B 2XNXA 3GMAA 3FWLA 2AXTE 4L76A 2QM7A 4EYYQ 2OYHC 3VP8A 1IK7A 3TGUJ 4RO0A 3H1KD 3CPWO 1PP9J 1IFNA 1CW5A 1DEEG 2E75B 2KUBA 5KAFH 2BASA 2R44A 2O3JA 5TISH 2JWDA 3L70D 3B5NB 3BCCE 1QVGO 3WU2H 2W90A 1GMJA 2N9BA 2G8YA 2Y9YA 3L75D 4W7YA 4EDFA 3TSIA 2OTJP 1ZR2A 1L0NK 2HG5D 1WRGA 3H1IG 3SSUA 4LLHA 5B66H 2QIWA 1HVVA 1KYOI 4UB6H 4PD4I 2KZIA 2P2UA 5DJUB 1SFCC 1K04A 1H8AA 2PP6A 2KI7B 1J1EC 2E42A 1EDIA 1VF5D 1OFCX 2QRXA 4MN4C 3BCCJ 1NU1K 3RK2C 1KYOE 1FE6A 2IDBA 2QJPB 3CMEP 1KMIZ 3BVHA 1RE3A 4OWFA 2WPSA 1ZOYC 2C0WA 1U7MA 3H1KE 2WITA 1Q86Q 1HWTC 1MFZA 3VMZA 2KOGA 2O01N 3D6ZA 1D7MA 1JY2O 2R5DA 2L91A 3B5ND 2OYOA 1KILE 5BVZA 5KJ7D 3G71P 3AE2C 1RF0A 3HTKA 5CJ0A 3JSVC 1NU1G 3USSA 2IBZD 1VQ5P 3EWKA 1LTSC 4ZNCA 2XDJA 2H43A 1UIXA 3CL3D 2Q3IA 1URQC 4U3FD 2FYUD 2OYHA 3H1JG 3RBXA 2O1JA 2BCCD 1HUCA 2K9YA 1BCCG 1GU5A 3H1IE 1GL2C 3SFDC 1NWQA 3FGAD 2JDIH 2KLUA 2QJYB 2WVRA 4U7JA 4C7RA 3LW5H 4IFFA 3I55P 2A45G 3VMYA 1AQ5A 4H44B 1P84E 1KILC 3M0DA 2KYVA 5APSA 5KLIB 2E43A 4I1LA 2FXPA 2YIUC 3W67A 3H1IJ 2OQQA 5KAIE 1Y8AA 1MKMA 2E76B 1L0NE 1OWAA 2H89C 2MJZA 2NZ2A 1LT9A 3PTZA 1LWUA 2WSCJ 2QJKB 2XZRA 2N1TD 3AE6C 1AA0A 3H1HG 4HH2A 1BGYD 2QE7H 2A06D 1NTZG 1K8AQ 3HTKB 1JMMA 4DZOA 2C0XA 1NJIQ 3CXHI 3H1LD 2IZ0A 2FY8A 5CCHC 2WSEJ 1NU1E 5H2FE 4GOFA 3UIAA 2LR2A 1PGJA 1VF5C 2H88C 2OYHB 2R5BA 1R5LA 1JM0A 1NTKD 1T3JA 2WPQA 2W83C 1HGZA 3CXHE 3VP9A 1BCCE 3P32A 4IL6X 1PIXA 1OVRA 2A45I 1NTMD 2E75C 4ZKPA 3LIDA 2PAJA 2PFXA 3E1RA 4H44D 3BRVB 1GW4A 1LP1A 4DT0A 3WUVA 1J2JB 3L73D 2KSJA 5KLVK 1NU1J 3B5NC 1LTIC 3MUDC 2JKVA 3CCUP 3L72D 2E76D 1XTCC 5AVRB 2HODA 3H1JJ 3RK3D 2CPBA 1G1JA 1H0TA 1K9MQ 1BCCJ 2J59M 2NPSD 1WMKA 1KB9E 3D71A 1SQBD 1LT9B 3CCMP 1LWUB 1BE3G 1J1EB 2ZYDA 2YXRB 3KYQA 2YMKA 3I56P 2QA4P 1CSBA 3RK2B 2AEFA 3RL0g 3A0BE 4PD4H 1ZMEC 1N86A 1VDFA 2QEXP 1HH0A 3CWBE 3PHLA 5KLVG 3SFEC 4JPZB 2FKWB 2QJPC 3BRTB 3CX5H 2P7JA 3GW6A 4OH8B 3AE5C 2L5GB 3P8MC 4KT0J 1ZV8A 1DD3A 1KQLA 1IFMA 1OXZA 2D2CD 2Y9ZA 2QM8A 1SVFA 3MTUE 1LT1A 5AVVB 2IYOA 3E7KA 5GTHH 3H1HJ 1LP1B 3L74G 3U1CA 3IR9A 1VQMP 3V5BA 1JEKA 1RQVA 3C1LA 1EZVD 1PGPA 1M1JA 2RKLA 5L8RJ 4EOTA 2Q7CA 2KZJA 1NKZB 1DX7A 2I1JA 1VQ4P 1ZXGA 2C9LY 1IFJA 2JJLA 5AVQB 1KORA 3HUSC 3TYYA 1L0LK 1GW3A 2WSCH 3D6YA 2K9JA 4WBAA 1JCCA 1LTAC 3CI9A 1S3JA 2IZ1A 2VRSA 2Z5IA 3B5NA 3MUDA 4UB8E 2WSEH 5KJ7A 3H6PA 3V2NA 3AEDC 2R3CA 1BDDA 4H44C 5M1BA 5KLVE 2ZJSE 1RE3C 3N4XA 1SQXD 2K3RA 5KLIC 1Q81Q 4W7ZA 2POHA 5APQA 2ZAEB 2E76C 3IN6A 5AW6B 1L0LG 1EDKA 2ZT9D 3S9OA 1DD4A 1BE3J 1MZ9A 1SQQD 