2Q5UA

Crystal structure of iqn17
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Fusion protein between yeast variant GCN4 and HIVgp41
publication title Inhibiting HIV Entry: Discovery of D-Peptide Inhibitors that Target the Gp41 Coiled-Coil Pocket
pubmed doi rcsb
total genus 21
structure length 45
sequence length 45
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2q5uA00
3P7KA 2QM8A 1JNMA 2XZRA 3KQGA 2N9BA 2WPQA 3T97A 5AVTB 5AVWB 3P8MC 3VMXA 2C9NY 3TK1A 2KP8A 2R3CA 2R5DA 5APQA 5CMZA 1H8AA 2H7HA 1HWTC 4AUWA 3HTKA 4M3LA 3M91A 1JUNA 2YO2A 3L37A 5APUA 3A5TA 1GU5A 5AVXB 2WPSA 2P7JA 3L36A 4JYCA 3TNUB 2WWWA 2Q7CA 3HE4B 2YO3A 2Z5IA 3OAKA 2IPPA 5AW7B 3A7OA 2Z5HA 1FOSE 3IR9A 2WTYA 4B86A 4KHXA 5AVVB 4XE5B 4C7NA 3A2AA 2VRSA 3L35A 1G2CB 3V5BA 3B8EB 3VYIA 2Q5UA 4HYTB 1GU4A 1FAVA 3LIDA 5AVUB 4JYBA 5AW9B 5AVSB 5AW4B 1HBWA 3M06A 1MUUA 2E42A 3VTPC 3UIAA 2R32A 2JJLA 1S9KE 5APSA 2W27A 1KQLA 4I2LC 3V4WA 4C46A 4AQRD 4RESB 5AVZB 3MD0A 4GKGA 5AW8B 3A3YB 1SLQA 4AYCA 1A02F 4C7NB 3I5CA 3M9BA 2R5BA 2QM7A 2YNYA 3NTNA 2E43A 4LC1A 3VMZA 1X8YA 5AW1B 3V4QA 1CSBA 5AVYB 1J2JB 2XU6A 5APVA 3NMDA 5APWA 1GK6A 5AVQB 1GTWA 1T2KD 1HJBA 1CI6A 2BASA 5APTA 3TYYA 5AW6B 3NFQA 2ZFCA 3M0DA 5AW5B 3MGNA 4GT1A 2WPRA 3VN0A 1FOSF 3O8ZA 1NWQA 1GK4A 2P2UA 3KDPB 2XV5A 1DH3A 3LIEA 5APXA 3M0AA 3NXSA 1SP4A 2ZXEB 1MV8A 3SWFA 2WT7B 5APYA 3HE5B 5AW3B 1GZLA 3VMYA 1OWAA 1CI6B 1YYCA 4DZOA 4I6MC 2WT7A 2C9LY 3HE5A 5AW0B 5AW2B 1GD2E 1NAFA 3P32A 1H88A 1MFZA 1H89A 1T2KC 4EOTA 2P67A 1HUCA 2Q3IA 1IO4A 1S9KD 3M9HA 1CZQA 2W6AA 1OXZA 1A02J 5AVRB 3TNUA 3HE4A
chains in the Genus database with same CATH superfamily
3JCUE 3N7NA 1CW5A 1PP9D 3CWBG 3CXHH 2FYUJ 1BE3G 3II6A 1DD3A 1SFCA 3H1KG 1RF1B 4PJ0H 1KC8Q 1LTIC 4I7ZC 3RK2C 5KAFH 1RQUA 1JY2O 4R4MA 1M7LA 5CCGC 1EZVG 1Q82Q 1Z56A 3CLQA 1M1JC 4H0LC 3BCCG 2JJLA 2YIUC 1VQ5P 2A06E 1GW4A 1WMKA 1YITP 5CBNA 1J1DC 4RESB 1P84I 5AW8B 2IDBA 4L76A 1OMIA 1LTBC 1NU1G 3C1LA 3L71J 3O6QA 5AVYB 1NKNA 2IX7C 3S9OA 1JTHA 2IZ0A 2H89C 3CI9A 4TLFA 3E7KA 3PTZA 2QIWA 1PGPA 2BEZF 1YQ4C 1NOHA 4A7PA 4D6TG 3L72G 1FZCA 1VQKP 3D70A 1VQMP 3SSUA 3AECC 3M0DC 2W6AA 3KZIH 4U7JA 2YMKA 1IK9A 3SWYA 3HUSC 3A0HH 3KXDA 1KD1Q 4UB6H 2P10A 1KZUB 1GL2C 3L70J 1BGYJ 3CC2P 3K5BA 2P7JA 1LTSC 1NH4A 1W2BO 1K04A 1FU1A 2AXTE 1RF1C 5KAIH 2KS1B 1HJ0A 1JY3O 2B87B 3UIAA 2M3BA 1FZEA 2WSSH 5KLIB 1A02F 1QL2A 4N78D 1JY2N 2HPCA 1SQXE 2YNYA 1Y47A 5AW1B 1KB9D 3GHGB 1ZN5A 4OVNF 4ZKPA 1S72P 1AFOA 3C9IA 2OTJP 1KFMA 3H1HJ 3AE7C 3SWKA 2KYVA 2JKVA 1DEBA 4L73A 3AE2C 1OW6A 5APYA 1BCCD 1U7JA 2V4HA 1LT9A 5B5EE 3HD7A 4I6MC 2E76D 1UIXA 5AW2B 2OYIA 3P32A 3ABVC 1KILE 5CCHC 2OGUA 2P67A 2XDJA 2I1KA 1DEEG 3G6EP 1TU3F 1PPJE 5CJ0A 3CCSP 3H1JE 3RL0D 1FDOA 2N9BA 1H0TB 2E76B 3CX5E 5BU5A 1IK7A 2L91A 5APUA 3L71D 1GU5A 1SFCD 1Q86Q 2IPPA 5AW7B 1P84D 3RL0B 2RN0A 4U3FE 3U1AA 1DX7A 1BCCG 2ZJSE 2VRSA 1G2CB 3B8EB 2Q5UA 5AW4B 1SFCB 3M06A 3P8CE 1NTKK 4IFDK 3FX0A 2KNCB 1FJKA 1N86A 3F89A 1EXJA 5B66H 3I56P 3GW6A 5BU8B 2WSEH 1N8RQ 5DJUB 3OW2O 2IBZI 5KLIC 2K37A 1LGHB 1YI2P 3L71G 4LGDE 1SQBE 1T6AA 3GHGC 2FKWB 1IFDA 4WY4A 3Q1MA 3L70D 2ZT9C 1JO5A 2KXPB 3AE3C 1DIPA 3NXSA 3O6QB 4Y28J 1VQLP 2H8PD 1M8OB 4GDOA 1HUCA 3WUUA 2HG5D 1ZOYC 1DD4A 1NTZJ 2QEXP 1KQGB 2Z4EA 3IN6A 2QJKC 2Q9IA 1OVVA 2FYUK 1L0NE 1RE4A 3M91A 5C39A 3L37A 1ZR4A 2GA1A 3CC7P 3TGUE 3AE9C 1NTMD 2D2CD 1N7SA 2SPZA 4XE5B 1U57A 3H1HD 1SQPE 1RY3A 3RL0g 3KHUA 3VTPC 1PGQA 4QMAA 4EDFA 1YJWP 1S3JA 1RF0A 2D2CB 3IAOA 2PP6A 1SFCC 5GTIH 4ZKUA 3FWLA 1VQ6P 1SQQJ 3L74E 1VQ4P 1UIIA 3GG2A 2QSIA 4H44D 4WB4A 3HRNA 1M56D 3L73J 1NTMG 3U59A 3CMAP 2HPCB 2HFED 3CWBE 1PGJA 3HE5B 3M9QA 4H44B 1AVYA 4IL6X 3IF4A 1URQD 1FBMA 3H1KE 4OGQC 3S1KA 2W6BA 3V2RA 2OTLP 1EZVE 1ZP0C 4JQ0D 1LT9B 1L0LG 2AEJA 1M57D 4BRYB 5KKZB 2OYIB 1URQB 1J1EB 3W68A 2Y9ZA 1OW8A 3TDKA 1FZCC 3CC4P 1NU1E 2Q1KA 1S5LE 1KN7A 1JOCA 3R4YA 1X79B 2FXMA 2KS1A 1S9KE 2O1KA 2B87A 1Y9BA 1K05A 4NPDA 2CPSA 2NZ2A 5KLVJ 2D2CC 4IL6H 3AEDC 4LC1A 2KB7P 3L75J 2WSFJ 4D6TE 3L72E 1NTZD 3FWNA 1AV1A 2WZ7A 5AW6B 4WY4D 5AW5B 3CL3D 1KTMA 3KDPB 1FDMA 3LIEA 3GF3A 1KYOE 1X0TA 2IBZG 1YJ9P 2Y0CA 2O3JA 2M0BA 2OQQA 4WY4B 3KPEA 5KJ7D 