2Q5UA

Crystal structure of iqn17
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
45
structure length
45
Chain Sequence
b'RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fusion protein between yeast variant GCN4 and HIVgp41
publication title Inhibiting HIV Entry: Discovery of D-Peptide Inhibitors that Target the Gp41 Coiled-Coil Pocket
pubmed doi rcsb
molecule tags Viral protein
total genus 21
structure length 45
sequence length 45
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2q5uA00
5APUA 5AVSB 3T97A 1FOSE 4AUWA 1FAVA 1JUNA 3NXSA 5AVQB 1MUUA 1SLQA 4I6MC 1CI6B 4AQRD 5AVVB 5AVTB 5AW3B 5AW8B 5AW2B 1GZLA 5AVRB 1NAFA 4RESB 2ZFCA 2WPQA 5AVUB 5AW5B 1DH3A 5AW9B 2YO3A 2WTYA 1SP4A 3A5TA 1GD2E 2R5BA 5AVWB 1H8AA 4AYCA 1GTWA 1NWQA 1MV8A 2WPSA 1OWAA 3MD0A 3NFQA 3VMXA 2R32A 2Z5IA 3MGNA 3VMZA 4C46A 3L36A 3HTKA 3HE5B 2H7HA 5APWA 2E43A 4KHXA 3B8EB 1HUCA 1HJBA 2WPRA 1G2CB 1OXZA 3KDPB 3LIEA 3P7KA 1A02F 4JYCA 2JJLA 2R3CA 2Q5UA 3VYIA 2WT7A 2C9LY 3NMDA 5APYA 3V4WA 2W6AA 3M9HA 5APVA 3V4QA 3I5CA 3L37A 1S9KD 1MFZA 3A2AA 4LC1A 1H89A 2N9BA 5CMZA 5AW4B 3M0AA 1T2KD 3VN0A 3A7OA 2Q7CA 4DZOA 1KQLA 2XZRA 3M91A 3NTNA 4C7NA 4GT1A 1H88A 2P67A 2C9NY 4EOTA 3TYYA 2W27A 1FOSF 5AW7B 3TNUA 2WWWA 1T2KC 5AVXB 2KP8A 2Z5HA 3HE4A 3O8ZA 4I2LC 2ZXEB 2XV5A 2WT7B 3A3YB 1HBWA 4XE5B 1GK6A 1HWTC 2R5DA 5AW0B 3P32A 1JNMA 1A02J 1J2JB 4B86A 2QM8A 2P7JA 2E42A 1CI6A 3KQGA 5AW1B 1S9KE 1GU4A 3V5BA 4JYBA 1CZQA 1X8YA 2YO2A 2QM7A 4GKGA 2Q3IA 1GK4A 5AVZB 3VTPC 1YYCA 5AW6B 1IO4A 3P8MC 5APXA 3VMYA 2P2UA 3OAKA 3M06A 4M3LA 3LIDA 4C7NB 2BASA 5APSA 2XU6A 1CSBA 3HE5A 3L35A 2VRSA 3TK1A 3UIAA 3TNUB 5APTA 1GU5A 3HE4B 2IPPA 3IR9A 3SWFA 5AVYB 4HYTB 5APQA 3M0DA 2YNYA 3M9BA
chains in the Genus database with same CATH superfamily
3T97A 1FOSE 3TDKA 2QEXP 1OW8A 1OMIA 3L70D 2OTJP 1SQPG 1NAFA 1EDIA 5E79H 1IFDA 3KYQA 3Q3DA 1SQQJ 2P1JA 2NZ2A 2OARA 2LXBA 1JY2N 1A02F 2WSEH 1M7LA 1KQFB 4EYYQ 1BGYD 1LT9A 1K73Q 3BCCD 1OVVA 2KXPB 1H89A 1LTSC 3P8CD 4W80A 1U7JA 3KXDA 4GT1A 1QGKB 5CCHA 3C1LA 2JEEA 1EXJA 5AVXB 1IK7A 2SPZA 1N7SD 1EZVG 3AEGC 2ZYAA 3OJAB 1BGYJ 4H13B 1T3UA 3H1IG 4Y99C 2K9JB 2ZAEB 1SFCD 5CCHD 2QJYB 2L5GB 1MKMA 3RBXA 1RF0A 1KB9I 5APSA 3RK3C 1X22A 5KKZB 1JO5A 3L75D 4JQ0D 4U3FE 1J1DC 3CXHH 3L74G 3CCVP 1S2EA 1S72P 2A06D 3D6ZA 1FE6A 1M1JB 1W2BO 4WY4B 2WITA 2P58A 3WU2H 2K37A 4HJGH 5KLVE 2E5TA 4BRYB 3L75J 3GF7A 2ZVOB 1L0NG 3EFGA 2OYHB 2AEJA 2RMZA 2R3CA 5EFWB 3H32A 4L75A 4I7ZC 2AEFA 1RQUA 1S9KD 1DD4A 1LWUB 1K8AQ 4WVZA 1JY3O 2JR8A 4LLHA 1W2EA 1PGOA 1EDJA 1OX3A 2WVRA 2KP8A 3L72E 1USEA 1LTGC 4GOFA 3HD7A 2R5DA 4ASWA 2M5AA 2K1AA 3VTPC 