2Q5UA

Crystal structure of iqn17
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fusion protein between yeast variant GCN4 and HIVgp41
publication title Inhibiting HIV Entry: Discovery of D-Peptide Inhibitors that Target the Gp41 Coiled-Coil Pocket
pubmed doi rcsb
molecule tags Viral protein
total genus 21
structure length 45
sequence length 45
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2q5uA00
3IR9A 5APWA 3SWFA 4C7NB 4DZOA 3HTKA 5APTA 2ZXEB 1YYCA 3NXSA 5APYA 4HYTB 2Q7CA 3V4QA 4EOTA 3TNUB 4JYCA 1DH3A 2XU6A 3L37A 1T2KC 2XZRA 3KDPB 4GT1A 3VN0A 3KQGA 3HE4B 5AW3B 2Z5HA 2ZFCA 1X8YA 2Q5UA 3M9HA 5AW1B 1HJBA 2W6AA 5APSA 2WTYA 5AW9B 1JNMA 4LC1A 3MGNA 3O8ZA 2QM8A 5AW5B 5AVUB 1H8AA 3TK1A 5AVWB 2Z5IA 2W27A 1OWAA 2JJLA 1G2CB 3M06A 2C9NY 3NFQA 3TYYA 4AYCA 3P7KA 2XV5A 1HWTC 3L36A 3VMYA 4RESB 4AQRD 2YO2A 3L35A 3NMDA 5AVTB 2R5BA 1GD2E 1GZLA 3VMXA 3A3YB 2WWWA 2R3CA 3A2AA 3HE5B 4I2LC 5APUA 5AW6B 1GU5A 1JUNA 5APQA 5APXA 5AW8B 2WT7B 2WPRA 1H89A 1KQLA 4XE5B 2YNYA 1FOSE 3A5TA 3OAKA 1GTWA 1HUCA 3M9BA 2YO3A 1S9KD 1NAFA 4C7NA 3UIAA 1OXZA 3TNUA 5AVSB 3B8EB 1FAVA 4C46A 2N9BA 3VYIA 3VTPC 2R5DA 2P2UA 1MV8A 1S9KE 2QM7A 3HE4A 5AVVB 2WPQA 1T2KD 2WPSA 3I5CA 4KHXA 1SLQA 5AVXB 4B86A 2E43A 2IPPA 5APVA 3A7OA 3V5BA 2P67A 3LIDA 3MD0A 1IO4A 1MFZA 3P32A 5AW2B 2C9LY 1CSBA 1GK6A 1HBWA 3VMZA 1SP4A 1H88A 1MUUA 1J2JB 3P8MC 1CI6B 2R32A 1A02F 3M91A 3V4WA 1NWQA 2KP8A 4GKGA 1GK4A 3HE5A 5AW7B 2P7JA 2VRSA 5AW4B 2WT7A 3NTNA 2H7HA 2E42A 3LIEA 2BASA 2Q3IA 1A02J 5AVYB 5AVQB 1CZQA 5AVRB 5AVZB 1FOSF 3T97A 1CI6A 1GU4A 4JYBA 5CMZA 4I6MC 4AUWA 5AW0B 3M0AA 3M0DA 4M3LA
chains in the Genus database with same CATH superfamily
2RMZA 1VQPP 1Y47A 2K9JA 1USDA 1KB9H 3A0HH 3W67A 2L5GB 1LTBC 2WSCH 5APSA 3MUDA 3PP5A 2QM8A 1VQ4P 3AEFC 1S5LE 1BCCD 1OWAA 3V6IA 5KJ7A 4ZMDA 1HWTC 3TSIA 1EZVE 2R3SA 4PD4H 3VP9A 2R3CA 5KKZB 2RH0A 1GU5A 4XA4A 1ZMEC 2CPBA 1M57D 4XE5B 1L0LG 1Q82Q 2P10A 1J1DB 1AQTA 1JO5A 3BRTB 2K37A 1S4XA 1LT9C 1KYOI 4D6TE 1SQPD 1EC5A 3AE9C 2KIKA 1ZR2A 2Q9IA 2WZ7A 1ZXGA 1BDDA 2XDJA 1NTME 3H25A 2L91A 3Q5RA 2NRGA 5BVZA 1SQBJ 2Y0DA 1FJPA 2A06E 2ZYGA 3CX5D 1NYHA 2QVAA 2LR2A 1E79H 2FXOA 1VQ9P 3L71D 5GTHE 2RKLA 1SQQJ 2MJZA 1JY2P 3PHLA 1YYCA 2FFDC 1U7MA 4HYTB 2KI7B 2D2CC 1LTAC 2GM4A 2WSSH 1NJIQ 3BCCE 1PPJG 1PP9D 1YTZI 2W6AA 2G8YA 1YHQP 1YTZT 3S4RA 2WSFH 2WSFJ 2BEZF 3KPEA 2Y0CA 5B66E 3NMDA 2R5BA 1HGZA 3A3YB 1HH0A 5APUA 3PH0A 1SQXG 2YNYA 1NTKG 3L75G 3M9BA 5CCGD 2IBZI 3TGUD 1OXZA 2WITA 1RF1C 4IL6E 3L70D 4KHXA 1YQ4C 2YXRB 3SFDC 1CSBA 1RQVA 1ZP0C 1BGYJ 4WWIA 1URQC 1DEEG 1GK4A 4OVNF 4LLHA 4N78D 3NTNA 2Q3IA 1JCCA 1VL2A 3M0DC 4JPZB 2GUVA 5CCHD 4L74A 4M3LA 1RE4C 1EZVG 1S5LX 2PRRA 2WPVB 1DH3A 2XU6A 1QEXA 1T2KC 5L8RJ 2NPSC 3L72G 3CXHE 1N7SC 3H32B 1L0LK 5AW1B 5TJHA 3CCEP 4I7ZC 1KILB 3O8ZA 5AVWB 5B5EE 3NFQA 1L0NE 3GHGB 4D6TG 2ZVOB 5AVTB 4R4MA 5CCGA 2JWAA 3PJSK 1KILE 4PV1D 3QH9A 4BRYA 2BCCE 1QGKB 1NTMG 2E75C 1BE3E 1GDTA 3B8EB 3CWBE 2P2UA 2PAJA 5AVVB 2A06G 3H32A 3O6QB 3TF5A 5AVXB 1SLQA 2ZT9D 1KILA 3EWKA 2O01J 3Q2YA 5KLVE 1X22A 2KS1B 1AFOA 2E5YA 1FE6A 3GHGA 2Q6QA 3JCUE 1KB9E 1DEBA 2KP8A 3HRNA 2ZAEB 1JMMA 2H7HA 3BCCG 5AVYB 1OW7A 3RK3C 2I1KA 1PV3A 4H0LC 2FXMA 1T6AA 3KZIH 3L74G 3O6QA 5CBNA 5APYA 3IF4A 1RE3A 1SQVE 2K3RA 5CHXA 1KMIZ 2KS1A 1SQXK 1NTKK 3N7NA 1LTGC 1IFNA 1SVFA 1DX7A 1KORA 2YIUC 1G1IA 3GG2A 4RESB 3AE1C 1T3JA 3WUUA 3E1RA 1JUNA 1L0LD 5AW8B 3H1JJ 3B5NB 4HH2A 3H1LG 1EDIA 1G1JA 3CPWO 2JO1A 1SQBE 3G71P 2E76D 1AQ5A 3HD7C 1KYOE 5EFWB 3PLNA 5C39A 1YJ9P 2H43A 3B71A 3MD0A 1LWUC 1SQQE 1LTJB 4UB8H 1DD4A 3WU2E 2KSEA 2CPSA 3GW6A 4H44D 2JDIH 3B5NA 1X0TA 3V2RA 2B87B 3H1IJ 4JYBA 1IK7A 1JY2O 2E76B 3SWFA 2KLVA 1VQKP 3BASA 2ZXEB 4Z1MH 3L73J 5TISE 1S72P 1PPJD 1LTJA 1NKNA 1L4AB 2M0BA 2BCCG 1X8YA 1W2BO 1J1EC 4LC1A 1NTMK 4H44B 1JTHB 1OVRA 3CC2P 2QJKC 3TYYA 4AYCA 2QSIA 1QVGO 2B87A 3CX5H 1UIIA 1GD2E 1SQXD 3HE5B 1BGYE 1NTKD 3L75D 4TT3H 1H89A 1KZUB 1YQ3C 1S1CX 2HODB 3IFMA 1JMBA 2IBZE 5CCHC 5E79E 2OTJP 2OYOA 1N73C 1NOHA 2Y9ZA 2KZIA 4C46A 2N9BA 1LTSC 1L4AA 1PP9J 3I56P 4R4LA 2FYNC 1YJWP 2NZ2A 2IPPA 2QE7H 3V5BA 1H0TB 1GK6A 1JTHA 3AE8C 3AE7C 1CI6B 2ZYDA 1FZFA 2LKMA 2H8PD 