3OJAB 1R5LA 3VOPA 3USSA 1W2EA 2GM4A 2KIKA 1KORA 2FFDA 1Y8AA 4K35A 5TJHA 2WPVB 1SQQD 3MTUE 4AUWA 2OYOA 3HD7C 5L8RJ 1VF5D 3PRJA 1LTJA 1N7SD 3L73D 1AQ5A 2PRRA 1PZQA 1IFJA 3Q5SA 1SQBK 1G2CA 1VF5B 3CXHE 1LJ2A 1X9VA 5APSA 1VPCA 4PV1C 1N7SB 2XNXA 4XFJA 2YXRB 2KNCA 3CCJP 4PJ0E 1BDDA 2E43A 5KAFE 4HKZH 1ZRTD 4Y99C 2P58A 1T2KD 2I1JA 1EDJA 1KB9H 2XV5A 3L73G 2N1TD 4H13D 2ZXEB 1K8AQ 1PP9G 4O9BA 2CPBA 3RK3D 3CCEP 4NPFX 3G3ZA 2OYHB 2ZAEB 1FZAA 3MIWA 2N1TB 4WY4C 4H13B 1BCCE 4R4LA 1NTZK 2E5YA 2G8YA 5KLVD 1SQPK 3RK3B 3MUDA 3TK1A 1FJPA 3AEFC 2POHA 2HYNA 1NTKD 1EXIA 5AVVB 3KZIE 1FE6A 2KLUA 4PD4I 3G71P 2JR8A 3E1IA 3A0HE 4YXWH 1T3JA 1P84H 2V7QJ 4TT3H 4UB6E 1RE4C 3BASA 1P84E 3H1LD 1KILA 2ZYGA 1W5CE 1VF5C 1SQXJ 1YQ3C 1WT6A 3M9BA 1SQQK 1N7SC 4ASWA 3WU2H 1J2JB 3NMDA 1Q2NA 1Q7YQ 3Q5RA 5KAIE 3OA7A 1CI6A 3EFFK 2KZIA 3NFQA 3C8VA 1NTKG 1FOSF 1NWQA 2QA4P 5APXA 2QVAA 1HGVA 5AW3B 1AQTA 3HE5A 5AW0B 2BCCE 3AEAC 1OFCX 4YPCA 1T2KC 3H1LG 2FYUD 3H1IE 2A06D 2H88C 3H1JJ 3BATA 3MHVA 2FXOA 2XZRA 1USDA 1JCDA 3TF5A 3D6ZA 2MKVA 4M3LA 4BRYA 1URQA 5AVXB 3FXEA 4EI2A 1LNQA 3JC22 2Q7CA 4DCKA 4U3FJ 3PHLA 3Q2YA 2FFDB 2KSEA 5CBOA 3AE8C 2IFNA 3A2AA 5GTHH 2WSCH 3KYQA 5AVUB 5M1BA 1NTME 1LTJB 2FYUG 4I2LC 5H2FH 5AVZB 2ZVNB 5KLVK 3CCRP 3G9RA 3Q5PA 1E79H 4DOJA 1NHLA 2QJYB 2PGDA 1SQBJ 3BVHA 2KUBA 2Q6QA 1N73B 3VMAA 4GT1A 3VP9A 3O8ZA 1S4XA 1L0LE 2NRGA 5B66E 1QEXA 4DJGA 1HTLC 3LW5J 1JY3N 1IFIA 1MFZA 2G3AA 2LXBA 2FYNB 2Q3IA 3BRTB 1BGYD 1JEKA 1SQVJ 1GMJA 1VQ9P 1L0NJ 1SQXD 4PD4D 1KQFB 3TGUJ 2WPSA 5KJ7A 2YXQB 4RKUJ 1QLED 1NGMB 1FDIA 1SQPJ 4N6JA 3PH0A 1OIPA 1SQVE 4OH8B 2FFDC 4W7ZA 2YKOA 1GU4A 2E76C 3V4WA 1KILD 4GIFA 3L70G 1BGYG 4GKGA 3L74J 1NVOA 1LTJC 1PGOA 2I8DA 5DJTB 2IBZE 1PPJD 1GL2A 1MKMA 2Q3EA 3RL0C 3AEEC 1KILB 5K5GB 5TISH 2ZFCA 2QJYC 4L74A 2WITA 3CCQP 2KLVA 2RMZA 3FXDA 1GK4A 3CWBJ 2AEMA 1SP4A 5GTIE 4NPEA 3B5NA 3PLNA 2HR3A 1YHQP 1CI6B 3H1KJ 3CCMP 1RH5B 1LP1B 2K88A 2AEFA 3PP5A 1L2PA 3M9HA 1CZQA 2OYHA 3H32A 5AVRB 3HE4A 4ZNCA 4KJMA 2OARA 2N1TA 2QJPB 1S5LX 5KTBA 5AVTB 1L4AD 1BE3E 2B89A 3H1HG 2R3CA 1VQNP 3AEGC 1K9MQ 3A5TA 3V2NA 1NU1J 1SQBD 1LTGC 4GOFA 1VQ8P 1OW7A 1L4AB 2E75D 4BWNA 1T3UA 2N9YB 3CCLP 1LTTC 4HYTB 1FAVA 4YTPC 1JY2P 3MUDC 5AVSB 1KMIZ 3QWOC 1IFMA 2E42A 2NPSA 3BCCE 1MZ9A 3BRVB 1IFNA 1S2EA 1IZNB 3MD0A 2E75B 1SQXK 1PP9E 2R5BA 3N4XA 4D6TJ 3L72J 1S1CX 1KYOI 2XU6A 3JSVC 2FBWC 1PL5A 3RGUA 4HH2A 2ZYAA 1SQBG 3TGUD 3IFMA 1ZLLA 4IFMA 1JCCA 1ZRTE 4RJTA 1BSHA 3PJSK 4H0LD 4IL6E 1LT1A 1RE3A 4I7ZB 4OWFA 1SQPD 1G1JA 2J59M 4EOTA 2HLOA 1OZHA 2HODB 1M1JB 3F5HA 4H0LB 5E79H 1EDIA 2YKPA 4W80A 2YIUB 2UWJE 3V6IA 2KP8A 1H8AA 1J1DB 1JMMA 3V2PA 1GW3A 1EDKA 2J5UA 4LLHA 1T8ZA 1Q90D 3CXHI 4XA4A 4H44C 2FY8A 4MN4C 3V2QA 3A7OA 3IR9A 2OTKE 2W8ZA 4C7NA 3L35A 3V5BA 4Z1MH 1QX8A 2W83C 1QVFO 1NTZG 3LIDA 2O01H 4JYBA 4UB8H 1LT9C 1FZBA 1SQPG 2JO1A 1NTKE 5KKZC 2OYIC 1URQC 3A0BH 1QGKB 1YBKA 1J1EC 1JY3P 2JDIH 3A3YB 2LR2A 1EZVD 2M8RA 1GL2D 1MFTA 4IOIH 1VDFA 2IYOA 3H1LE 1HJBA 3TYYA 1VQ7P 1EDLA 3HUSB 2WPRA 1N73A 2PFXA 3JCUH 4N3YB 2R44A 1FS0E 4KT0J 2K9YA 1GL2B 1NU1D 1MV8A 2IZ1A 3B5ND 2ZXXA 1SQQG 1H88A 2K9JB 3CCUP 3GF7A 1BCCJ 4N78E 1S9KD 1OXZA 1OVRA 2PAJA 3H25A 2KOGA 3B5NB 1OX3A 1KB9E 2WPQA 1SQVK 2KK7A 1L0NK 1NYHA 4L75A 3HTKA 2FYUE 4D6TD 3L72D 4JF7A 2H43A 4EIJA 2YMYA 4HJGH 3L36A 1HVVA 3H32B 3HE4B 2KZJA 2LXCB 4GODA 1KYOD 5CCHD 2NPSD 2R3SA 3QH9A 3L75D 4C46A 4WWIA 5KJ7C 2FXPA 2M5AA 3SFDC 1N2DC 2NPSB 3L71E 1ZR2A 1VQPP 3AE1C 1YIJP 2BASA 5APTA 2JWDA 3AE5C 3MGNA 4JBZA 3VP8A 4HB1A 5KLVG 4C7RA 1GZLA 2BCCJ 4DZOA 1M90Q 2C9LY 3WU2E 3SFEC 1RHZB 2A45I 3H1IJ 3L75G 1H89A 3CXHD 1XTCC 2AXTH 1LP1A 1EQ7A 1RF0C 2KSJA 3T97B 3TNUA 2QM8A 1HF9A 2C0WA 5AVWB 3H6PA 1M1KQ 1JMBA 1SVFA 1NAYA 3B5NC 2V7QH 1HWTC 3CX5I 3AE6C 2J58A 1D7MA 1GDTA 2ZT9D 3MP7B 3L70E 1BGYE 1R5SA 2WWWA 1IFPA 1NU1K 2YO3A 2Z5IA 4PD4H 2Z5HA 1HH0A 2Y0DA 2OYHC 1LWUA 4PD4E 2ZVOB 1VL2A 2N1TC 4ASVA 1L4AA 4H13C 1NTMJ 3U1CA 3FGAD 2ZT9B 5AW9B 2WSCJ 1WRGA 3RK3C 1E5WA 3TSIA 1PV3A 2K3RA 1XTGB 1YTZI 4AQRD 2W90A 1EC5A 1PFIA 4C7NB 5B5EH 2A45H 1G1IA 4BXLA 1FC2C 5APWA 5GTHE 1AVOA 2NPSC 3GLMA 1L0LJ 3EFGA 2A06G 2QJKB 3CX5H 2E5TA 2WVRA 3CCVP 5H2FE 3H1HE 3L4FA 2WSEJ 