2QJKC 1QGKB 1NO4A 1EDLA 2NPSC 2Q5UA 2O1KA 2ZXEB 4N3YB 1M1JB 3CCLP 5KLVJ 1JY3N 3H1KG 4WY4D 4PJ0E 1M57D 2K88A 4JQ0D 1SQPD 4ZMDA 1PGOA 2Q6QA 5AW9B 4NPDA 2ZVOB 1GZLA 1VL2A 4PD4D 2K9JB 2WSSH 4H0LB 5GTIH 1FOSF 4O9BA 3L70G 3FWNA 2KP8A 2H7HA 3TF5A 2E5TA 2Z4EA 1GDTA 2QSIA 3RBZA 1LTJC 1ZR4A 2D2CC 2RN0A 5E79H 3CX5D 1VQ7P 5CJ4A 3L74J 3I5CA 1GK4A 4XE5B 4I6MC 2N1TA 2E74D 2IPPA 1GK6A 1OVUA 4HB1A 1PPJE 3M9BA 1L4AD 2KK7A 3C8VA 3IAOA 3M0DC 4OGQD 1JNMA 2XKMA 1H88A 4R4MA 2IX7C 3HUSA 3R4YA 3C9IA 3KHUA 2KLVA 4N78E 1T2KD 3KZIE 2IFNA 4DCKA 1LT9C 1L0LE 1LWUC 1S9KD 3MIWA 1E5WA 2O01H 4TT3H 3CCJP 2FYUK 1NH4A 2P1JA 1YITP 3VOPA 3AE9C 2WZ7A 2YO2A 1S5LE 2ZYAA 1JOCA 2YKQA 1FBMA 1Y9BA 4H0LD 1L0NG 2JWAA 3VTPC 2GUVA 4OVNF 1DEBA 2NRGA 1GTWA 3GLMA 4XFJA 1L0LJ 3L71D 2I1KA 3GHGA 1M90Q 2NPSA 5AVYB 2OTKE 1EXJA 3L70E 3HE5A 1T6AA 2IYPA 2ZYGA 3EQ2A 1EQ7A 1QVFO 4U3FG 2N1TB 2FYUG 3PP5A 3L75E 5AVTB 3SWFA 3A5TA 5AVUB 1LTTC 2WWWA 1FC2C 3H1KJ 2HPCA 5BU8B 1VQ6P 1YQ3C 5GTHE 4JBZA 1CI6A 2FBWC 3NFQA 2K37A 3HUSB 4GKGA 1YTZT 2SPZA 1Y47A 1RQUA 1X22A 4IOIH 2KXPB 3F5HA 1P84I 2B87A 3JCUH 1Q2NA 4AUWA 3L70J 1LTJA 1JMBA 4IL6H 1NYHA 1FS0E 4GOEA 5APUA 3H1JD 1G2CA 1VQLP 1KZUB 1NTKK 4ZKUA 1MFTA 1ZRTD 3G4SP 1DIPA 4Y99B 4A7PA 1JO5A 5B5EH 3QWOC 1BSHA 2LXBA 1NTMK 1YI2P 2V7QJ 1OW8A 1L4AC 3O8ZA 1BGYG 3RK3B 2A06G 1VQ8P 1LTGC 3GHGB 2FXOA 1KFMA 2NPSB 1R5SA 3SWYA 3HE5B 3CWBG 2IBZE 3EFFK 1PL5A 3AEFC 1NTKG 2WSFJ 4U3FE 2AXTH 2FYUE 3B71A 2UWJE 1M1JC 3A0HE 1VQKP 2J58A 1Q90D 2Q3EA 2BCCE 2HPCB 2OTLP 1SQBK 5APXA 3VMXA 1CI6B 3KPEA 3M9HA 1L0NJ 2KIKA 3FXEA 2XU6A 1NTZD 3VYIA 1HGVA 4H0LC 2B87B 3L73G 1LTJB 2D2CB 3JC22 3CCSP 2ZXXA 2PGDA 3ABVC 3AEGC 1IO4A 4H13D 1FJPA 1IK9A 1G2CB 3PJSK 1FDOA 3WUUA 4U3FJ 2H8PD 1KB9I 2FYUJ 2B9BA 2GM4A 2QVAA 5KJ7C 4D6TD 1YJWP 1W5CE 3CCRP 5KAFE 4RESB 1VPCA 5C39A 4WB4A 2RH0A 2WPVB 5TISE 1S1CX 3CCEP 2OYIA 1VQOP 2W27A 3ITKA 1HTLC 4Y28J 4I7ZB 4WY4A 1JTHB 3P7KA 4JF7A 3WU2E 2DW3A 1YJ9P 1BSNA 2W8ZA 5AW8B 1BGYE 4PV1D 4DOJA 2A06E 2WT7A 3V6IA 1HJBA 1OMIA 2OARA 3H1LE 1KYOH 3V4QA 5CMZA 3OW2O 5B66E 2WPRA 4UB6E 3Q2YA 2P67A 1NTKE 1SQVD 3OJAB 1RF1A 4Z1MH 1BE3D 1N7LA 3U1AA 2YMYA 1FZCA 1FZGA 1M7LA 1FZFA 3Q3DA 3Q5SA 4GODA 2K1AA 3VMAA 1L4AA 4YXWH 3KQGA 2YKOA 1FOSE 4NPEA 4BRYA 1NTME 2ZVNB 4HJGH 1BGYJ 4YPCA 2HR3A 1AVOA 2Y0CA 1M1KQ 3TDKA 1PV3A 2Q9IA 4GIFA 1IJDB 1EZVG 3G9RA 3L73E 2ZT9B 1T3UA 3CWBJ 3V2RA 5KKZB 3ZDMA 1OW7A 4L75A 1MV8A 3RL0D 1SQXK 3TGUD 2JO1A 3L72E 4KHXA 2N1TC 1NVOA 1NTKJ 2G3AA 5APTA 1PP9D 1YJNP 4WVZA 3RK3E 5APYA 