3HE5A 4U7JA 5AW7B 4LGDE 3K5BA 3KYQA 1VQMP 1NTZJ 2BASA 2HODA 2C0WA 1L0NJ 4PV1C 3MTUE 1P84I 1EZVD 1M56D 1PGPA 2E74B 4DZOA 5APTA 2Q7CA 3L72D 1JY2N 4H13B 1BE3J 1GW4A 1S3JA 2ZT9C 3CWBJ 1JCDA 3CC4P 3FXEA 3MGNA 1SQBG 1VQOP 4D6TD 5KLVJ 2DW3A 3M06A 2C9NY 3L4FA 2SPZA 3AE2C 4PD4I 4WB4A 3A2AA 1SQQG 4U3FJ 1EQ7A 1DD3A 5APXA 3AEEC 1GMJA 1NTMD 1KD1Q 1IFJA 1IFMA 2WSCJ 2HFED 1LP1B 2OGUA 2M3BA 5K5GB 3CMEP 3AEAC 2A06D 1VPCA 1M7LA 4NPEA 2QA4P 4WY4B 2POHA 4EYYQ 5AW2B 1SQVJ 4ZKPA 3II6A 5KAIH 1H88A 2FYUE 3BCCD 4PJ0E 2IYPA 2IZ0A 3Q5SA 5KTBA 4JQ0D 1LP1A 3AEGC 1HVVA 3AE4C 3AE5C 1D7MA 3L74D 3OJAB 1WRGA 2R44A 3LW5H 1Q90D 4WY4A 1FZCC 3H1JE 2E76C 3V4QA 1ZW0A 1BGYG 2QJYC 4MN4C 3KDPB 1YIJP 1FZBA 2IBZG 1SFCD 3Q3DA 1KQGB 3H6PA 2JJLA 3RBXA 2LXBA 3SSUA 1EDLA 3P7KA 2YMYA 2WQYC 1BDCA 2W8ZA 3N4XA 4I2LC 3H1LD 1K8AQ 4L75A 1RF0C 3A5TA 3MZWB 1Q7YQ 3FXDA 3H1KJ 3RK3E 1RHZB 3FX0A 1XTCC 2HPCB 3CD6P 1M1JC 4EI2A 3H1IE 5CBOA 3I5CA 1NH4A 1SFCB 2WSEH 1M8OB 5GTIH 3L73E 1SQPE 3ABVC 3P8MC 3CXHD 3AEBC 3ITKA 4W7YA 4QMAA 3EFGA 4GOEA 4K3AA 1WT6A 2N9YB 2OYHC 1R8EA 4NPDA 5KLIB 1SQBK 1TU3F 1BSHA 2HPCA 4AUWA 1LT1A 3Q5PA 3CX5E 3C1LA 1KILD 4C7NB 2KZJA 3KXDA 1SFCA 1SQQK 3MUDC 3L37A 2BCCD 1T8ZA 2AXTH 3CCRP 1AVOA 1PGJA 2W6JH 4TLFA 5KJ7C 1JNMA 3IN6A 1YBKA 1PP9E 4BRYB 1OW6A 3VMYA 2HG5D 3A0BH 3JSVC 4RKUJ 1PFIA 1IFPA 3HD7A 5KAFH 1LNQA 1UIXA 1FBMA 4C7NA 1NTZE 3RK2D 1GL2B 1EDKA 4K35A 1XTGB 3HTKB 2JP3A 3H1HJ 3CC7P 1MFZA 4WVZA 4Y99B 1VQLP 1NHLA 5KKZC 1ZR4A 2QJPB 5H2FH 2R32A 1ZRTD 4BWNA 3E7KA 4ASVA 4YPCA 3L75J 3LIEA 1J1DC 1P84E 5AVQB 4N78E 1IFIA 3WUTA 2IZ1A 3RK2B 2OQQA 1GL2A 3RL0B 1EXIA 4U3FE 3A0HE 4OGQB 1VQ8P 1VQNP 3HTKA 2O01N 4BXLA 1U57A 2CK3H 3G3ZA 1SQBD 2JWDA 1N86A 2Q5UA 3F5HA 2OYIB 1KYOD 1IFDA 3CCJP 1DIPA 3B5ND 3TK1A 1G2CB 3H1IG 4PD4E 1S5LH 1AV1A 4DCKA 1SQQD 2N1TB 1FC2C 2FYUJ 1VF5B 3P8CE 5KAIE 1QLED 2WT7B 3GLMA 3L73G 1KQSO 3R4YA 1S9KD 1NAFA 1NU1J 3HUSB 2QEXP 3L72J 1YI2P 1OVUA 1FAVA 4CPGA 4W7ZA 4Y28J 3SWKA 2IDBA 2QRXA 4IL6X 2W83C 2KUBA 2Y0EA 2OYIA 3BRVB 2FXPA 1VQ5P 1G2CA 4DOJA 1VDFA 4DT0A 1A02F 2N1TA 2J58A 2MKVA 2WT7A 2V7QH 2V7QJ 2AEMA 3HUSA 1GU4A 1BCCJ 2J59M 4UB6H 1L4AD 4WBAA 3IR9A 1Q81Q 1BGYD 3NXSA 5GTHH 2IBZD 4JF7A 3H1KE 4OH8B 2Z5HA 3CCSP 2ZFCA 3WUVA 1VQ6P 1NTZG 1MKMA 5CCGC 1L0NG 1LT9B 2YXQB 1JY3P 3CX5I 2YO2A 3CCLP 1SQPJ 1GZLA 2KYVA 5B66H 5GTIE 3MHVA 1EDJA 2YO3A 1BE3G 3S1KA 3CWBG 1Q86Q 1KILC 3VTPC 2H89C 2QM7A 1PL5A 3WMM0 2WPSA 5KLVG 1OMIA 3GHGC 1HTLC 1IZNB 1KQFB 3L71J 1PIXA 1LT9A 2FFDB 1IK9A 2JKVA 1LTTC 1J2JB 4U3FG 3AECC 1NWQA 1HF9A 1Z56A 2E74D 2M5AB 1A02J 1QL2A 3AE3C 4DJGA 4H13D 3BVHA 3G9RA 2KSJA 1FZGA 1RE3C 3ZDMA 1OFCX 1GW3A 1URQD 2AEFA 1SQVG 1L2PA 2ZJSE 2YKQA 1PGQA 1LTIC 2O3JA 3GF7A 2J5UA 3RBZA 3C9IA 4IFFA 3B4SA 2FFDA 5M1BA 2ZXXA 2WTYA 3TGUJ 3CXHH 1RF1B 2Z5IA 2W27A 4ZKUA 1RF0A 2A45I 2O1KA 3H1HE 2M5AA 3G4SP 2O1JA 3L70J 1K05A 1M90Q 2G3AA 3EFFK 2IFNA 1U7JA 2V4HA 1URQB 4IFMA 4WY4D 3G6EP 5CJ0A 3L75E 3VOPA 2M8RA 1OX3A 5CJ4A 5BU5A 3FGAD 2A45H 3CMAP 1W5CE 3OA7A 3A7OA 1RF1A 4GDOA 4KJMA 1N7LA 1R5SA 1QL1A 2E75D 3USSA 2XNDH 3B5NC 1USEA 2NPSB 3JCUH 1SS1A 1N7SB 3H1KG 4I7ZB 1URQA 1W2EA 1X79B 5AVRB 1NTZK 2QG4A 2IYOA 1L0NK 3KZIE 3M0DA 1LTJC 4GOFA 1FJKA 4EOTA 3TNUB 1RY3A 1QVFO 3VMAA 1RE4A 3RK3D 1NU1E 2E75B 3L72E 2OARA 2RN0A 1FU1A 2NPSA 3H1ID 4H0LD 2YKPA 1N7SA 2K1AA 2W90A 2XV5A 3LW5J 3CCVP 1OW8A 5KLVK 1X9VA 3L73D 3AE6C 2Q3EA 3I55P 2WPRA 1FOSE 1NGMB 3JC22 3RGUA 1L4AC 3V2PA 1OZHA 4HB1A 2ITAA 3TNUA 5DJTB 3RK3B 3VYIA 4H44C 1BCCE 3AEDC 4B86A 1KYOH 4UB6E 2XNXA 4UB8E 3LIDA 3P32A 4YTPC 4H0LB 2I1JA 1QX8A 1KFMA 1SQVK 3V4WA 3HD7D 3WU2H 2KXPB 4N6JA 3IAOA 4YXDC 2B9BA 1Y9BA 3VP8A 2E5TA 5AVZB 3PRJA 1KC8Q 3OW2O 2YIUB 2WSEJ 4RJTA 3H1HG 5AW0B 2M3EA 3M0AA 2E42A 2GUSA 4IFDK 3L74E 2PFXA 2JEEA 2B89A 1L0LJ 4GODA 3FWLA 1R5LA 5TISH 1NTZD 4ZNCA 2IFMA 1L0ND 2WVRA 5AW5B 4L73A 2KOGA 3HD7B 1BSNA 1JY3O 2XKMA 3D71A 2KNCB 1K73Q 2HYNA 2W6BA 1T3UA 1LWUB 2E74C 3L71E 1YITP 1GL2D 3TDKA 1BE3D 4H13C 3CWBD 3H1LE 3UIAA 5AVSB 1P84D 3SFEC 1YJNP 2K88A 2HLOA 5E79H 5KLVD 3KHUA 2KK7A 1MFTA 1KFNA 1KB9D 1RH5B 4U3FD 3CLQA 2FYUG 2KNCA 3E1IA 1LWUA 1EXJA 4GKGA 1OVVA 2P1JA 3RL0D 1FS0E 1NU1G 1J1EB 3TGUE 1FDMA 3U1AA 