2WT7B 2L5GB 1JM0A 3AEBC 5CHXA 1OWAA 1YYCA 4JPZB 1GD2E 1NAFA 3EQ2A 4GOEA 1NKZB 5CCGA 3P7KA 3AE4C 2YKQA 2HODA 1M1JA 2R5DA 1Q81Q 1IJDB 1JUNA 2YO2A 1RE3C 3WUVA 4IFFA 4WVZA 3S4RA 2WTYA 3G4SP 2AXCA 3HTKB 4OGQD 2JWAA 1MUUA 2R32A 2BCCD 2W27A 1KQLA 4K3AA 1SLQA 4AYCA 3H1ID 4WBAA 3NTNA 3VMZA 2E74D 1JTHB 1X8YA 4OGQB 3V4QA 1FZGA 4EYYQ 5APVA 3WMM0 3LW5H 5AVQB 1GTWA 3M0DA 2CK3H 2M5AB 1KQSO 2P2UA 1KFNA 3GMAA 3HUSA 1VQOP 2E74B 1BDCA 1SQXG 3RBXA 1FZCB 3H1JD 1RQVA 1SS1A 2MJZA 3CX5D 1OVUA 2BCCG 2FYZA 4YXDC 1IO4A 2K9JA 5TISE 3H1IG 1RF1A 1N73C 1AJYA 1ZMEC 1JNMA 1BE3J 1USEA 1EZVI 1NTZE 4U3FD 3P8MC 3VMXA 2C9NY 2H7HA 2A45G 2RH0A 1ZXGA 2WQYC 3MZWB 3P8CD 3TNUB 1HGZA 1PIXA 2XNDH 1ZW0A 1L0LD 1PPJG 4ZMDA 2FYNC 3H1JG 3VYIA 3BCCJ 5CJ4A 2RKLA 1FZFA 1HBWA 1NJIQ 1QVGO 2ZYDA 1KV4A 3CD6P 2QG4A 1LWUB 1PP9J 2B88A 3I5CA 2IFMA 3ITKA 4U3FG 2GUSA 1SQQE 3HD7D 1CSBA 3R2PA 1GK6A 5CCHA 2W6JH 3L73E 4CPGA 1NO4A 1YTZT 3M0AA 3HD7B 2KI7B 2JP3A 4I1LA 3VMYA 2C0XA 2E74C 1SQVD 3W67A 4PV1D 3I55P 1JB0J 1L0ND 3RK2D 2DW3A 1S5LH 2O1JA 1A02J 3D6YA 5CCGD 1KILC 3KQGA 3T97A 2BEQD 3ZDMA 2P1JA 2IBZD 4RO0A 4PV1B 5APQA 5CMZA 5BVZA 1QL1A 3RK2B 1N7LA 1X22A 4JYCA 2WMMA 1K73Q 3OAKA 3B71A 1FOSE 4Y99B 4B86A 4KHXA 3RK3E 1ZV8A 3L74D 5EFWB 5E79E 1SQVG 1NTMK 1NTKJ 2O01J 3GHGA 2K1AA 2QJPC 2ITAA 1L0NG 3CMEP 1YJNP 2O01N 3TGUG 3EWKA 1KYOH 4W7YA 5KLVE 3CPWO 2JEEA 2LKMA 2QM7A 3B4SA 1LWUC 2WSFH 3CWBD 3H1LJ 1IC2A 1R8EA 2Y9YA 1BE3D 3L75E 1L4AC 1LTAC 4UB8E 3RBZA 3H1KD 3VN0A 4DT0A 1L0LK 1DH3A 2XKMA 2M3EA 2B9BA 3E1RA 3A0BE 2IYPA 2Y0EA 3SWFA 1KB9I 2GUVA 3L74G 2E75C 1U7MA 2WT7A 1AA0A 1H0TA 1BSNA 3WUTA 3BCCD 3D71A 3Q3DA 2QE7H 2QRXA
chains in the Genus database with same CATH topology
2QM8A 1LT9B 2C0WA 3N7NA 1CW5A 5AVWB 3H6PA 1SVFA 2OYIB 1URQB 3B5NC 3II6A 1HWTC 1J1EB 2J58A 1GDTA 2WPSA 5KJ7A 1SFCA 1FZCC 1RF1B 2WWWA 1LTIC 1NU1K 2YO3A 2Z5IA 3RK2C 2Z5HA 1JY2O 1HH0A 2OYHC 1LWUA 1M7LA 5CCGC 4N6JA 1JOCA 2N1TC 4OH8B 1L4AA 1Z56A 2FFDC 4W7ZA 1X79B 3CLQA 2YKOA 1GU4A 3U1CA 2FXMA 5AW9B 1M1JC 1WRGA 3RK3C 1E5WA 2JJLA 2O1KA 3TSIA 1S9KE 1GW4A 3V4WA 1KILD 1XTGB 2CPSA 1J1DC 1YTZI 4GIFA 4RESB 4AQRD 4GKGA 5AW8B 1PFIA 1LTJC 4C7NB 1LTBC 2A45H 1G1IA 4LC1A 1GL2A 2KB7P 5AVYB 3RL0C 1NKNA 5APWA 2IX7C 1JTHA 2WZ7A 1KILB 5AW6B 2ZFCA 2NPSC 4WY4D 5AW5B 2WITA 3CL3D 3CI9A 3EFGA 2KLVA 1GK4A 3KDPB 1FDMA 3LIEA 1SP4A 3L4FA 2WT7B 3B5NA 2L5GB 5CHXA 1OWAA 1CI6B 1YYCA 1NOHA 1GD2E 1NAFA 4WY4B 1FZCA 3KPEA 5KJ7D 3OJAB 3EQ2A 3PP5A 3VOPA 3M0DC 3M9HA 1CZQA 2W6AA 2OYHA 1W2EA 2GM4A 1NKZB 3H32A 5AVRB 5CCGA 3HE4A 3P7KA 2OARA 1IK9A 2N1TA 2YKQA 3HUSC 3SWYA 2FFDA 5KTBA 5AVTB 1L4AD 2HODA 1M1JA 2R3CA 2R5DA 3MTUE 1IJDB 4AUWA 1KZUB 1GL2C 1JUNA 2YO2A 3HD7C 1RE3C 3A5TA 4IFFA 3V2NA 2P7JA 1LTSC 1NH4A 1LTGC 1LTJA 1FU1A 1N7SD 1AQ5A 2WTYA 1L4AB 1RF1C 1T3UA 3HTKB 1IFJA 1LTTC 4HYTB 1FAVA 1SQBK 1JY3O 1JY2P 5AVSB 1G2CA 1IFMA 1MUUA 2NPSA 2E42A 1MZ9A 3UIAA 2R32A 1X9VA 2W27A 5APSA 1KQLA 3BRVB 2M3BA 1FZEA 1VPCA 1IFNA 1N7SB 2XNXA 3MD0A 1SLQA 4AYCA 1A02F 1QL2A 1SQXK 4N78D 1JY2N 4WBAA 2HPCA 2R5BA 3N4XA 2YNYA 3NTNA 2E43A 3VMZA 1JTHB 1X8YA 5AW1B 3V4QA 1FZGA 3GHGB 1ZN5A 2XU6A 5APVA 3WMM0 3LW5H 4Y99C 5AVQB 1GTWA 1T2KD 2I1JA 4HH2A 4ZKPA 3M0DA 1AFOA 3C9IA 2P2UA 2XV5A 3IFMA 1KFMA 1KFNA 1ZLLA 3HUSA 2KYVA 2N1TD 1DEBA 4IFMA 2ZXEB 1JCCA 5APYA 1LT9A 4O9BA 2CPBA 1FZCB 3HD7A 3RK3D 1RE3A 4I6MC 2MJZA 5AW2B 2OYIA 1G1JA 3P32A 3G3ZA 2J59M 2OYHB 2FYZA 5CCHC 4EOTA 2P67A 1FZAA 2XDJA 3MIWA 1IO4A 2I1KA 2HLOA 2N1TB 4WY4C 1RF1A 1N73C 2HODB 5CJ0A 1JNMA 1M1JB 1NTZK 3RL0D 2N9BA 3RK3B 1SQPK 2YKPA 4W80A 3P8MC 3VMXA 3MUDA 5BU5A 2C9NY 3TK1A 2KP8A 2H7HA 1H8AA 1J1DB 1FJPA 1JMMA 3V2PA 1GW3A 5APUA 1GU5A 2A45G 2POHA 2HYNA 1SFCD 1T8ZA 4LLHA 4XA4A 3P8CD 3TNUB 1HGZA 3V2QA 2IPPA 5AW7B 3A7OA 3RL0B 3IR9A 3U1AA 1DX7A 5AVVB 4C7NA 2VRSA 3L35A 1G2CB 3V5BA 3B8EB 3VYIA 2Q5UA 5CJ4A 3E1IA 3LIDA 2O01H 4JYBA 1FZFA 1LT9C 1FZBA 5AW4B 1SFCB 3M06A 1T3JA 3P8CE 1HBWA 1NTKK 1RE4C 3BASA 4IFDK 2OYIC 1FJKA 1URQC 1N86A 1KILA 1J1EC 1LWUB 1JY3P 3A3YB 1WT6A 5BU8B 2WSEH 3I5CA 3M9BA 1SQQK 1N7SC 2IFMA 2GUSA 2M8RA 1GL2D 3HD7D 1CSBA 3R2PA 1J2JB 3NMDA 1LGHB 1GK6A 1VDFA 5CCHA 3OA7A 1HJBA 1CI6A 4LGDE 3TYYA 3NFQA 