1A02F 3P8CD 1VQNP 3H32A 2OYIB 2HLOA 1SQQK 1SQBE 2Y0EA 3HE4A 2OGUA 4WY4B 3L74D 1LJ2A 1FZEA 2JP3A 1EXIA 1K73Q 2R32A 5CBOA 2WT7B 1SFCD 1X9VA 2YKPA 1S5LX 3L73J 3NMDA 1EDJA 3CCQP 4ASWA 1PPJG 5AW2B 4C46A 4DJGA 2AEJA 1P84H 1SQPK 1SQXG 4RKUJ 5APWA 3V4WA 1RF1B 2KS1A 4H13C 3TNUA 1JUNA 1OIPA 2E74B 5KAIH 4Y99C 1JY2N 3M91A 1FZCB 1G1IA 1EZVI 2JR8A 2QG4A 1N7SA 1SQQG 1JCDA 1L4AB 1ZW0A 3BCCD 4LC1A 3PRJA 4OGQB 4BRYB 1J1DB 2XNDH 2Q1KA 1AJYA 1Q7YQ 3RK3C 3H25A 2FYNB 1N73A 3S4RA 3GHGC 3AE7C 3BATA 3L4FA 3GG2A 1PZQA 1JY3P 3L36A 3WMM0 1EZVE 5H2FH 3AE3C 2IFMA 2KNCA 2BEZF 1KQFB 3L37A 4PV1C 1SQPG 3CD6P 1OVVA 4B86A 1URQD 1FZBA 3CXHH 3H32B 2M3EA 3HE4B 2W6JH 1KYOD 1QEXA 3HD7D 1GL2D 1NAYA 1S72P 3T97A 2FFDB 1HBWA 3A2AA 1QL1A 3AEBC 3CMAP 1FZAA 3F89A 3KXDA 3L75G 2V4HA 3HRNA 1N8RQ 2ZFCA 3EFGA 1LGHB 1R8EA 2A45H 4RJTA 1AQTA 1WT6A 3MZWB 2KS1B 3TNUB 1SQXE 4I2LC 4XA4A 1KILD 1W2EA 5K5GB 1LTBC 2I8DA 1PFIA 1KB9H 3RL0C 1VQPP 2XV5A 1N7SB 1KV4A 1QL2A 3IF4A 4I7ZC 1SQQE 1K05A 1U57A 1N73B 1ZLLA 2C9NY 2M5AA 1RE4A 3G6EP 1KC8Q 5AW1B 2M8RA 3A0BH 3MHVA 2Z5HA 4K3AA 3V2PA 3AEAC 3N7NA 3AE1C 3H1ID 2KNCB 1S2EA 4JYCA 1SQXJ 4C7NA 5CCHD 1KQSO 1SQPE 4R4LA 3CX5I 4BWNA 3PLNA 3W68A 3L71G 3IFMA 4L74A 4PD4E 2AEMA 1SQQJ 1GD2E 2LXCB 3T97B 1P84D 3CX5E 2HFED 1W2BO 4HYTB 2IBZG 1NKNA 2E75D 3L35A 1ZN5A 1NHLA 1YBKA 2ZT9C 1L0ND 5KKZC 2BCCG 2B89A 2YXQB 2P58A 5AW5B 5APVA 1SQPJ 1N7SD 3V2QA 4TLFA 1U7JA 5BU5A 3AE8C 4QMAA 1Z56A 1MUUA 1H89A 5AW0B 1M8OB 1HJ0A 2OYIC 1FJKA 1N2DC 2MKVA 1S9KE 4WY4C 1NU1D 5CCGD 1XTGB 2M5AB 2WMMA 3M06A 3MGNA 3CC4P 1FDIA 1JB0J 2YNYA 4UB8H 1JY3O 3CLQA 3HD7C 3S1KA 1E79H 4GT1A 2FYZA 1FU1A 3PH0A 3L75J 3CXHD 3Q5PA 2ITAA 4ASVA 1BCCD 2GUSA 2N9YB 4C7NB 1X0TA 4H13B 3A3YB 1SLQA 5AW4B 4BXLA 4JYBA 1NTZK 1RF1C 2E74C 2RMZA 2IBZI 3NXSA 1X8YA 1FZCC 3M0AA 3L71E 1JTHA 1USEA 4AQRD 1NGMB 1M56D 4OGQC 1J1DC 1LNQA 1KD1Q 2JEEA 3Q1MA 3H1LG 2FYNC 4IFMA 1PGQA 5AVXB 5CHXA 1T2KC 3KDPB 3SWKA 4PV1B 1SFCA 1KB9D 2BEQD 2CPSA 4PJ0H 5EFWB 2E5YA 4L73A 2J5UA 3B4SA 3AE4C 1RHZB 1OX3A 3FXDA 3L71J 3H1HD 1CZQA 1NTMG 3CWBD 3K5BA 3B8EB 4YTPC 1X79B 4IFDK 3H1JE 2FFDC 2M3BA 1SQVK 4D6TG 3L72G 4W80A
chains in the Genus database with same CATH topology
4YPCA 3SSUA 1USEA 3MUDC 3QH9A 3S4RA 1USDA 3SWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YPC A;  3SSU A;  1USE A;  3MUD C;  3QH9 A;  3S4R A;  1USD A;  3SWK A; 
#chains in the Genus database with same CATH topology