4OGQD 1CZQA 1HJ0A 1FOSF 4PD4D 1MZ9A 2QJKB 4YXWH 4WY4C 1SQVD 3L70E 5AW6B 3P8CD 3H1JG 1HJBA 1SQXJ 3CCQP 1NTKJ 1K9MQ 1M1KQ 2I8DA 2ZYAA 3MP7B 3VN0A 4OWFA 3KQGA 2N1TD 3U59A 2PGDA 3M9HA 1N73B 1VF5D 4XFJA 5AVUB 1H8AA 3CCMP 3D6ZA 2WMMA 2FYNB 3S9OA 4EDFA 1BCCG 3L36A 1NKZB 3GF3A 1Q2NA 1EZVI 1JY3N 2O01H 3CL3D 2Z4EA 4N3YB 1ZN5A 1JEKA 1IJDB 1PZQA 3U1CA 1JB0J 2UWJE 1FZEA 2Y9YA 2B88A 2P58A 2R5DA 4PV1B 1MV8A 5CCHA 3F89A 1ZLLA 5DJUB 1AJYA 1N73A 2IX7C 2OTKE 2P67A 3BATA 1ZV8A 1SQPG 3GMAA 2PP6A 3H1KD 2ZT9B 2ZVNB 4A7PA 3EQ2A 1ZRTE 4PJ0H 2FY8A 3W68A 1NVOA 1KV4A 4D6TJ 5CMZA 4KT0J 4I6MC 2KB7P 1SFCC 4HKZH 5APWA 1CW5A 3L71G 1NAYA 2HR3A 2XZRA 1NTMJ 3D6YA 3HE4B 2YMKA 3C8VA 1IC2A 5AW9B 4JBZA 1WMKA 1RQUA 1PP9G 3CI9A 5KLIC 2GA1A 1OIPA 1PGOA 4AQRD 5BU8B 5APQA 2FBWC 2FYUK 2Q1KA 2FKWB 1VQ7P 2QIWA 2YKOA 3BCCJ 4RO0A 2C0XA 2KLUA 3TGUG 1NU1K 1NO4A 1S9KE 3HE4A 2D2CD 1N2DC 1N8RQ 4HJGH 3SWYA 3CCUP 2H88C 5APVA 4O9BA 3L70G 1AVYA 3R2PA 1HBWA 3L74J 1SP4A 1FZCB 2QJYB 3MIWA 1L0LE 3M91A 2K9YA 3Q1MA 4ASWA 5AW4B 2VRSA 1JOCA 2BEQD 1Y8AA 2LXCB 1GL2C 2JR8A 4IL6H 3FWNA 1JM0A 4L76A 2A45G 3H1HD 4Y99C 3M9QA 2D2CB 2AXTE 2QJPC 3H1LJ 4JYCA 1FDOA 4GT1A 1FZCA 5AW3B 3PTZA 3CXHI 1AA0A 1E5WA 1M1JB 2AEJA 3RL0g 1K04A 3A0BE 2OTLP 4EIJA 3RK2C 3L35A 3RL0C 5KAFE 3VMXA 2WWWA 1ZOYC 4OGQC 5KJ7D 1SQPK 4W80A 1KQLA 4IOIH 1LGHB 3OAKA 1GTWA 1KTMA 1PPJE 3QWOC 3T97B 2AXCA 2OYIC 2OYHB 1FDIA 5B5EH 2WPQA 4I1LA 1T2KD 2NPSD 2K9JB 1LJ2A 2E43A 4C7RA 2FYUD 1N7SD 3V2NA 2N1TC 1IO4A 2C9LY 1M1JA 5H2FE 3VMZA 1VF5C 1MUUA 1SQXE 1S2EA 1NTKE 1FZAA 3D70A 3V2QA 1NU1D 1HGVA 1KB9I 2BCCJ 4GIFA 2P7JA 3HUSC 1H0TA 1KN7A 2FYZA 3T97A 1CI6A 4NPFX 1P84H 3H1JD 2OYHA 1HUCA
chains in the Genus database with same CATH topology
3SWFA 2KLVA 2GUSA 3BASA 3HTKA 4IFDK 2ZXEB 2JEEA 3G3ZA 2L5GB 1LTJA 1LTBC 1NKNA 1L4AB 1N86A 1X8YA 2Q5UA 2WSCH 5APSA 2IFMA 1J1EC 2OYIB 4LC1A 3MUDA 1NTMK 3PP5A 2QM8A 1IFDA 5AW5B 2KOGA 3HD7B 3B5ND 3TK1A 1OWAA 1JY3O 1G2CB 1JTHB 5KJ7A 2XKMA 3TYYA 4AYCA 2HYNA 1HWTC 3TSIA 2W6BA 1T3UA 2N1TB 1LWUB 1GD2E 1GL2D 3VP9A 3P8CE 2R3CA 3HE5B 1GU5A 4XA4A 2WT7B 2CPBA 1H89A 1KZUB 4XE5B 2HODB 3IFMA 5CCHC 1S9KD 1NAFA 3UIAA 3HUSB 5AVSB 1J1DB 1NOHA 1N73C 1FAVA 4C46A 3BRTB 2HLOA 2N9BA 1JO5A 1LTSC 4W7ZA 1L4AA 1LT9C 2OYIA 2IPPA 3BRVB 3V5BA 1KFNA 1ZR2A 2Q9IA 1GK6A 3CLQA 1G2CA 1JTHA 4DOJA 2WZ7A 3E1IA 1VDFA 1CI6B 1A02F 2N1TA 1FZFA 2J58A 1LWUA 2XDJA 2LKMA 4GKGA 2H8PD 3HE5A 5AW7B 2P1JA 4LGDE 3RL0D 3KYQA 5BVZA 2WT7A 1J1EB 1FDMA 2BASA 3U1AA 1FJPA 2HODA 2C0WA 1CZQA 3MTUE 1FOSF 1MZ9A 3HUSA 1GU4A 2J59M 4WY4C 1L4AD 4WBAA 5AW6B 3P8CD 3IR9A 2MJZA 1JY2P 4DZOA 5APTA 2Q7CA 1HJBA 1YYCA 3NXSA 2FFDC 4HYTB 1JY2N 4JF7A 1GW4A 1LTAC 2GM4A 3VN0A 3KQGA 2N1TD 1JCDA 4OH8B 3U59A 2Z5HA 2ZFCA 1YTZI 3M9HA 1N73B 2W6AA 1YTZT 3MGNA 5AVUB 1H8AA 5CCGC 2WSFH 1LT9B 3M06A 2C9NY 3L4FA 3KPEA 3L36A 1JY3P 1NKZB 2YO2A 3M0AA 3NMDA 2R5BA 1HGZA 4WB4A 1GZLA 3A3YB 3A2AA 1JY3N 1HH0A 2O01H 2KYVA 5APUA 1EQ7A 3CL3D 2Z4EA 4N3YB 5APXA 2YNYA 1IFJA 1IFMA 1ZN5A 1IJDB 3M9BA 2YO3A 2HFED 5CCGD 3U1CA 2M3BA 1OXZA 1FZEA 2WITA 1KILC 1RF1C 1VPCA 3VTPC 5CCHA 2R5DA 1MV8A 2QM7A 3WMM0 1M7LA 1ZLLA 2WPSA 4WY4B 1N73A 4KHXA 2IX7C 3GHGC 2POHA 1HTLC 2P67A 3BATA 5AW2B 1ZV8A 1CSBA 4ZKPA 3II6A 1LT9A 1H88A 2FFDB 1IK9A 1LTTC 1J2JB 2PP6A 1URQC 1NWQA 1GK4A 4LLHA 1Z56A 4N78D 3EQ2A 3NTNA 5KTBA 2Q3IA 1A02J 1JCCA 3M0DC 1QL2A 2GUVA 1HVVA 3BVHA 5CCHD 5CMZA 2KSJA 1FZGA 4I6MC 1RE3C 1GW3A 2KB7P 1URQD 3OJAB 1SFCC 4M3LA 1RE4C 5APWA 1WRGA 1CW5A 3LW5H 2YKQA 4WY4A 1FZCC 3V4QA 1LTIC 1DH3A 2XU6A 1T2KC 2XZRA 3KDPB 2NPSC 3C9IA 4IFFA 1FZBA 3HE4B 2FFDA 1N7SC 3H32B 1L0LK 5AW1B 1IC2A 2WTYA 5AW9B 1KILB 1RF1B 3O8ZA 1SFCD 3H6PA 3CI9A 5AVWB 2Z5IA 2JJLA 2W27A 4ZKUA 1RF0A 2A45I 2O1KA 3NFQA 3P7KA 3GHGB 2O1JA 2YMYA 4AQRD 5AVTB 2IFNA 5CCGA 5BU8B 3N4XA 4I2LC 5APQA 1RF0C 1URQB 2FYUK 3A5TA 4IFMA 4WY4D 5CJ0A 2FKWB 3VOPA 2M8RA 1XTCC 2YKOA 5CJ4A 5BU5A 2HPCB 1GDTA 2C0XA 3B8EB 2A45H 1NU1K 1NO4A 1S9KE 2P2UA 2PAJA 1M1JC 3HE4A 5AVVB 3OA7A 1N2DC 3H32A 3I5CA 3SWYA 1NH4A 5AVXB 1SLQA 5APVA 1KILA 3A7OA 4O9BA 1RF1A 1SFCB 3R2PA 2WSEH 1AFOA 1HBWA 1SP4A 1N7LA 1FZCB 1QL1A 3P8MC 3GHGA 3B5NC 3MIWA 3M91A 1DEBA 2NPSB 2KP8A 4W7YA 