3GHGC 2FKWB 1IFDA 3HUSB 4WY4A 2WPRA 1N73A 1FOSF 1NWQA 4N3YB 1NO4A 1JO5A 5APXA 1YTZT 3M0AA 1GL2B 3NXSA 3HD7B 1HGVA 1MV8A 3B5ND 5AW3B 4I1LA 3VMYA 2C0XA 2H8PD 3HE5A 5AW0B 1H88A 1T2KC 3RK2D 1HUCA 2HG5D 4N78E 1S9KD 1OXZA 2O1JA 2PAJA 1A02J 5CCGD 3BATA 2KOGA 3B5NB 1KILC 2XZRA 3KQGA 2WPQA 1SQVK 2Z4EA 3T97A 1JCDA 2P1JA 2Q9IA 1L0NK 5APQA 5CMZA 2FYUK 5BVZA 1RE4A 3HTKA 1QL1A 3M91A 4M3LA 3L37A 4JF7A 3RK2B 2H43A 1N7LA 1URQA 5AVXB 2YMYA 4EIJA 1ZR4A 3L36A 4JYCA 1HVVA 3H32B 2Q7CA 3HE4B 3OAKA 1FOSE 1N7SA 2FFDB 4Y99B 4B86A 4KHXA 4XE5B 2IFNA 3A2AA 1ZV8A 1RY3A 2WSCH 3KYQA 1NTMK 5AVUB 5CCHD 2NPSD 3GHGA 3VTPC 1RF0A 1LTJB 4I2LC 4C46A 2PP6A 5KJ7C 1SFCC 5AVZB 4ZKUA 5KLVK 4W7YA 2JEEA 2LKMA 2QM7A 4DOJA 1NHLA 1N2DC 1LWUC 2WSFH 2NPSB 1IC2A 1ZR2A 3BVHA 1L4AC 4WB4A 1LTAC 3HRNA 1N73B 2BASA 5APTA 3MGNA 3U59A 4GT1A 3VN0A 3VP9A 3O8ZA 1L0LK 2HPCB 1DH3A 2XKMA 2HFED 3VP8A 3SWFA 4C7RA 3HE5B 1GZLA 2GUVA 3M9QA 1HTLC 4DZOA 2WT7A 2C9LY 1URQD 1FBMA 1JY3N 2A45I 1IFIA 1MFZA 1H89A 2W6BA 3V2RA 1XTCC 2Q3IA 1EQ7A 3BRTB 1RF0C 2KSJA 3TNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P7K A;  2QM8 A;  1JNM A;  2XZR A;  3KQG A;  2N9B A;  2WPQ A;  3T97 A;  5AVT B;  5AVW B;  3P8M C;  3VMX A;  2C9N Y;  3TK1 A;  2KP8 A;  2R3C A;  2R5D A;  5APQ A;  5CMZ A;  1H8A A;  2H7H A;  1HWT C;  4AUW A;  3HTK A;  4M3L A;  3M91 A;  1JUN A;  2YO2 A;  3L37 A;  5APU A;  3A5T A;  1GU5 A;  5AVX B;  2WPS A;  2P7J A;  3L36 A;  4JYC A;  3TNU B;  2WWW A;  2Q7C A;  3HE4 B;  2YO3 A;  2Z5I A;  3OAK A;  2IPP A;  5AW7 B;  3A7O A;  2Z5H A;  1FOS E;  3IR9 A;  2WTY A;  4B86 A;  4KHX A;  5AVV B;  4XE5 B;  4C7N A;  3A2A A;  2VRS A;  3L35 A;  1G2C B;  3V5B A;  3B8E B;  3VYI A;  2Q5U A;  4HYT B;  1GU4 A;  1FAV A;  3LID A;  5AVU B;  4JYB A;  5AW9 B;  5AVS B;  5AW4 B;  1HBW A;  3M06 A;  1MUU A;  2E42 A;  3VTP C;  3UIA A;  2R32 A;  2JJL A;  1S9K E;  5APS A;  2W27 A;  1KQL A;  4I2L C;  3V4W A;  4C46 A;  4AQR D;  4RES B;  5AVZ B;  3MD0 A;  4GKG A;  5AW8 B;  3A3Y B;  1SLQ A;  4AYC A;  1A02 F;  4C7N B;  3I5C A;  3M9B A;  2R5B A;  2QM7 A;  2YNY A;  3NTN A;  2E43 A;  4LC1 A;  3VMZ A;  1X8Y A;  5AW1 B;  3V4Q A;  1CSB A;  5AVY B;  1J2J B;  2XU6 A;  5APV A;  3NMD A;  5APW A;  1GK6 A;  5AVQ B;  1GTW A;  1T2K D;  1HJB A;  1CI6 A;  2BAS A;  5APT A;  3TYY A;  5AW6 B;  3NFQ A;  2ZFC A;  3M0D A;  5AW5 B;  3MGN A;  4GT1 A;  2WPR A;  3VN0 A;  1FOS F;  3O8Z A;  1NWQ A;  1GK4 A;  2P2U A;  3KDP B;  2XV5 A;  1DH3 A;  3LIE A;  5APX A;  3M0A A;  3NXS A;  1SP4 A;  2ZXE B;  1MV8 A;  3SWF A;  2WT7 B;  5APY A;  3HE5 B;  5AW3 B;  1GZL A;  3VMY A;  1OWA A;  1CI6 B;  1YYC A;  4DZO A;  4I6M C;  2WT7 A;  2C9L Y;  3HE5 A;  5AW0 B;  5AW2 B;  1GD2 E;  1NAF A;  3P32 A;  1H88 A;  1MFZ A;  1H89 A;  1T2K C;  4EOT A;  2P67 A;  1HUC A;  2Q3I A;  1IO4 A;  1S9K D;  3M9H A;  1CZQ A;  2W6A A;  1OXZ A;  1A02 J;  5AVR B;  3TNU A;  3HE4 A; 
#chains in the Genus database with same CATH topology
 3JCU E;  3N7N A;  1CW5 A;  1PP9 D;  3CWB G;  3CXH H;  2FYU J;  1BE3 G;  3II6 A;  1DD3 A;  1SFC A;  3H1K G;  1RF1 B;  4PJ0 H;  1KC8 Q;  1LTI C;  4I7Z C;  3RK2 C;  5KAF H;  1RQU A;  1JY2 O;  4R4M A;  1M7L A;  5CCG C;  1EZV G;  1Q82 Q;  1Z56 A;  3CLQ A;  1M1J C;  4H0L C;  3BCC G;  2JJL A;  2YIU C;  1VQ5 P;  2A06 E;  1GW4 A;  1WMK A;  1YIT P;  5CBN A;  1J1D C;  4RES B;  1P84 I;  5AW8 B;  2IDB A;  4L76 A;  1OMI A;  1LTB C;  1NU1 G;  3C1L A;  3L71 J;  3O6Q A;  5AVY B;  1NKN A;  2IX7 C;  3S9O A;  1JTH A;  2IZ0 A;  2H89 C;  3CI9 A;  4TLF A;  3E7K A;  3PTZ A;  2QIW A;  1PGP A;  2BEZ F;  1YQ4 C;  1NOH A;  4A7P A;  4D6T G;  3L72 G;  1FZC A;  1VQK P;  3D70 A;  1VQM P;  3SSU A;  3AEC C;  3M0D C;  2W6A A;  3KZI H;  4U7J A;  2YMK A;  1IK9 A;  3SWY A;  3HUS C;  3A0H H;  3KXD A;  1KD1 Q;  4UB6 H;  2P10 A;  1KZU B;  1GL2 C;  3L70 J;  1BGY J;  3CC2 P;  3K5B A;  2P7J A;  1LTS C;  1NH4 A;  1W2B O;  1K04 A;  1FU1 A;  2AXT E;  1RF1 C;  5KAI H;  2KS1 B;  1HJ0 A;  1JY3 O;  2B87 B;  3UIA A;  2M3B A;  1FZE A;  2WSS H;  5KLI B;  1A02 F;  1QL2 A;  4N78 D;  1JY2 N;  2HPC A;  1SQX E;  2YNY A;  1Y47 A;  5AW1 B;  1KB9 D;  3GHG B;  1ZN5 A;  4OVN F;  