 3R2P A;  4GDO A;  1NAF A;  3GF3 A;  2M0B A;  1ZRT E;  4KJM A;  1A02 J;  2BCC J;  3QH9 A;  5GTI E;  4NPF X;  4EIJ A;  1Q82 Q;  3RL0 B;  1SQB G;  2B88 A;  5E79 E;  1S4X A;  2R3S A;  5KTB A;  1VQ9 P;  3KZI H;  3Q5R A;  1URQ A;  1N7S C;  4HKZ H;  1OZH A;  2YO3 A;  2HYN A;  1YIJ P;  3A7O A;  2P10 A;  1KN7 A;  1L2P A;  1DH3 A;  1N73 C;  5TJH A;  1EC5 A;  1FAV A;  1YTZ I;  3HD7 A;  1GL2 A;  1SQV G;  1YHQ P;  1SFC B;  3MP7 B;  1S5L H;  1UII A;  5CCG C;  3NTN A;  3OA7 A;  2CK3 H;  1NOH A;  2W6A A;  2Y0D A;  4EI2 A;  1GU4 A;  2KSE A;  1BDC A;  5AVS B;  3H1H E;  5DJT B;  5AVZ B;  3FX0 A;  1NTZ E;  1RY3 A;  1SS1 A;  1IFI A;  1KIL A;  2WTY A;  5KLV D;  3AEC C;  3TGU G;  3H1L J;  1FDM A;  1PP9 G;  3II6 A;  3TK1 A;  4D6T E;  5AW3 B;  3LIE A;  1YQ4 C;  3WUT A;  3O6Q A;  1QX8 A;  1OW6 A;  1NTZ J;  2O01 J;  5CCH A;  2LKM A;  1KFN A;  2V7Q H;  1URQ B;  1KTM A;  1AVY A;  1NTM J;  4CPG A;  3M9Q A;  1YYC A;  1USD A;  1AV1 A;  2HOD B;  1ZP0 C;  2FFD A;  1RE4 C;  3AEE C;  1H0T B;  1IFP A;  1GL2 B;  3HD7 B;  3GF7 A;  4N6J A;  4D6T J;  2FXM A;  4LGD E;  3VN0 A;  3L72 J;  2WSF H;  1JY2 P;  4YXD C;  3RK2 D;  1SQV E;  1HF9 A;  3E1I A;  1QLE D;  3CCV P;  1BE3 E;  2GA1 A;  3JCU E;  3BCC G;  2QJY C;  1IC2 A;  1T8Z A;  3RGU A;  1IZN B;  4IL6 E;  1SQB J;  3BAS A;  3U59 A;  3MD0 A;  2WQY C;  4AYC A;  1AFO A;  3D70 A;  2W6B A;  1KIL B;  5CBN A;  1PPJ D;  2AXC A;  1KQG B;  2YIU B;  1SP4 A;  3G3Z A;  1RH5 B;  1IFD A;  5B5E E;  3CC2 P;  4WWI A;  3TGU E;  5AW7 B;  5CCG A;  1SQV J;  1PP9 E;  3A0H H;  2PRR A;  4N78 D;  3P8C E;  1L0L D;  1TU3 F;  3O6Q B;  2KB7 P;  4M3L A;  1RF0 C;  5AVW B;  3L74 E;  3OAK A;  3LW5 J;  4K35 A;  3CC7 P;  1VF5 B;  2XNX A;  3GMA A;  3FWL A;  2AXT E;  4L76 A;  2QM7 A;  4EYY Q;  2OYH C;  3VP8 A;  1IK7 A;  3TGU J;  4RO0 A;  3H1K D;  3CPW O;  1PP9 J;  1IFN A;  1CW5 A;  1DEE G;  2E75 B;  2KUB A;  5KAF H;  2BAS A;  2R44 A;  2O3J A;  5TIS H;  2JWD A;  3L70 D;  3B5N B;  3BCC E;  1QVG O;  3WU2 H;  2W90 A;  1GMJ A;  2N9B A;  2G8Y A;  2Y9Y A;  3L75 D;  4W7Y A;  4EDF A;  3TSI A;  2OTJ P;  1ZR2 A;  1L0N K;  2HG5 D;  1WRG A;  3H1I G;  3SSU A;  4LLH A;  5B66 H;  2QIW A;  1HVV A;  1KYO I;  4UB6 H;  4PD4 I;  2KZI A;  2P2U A;  5DJU B;  1SFC C;  1K04 A;  1H8A A;  2PP6 A;  2KI7 B;  1J1E C;  2E42 A;  1EDI A;  1VF5 D;  1OFC X;  2QRX A;  4MN4 C;  3BCC J;  1NU1 K;  3RK2 C;  1KYO E;  1FE6 A;  2IDB A;  2QJP B;  3CME P;  1KMI Z;  3BVH A;  1RE3 A;  4OWF A;  2WPS A;  1ZOY C;  2C0W A;  1U7M A;  3H1K E;  2WIT A;  1Q86 Q;  1HWT C;  1MFZ A;  3VMZ A;  2KOG A;  2O01 