5AW4B 2VRSA 1JOCA 3EFGA 1N7SB 3HRNA 1JMMA 2H7HA 1URQA 1WT6A 1GL2C 1W2EA 5AVYB 2OYHC 1X79B 3RK3C 5AVRB 2I1KA 2A45G 1NTZK 1SQBK 2HPCA 4AUWA 1L0NK 3M0DA 4Y99C 3M9QA 1KILD 2FXMA 4C7NB 1LTJC 1FJKA 5APYA 4EOTA 1RE3A 3TNUB 5CHXA 1RY3A 4JYCA 1SFCA 1SQQK 3L37A 1T8ZA 1RE4A 3RK3D 4GT1A 1SQXK 1FZCA 5AW3B 5KJ7C 1NTKK 2OARA 3N7NA 1JNMA 1E5WA 1FU1A 1LTGC 2NPSA 1IFNA 1M1JB 2YKPA 1N7SA 1SVFA 1DX7A 4EIJA 3RK2C 2XV5A 1G1IA 2HG5D 4RESB 3VMYA 3L35A 3RL0C 5KLVK 1X9VA 1T3JA 3VMXA 2WWWA 1PFIA 5KJ7D 1JUNA 5AW8B 3HD7A 2WPRA 1SQPK 3B5NB 4W80A 1KQLA 1FOSE 1LGHB 3OAKA 4HH2A 1GTWA 1FBMA 4C7NA 1L4AC 1G1JA 3V2PA 3TNUA 3RK2D 1GL2B 2OYIC 2OYHB 1AQ5A 1XTGB 3RK3B 3VYIA 3HD7C 2WPQA 4I1LA 1T2KD 2NPSD 3HTKB 2H43A 4B86A 2E43A 4C7RA 2XNXA 1N7SD 3V2NA 3LIDA 2N1TC 3MD0A 1IO4A 1MFZA 3P32A 2C9LY 1M1JA 1LWUC 4Y99B 2I1JA 3VMZA 1LTJB 1NHLA 1ZR4A 1MUUA 1KFMA 1SQVK 1FZAA 2CPSA 2R32A 3V2QA 3V4WA 3HD7D 1HGVA 4N6JA 4GIFA 2P7JA 3HUSC 3B5NA 3LIEA 1J1DC 3VP8A 3V2RA 5AVQB 2FYZA 5AVZB 4N78E 3T97A 1IFIA 1CI6A 4JYBA 3RK2B 1GL2A 1JY2O 5AW0B 2OYHA 3RL0B 1HUCA 2E42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IR9 A;  5APW A;  3SWF A;  4C7N B;  4DZO A;  3HTK A;  5APT A;  2ZXE B;  1YYC A;  3NXS A;  5APY A;  4HYT B;  2Q7C A;  3V4Q A;  4EOT A;  3TNU B;  4JYC A;  1DH3 A;  2XU6 A;  3L37 A;  1T2K C;  2XZR A;  3KDP B;  4GT1 A;  3VN0 A;  3KQG A;  3HE4 B;  5AW3 B;  2Z5H A;  2ZFC A;  1X8Y A;  2Q5U A;  3M9H A;  5AW1 B;  1HJB A;  2W6A A;  5APS A;  2WTY A;  5AW9 B;  1JNM A;  4LC1 A;  3MGN A;  3O8Z A;  2QM8 A;  5AW5 B;  5AVU B;  1H8A A;  3TK1 A;  5AVW B;  2Z5I A;  2W27 A;  1OWA A;  2JJL A;  1G2C B;  3M06 A;  2C9N Y;  3NFQ A;  3TYY A;  4AYC A;  3P7K A;  2XV5 A;  1HWT C;  3L36 A;  3VMY A;  4RES B;  4AQR D;  2YO2 A;  3L35 A;  3NMD A;  5AVT B;  2R5B A;  1GD2 E;  1GZL A;  3VMX A;  3A3Y B;  2WWW A;  2R3C A;  3A2A A;  3HE5 B;  4I2L C;  5APU A;  5AW6 B;  1GU5 A;  1JUN A;  5APQ A;  5APX A;  5AW8 B;  2WT7 B;  2WPR A;  1H89 A;  1KQL A;  4XE5 B;  2YNY A;  1FOS E;  3A5T A;  3OAK A;  1GTW A;  1HUC A;  3M9B A;  2YO3 A;  1S9K D;  1NAF A;  4C7N A;  3UIA A;  1OXZ A;  3TNU A;  5AVS B;  3B8E B;  1FAV A;  4C46 A;  2N9B A;  3VYI A;  3VTP C;  2R5D A;  2P2U A;  1MV8 A;  1S9K E;  2QM7 A;  3HE4 A;  5AVV B;  2WPQ A;  1T2K D;  2WPS A;  3I5C A;  4KHX A;  1SLQ A;  5AVX B;  4B86 A;  2E43 A;  2IPP A;  5APV A;  3A7O A;  3V5B A;  2P67 A;  3LID A;  3MD0 A;  1IO4 A;  1MFZ A;  3P32 A;  5AW2 B;  2C9L Y;  1CSB A;  1GK6 A;  1HBW A;  3VMZ A;  1SP4 A;  1H88 A;  1MUU A;  1J2J B;  3P8M C;  1CI6 B;  2R32 A;  1A02 F;  3M91 A;  3V4W A;  1NWQ A;  2KP8 A;  4GKG A;  1GK4 A;  3HE5 A;  5AW7 B;  2P7J A;  2VRS A;  5AW4 B;  2WT7 A;  3NTN A;  2H7H A;  2E42 A;  3LIE A;  2BAS A;  2Q3I A;  1A02 J;  5AVY B;  5AVQ B;  1CZQ A;  5AVR B;  5AVZ B;  1FOS F;  3T97 A;  1CI6 A;  1GU4 A;  4JYB A;  5CMZ A;  4I6M C;  4AUW A;  5AW0 B;  3M0A A;  3M0D A;  4M3L A; 
#chains in the Genus database with same CATH topology
 2RMZ A;  1VQP P;  1Y47 A;  2K9J A;  1USD A;  1KB9 H;  3A0H H;  3W67 A;  2L5G B;  1LTB C;  2WSC H;  5APS A;  3MUD A;  3PP5 A;  2QM8 A;  1VQ4 P;  3AEF C;  1S5L E;  1BCC D;  1OWA A;  3V6I A;  5KJ7 A;  4ZMD A;  1HWT C;  3TSI A;  1EZV E;  2R3S A;  4PD4 H;  3VP9 A;  2R3C A;  5KKZ B;  2RH0 A;  1GU5 A;  4XA4 A;  1ZME C;  2CPB A;  1M57 D;  4XE5 B;  1L0L G;  1Q82 Q;  2P10 A;  1J1D B;  1AQT A;  1JO5 A;  3BRT B;  2K37 A;  1S4X A;  1LT9 C;  1KYO I;  4D6T E;  1SQP D;  1EC5 A;  3AE9 C;  2KIK A;  1ZR2 A;  2Q9I A;  2WZ7 A;  1ZXG A;  1BDD A;  2XDJ A;  1NTM E;  3H25 A;  2L91 A;  3Q5R A;  2NRG A;  5BVZ A;  1SQB J;  2Y0D A;  1FJP A;  2A06 E;  2ZYG A;  3CX5 D;  1NYH A;  2QVA A;  2LR2 A;  1E79 H;  2FXO A;  1VQ9 P;  3L71 D;  5GTH E;  2RKL A;  1SQQ J;  2MJZ A;  1JY2 P;  3PHL A;  1YYC A;  2FFD C;  1U7M A;  4HYT B;  2KI7 B;  2D2C C;  1LTA C;  2GM4 A;  2WSS H;  1NJI Q;  3BCC E;  1PPJ G;  1PP9 D;  1YTZ I;  2W6A A;  2G8Y A;  1YHQ P;  1YTZ T;  3S4R A;  2WSF H;  2WSF J;  2BEZ F;  3KPE A;  2Y0C A;  5B66 E;  3NMD A;  2R5B A;  1HGZ A;  3A3Y B;  1HH0 A;  5APU A;  3PH0 A;  1SQX G;  2YNY A;  1NTK G;  3L75 G;  3M9B A;  5CCG D;  2IBZ I;  3TGU