4ZKP A;  1S72 P;  1AFO A;  3C9I A;  2OTJ P;  1KFM A;  3H1H J;  3AE7 C;  3SWK A;  2KYV A;  2JKV A;  1DEB A;  4L73 A;  3AE2 C;  1OW6 A;  5APY A;  1BCC D;  1U7J A;  2V4H A;  1LT9 A;  5B5E E;  3HD7 A;  4I6M C;  2E76 D;  1UIX A;  5AW2 B;  2OYI A;  3P32 A;  3ABV C;  1KIL E;  5CCH C;  2OGU A;  2P67 A;  2XDJ A;  2I1K A;  1DEE G;  3G6E P;  1TU3 F;  1PPJ E;  5CJ0 A;  3CCS P;  3H1J E;  3RL0 D;  1FDO A;  2N9B A;  1H0T B;  2E76 B;  3CX5 E;  5BU5 A;  1IK7 A;  2L91 A;  5APU A;  3L71 D;  1GU5 A;  1SFC D;  1Q86 Q;  2IPP A;  5AW7 B;  1P84 D;  3RL0 B;  2RN0 A;  4U3F E;  3U1A A;  1DX7 A;  1BCC G;  2ZJS E;  2VRS A;  1G2C B;  3B8E B;  2Q5U A;  5AW4 B;  1SFC B;  3M06 A;  3P8C E;  1NTK K;  4IFD K;  3FX0 A;  2KNC B;  1FJK A;  1N86 A;  3F89 A;  1EXJ A;  5B66 H;  3I56 P;  3GW6 A;  5BU8 B;  2WSE H;  1N8R Q;  5DJU B;  3OW2 O;  2IBZ I;  5KLI C;  2K37 A;  1LGH B;  1YI2 P;  3L71 G;  4LGD E;  1SQB E;  1T6A A;  3GHG C;  2FKW B;  1IFD A;  4WY4 A;  3Q1M A;  3L70 D;  2ZT9 C;  1JO5 A;  2KXP B;  3AE3 C;  1DIP A;  3NXS A;  3O6Q B;  4Y28 J;  1VQL P;  2H8P D;  1M8O B;  4GDO A;  1HUC A;  3WUU A;  2HG5 D;  1ZOY C;  1DD4 A;  1NTZ J;  2QEX P;  1KQG B;  2Z4E A;  3IN6 A;  2QJK C;  2Q9I A;  1OVV A;  2FYU K;  1L0N E;  1RE4 A;  3M91 A;  5C39 A;  3L37 A;  1ZR4 A;  2GA1 A;  3CC7 P;  3TGU E;  3AE9 C;  1NTM D;  2D2C D;  1N7S A;  2SPZ A;  4XE5 B;  1U57 A;  3H1H D;  1SQP E;  1RY3 A;  3RL0 g;  3KHU A;  3VTP C;  1PGQ A;  4QMA A;  4EDF A;  1YJW P;  1S3J A;  1RF0 A;  2D2C B;  3IAO A;  2PP6 A;  1SFC C;  5GTI H;  4ZKU A;  3FWL A;  1VQ6 P;  1SQQ J;  3L74 E;  1VQ4 P;  1UII A;  3GG2 A;  2QSI A;  4H44 D;  4WB4 A;  3HRN A;  1M56 D;  3L73 J;  1NTM G;  3U59 A;  3CMA P;  2HPC B;  2HFE D;  3CWB E;  1PGJ A;  3HE5 B;  3M9Q A;  4H44 B;  1AVY A;  4IL6 X;  3IF4 A;  1URQ D;  1FBM A;  3H1K E;  4OGQ C;  3S1K A;  2W6B A;  3V2R A;  2OTL P;  1EZV E;  1ZP0 C;  4JQ0 D;  1LT9 B;  1L0L G;  2AEJ A;  1M57 D;  4BRY B;  5KKZ B;  2OYI B;  1URQ B;  1J1E B;  3W68 A;  2Y9Z A;  1OW8 A;  3TDK A;  1FZC C;  3CC4 P;  1NU1 E;  2Q1K A;  1S5L E;  1KN7 A;  1JOC A;  3R4Y A;  1X79 B;  2FXM A;  2KS1 A;  1S9K E;  2O1K A;  2B87 A;  1Y9B A;  1K05 A;  4NPD A;  2CPS A;  2NZ2 A;  5KLV J;  2D2C C;  4IL6 H;  3AED C;  4LC1 A;  2KB7 P;  3L75 J;  2WSF J;  4D6T E;  3L72 E;  1NTZ D;  3FWN A;  1AV1 A;  2WZ7 A;  5AW6 B;  4WY4 D;  5AW5 B;  3CL3 D;  1KTM A;  3KDP B;  1FDM A;  3LIE A;  3GF3 A;  1KYO E;  1X0T A;  2IBZ G;  1YJ9 P;  2Y0C A;  2O3J A;  2M0B A;  2OQQ A;  4WY4 B;  3KPE A;  5KJ7 D;  3OJA B;  1R5L A;  3VOP A;  3USS A;  1W2E A;  2GM4 A;  2KIK A;  1KOR A;  2FFD A;  1Y8A A;  4K35 A;  5TJH A;  2WPV B;  1SQQ D;  3MTU E;  4AUW A;  2OYO A;  3HD7 C;  5L8R J;  1VF5 D;  3PRJ A;  1LTJ A;  1N7S D;  3L73 D;  1AQ5 A;  2PRR A;  1PZQ A;  1IFJ A;  3Q5S A;  1SQB K;  1G2C A;  1VF5 B;  3CXH E;  1LJ2 A;  1X9V A;  5APS A;  1VPC A;  4PV1 C;  1N7S B;  2XNX A;  4XFJ A;  2YXR B;  2KNC A;  3CCJ P;  4PJ0 E;  1BDD A;  2E43 A;  5KAF E;  4HKZ H;  1ZRT D;  4Y99 C;  2P58 A;  1T2K D;  2I1J A;  1EDJ A;  1KB9 H;  2XV5 A;  3L73 G;  2N1T D;  4H13 D;  2ZXE B;  1K8A Q;  1PP9 G;  4O9B A;  2CPB A;  3RK3 D;  3CCE P;  4NPF X;  3G3Z A;  2OYH B;  2ZAE B;  1FZA A;  3MIW A;  2N1T B;  4WY4 C;  4H13 B;  1BCC E;  4R4L A;  1NTZ K;  2E5Y A;  2G8Y A;  5KLV D;  1SQP K;  3RK3 B;  3MUD A;  3TK1 A;  1FJP A;  3AEF C;  2POH A;  2HYN A;  1NTK D;  1EXI A;  5AVV B;  3KZI E;  1FE6 A;  2KLU A;  4PD4 I;  3G71 P;  2JR8 A;  3E1I A;  3A0H E;  4YXW H;  1T3J A;  1P84 H;  2V7Q J;  4TT3 H;  4UB6 E;  1RE4 C;  3BAS A;  1P84 E;  3H1L D;  1KIL A;  2ZYG A;  1W5C E;  1VF5 C;  1SQX J;  1YQ3 C;  1WT6 A;  3M9B A;  1SQQ K;  1N7S C;  4ASW A;  3WU2 H;  1J2J B;  3NMD A;  1Q2N A;  1Q7Y Q;  3Q5R A;  5KAI E;  3OA7 A;  1CI6 A;  3EFF K;  2KZI A;  3NFQ A;  3C8V A;  1NTK G;  1FOS F;  1NWQ A;  2QA4 P;  5APX A;  2QVA A;  1HGV A;  5AW3 B;  1AQT A;  3HE5 A;  5AW0 B;  2BCC E;  3AEA C;  1OFC X;  4YPC A;  1T2K C;  3H1L G;  2FYU D;  3H1I E;  2A06 D;  2H88 C;  3H1J J;  3BAT A;  3MHV A;  2FXO A;  2XZR A;  1USD A;  1JCD A;  3TF5 A;  3D6Z A;  2MKV A;  4M3L A;  4BRY A;  1URQ A;  5AVX B;  3FXE