N;  3D6Z A;  1D7M A;  1JY2 O;  2R5D A;  2L91 A;  3B5N D;  2OYO A;  1KIL E;  5BVZ A;  5KJ7 D;  3G71 P;  3AE2 C;  1RF0 A;  3HTK A;  5CJ0 A;  3JSV C;  1NU1 G;  3USS A;  2IBZ D;  1VQ5 P;  3EWK A;  1LTS C;  4ZNC A;  2XDJ A;  2H43 A;  1UIX A;  3CL3 D;  2Q3I A;  1URQ C;  4U3F D;  2FYU D;  2OYH A;  3H1J G;  3RBX A;  2O1J A;  2BCC D;  1HUC A;  2K9Y A;  1BCC G;  1GU5 A;  3H1I E;  1GL2 C;  3SFD C;  1NWQ A;  3FGA D;  2JDI H;  2KLU A;  2QJY B;  2WVR A;  4U7J A;  4C7R A;  3LW5 H;  4IFF A;  3I55 P;  2A45 G;  3VMY A;  1AQ5 A;  4H44 B;  1P84 E;  1KIL C;  3M0D A;  2KYV A;  5APS A;  5KLI B;  2E43 A;  4I1L A;  2FXP A;  2YIU C;  3W67 A;  3H1I J;  2OQQ A;  5KAI E;  1Y8A A;  1MKM A;  2E76 B;  1L0N E;  1OWA A;  2H89 C;  2MJZ A;  2NZ2 A;  1LT9 A;  3PTZ A;  1LWU A;  2WSC J;  2QJK B;  2XZR A;  2N1T D;  3AE6 C;  1AA0 A;  3H1H G;  4HH2 A;  1BGY D;  2QE7 H;  2A06 D;  1NTZ G;  1K8A Q;  3HTK B;  1JMM A;  4DZO A;  2C0X A;  1NJI Q;  3CXH I;  3H1L D;  2IZ0 A;  2FY8 A;  5CCH C;  2WSE J;  1NU1 E;  5H2F E;  4GOF A;  3UIA A;  2LR2 A;  1PGJ A;  1VF5 C;  2H88 C;  2OYH B;  2R5B A;  1R5L A;  1JM0 A;  1NTK D;  1T3J A;  2WPQ A;  2W83 C;  1HGZ A;  3CXH E;  3VP9 A;  1BCC E;  3P32 A;  4IL6 X;  1PIX A;  1OVR A;  2A45 I;  1NTM D;  2E75 C;  4ZKP A;  3LID A;  2PAJ A;  2PFX A;  3E1R A;  4H44 D;  3BRV B;  1GW4 A;  1LP1 A;  4DT0 A;  3WUV A;  1J2J B;  3L73 D;  2KSJ A;  5KLV K;  1NU1 J;  3B5N C;  1LTI C;  3MUD C;  2JKV A;  3CCU P;  3L72 D;  2E76 D;  1XTC C;  5AVR B;  2HOD A;  3H1J J;  3RK3 D;  2CPB A;  1G1J A;  1H0T A;  1K9M Q;  1BCC J;  2J59 M;  2NPS D;  1WMK A;  1KB9 E;  3D71 A;  1SQB D;  1LT9 B;  3CCM P;  1LWU B;  1BE3 G;  1J1E B;  2ZYD A;  2YXR B;  3KYQ A;  2YMK A;  3I56 P;  2QA4 P;  1CSB A;  3RK2 B;  2AEF A;  3RL0 g;  3A0B E;  4PD4 H;  1ZME C;  1N86 A;  1VDF A;  2QEX P;  1HH0 A;  3CWB E;  3PHL A;  5KLV G;  3SFE C;  4JPZ B;  2FKW B;  2QJP C;  3BRT B;  3CX5 H;  2P7J A;  3GW6 A;  4OH8 B;  3AE5 C;  2L5G B;  3P8M C;  4KT0 J;  1ZV8 A;  1DD3 A;  1KQL A;  1IFM A;  1OXZ A;  2D2C D;  2Y9Z A;  2QM8 A;  1SVF A;  3MTU E;  1LT1 A;  5AVV B;  2IYO A;  3E7K A;  5GTH H;  3H1H J;  1LP1 B;  3L74 G;  3U1C A;  3IR9 A;  1VQM P;  3V5B A;  1JEK A;  1RQV A;  3C1L A;  1EZV D;  1PGP A;  1M1J A;  2RKL A;  5L8R J;  4EOT A;  2Q7C A;  2KZJ A;  1NKZ B;  1DX7 A;  2I1J A;  1VQ4 P;  1ZXG A;  2C9L Y;  1IFJ A;  2JJL A;  5AVQ B;  1KOR A;  3HUS C;  3TYY A;  1L0L K;  1GW3 A;  2WSC H;  3D6Y A;  2K9J A;  4WBA A;  1JCC A;  1LTA C;  3CI9 