D;  1OXZ A;  2WIT A;  1RF1 C;  4IL6 E;  3L70 D;  4KHX A;  1YQ4 C;  2YXR B;  3SFD C;  1CSB A;  1RQV A;  1ZP0 C;  1BGY J;  4WWI A;  1URQ C;  1DEE G;  1GK4 A;  4OVN F;  4LLH A;  4N78 D;  3NTN A;  2Q3I A;  1JCC A;  1VL2 A;  3M0D C;  4JPZ B;  2GUV A;  5CCH D;  4L74 A;  4M3L A;  1RE4 C;  1EZV G;  1S5L X;  2PRR A;  2WPV B;  1DH3 A;  2XU6 A;  1QEX A;  1T2K C;  5L8R J;  2NPS C;  3L72 G;  3CXH E;  1N7S C;  3H32 B;  1L0L K;  5AW1 B;  5TJH A;  3CCE P;  4I7Z C;  1KIL B;  3O8Z A;  5AVW B;  5B5E E;  3NFQ A;  1L0N E;  3GHG B;  4D6T G;  2ZVO B;  5AVT B;  4R4M A;  5CCG A;  2JWA A;  3PJS K;  1KIL E;  4PV1 D;  3QH9 A;  4BRY A;  2BCC E;  1QGK B;  1NTM G;  2E75 C;  1BE3 E;  1GDT A;  3B8E B;  3CWB E;  2P2U A;  2PAJ A;  5AVV B;  2A06 G;  3H32 A;  3O6Q B;  3TF5 A;  5AVX B;  1SLQ A;  2ZT9 D;  1KIL A;  3EWK A;  2O01 J;  3Q2Y A;  5KLV E;  1X22 A;  2KS1 B;  1AFO A;  2E5Y A;  1FE6 A;  3GHG A;  2Q6Q A;  3JCU E;  1KB9 E;  1DEB A;  2KP8 A;  3HRN A;  2ZAE B;  1JMM A;  2H7H A;  3BCC G;  5AVY B;  1OW7 A;  3RK3 C;  2I1K A;  1PV3 A;  4H0L C;  2FXM A;  1T6A A;  3KZI H;  3L74 G;  3O6Q A;  5CBN A;  5APY A;  3IF4 A;  1RE3 A;  1SQV E;  2K3R A;  5CHX A;  1KMI Z;  2KS1 A;  1SQX K;  1NTK K;  3N7N A;  1LTG C;  1IFN A;  1SVF A;  1DX7 A;  1KOR A;  2YIU C;  1G1I A;  3GG2 A;  4RES B;  3AE1 C;  1T3J A;  3WUU A;  3E1R A;  1JUN A;  1L0L D;  5AW8 B;  3H1J J;  3B5N B;  4HH2 A;  3H1L G;  1EDI A;  1G1J A;  3CPW O;  2JO1 A;  1SQB E;  3G71 P;  2E76 D;  1AQ5 A;  3HD7 C;  1KYO E;  5EFW B;  3PLN A;  5C39 A;  1YJ9 P;  2H43 A;  3B71 A;  3MD0 A;  1LWU C;  1SQQ E;  1LTJ B;  4UB8 H;  1DD4 A;  3WU2 E;  2KSE A;  2CPS A;  3GW6 A;  4H44 D;  2JDI H;  3B5N A;  1X0T A;  3V2R A;  2B87 B;  3H1I J;  4JYB A;  1IK7 A;  1JY2 O;  2E76 B;  3SWF A;  2KLV A;  1VQK P;  3BAS A;  2ZXE B;  4Z1M H;  3L73 J;  5TIS E;  1S72 P;  1PPJ D;  1LTJ A;  1NKN A;  1L4A B;  2M0B A;  2BCC G;  1X8Y A;  1W2B O;  1J1E C;  4LC1 A;  1NTM K;  4H44 B;  1JTH B;  1OVR A;  3CC2 P;  2QJK C;  3TYY A;  4AYC A;  2QSI A;  1QVG O;  2B87 A;  3CX5 H;  1UII A;  1GD2 E;  1SQX D;  3HE5 B;  1BGY E;  1NTK D;  3L75 D;  4TT3 H;  1H89 A;  1KZU B;  1YQ3 C;  1S1C X;  2HOD B;  3IFM A;  1JMB A;  2IBZ E;  5CCH C;  5E79 E;  2OTJ P;  2OYO A;  1N73 C;  1NOH A;  2Y9Z A;  2KZI A;  4C46 A;  2N9B A;  1LTS C;  1L4A A;  1PP9 J;  3I56 P;  4R4L A;  2FYN C;  1YJW P;  2NZ2 A;  2IPP A;  2QE7 H;  3V5B A;  1H0T B;  1GK6 A;  1JTH A;  3AE8 C;  3AE7 C;  1CI6 B;  2ZYD A;  1FZF A;  2LKM A;  2H8P D;  3HE5 A;  4U7J A;  5AW7 B;  4LGD E;  3K5B A;  3KYQ A;  1VQM P;  1NTZ J;  2BAS A;  2HOD A;  2C0W A;  1L0N J;  4PV1 C;  3MTU E;  1P84 I;  1EZV D;  1M56 D;  1PGP A;  2E74 B;  4DZO A;  5APT A;  2Q7C A;  3L72 D;  1JY2 N;  4H13 B;  1BE3 J;  1GW4 A;  1S3J A;  2ZT9 C;  3CWB J;  1JCD A;  3CC4 P;  3FXE A;  3MGN A;  1SQB G;  1VQO P;  4D6T D;  5KLV J;  2DW3 A;  3M06 A;  2C9N Y;  3L4F A;  2SPZ A;  3AE2 C;  4PD4 I;  4WB4 A;  3A2A A;  1SQQ G;  4U3F J;  1EQ7 A;  1DD3 A;  5APX A;  3AEE C;  1GMJ A;  1NTM D;  1KD1 Q;  1IFJ A;  1IFM A;  2WSC J;  2HFE D;  1LP1 B;  2OGU A;  2M3B A;  5K5G B;  3CME P;  3AEA C;  2A06 D;  1VPC A;  1M7L A;  4NPE A;  2QA4 P;  4WY4 B;  2POH A;  4EYY Q;  5AW2 B;  1SQV J;  4ZKP A;  3II6 A;  5KAI H;  1H88 A;  2FYU E;  3BCC D;  4PJ0 E;  2IYP A;  2IZ0 A;  3Q5S A;  5KTB A;  4JQ0 D;  1LP1 A;  3AEG C;  1HVV A;  3AE4 C;  3AE5 C;  1D7M A;  3L74 D;  3OJA B;  1WRG A;  2R44 A;  3LW5 H;  1Q90 D;  4WY4 A;  1FZC C;  3H1J E;  2E76 C;  3V4Q A;  1ZW0 A;  1BGY G;  2QJY C;  4MN4 C;  3KDP B;  1YIJ P;  1FZB A;  2IBZ G;  1SFC D;  3Q3D A;  1KQG B;  3H6P A;  2JJL A;  3RBX A;  2LXB A;  3SSU A;  1EDL A;  3P7K A;  2YMY A;  2WQY C;  1BDC A;  2W8Z A;  3N4X A;  4I2L C;  3H1L D;  1K8A Q;  4L75 A;  1RF0 C;  3A5T A;  3MZW B;  1Q7Y Q;  3FXD A;  3H1K J;  3RK3 E;  1RHZ B;  3FX0 A;  1XTC C;  2HPC B;  3CD6 P;  1M1J C;  4EI2 A;  3H1I E;  5CBO A;  3I5C A;  1NH4 A;  1SFC B;  2WSE H;  1M8O B;  5GTI H;  3L73 E;  1SQP E;  3ABV C;  3P8M C;  3CXH D;  3AEB C;  3ITK A;  4W7Y A;  4QMA A;  3EFG A;  4GOE A;  4K3A A;  1WT6 A;  2N9Y B;  2OYH C;  1R8E A;  4NPD A;  5KLI B;  1SQB K;  