A;  4EI2 A;  1LNQ A;  3JC2 2;  2Q7C A;  4DCK A;  4U3F J;  3PHL A;  3Q2Y A;  2FFD B;  2KSE A;  5CBO A;  3AE8 C;  2IFN A;  3A2A A;  5GTH H;  2WSC H;  3KYQ A;  5AVU B;  5M1B A;  1NTM E;  1LTJ B;  2FYU G;  4I2L C;  5H2F H;  5AVZ B;  2ZVN B;  5KLV K;  3CCR P;  3G9R A;  3Q5P A;  1E79 H;  4DOJ A;  1NHL A;  2QJY B;  2PGD A;  1SQB J;  3BVH A;  2KUB A;  2Q6Q A;  1N73 B;  3VMA A;  4GT1 A;  3VP9 A;  3O8Z A;  1S4X A;  1L0L E;  2NRG A;  5B66 E;  1QEX A;  4DJG A;  1HTL C;  3LW5 J;  1JY3 N;  1IFI A;  1MFZ A;  2G3A A;  2LXB A;  2FYN B;  2Q3I A;  3BRT B;  1BGY D;  1JEK A;  1SQV J;  1GMJ A;  1VQ9 P;  1L0N J;  1SQX D;  4PD4 D;  1KQF B;  3TGU J;  2WPS A;  5KJ7 A;  2YXQ B;  4RKU J;  1QLE D;  1NGM B;  1FDI A;  1SQP J;  4N6J A;  3PH0 A;  1OIP A;  1SQV E;  4OH8 B;  2FFD C;  4W7Z A;  2YKO A;  1GU4 A;  2E76 C;  3V4W A;  1KIL D;  4GIF A;  3L70 G;  1BGY G;  4GKG A;  3L74 J;  1NVO A;  1LTJ C;  1PGO A;  2I8D A;  5DJT B;  2IBZ E;  1PPJ D;  1GL2 A;  1MKM A;  2Q3E A;  3RL0 C;  3AEE C;  1KIL B;  5K5G B;  5TIS H;  2ZFC A;  2QJY C;  4L74 A;  2WIT A;  3CCQ P;  2KLV A;  2RMZ A;  3FXD A;  1GK4 A;  3CWB J;  2AEM A;  1SP4 A;  5GTI E;  4NPE A;  3B5N A;  3PLN A;  2HR3 A;  1YHQ P;  1CI6 B;  3H1K J;  3CCM P;  1RH5 B;  1LP1 B;  2K88 A;  2AEF A;  3PP5 A;  1L2P A;  3M9H A;  1CZQ A;  2OYH A;  3H32 A;  5AVR B;  3HE4 A;  4ZNC A;  4KJM A;  2OAR A;  2N1T A;  2QJP B;  1S5L X;  5KTB A;  5AVT B;  1L4A D;  1BE3 E;  2B89 A;  3H1H G;  2R3C A;  1VQN P;  3AEG C;  1K9M Q;  3A5T A;  3V2N A;  1NU1 J;  1SQB D;  1LTG C;  4GOF A;  1VQ8 P;  1OW7 A;  1L4A B;  2E75 D;  4BWN A;  1T3U A;  2N9Y B;  3CCL P;  1LTT C;  4HYT B;  1FAV A;  4YTP C;  1JY2 P;  3MUD C;  5AVS B;  1KMI Z;  3QWO C;  1IFM A;  2E42 A;  2NPS A;  3BCC E;  1MZ9 A;  3BRV B;  1IFN A;  1S2E A;  1IZN B;  3MD0 A;  2E75 B;  1SQX K;  1PP9 E;  2R5B A;  3N4X A;  4D6T J;  3L72 J;  1S1C X;  1KYO I;  2XU6 A;  3JSV C;  2FBW C;  1PL5 A;  3RGU A;  4HH2 A;  2ZYA A;  1SQB G;  3TGU D;  3IFM A;  1ZLL A;  4IFM A;  1JCC A;  1ZRT E;  4RJT A;  1BSH A;  3PJS K;  4H0L D;  4IL6 E;  1LT1 A;  1RE3 A;  4I7Z B;  4OWF A;  1SQP D;  1G1J A;  2J59 M;  4EOT A;  2HLO A;  1OZH A;  2HOD B;  1M1J B;  3F5H A;  4H0L B;  5E79 H;  1EDI A;  2YKP A;  4W80 A;  2YIU B;  2UWJ E;  3V6I A;  2KP8 A;  1H8A A;  1J1D B;  1JMM A;  3V2P A;  1GW3 A;  1EDK A;  2J5U A;  4LLH A;  1T8Z A;  1Q90 D;  3CXH I;  4XA4 A;  4H44 C;  2FY8 A;  4MN4 C;  3V2Q A;  3A7O A;  3IR9 A;  2OTK E;  2W8Z A;  4C7N A;  3L35 A;  3V5B A;  4Z1M H;  1QX8 A;  2W83 C;  1QVF O;  1NTZ G;  3LID A;  2O01 H;  4JYB A;  4UB8 H;  1LT9 C;  1FZB A;  1SQP G;  2JO1 A;  1NTK E;  5KKZ C;  2OYI C;  1URQ C;  3A0B H;  1QGK B;  1YBK A;  1J1E C;  1JY3 P;  2JDI H;  3A3Y B;  2LR2 A;  1EZV D;  2M8R A;  1GL2 D;  1MFT A;  4IOI H;  1VDF A;  2IYO A;  3H1L E;  1HJB A;  3TYY A;  1VQ7 P;  1EDL A;  3HUS B;  2WPR A;  1N73 A;  2PFX A;  3JCU H;  4N3Y B;  2R44 A;  1FS0 E;  4KT0 J;  2K9Y A;  1GL2 B;  1NU1 D;  1MV8 A;  2IZ1 A;  3B5N D;  2ZXX A;  1SQQ G;  1H88 A;  2K9J B;  3CCU P;  3GF7 A;  1BCC J;  4N78 E;  1S9K D;  1OXZ A;  1OVR A;  2PAJ A;  3H25 A;  2KOG A;  3B5N B;  1OX3 A;  1KB9 E;  2WPQ A;  1SQV K;  2KK7 A;  1L0N K;  1NYH A;  4L75 A;  3HTK A;  2FYU E;  4D6T D;  3L72 D;  4JF7 A;  2H43 A;  4EIJ A;  2YMY A;  4HJG H;  3L36 A;  1HVV A;  3H32 B;  3HE4 B;  2KZJ A;  2LXC B;  4GOD A;  1KYO D;  5CCH D;  2NPS D;  2R3S A;  3QH9 A;  3L75 D;  4C46 A;  4WWI A;  5KJ7 C;  2FXP A;  2M5A A;  3SFD C;  1N2D C;  2NPS B;  3L71 E;  1ZR2 A;  1VQP P;  3AE1 C;  1YIJ P;  2BAS A;  5APT A;  2JWD A;  3AE5 C;  3MGN A;  4JBZ A;  3VP8 A;  4HB1 A;  5KLV G;  4C7R A;  1GZL A;  2BCC J;  4DZO A;  1M90 Q;  2C9L Y;  3WU2 E;  3SFE C;  1RHZ B;  2A45 I;  3H1I J;  3L75 G;  1H89 A;  3CXH D;  1XTC C;  2AXT H;  1LP1 A;  1EQ7 A;  1RF0 C;  2KSJ A;  3T97 B;  3TNU A;  2QM8 A;  1HF9 A;  2C0W A;  5AVW B;  3H6P A;  1M1K Q;  1JMB A;  1SVF A;  1NAY A;  3B5N C;  2V7Q H;  1HWT C;  3CX5 I;  3AE6 C;  2J58 A;  1D7M A;  1GDT A;  2ZT9 D;  3MP7 B;  3L70 E;  1BGY E;  1R5S A;  2WWW A;  1IFP A;  1NU1 K;  2YO3 A;  2Z5I A;  4PD4 H;  2Z5H A;  1HH0 A;  2Y0D A;  2OYH