A;  1S3J A;  2IZ1 A;  2VRS A;  2Z5I A;  3B5N A;  3MUD A;  4UB8 E;  2WSE H;  5KJ7 A;  3H6P A;  3V2N A;  3AED C;  2R3C A;  1BDD A;  4H44 C;  5M1B A;  5KLV E;  2ZJS E;  1RE3 C;  3N4X A;  1SQX D;  2K3R A;  5KLI C;  1Q81 Q;  4W7Z A;  2POH A;  5APQ A;  2ZAE B;  2E76 C;  3IN6 A;  5AW6 B;  1L0L G;  1EDK A;  2ZT9 D;  3S9O A;  1DD4 A;  1BE3 J;  1MZ9 A;  1SQQ D;  2QJK C;  1QGK B;  1NO4 A;  1EDL A;  2NPS C;  2Q5U A;  2O1K A;  2ZXE B;  4N3Y B;  1M1J B;  3CCL P;  5KLV J;  1JY3 N;  3H1K G;  4WY4 D;  4PJ0 E;  1M57 D;  2K88 A;  4JQ0 D;  1SQP D;  4ZMD A;  1PGO A;  2Q6Q A;  5AW9 B;  4NPD A;  2ZVO B;  1GZL A;  1VL2 A;  4PD4 D;  2K9J B;  2WSS H;  4H0L B;  5GTI H;  1FOS F;  4O9B A;  3L70 G;  3FWN A;  2KP8 A;  2H7H A;  3TF5 A;  2E5T A;  2Z4E A;  1GDT A;  2QSI A;  3RBZ A;  1LTJ C;  1ZR4 A;  2D2C C;  2RN0 A;  5E79 H;  3CX5 D;  1VQ7 P;  5CJ4 A;  3L74 J;  3I5C A;  1GK4 A;  4XE5 B;  4I6M C;  2N1T A;  2E74 D;  2IPP A;  1GK6 A;  1OVU A;  4HB1 A;  1PPJ E;  3M9B A;  1L4A D;  2KK7 A;  3C8V A;  3IAO A;  3M0D C;  4OGQ D;  1JNM A;  2XKM A;  1H88 A;  4R4M A;  2IX7 C;  3HUS A;  3R4Y A;  3C9I A;  3KHU A;  2KLV A;  4N78 E;  1T2K D;  3KZI E;  2IFN A;  4DCK A;  1LT9 C;  1L0L E;  1LWU C;  1S9K D;  3MIW A;  1E5W A;  2O01 H;  4TT3 H;  3CCJ P;  2FYU K;  1NH4 A;  2P1J A;  1YIT P;  3VOP A;  3AE9 C;  2WZ7 A;  2YO2 A;  1S5L E;  2ZYA A;  1JOC A;  2YKQ A;  1FBM A;  1Y9B A;  4H0L D;  1L0N G;  2JWA A;  3VTP C;  2GUV A;  4OVN F;  1DEB A;  2NRG A;  1GTW A;  3GLM A;  4XFJ A;  1L0L J;  3L71 D;  2I1K A;  3GHG A;  1M90 Q;  2NPS A;  5AVY B;  2OTK E;  1EXJ A;  3L70 E;  3HE5 A;  1T6A A;  2IYP A;  2ZYG A;  3EQ2 A;  1EQ7 A;  1QVF O;  4U3F G;  2N1T B;  2FYU G;  3PP5 A;  3L75 E;  5AVT B;  3SWF A;  3A5T A;  5AVU B;  1LTT C;  2WWW A;  1FC2 C;  3H1K J;  2HPC A;  5BU8 B;  1VQ6 P;  1YQ3 C;  5GTH E;  4JBZ A;  1CI6 A;  2FBW C;  3NFQ A;  2K37 A;  3HUS B;  4GKG A;  1YTZ T;  2SPZ A;  1Y47 A;  1RQU A;  1X22 A;  4IOI H;  2KXP B;  3F5H A;  1P84 I;  2B87 A;  3JCU H;  1Q2N A;  4AUW A;  3L70 J;  1LTJ A;  1JMB A;  4IL6 H;  1NYH A;  1FS0 E;  4GOE A;  5APU A;  3H1J D;  1G2C A;  1VQL P;  1KZU B;  1NTK K;  4ZKU A;  1MFT A;  1ZRT D;  3G4S P;  1DIP A;  4Y99 B;  4A7P A;  1JO5 A;  5B5E H;  3QWO C;  1BSH A;  2LXB A;  1NTM K;  1YI2 P;  2V7Q J;  1OW8 A;  1L4A C;  3O8Z A;  1BGY G;  3RK3 B;  2A06 G;  1VQ8 P;  1LTG C;  3GHG B;  2FXO A;  1KFM A;  2NPS B;  1R5S A;  3SWY A;  3HE5 B;  3CWB G;  2IBZ E;  3EFF K;  1PL5 A;  3AEF C;  1NTK G;  