1TU3 F;  1BSH A;  2HPC A;  4AUW A;  1LT1 A;  3Q5P A;  3CX5 E;  3C1L A;  1KIL D;  4C7N B;  2KZJ A;  3KXD A;  1SFC A;  1SQQ K;  3MUD C;  3L37 A;  2BCC D;  1T8Z A;  2AXT H;  3CCR P;  1AVO A;  1PGJ A;  2W6J H;  4TLF A;  5KJ7 C;  1JNM A;  3IN6 A;  1YBK A;  1PP9 E;  4BRY B;  1OW6 A;  3VMY A;  2HG5 D;  3A0B H;  3JSV C;  4RKU J;  1PFI A;  1IFP A;  3HD7 A;  5KAF H;  1LNQ A;  1UIX A;  1FBM A;  4C7N A;  1NTZ E;  3RK2 D;  1GL2 B;  1EDK A;  4K35 A;  1XTG B;  3HTK B;  2JP3 A;  3H1H J;  3CC7 P;  1MFZ A;  4WVZ A;  4Y99 B;  1VQL P;  1NHL A;  5KKZ C;  1ZR4 A;  2QJP B;  5H2F H;  2R32 A;  1ZRT D;  4BWN A;  3E7K A;  4ASV A;  4YPC A;  3L75 J;  3LIE A;  1J1D C;  1P84 E;  5AVQ B;  4N78 E;  1IFI A;  3WUT A;  2IZ1 A;  3RK2 B;  2OQQ A;  1GL2 A;  3RL0 B;  1EXI A;  4U3F E;  3A0H E;  4OGQ B;  1VQ8 P;  1VQN P;  3HTK A;  2O01 N;  4BXL A;  1U57 A;  2CK3 H;  3G3Z A;  1SQB D;  2JWD A;  1N86 A;  2Q5U A;  3F5H A;  2OYI B;  1KYO D;  1IFD A;  3CCJ P;  1DIP A;  3B5N D;  3TK1 A;  1G2C B;  3H1I G;  4PD4 E;  1S5L H;  1AV1 A;  4DCK A;  1SQQ D;  2N1T B;  1FC2 C;  2FYU J;  1VF5 B;  3P8C E;  5KAI E;  1QLE D;  2WT7 B;  3GLM A;  3L73 G;  1KQS O;  3R4Y A;  1S9K D;  1NAF A;  1NU1 J;  3HUS B;  2QEX P;  3L72 J;  1YI2 P;  1OVU A;  1FAV A;  4CPG A;  4W7Z A;  4Y28 J;  3SWK A;  2IDB A;  2QRX A;  4IL6 X;  2W83 C;  2KUB A;  2Y0E A;  2OYI A;  3BRV B;  2FXP A;  1VQ5 P;  1G2C A;  4DOJ A;  1VDF A;  4DT0 A;  1A02 F;  2N1T A;  2J58 A;  2MKV A;  2WT7 A;  2V7Q H;  2V7Q J;  2AEM A;  3HUS A;  1GU4 A;  1BCC J;  2J59 M;  4UB6 H;  1L4A D;  4WBA A;  3IR9 A;  1Q81 Q;  1BGY D;  3NXS A;  5GTH H;  2IBZ D;  4JF7 A;  3H1K E;  4OH8 B;  2Z5H A;  3CCS P;  2ZFC A;  3WUV A;  1VQ6 P;  1NTZ G;  1MKM A;  5CCG C;  1L0N G;  1LT9 B;  2YXQ B;  1JY3 P;  3CX5 I;  2YO2 A;  3CCL P;  1SQP J;  1GZL A;  2KYV A;  5B66 H;  5GTI E;  3MHV A;  1EDJ A;  2YO3 A;  1BE3 G;  3S1K A;  3CWB G;  1Q86 Q;  1KIL C;  3VTP C;  2H89 C;  2QM7 A;  1PL5 A;  3WMM 0;  2WPS A;  5KLV G;  1OMI A;  3GHG C;  1HTL C;  1IZN B;  1KQF B;  3L71 J;  1PIX A;  1LT9 A;  2FFD B;  1IK9 A;  2JKV A;  1LTT C;  1J2J B;  4U3F G;  3AEC C;  1NWQ A;  1HF9 A;  1Z56 A;  2E74 D;  2M5A B;  1A02 J;  1QL2 A;  3AE3 C;  4DJG A;  4H13 D;  3BVH A;  3G9R A;  2KSJ A;  1FZG A;  1RE3 C;  3ZDM A;  1OFC X;  1GW3 A;  1URQ D;  2AEF A;  1SQV G;  1L2P A;  2ZJS E;  2YKQ A;  1PGQ A;  1LTI C;  2O3J A;  3GF7 A;  2J5U A;  3RBZ A;  3C9I A;  4IFF A;  3B4S A;  2FFD A;  5M1B A;  2ZXX A;  2WTY A;  3TGU J;  3CXH H;  1RF1 B;  2Z5I A;  2W27 A;  4ZKU A;  1RF0 A;  2A45 I;  2O1K A;  3H1H E;  2M5A A;  3G4S P;  2O1J A;  3L70 J;  1K05 A;  1M90 Q;  2G3A A;  3EFF K;  2IFN A;  1U7J A;  2V4H A;  1URQ B;  4IFM A;  4WY4 D;  3G6E P;  5CJ0 A;  3L75 E;  3VOP A;  2M8R A;  1OX3 A;  5CJ4 A;  5BU5 A;  3FGA D;  2A45 H;  3CMA P;  1W5C E;  3OA7 A;  3A7O A;  1RF1 A;  4GDO A;  4KJM A;  1N7L A;  1R5S A;  1QL1 A;  2E75 D;  3USS A;  2XND H;  3B5N C;  1USE A;  2NPS B;  3JCU H;  1SS1 A;  1N7S B;  3H1K G;  4I7Z B;  1URQ A;  1W2E A;  1X79 B;  5AVR B;  1NTZ K;  2QG4 A;  2IYO A;  1L0N K;  3KZI E;  3M0D A;  1LTJ C;  4GOF A;  1FJK A;  4EOT A;  3TNU B;  1RY3 A;  1QVF O;  3VMA A;  1RE4 A;  3RK3 D;  1NU1 E;  2E75 B;  3L72 E;  2OAR A;  2RN0 A;  1FU1 A;  2NPS A;  3H1I D;  4H0L D;  2YKP A;  1N7S A;  2K1A A;  2W90 A;  2XV5 A;  3LW5 J;  3CCV P;  1OW8 A;  5KLV K;  1X9V A;  3L73 D;  3AE6 C;  2Q3E A;  3I55 P;  2WPR A;  1FOS E;  1NGM B;  3JC2 2;  3RGU A;  1L4A C;  3V2P A;  1OZH A;  4HB1 A;  2ITA A;  3TNU A;  5DJT B;  3RK3 B;  3VYI A;  4H44 C;  1BCC E;  3AED C;  4B86 A;  1KYO H;  4UB6 E;  2XNX A;  4UB8 E;  3LID A;  3P32 A;  4YTP C;  4H0L B;  2I1J A;  1QX8 A;  1KFM A;  1SQV K;  3V4W A;  3HD7 D;  3WU2 H;  2KXP B;  4N6J A;  3IAO A;  4YXD C;  2B9B A;  1Y9B A;  3VP8 A;  2E5T A;  5AVZ B;  3PRJ A;  1KC8 Q;  3OW2 O;  2YIU B;  2WSE J;  4RJT A;  3H1H G;  5AW0 B;  2M3E A;  3M0A A;  2E42 A;  2GUS A;  4IFD K;  3L74 E;  2PFX A;  2JEE A;  2B89 A;  1L0L J;  4GOD A;  3FWL A;  1R5L A;  5TIS H;  1NTZ D;  4ZNC A;  2IFM A;  1L0N D;  2WVR A;  5AW5 B;  4L73 A;  2KOG A;  3HD7 B;  1BSN A;  1JY3 O;  2XKM A;  3D71 A;  2KNC