C;  1LWU A;  4PD4 E;  2ZVO B;  1VL2 A;  2N1T C;  4ASV A;  1L4A A;  4H13 C;  1NTM J;  3U1C A;  3FGA D;  2ZT9 B;  5AW9 B;  2WSC J;  1WRG A;  3RK3 C;  1E5W A;  3TSI A;  1PV3 A;  2K3R A;  1XTG B;  1YTZ I;  4AQR D;  2W90 A;  1EC5 A;  1PFI A;  4C7N B;  5B5E H;  2A45 H;  1G1I A;  4BXL A;  1FC2 C;  5APW A;  5GTH E;  1AVO A;  2NPS C;  3GLM A;  1L0L J;  3EFG A;  2A06 G;  2QJK B;  3CX5 H;  2E5T A;  2WVR A;  3CCV P;  5H2F E;  3H1H E;  3L4F A;  2WSE J;  2WT7 B;  2L5G B;  1JM0 A;  3AEB C;  5CHX A;  1OWA A;  1YYC A;  4JPZ B;  1GD2 E;  1NAF A;  3EQ2 A;  4GOE A;  1NKZ B;  5CCG A;  3P7K A;  3AE4 C;  2YKQ A;  2HOD A;  1M1J A;  2R5D A;  1Q81 Q;  1IJD B;  1JUN A;  2YO2 A;  1RE3 C;  3WUV A;  4IFF A;  4WVZ A;  3S4R A;  2WTY A;  3G4S P;  2AXC A;  3HTK B;  4OGQ D;  2JWA A;  1MUU A;  2R32 A;  2BCC D;  2W27 A;  1KQL A;  4K3A A;  1SLQ A;  4AYC A;  3H1I D;  4WBA A;  3NTN A;  3VMZ A;  2E74 D;  1JTH B;  1X8Y A;  4OGQ B;  3V4Q A;  1FZG A;  4EYY Q;  5APV A;  3WMM 0;  3LW5 H;  5AVQ B;  1GTW A;  3M0D A;  2CK3 H;  2M5A B;  1KQS O;  2P2U A;  1KFN A;  3GMA A;  3HUS A;  1VQO P;  2E74 B;  1BDC A;  1SQX G;  3RBX A;  1FZC B;  3H1J D;  1RQV A;  1SS1 A;  2MJZ A;  3CX5 D;  1OVU A;  2BCC G;  2FYZ A;  4YXD C;  1IO4 A;  2K9J A;  5TIS E;  3H1I G;  1RF1 A;  1N73 C;  1AJY A;  1ZME C;  1JNM A;  1BE3 J;  1USE A;  1EZV I;  1NTZ E;  4U3F D;  3P8M C;  3VMX A;  2C9N Y;  2H7H A;  2A45 G;  2RH0 A;  1ZXG A;  2WQY C;  3MZW B;  3P8C D;  3TNU B;  1HGZ A;  1PIX A;  2XND H;  1ZW0 A;  1L0L D;  1PPJ G;  4ZMD A;  2FYN C;  3H1J G;  3VYI A;  3BCC J;  5CJ4 A;  2RKL A;  1FZF A;  1HBW A;  1NJI Q;  1QVG O;  2ZYD A;  1KV4 A;  3CD6 P;  2QG4 A;  1LWU B;  1PP9 J;  2B88 A;  3I5C A;  2IFM A;  3ITK A;  4U3F G;  2GUS A;  1SQQ E;  3HD7 D;  1CSB A;  3R2P A;  1GK6 A;  5CCH A;  2W6J H;  3L73 E;  4CPG A;  1NO4 A;  1YTZ T;  3M0A A;  3HD7 B;  2KI7 B;  2JP3 A;  4I1L A;  3VMY A;  2C0X A;  2E74 C;  1SQV D;  3W67 A;  4PV1 D;  3I55 P;  1JB0 J;  1L0N D;  3RK2 D;  2DW3 A;  1S5L H;  2O1J A;  1A02 J;  3D6Y A;  5CCG D;  1KIL C;  3KQG A;  3T97 A;  2BEQ D;  3ZDM A;  2P1J A;  2IBZ D;  4RO0 A;  4PV1 B;  5APQ A;  5CMZ A;  5BVZ A;  1QL1 A;  3RK2 B;  1N7L A;  1X22 A;  4JYC A;  2WMM A;  1K73 Q;  3OAK A;  3B71 A;  1FOS E;  4Y99 B;  4B86 A;  4KHX A;  3RK3 E;  1ZV8 A;  3L74 D;  5EFW B;  5E79 E;  1SQV G;  1NTM K;  1NTK J;  2O01 J;  3GHG A;  2K1A A;  2QJP C;  2ITA A;  1L0N G;  3CME P;  1YJN P;  2O01 N;  3TGU G;  3EWK A;  1KYO H;  4W7Y A;  5KLV E;  3CPW O;  2JEE A;  2LKM A;  2QM7 A;  3B4S A;  1LWU C;  2WSF H;  3CWB D;  3H1L J;  1IC2 A;  1R8E A;  2Y9Y A;  1BE3 D;  3L75 E;  1L4A C;  1LTA C;  4UB8 E;  3RBZ A;  3H1K D;  3VN0 A;  4DT0 A;  1L0L K;  1DH3 A;  2XKM A;  2M3E A;  2B9B A;  3E1R A;  3A0B E;  2IYP A;  2Y0E A;  3SWF A;  1KB9 I;  2GUV A;  3L74 G;  2E75 C;  1U7M A;  2WT7 A;  1AA0 A;  1H0T A;  1BSN A;  3WUT A;  3BCC D;  3D71 A;  3Q3D A;  2QE7 H;  2QRX A; 
#chains in the Genus database with same CATH homology
 2QM8 A;  1LT9 B;  2C0W A;  3N7N A;  1CW5 A;  5AVW B;  3H6P A;  1SVF A;  2OYI B;  1URQ B;  3B5N C;  3II6 A;  1HWT C;  1J1E B;  2J58 A;  1GDT A;  2WPS A;  5KJ7 A;  1SFC A;  1FZC C;  1RF1 B;  2WWW A;  1LTI C;  1NU1 K;  2YO3 A;  2Z5I A;  3RK2 C;  2Z5H A;  1JY2 O;  1HH0 A;  2OYH C;  1LWU A;  1M7L A;  5CCG C;  4N6J A;  1JOC A;  2N1T C;  4OH8 B;  1L4A A;  1Z56 A;  2FFD C;  4W7Z A;  1X79 B;  3CLQ A;  2YKO A;  1GU4 A;  3U1C A;  2FXM A;  5AW9 B;  1M1J C;  1WRG A;  3RK3 C;  1E5W A;  2JJL A;  2O1K A;  3TSI A;  1S9K E;  1GW4 A;  3V4W A;  1KIL D;  1XTG B;  2CPS A;  1J1D C;  1YTZ I;  4GIF A;  4RES B;  4AQR D;  4GKG A;  5AW8 B;  1PFI A;  1LTJ C;  4C7N B;  1LTB C;  2A45 H;  1G1I A;  4LC1 A;  1GL2 A;  2KB7 P;  5AVY B;  3RL0 C;  1NKN A;  5APW A;  2IX7 C;  1JTH A;  2WZ7 A;  1KIL B;  5AW6 B;  2ZFC A;  2NPS C;  4WY4 D;  5AW5 B;  2WIT A;  3CL3 D;  3CI9 A;  3EFG A;  2KLV A;  1GK4 A;  3KDP B;  1FDM A;  3LIE A;  1SP4 A;  3L4F A;  2WT7 B;  3B5N A;  2L5G B;  5CHX A;  1OWA A;  1CI6 B;  1YYC A;  1NOH A;  1GD2 E;  1NAF A;  4WY4 B;  1FZC A;  3KPE A;  5KJ7 D;  3OJA B;  3EQ2 A;  3PP5 A;  3VOP A;  3M0D C;  3M9H