2WSF J;  4U3F E;  2AXT H;  2FYU E;  3B71 A;  2UWJ E;  1M1J C;  3A0H E;  1VQK P;  2J58 A;  1Q90 D;  2Q3E A;  2BCC E;  2HPC B;  2OTL P;  1SQB K;  5APX A;  3VMX A;  1CI6 B;  3KPE A;  3M9H A;  1L0N J;  2KIK A;  3FXE A;  2XU6 A;  1NTZ D;  3VYI A;  1HGV A;  4H0L C;  2B87 B;  3L73 G;  1LTJ B;  2D2C B;  3JC2 2;  3CCS P;  2ZXX A;  2PGD A;  3ABV C;  3AEG C;  1IO4 A;  4H13 D;  1FJP A;  1IK9 A;  1G2C B;  3PJS K;  1FDO A;  3WUU A;  4U3F J;  2H8P D;  1KB9 I;  2FYU J;  2B9B A;  2GM4 A;  2QVA A;  5KJ7 C;  4D6T D;  1YJW P;  1W5C E;  3CCR P;  5KAF E;  4RES B;  1VPC A;  5C39 A;  4WB4 A;  2RH0 A;  2WPV B;  5TIS E;  1S1C X;  3CCE P;  2OYI A;  1VQO P;  2W27 A;  3ITK A;  1HTL C;  4Y28 J;  4I7Z B;  4WY4 A;  1JTH B;  3P7K A;  4JF7 A;  3WU2 E;  2DW3 A;  1YJ9 P;  1BSN A;  2W8Z A;  5AW8 B;  1BGY E;  4PV1 D;  4DOJ A;  2A06 E;  2WT7 A;  3V6I A;  1HJB A;  1OMI A;  2OAR A;  3H1L E;  1KYO H;  3V4Q A;  5CMZ A;  3OW2 O;  5B66 E;  2WPR A;  4UB6 E;  3Q2Y A;  2P67 A;  1NTK E;  1SQV D;  3OJA B;  1RF1 A;  4Z1M H;  1BE3 D;  1N7L A;  3U1A A;  2YMY A;  1FZC A;  1FZG A;  1M7L A;  1FZF A;  3Q3D A;  3Q5S A;  4GOD A;  2K1A A;  3VMA A;  1L4A A;  4YXW H;  3KQG A;  2YKO A;  1FOS E;  4NPE A;  4BRY A;  1NTM E;  2ZVN B;  4HJG H;  1BGY J;  4YPC A;  2HR3 A;  1AVO A;  2Y0C A;  1M1K Q;  3TDK A;  1PV3 A;  2Q9I A;  4GIF A;  1IJD B;  1EZV G;  3G9R A;  3L73 E;  2ZT9 B;  1T3U A;  3CWB J;  3V2R A;  5KKZ B;  3ZDM A;  1OW7 A;  4L75 A;  1MV8 A;  3RL0 D;  1SQX K;  3TGU D;  2JO1 A;  3L72 E;  4KHX A;  2N1T C;  1NVO A;  1NTK J;  2G3A A;  5APT A;  1PP9 D;  1YJN P;  4WVZ A;  3RK3 E;  5APY A;  1A02 F;  3P8C D;  1VQN P;  3H32 A;  2OYI B;  2HLO A;  1SQQ K;  1SQB E;  2Y0E A;  3HE4 A;  2OGU A;  4WY4 B;  3L74 D;  1LJ2 A;  1FZE A;  2JP3 A;  1EXI A;  1K73 Q;  2R32 A;  5CBO A;  2WT7 B;  1SFC D;  1X9V A;  2YKP A;  1S5L X;  3L73 J;  3NMD A;  1EDJ A;  3CCQ P;  4ASW A;  1PPJ G;  5AW2 B;  4C46 A;  4DJG A;  2AEJ A;  1P84 H;  1SQP K;  1SQX G;  4RKU J;  5APW A;  3V4W A;  1RF1 B;  2KS1 A;  4H13 C;  3TNU A;  1JUN A;  1OIP A;  2E74 B;  5KAI H;  4Y99 C;  1JY2 N;  3M91 A;  1FZC B;  1G1I A;  1EZV I;  2JR8 A;  2QG4 A;  1N7S A;  1SQQ G;  1JCD A;  1L4A B;  1ZW0 A;  3BCC D;  4LC1 A;  3PRJ A;  4OGQ B;  4BRY B;  1J1D B;  2XND H;  2Q1K A;  1AJY A;  1Q7Y Q;  3RK3 C;  3H25 A;  2FYN B;  1N73 A;  3S4R A;  3GHG C;  3AE7 C;  3BAT A;  3L4F A;  3GG2 A;  1PZQ A;  1JY3 P;  3L36 A;  3WMM 0;  1EZV E;  5H2F H;  3AE3 C;  2IFM A;  2KNC A;  2BEZ F;  1KQF B;  