B;  1K73 Q;  2HYN A;  2W6B A;  1T3U A;  1LWU B;  2E74 C;  3L71 E;  1YIT P;  1GL2 D;  3TDK A;  1BE3 D;  4H13 C;  3CWB D;  3H1L E;  3UIA A;  5AVS B;  1P84 D;  3SFE C;  1YJN P;  2K88 A;  2HLO A;  5E79 H;  5KLV D;  3KHU A;  2KK7 A;  1MFT A;  1KFN A;  1KB9 D;  1RH5 B;  4U3F D;  3CLQ A;  2FYU G;  2KNC A;  3E1I A;  1LWU A;  1EXJ A;  4GKG A;  1OVV A;  2P1J A;  3RL0 D;  1FS0 E;  1NU1 G;  1J1E B;  3TGU E;  1FDM A;  3U1A A;  4OGQ D;  1CZQ A;  1HJ0 A;  1FOS F;  4PD4 D;  1MZ9 A;  2QJK B;  4YXW H;  4WY4 C;  1SQV D;  3L70 E;  5AW6 B;  3P8C D;  3H1J G;  1HJB A;  1SQX J;  3CCQ P;  1NTK J;  1K9M Q;  1M1K Q;  2I8D A;  2ZYA A;  3MP7 B;  3VN0 A;  4OWF A;  3KQG A;  2N1T D;  3U59 A;  2PGD A;  3M9H A;  1N73 B;  1VF5 D;  4XFJ A;  5AVU B;  1H8A A;  3CCM P;  3D6Z A;  2WMM A;  2FYN B;  3S9O A;  4EDF A;  1BCC G;  3L36 A;  1NKZ B;  3GF3 A;  1Q2N A;  1EZV I;  1JY3 N;  2O01 H;  3CL3 D;  2Z4E A;  4N3Y B;  1ZN5 A;  1JEK A;  1IJD B;  1PZQ A;  3U1C A;  1JB0 J;  2UWJ E;  1FZE A;  2Y9Y A;  2B88 A;  2P58 A;  2R5D A;  4PV1 B;  1MV8 A;  5CCH A;  3F89 A;  1ZLL A;  5DJU B;  1AJY A;  1N73 A;  2IX7 C;  2OTK E;  2P67 A;  3BAT A;  1ZV8 A;  1SQP G;  3GMA A;  2PP6 A;  3H1K D;  2ZT9 B;  2ZVN B;  4A7P A;  3EQ2 A;  1ZRT E;  4PJ0 H;  2FY8 A;  3W68 A;  1NVO A;  1KV4 A;  4D6T J;  5CMZ A;  4KT0 J;  4I6M C;  2KB7 P;  1SFC C;  4HKZ H;  5APW A;  1CW5 A;  3L71 G;  1NAY A;  2HR3 A;  2XZR A;  1NTM J;  3D6Y A;  3HE4 B;  2YMK A;  3C8V A;  1IC2 A;  5AW9 B;  4JBZ A;  1WMK A;  1RQU A;  1PP9 G;  3CI9 A;  5KLI C;  2GA1 A;  1OIP A;  1PGO A;  4AQR D;  5BU8 B;  5APQ A;  2FBW C;  2FYU K;  2Q1K A;  2FKW B;  1VQ7 P;  2QIW A;  2YKO A;  3BCC J;  4RO0 A;  2C0X A;  2KLU A;  3TGU G;  1NU1 K;  1NO4 A;  1S9K E;  3HE4 A;  2D2C D;  1N2D C;  1N8R Q;  4HJG H;  3SWY A;  3CCU P;  2H88 C;  5APV A;  4O9B A;  3L70 G;  1AVY A;  3R2P A;  1HBW A;  3L74 J;  1SP4 A;  1FZC B;  2QJY B;  3MIW A;  1L0L E;  3M91 A;  2K9Y A;  3Q1M A;  4ASW A;  5AW4 B;  2VRS A;  1JOC A;  2BEQ D;  1Y8A A;  2LXC B;  1GL2 C;  2JR8 A;  4IL6 H;  3FWN A;  1JM0 A;  4L76 A;  2A45 G;  3H1H D;  4Y99 C;  3M9Q A;  2D2C B;  2AXT E;  2QJP C;  3H1L J;  4JYC A;  1FDO A;  4GT1 A;  1FZC A;  5AW3 B;  3PTZ A;  3CXH I;  1AA0 A;  1E5W A;  1M1J B;  2AEJ A;  3RL0 g;  1K04 A;  3A0B E;  2OTL P;  4EIJ A;  3RK2 C;  3L35 A;  3RL0 C;  5KAF E;  3VMX A;  2WWW A;  1ZOY C;  4OGQ C;  5KJ7 D;  1SQP K;  4W80 A;  1KQL A;  4IOI H;  1LGH B;  3OAK A;  1GTW A;  1KTM A;  1PPJ E;  3QWO C;  3T97 B;  2AXC A;  2OYI C;  2OYH B;  1FDI A;  5B5E H;  2WPQ A;  4I1L A;  1T2K D;  2NPS D;  2K9J B;  1LJ2 A;  2E43 A;  4C7R A;  2FYU D;  1N7S D;  3V2N A;  2N1T C;  1IO4 A;  2C9L Y;  1M1J A;  5H2F E;  3VMZ A;  1VF5 C;  1MUU A;  1SQX E;  1S2E A;  1NTK E;  1FZA A;  3D70 A;  3V2Q A;  1NU1 D;  1HGV A;  1KB9 I;  2BCC J;  4GIF A;  2P7J A;  3HUS C;  1H0T A;  1KN7 A;  2FYZ A;  3T97 A;  1CI6 A;  4NPF X;  1P84 H;  3H1J D;  2OYH A;  1HUC A; 
#chains in the Genus database with same CATH homology
 3SWF A;  2KLV A;  2GUS A;  3BAS A;  3HTK A;  4IFD K;  2ZXE B;  2JEE A;  3G3Z A;  2L5G B;  1LTJ A;  1LTB C;  1NKN A;  1L4A B;  1N86 A;  1X8Y A;  2Q5U A;  2WSC H;  5APS A;  2IFM A;  1J1E C;  2OYI B;  4LC1 A;  3MUD A;  1NTM K;  3PP5 A;  2QM8 A;  1IFD A;  5AW5 B;  2KOG A;  3HD7 B;  3B5N D;  3TK1 A;  1OWA A;  1JY3 O;  1G2C B;  1JTH B;  5KJ7 A;  2XKM A;  3TYY A;  4AYC A;  2HYN A;  1HWT C;  3TSI A;  2W6B A;  1T3U A;  2N1T B;  1LWU B;  1GD2 E;  1GL2 D;  3VP9 A;  3P8C E;  2R3C A;  3HE5 B;  1GU5 A;  4XA4 A;  2WT7 B;  2CPB A;  1H89 A;  1KZU B;  4XE5 B;  2HOD B;  3IFM A;  5CCH C;  1S9K D;  1NAF A;  3UIA A;  3HUS B;  5AVS B;  1J1D B;  1NOH A;  1N73 C;  1FAV A;  4C46 A;  3BRT B;  2HLO A;  2N9B A;  1JO5 A;  1LTS C;  4W7Z A;  1L4A A;  1LT9 C;  2OYI A;  2IPP A;  3BRV B;  3V5B A;  1KFN A;  1ZR2 A;  2Q9I A;  1GK6 A;  3CLQ A;  1G2C A;  1JTH A;  4DOJ A;  2WZ7 A;  3E1I A;  1VDF A;  1CI6 B;  1A02 F;  2N1T A;  1FZF A;  2J58 A;  1LWU A;  2XDJ A;  2LKM A;  4GKG A;  2H8P D;  3HE5 A;  5AW7 B;  2P1J A;  4LGD E;  3RL0 D;  3KYQ A;  5BVZ A;  2WT7 A;  1J1E B;  1FDM A;  2BAS A;  3U1A A;  1FJP A;  2HOD A;  