A;  1CZQ A;  2W6A A;  2OYH A;  1W2E A;  2GM4 A;  1NKZ B;  3H32 A;  5AVR B;  5CCG A;  3HE4 A;  3P7K A;  2OAR A;  1IK9 A;  2N1T A;  2YKQ A;  3HUS C;  3SWY A;  2FFD A;  5KTB A;  5AVT B;  1L4A D;  2HOD A;  1M1J A;  2R3C A;  2R5D A;  3MTU E;  1IJD B;  4AUW A;  1KZU B;  1GL2 C;  1JUN A;  2YO2 A;  3HD7 C;  1RE3 C;  3A5T A;  4IFF A;  3V2N A;  2P7J A;  1LTS C;  1NH4 A;  1LTG C;  1LTJ A;  1FU1 A;  1N7S D;  1AQ5 A;  2WTY A;  1L4A B;  1RF1 C;  1T3U A;  3HTK B;  1IFJ A;  1LTT C;  4HYT B;  1FAV A;  1SQB K;  1JY3 O;  1JY2 P;  5AVS B;  1G2C A;  1IFM A;  1MUU A;  2NPS A;  2E42 A;  1MZ9 A;  3UIA A;  2R32 A;  1X9V A;  2W27 A;  5APS A;  1KQL A;  3BRV B;  2M3B A;  1FZE A;  1VPC A;  1IFN A;  1N7S B;  2XNX A;  3MD0 A;  1SLQ A;  4AYC A;  1A02 F;  1QL2 A;  1SQX K;  4N78 D;  1JY2 N;  4WBA A;  2HPC A;  2R5B A;  3N4X A;  2YNY A;  3NTN A;  2E43 A;  3VMZ A;  1JTH B;  1X8Y A;  5AW1 B;  3V4Q A;  1FZG A;  3GHG B;  1ZN5 A;  2XU6 A;  5APV A;  3WMM 0;  3LW5 H;  4Y99 C;  5AVQ B;  1GTW A;  1T2K D;  2I1J A;  4HH2 A;  4ZKP A;  3M0D A;  1AFO A;  3C9I A;  2P2U A;  2XV5 A;  3IFM A;  1KFM A;  1KFN A;  1ZLL A;  3HUS A;  2KYV A;  2N1T D;  1DEB A;  4IFM A;  2ZXE B;  1JCC A;  5APY A;  1LT9 A;  4O9B A;  2CPB A;  1FZC B;  3HD7 A;  3RK3 D;  1RE3 A;  4I6M C;  2MJZ A;  5AW2 B;  2OYI A;  1G1J A;  3P32 A;  3G3Z A;  2J59 M;  2OYH B;  2FYZ A;  5CCH C;  4EOT A;  2P67 A;  1FZA A;  2XDJ A;  3MIW A;  1IO4 A;  2I1K A;  2HLO A;  2N1T B;  4WY4 C;  1RF1 A;  1N73 C;  2HOD B;  5CJ0 A;  1JNM A;  1M1J B;  1NTZ K;  3RL0 D;  2N9B A;  3RK3 B;  1SQP K;  2YKP A;  4W80 A;  3P8M C;  3VMX A;  3MUD A;  5BU5 A;  2C9N Y;  3TK1 A;  2KP8 A;  2H7H A;  1H8A A;  1J1D B;  1FJP A;  1JMM A;  3V2P A;  1GW3 A;  5APU A;  1GU5 A;  2A45 G;  2POH A;  2HYN A;  1SFC D;  1T8Z A;  4LLH A;  4XA4 A;  3P8C D;  3TNU B;  1HGZ A;  3V2Q A;  2IPP A;  5AW7 B;  3A7O A;  3RL0 B;  3IR9 A;  3U1A A;  1DX7 A;  5AVV B;  4C7N A;  2VRS A;  3L35 A;  1G2C B;  3V5B A;  3B8E B;  3VYI A;  2Q5U A;  5CJ4 A;  3E1I A;  3LID A;  2O01 H;  4JYB A;  1FZF A;  1LT9 C;  1FZB A;  5AW4 B;  1SFC B;  3M06 A;  1T3J A;  3P8C E;  1HBW A;  1NTK K;  1RE4 C;  3BAS A;  4IFD K;  2OYI C;  1FJK A;  1URQ C;  1N86 A;  1KIL A;  1J1E C;  1LWU B;  1JY3 P;  3A3Y B;  1WT6 A;  5BU8 B;  2WSE H;  3I5C A;  3M9B A;  1SQQ K;  1N7S C;  2IFM A;  2GUS A;  2M8R A;  1GL2 D;  3HD7 D;  1CSB A;  3R2P A;  1J2J B;  3NMD A;  1LGH B;  1GK6 A;  1VDF A;  5CCH A;  3OA7 A;  1HJB A;  1CI6 A;  4LGD E;  3TYY A;  3NFQ A;  3GHG C;  2FKW B;  1IFD A;  3HUS B;  4WY4 A;  2WPR A;  1N73 A;  1FOS F;  1NWQ A;  4N3Y B;  1NO4 A;  1JO5 A;  5APX A;  1YTZ T;  3M0A A;  1GL2 B;  3NXS A;  3HD7 B;  1HGV A;  1MV8 A;  3B5N D;  5AW3 B;  4I1L A;  3VMY A;  2C0X A;  2H8P D;  3HE5 A;  5AW0 B;  1H88 A;  1T2K C;  3RK2 D;  1HUC A;  2HG5 D;  4N78 E;  1S9K D;  1OXZ A;  2O1J A;  2PAJ A;  1A02 J;  5CCG D;  3BAT A;  2KOG A;  3B5N B;  1KIL C;  2XZR A;  3KQG A;  2WPQ A;  1SQV K;  2Z4E A;  3T97 A;  1JCD A;  2P1J A;  2Q9I A;  1L0N K;  5APQ A;  5CMZ A;  2FYU K;  5BVZ A;  1RE4 A;  3HTK A;  1QL1 A;  3M91 A;  4M3L A;  3L37 A;  4JF7 A;  3RK2 B;  2H43 A;  1N7L A;  1URQ A;  5AVX B;  2YMY A;  4EIJ A;  1ZR4 A;  3L36 A;  4JYC A;  1HVV A;  3H32 B;  2Q7C A;  3HE4 B;  3OAK A;  1FOS E;  1N7S A;  2FFD B;  4Y99 B;  4B86 A;  4KHX A;  4XE5 B;  2IFN A;  3A2A A;  1ZV8 A;  1RY3 A;  2WSC H;  3KYQ A;  1NTM K;  5AVU B;  5CCH D;  2NPS D;  3GHG A;  3VTP C;  1RF0 A;  1LTJ B;  4I2L C;  4C46 A;  2PP6 A;  5KJ7 C;  1SFC C;  5AVZ B;  4ZKU A;  5KLV K;  4W7Y A;  2JEE A;  2LKM A;  2QM7 A;  4DOJ A;  1NHL A;  1N2D C;  1LWU C;  2WSF H;  2NPS B;  1IC2 A;  1ZR2 A;  3BVH A;  1L4A C;  4WB4 A;  1LTA C;  3HRN A;  1N73 B;  2BAS A;  5APT A;  3MGN A;  3U59 A;  4GT1 A;  3VN0 A;  3VP9 A;  3O8Z A;  1L0L K;  2HPC B;  1DH3 A;  2XKM A;  2HFE D;  3VP8 A;  3SWF A;  4C7R A;  3HE5 B;  1GZL A;  2GUV A;  3M9Q A;  1HTL C;  4DZO A;  2WT7 A;  2C9L Y;  1URQ D;  1FBM A;  1JY3 N;  2A45 I;  1IFI A;  1MFZ A;  1H89 A;  2W6B A;  3V2R A;  1XTC C;  2Q3I A;  1EQ7 A;  3BRT B;  1RF0 C;  2KSJ A;  3TNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...