3L37 A;  4PV1 C;  1SQP G;  3CD6 P;  1OVV A;  4B86 A;  1URQ D;  1FZB A;  3CXH H;  3H32 B;  2M3E A;  3HE4 B;  2W6J H;  1KYO D;  1QEX A;  3HD7 D;  1GL2 D;  1NAY A;  1S72 P;  3T97 A;  2FFD B;  1HBW A;  3A2A A;  1QL1 A;  3AEB C;  3CMA P;  1FZA A;  3F89 A;  3KXD A;  3L75 G;  2V4H A;  3HRN A;  1N8R Q;  2ZFC A;  3EFG A;  1LGH B;  1R8E A;  2A45 H;  4RJT A;  1AQT A;  1WT6 A;  3MZW B;  2KS1 B;  3TNU B;  1SQX E;  4I2L C;  4XA4 A;  1KIL D;  1W2E A;  5K5G B;  1LTB C;  2I8D A;  1PFI A;  1KB9 H;  3RL0 C;  1VQP P;  2XV5 A;  1N7S B;  1KV4 A;  1QL2 A;  3IF4 A;  4I7Z C;  1SQQ E;  1K05 A;  1U57 A;  1N73 B;  1ZLL A;  2C9N Y;  2M5A A;  1RE4 A;  3G6E P;  1KC8 Q;  5AW1 B;  2M8R A;  3A0B H;  3MHV A;  2Z5H A;  4K3A A;  3V2P A;  3AEA C;  3N7N A;  3AE1 C;  3H1I D;  2KNC B;  1S2E A;  4JYC A;  1SQX J;  4C7N A;  5CCH D;  1KQS O;  1SQP E;  4R4L A;  3CX5 I;  4BWN A;  3PLN A;  3W68 A;  3L71 G;  3IFM A;  4L74 A;  4PD4 E;  2AEM A;  1SQQ J;  1GD2 E;  2LXC B;  3T97 B;  1P84 D;  3CX5 E;  2HFE D;  1W2B O;  4HYT B;  2IBZ G;  1NKN A;  2E75 D;  3L35 A;  1ZN5 A;  1NHL A;  1YBK A;  2ZT9 C;  1L0N D;  5KKZ C;  2BCC G;  2B89 A;  2YXQ B;  2P58 A;  5AW5 B;  5APV A;  1SQP J;  1N7S D;  3V2Q A;  4TLF A;  1U7J A;  5BU5 A;  3AE8 C;  4QMA A;  1Z56 A;  1MUU A;  1H89 A;  5AW0 B;  1M8O B;  1HJ0 A;  2OYI C;  1FJK A;  1N2D C;  2MKV A;  1S9K E;  4WY4 C;  1NU1 D;  5CCG D;  1XTG B;  2M5A B;  2WMM A;  3M06 A;  3MGN A;  3CC4 P;  1FDI A;  1JB0 J;  2YNY A;  4UB8 H;  1JY3 O;  3CLQ A;  3HD7 C;  3S1K A;  1E79 H;  4GT1 A;  2FYZ A;  1FU1 A;  3PH0 A;  3L75 J;  3CXH D;  3Q5P A;  2ITA A;  4ASV A;  1BCC D;  2GUS A;  2N9Y B;  4C7N B;  1X0T A;  4H13 B;  3A3Y B;  1SLQ A;  5AW4 B;  4BXL A;  4JYB A;  1NTZ K;  1RF1 C;  2E74 C;  2RMZ A;  2IBZ I;  3NXS A;  1X8Y A;  1FZC C;  3M0A A;  3L71 E;  1JTH A;  1USE A;  4AQR D;  1NGM B;  1M56 D;  4OGQ C;  1J1D C;  1LNQ A;  1KD1 Q;  2JEE A;  3Q1M A;  3H1L G;  2FYN C;  4IFM A;  1PGQ A;  5AVX B;  5CHX A;  1T2K C;  3KDP B;  3SWK A;  4PV1 B;  1SFC A;  1KB9 D;  2BEQ D;  2CPS A;  4PJ0 H;  5EFW B;  2E5Y A;  4L73 A;  2J5U A;  3B4S A;  3AE4 C;  1RHZ B;  1OX3 A;  3FXD A;  3L71 J;  3H1H D;  1CZQ A;  1NTM G;  3CWB D;  3K5B A;  3B8E B;  4YTP C;  1X79 B;  4IFD K;  3H1J E;  2FFD C;  2M3B A;  1SQV K;  4D6T G;  3L72 G;  4W80 A; 
#chains in the Genus database with same CATH homology
 4YPC A;  3SSU A;  1USE A;  3MUD C;  3QH9 A;  3S4R A;  1USD A;  3SWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...