2C0W A;  1CZQ A;  3MTU E;  1FOS F;  1MZ9 A;  3HUS A;  1GU4 A;  2J59 M;  4WY4 C;  1L4A D;  4WBA A;  5AW6 B;  3P8C D;  3IR9 A;  2MJZ A;  1JY2 P;  4DZO A;  5APT A;  2Q7C A;  1HJB A;  1YYC A;  3NXS A;  2FFD C;  4HYT B;  1JY2 N;  4JF7 A;  1GW4 A;  1LTA C;  2GM4 A;  3VN0 A;  3KQG A;  2N1T D;  1JCD A;  4OH8 B;  3U59 A;  2Z5H A;  2ZFC A;  1YTZ I;  3M9H A;  1N73 B;  2W6A A;  1YTZ T;  3MGN A;  5AVU B;  1H8A A;  5CCG C;  2WSF H;  1LT9 B;  3M06 A;  2C9N Y;  3L4F A;  3KPE A;  3L36 A;  1JY3 P;  1NKZ B;  2YO2 A;  3M0A A;  3NMD A;  2R5B A;  1HGZ A;  4WB4 A;  1GZL A;  3A3Y B;  3A2A A;  1JY3 N;  1HH0 A;  2O01 H;  2KYV A;  5APU A;  1EQ7 A;  3CL3 D;  2Z4E A;  4N3Y B;  5APX A;  2YNY A;  1IFJ A;  1IFM A;  1ZN5 A;  1IJD B;  3M9B A;  2YO3 A;  2HFE D;  5CCG D;  3U1C A;  2M3B A;  1OXZ A;  1FZE A;  2WIT A;  1KIL C;  1RF1 C;  1VPC A;  3VTP C;  5CCH A;  2R5D A;  1MV8 A;  2QM7 A;  3WMM 0;  1M7L A;  1ZLL A;  2WPS A;  4WY4 B;  1N73 A;  4KHX A;  2IX7 C;  3GHG C;  2POH A;  1HTL C;  2P67 A;  3BAT A;  5AW2 B;  1ZV8 A;  1CSB A;  4ZKP A;  3II6 A;  1LT9 A;  1H88 A;  2FFD B;  1IK9 A;  1LTT C;  1J2J B;  2PP6 A;  1URQ C;  1NWQ A;  1GK4 A;  4LLH A;  1Z56 A;  4N78 D;  3EQ2 A;  3NTN A;  5KTB A;  2Q3I A;  1A02 J;  1JCC A;  3M0D C;  1QL2 A;  2GUV A;  1HVV A;  3BVH A;  5CCH D;  5CMZ A;  2KSJ A;  1FZG A;  4I6M C;  1RE3 C;  1GW3 A;  2KB7 P;  1URQ D;  3OJA B;  1SFC C;  4M3L A;  1RE4 C;  5APW A;  1WRG A;  1CW5 A;  3LW5 H;  2YKQ A;  4WY4 A;  1FZC C;  3V4Q A;  1LTI C;  1DH3 A;  2XU6 A;  1T2K C;  2XZR A;  3KDP B;  2NPS C;  3C9I A;  4IFF A;  1FZB A;  3HE4 B;  2FFD A;  1N7S C;  3H32 B;  1L0L K;  5AW1 B;  1IC2 A;  2WTY A;  5AW9 B;  1KIL B;  1RF1 B;  3O8Z A;  1SFC D;  3H6P A;  3CI9 A;  5AVW B;  2Z5I A;  2JJL A;  2W27 A;  4ZKU A;  1RF0 A;  2A45 I;  2O1K A;  3NFQ A;  3P7K A;  3GHG B;  2O1J A;  2YMY A;  4AQR D;  5AVT B;  2IFN A;  5CCG A;  5BU8 B;  3N4X A;  4I2L C;  5APQ A;  1RF0 C;  1URQ B;  2FYU K;  3A5T A;  4IFM A;  4WY4 D;  5CJ0 A;  2FKW B;  3VOP A;  2M8R A;  1XTC C;  2YKO A;  5CJ4 A;  5BU5 A;  2HPC B;  1GDT A;  2C0X A;  3B8E B;  2A45 H;  1NU1 K;  1NO4 A;  1S9K E;  2P2U A;  2PAJ A;  1M1J C;  3HE4 A;  5AVV B;  3OA7 A;  1N2D C;  3H32 A;  3I5C A;  3SWY A;  1NH4 A;  5AVX B;  1SLQ A;  5APV A;  1KIL A;  3A7O A;  4O9B A;  1RF1 A;  1SFC B;  3R2P A;  2WSE H;  1AFO A;  1HBW A;  1SP4 A;  1N7L A;  1FZC B;  1QL1 A;  3P8M C;  3GHG A;  3B5N C;  3MIW A;  3M91 A;  1DEB A;  2NPS B;  2KP8 A;  4W7Y A;  5AW4 B;  2VRS A;  1JOC A;  3EFG A;  1N7S B;  3HRN A;  1JMM A;  2H7H A;  1URQ A;  1WT6 A;  1GL2 C;  1W2E A;  5AVY B;  2OYH C;  1X79 B;  3RK3 C;  5AVR B;  2I1K A;  2A45 G;  1NTZ K;  1SQB K;  2HPC A;  4AUW A;  1L0N K;  3M0D A;  4Y99 C;  3M9Q A;  1KIL D;  2FXM A;  4C7N B;  1LTJ C;  1FJK A;  5APY A;  4EOT A;  1RE3 A;  3TNU B;  5CHX A;  1RY3 A;  4JYC A;  1SFC A;  1SQQ K;  3L37 A;  1T8Z A;  1RE4 A;  3RK3 D;  4GT1 A;  1SQX K;  1FZC A;  5AW3 B;  5KJ7 C;  1NTK K;  2OAR A;  3N7N A;  1JNM A;  1E5W A;  1FU1 A;  1LTG C;  2NPS A;  1IFN A;  1M1J B;  2YKP A;  1N7S A;  1SVF A;  1DX7 A;  4EIJ A;  3RK2 C;  2XV5 A;  1G1I A;  2HG5 D;  4RES B;  3VMY A;  3L35 A;  3RL0 C;  5KLV K;  1X9V A;  1T3J A;  3VMX A;  2WWW A;  1PFI A;  5KJ7 D;  1JUN A;  5AW8 B;  3HD7 A;  2WPR A;  1SQP K;  3B5N B;  4W80 A;  1KQL A;  1FOS E;  1LGH B;  3OAK A;  4HH2 A;  1GTW A;  1FBM A;  4C7N A;  1L4A C;  1G1J A;  3V2P A;  3TNU A;  3RK2 D;  1GL2 B;  2OYI C;  2OYH B;  1AQ5 A;  1XTG B;  3RK3 B;  3VYI A;  3HD7 C;  2WPQ A;  4I1L A;  1T2K D;  2NPS D;  3HTK B;  2H43 A;  4B86 A;  2E43 A;  4C7R A;  2XNX A;  1N7S D;  3V2N A;  3LID A;  2N1T C;  3MD0 A;  1IO4 A;  1MFZ A;  3P32 A;  2C9L Y;  1M1J A;  1LWU C;  4Y99 B;  2I1J A;  3VMZ A;  1LTJ B;  1NHL A;  1ZR4 A;  1MUU A;  1KFM A;  1SQV K;  1FZA A;  2CPS A;  2R32 A;  3V2Q A;  3V4W A;  3HD7 D;  1HGV A;  4N6J A;  4GIF A;  2P7J A;  3HUS C;  3B5N A;  3LIE A;  1J1D C;  3VP8 A;  3V2R A;  5AVQ B;  2FYZ A;  5AVZ B;  4N78 E;  3T97 A;  1IFI A;  1CI6 A;  4JYB A;  3RK2 B;  1GL2 A;  1JY2 O;  5AW0 B;  2OYH A;  3RL0 B;  1HUC A;  2E42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...