3HUSC 3B5NA 1EQ7A 3S1KA 2H88C 1H0TB 3HD7D 4JBZA 3CMEP 1M90Q 1PPJE 1URQC 2IPPA 5CJ4A 2FFDC 3RBZA 2RKLA 5APUA 1FZGA 3GHGA 2OYOA 4I6MC 2J5UA 1EXIA 4DOJA 3E7KA 3SSUA 1L0LD 3A5TA 1SQVK 4AYCA 1AV1A 1WRGA 3KPEA 4EDFA 2QA4P 3HE5B 3CWBJ 1IFMA 4KHXA 1G2CB 3P7KA 1BE3D 1OZHA 1DD3A 5E79E 1JY2P 4GDOA 4IOIH 3PLNA 3RL0D 4D6TE 5APVA 3S9OA 2N9BA 2B87A 2O01N 3H1HE 1EZVI 1L0LJ 1KQLA 3FWLA 4RKUJ 4JF7A 2KZJA 3E1RA 1YTZT 1PP9G 3RGUA 1BE3J 5KAIE 4H44C 3B4SA 1YI2P 2OYIC 1FJKA 1X8YA 4PD4I 2HODA 2W83C 2KB7P 1JMBA 1ZRTD 1SQQK 3OAKA 3M06A 4K3AA 1QX8A 1CW5A 3MP7B 3TK1A 3MHVA 2FYZA 1VDFA 2O1JA 1VF5B 3QWOC 5APQA 4OGQB 4YTPC 1FAVA 4BWNA 2NPSB 1VQOP 3G3ZA 5H2FE 3KZIH 4BXLA 1Y8AA 1JM0A 2A45H 2OTKE 1SQBE 2M3EA 3VMZA 3PRJA 3L36A 1YJ9P 2K88A 1HUCA 1OXZA 4GOEA 1KYOH 5M1BA 2Q5UA 3AE7C 1NKNA 1QL1A 1S3JA 3D70A 2CK3H 5KLIB 2B88A 4ASVA 2RH0A 1R5SA 4PJ0H 3V2PA 1HH0A 4U3FG 3M91A 3CC4P 1KV4A 4C7RA 4IL6X 4O9BA 4Z1MH 1SQVE 1T2KC 1M1KQ 3TF5A 4WWIA 1GL2B 2WSEJ 4A7PA 1G1JA 4PD4E 5KLVG 3EQ2A 2DW3A 1GMJA 3HUSB 5KAFH 3Q5RA 3C9IA 3H1KE 2Q6QA 1NH4A 1JTHA 1IFIA 1PL5A 2AXTE 1S5LH 4HB1A 1SQPD 3BASA 3TGUE 4H13C 5AVQB 2P10A 3CXHD 1NOHA 5CJ0A 4R4MA 1SQXK 3L72G 1JY3P 2QJYC 2WTYA 2HPCA 1FU1A 1MV8A 2WPSA 3MD0A 5KKZC 1SQQE 3II6A 2XKMA 1KORA 1URQA 1SQPJ 2FFDA 4TLFA 3N7NA 2G3AA 3I5CA 1NU1D 3U1AA 1M1JC 1RE4A 4WY4C 1PPJG 3M9QA 3VN0A 3CCQP 2E75B 2D2CB 2L91A 4H0LC 3G6EP 1KILA 2OYHC 1A02J 3H1KD 1BGYE 3H25A 1GW3A 1LWUC 1NU1J 5L8RJ 3FX0A 5AVZB 1HJ0A 1NTKK 1LTJB 2FXOA 3CX5H 3QH9A 3SWYA 1KILD 3FWNA 4YXWH 2E76B 2M3BA 4D6TG 1CSBA 2OQQA 2PP6A 1FDIA 3HE4B 1X79B 3H1HG 1JY2O 3IR9A 3USSA 2R3SA 3NXSA 3BVHA 1IFJA 1CI6B 1L0LK 1YIJP 1L4AA 2OYIA 1PGQA 2KOGA 2PFXA 1DH3A 1L0ND 2R5BA 1N86A 3K5BA 4H44D 2H7HA 3L75E 1Y9BA 1L4AD 2WT7A 1HGZA 3IN6A 2A06E 1R5LA 2ZT9D 4WB4A 1Z56A 1NTZG 1LTBC 1KYOE 1LT9B 2KYVA 2Q7CA 1N7SB 1L0NJ 1XTCC 3HTKB 1FZCA 1N2DC 4LGDE 1SFCB 3JCUE 2YXQB 1SQBG 1JNMA 3FXEA 2KI7B 3CCJP 3I55P 1S9KE 2JO1A 1L2PA 1UIXA 3G71P 1DEBA 4EIJA 2Q3EA 5KTBA 1VL2A 2GA1A 4I1LA 5KAFE 3GW6A 4RO0A 3F89A 1VQ7P 5TISH 3Q5SA 1KD1Q 5AW8B 2MKVA 5BVZA 1AFOA 2YO3A 1BSHA 2YMYA 1GDTA 2BEQD 2R32A 2KSJA 1NYHA 1NTMD 1P84H 1VF5C 4OGQC 4PV1C 1KYOD 4NPFX 3NMDA 2NPSC 5B66H 1FZFA 4JPZB 2YMKA 2K9JA 2Y0DA 1SQXD 4H0LB 3CD6P 3TGUG 1VQ5P 1PP9D 3IF4A 5K5GB 1L0LE 1SVFA 1VQPP 4XA4A 2WQYC 3PTZA 2UWJE 1NTMJ 2WSCH 3V6IA 3AE8C 3O8ZA 1FS0E 1BE3E 3H1LG 3M0DC 1M57D 5KLIC 4DT0A 2P7JA 3KQGA 3A0BH 1SQQG 3HD7B 1M1JA 3SWKA 1SQXJ 3AECC 4WY4A 3A0HH 1PP9J 1YTZI 2P2UA 3L73G 1EDLA 3G9RA 2ZJSE 1SQPK 3L70G 4BRYA 2JWAA 3UIAA 3AEBC 1IFNA 1BCCD 2OYHA 2B89A 1GL2C 3M9BA 2N1TB 1HVVA 1SS1A 4AQRD 1N8RQ 2KS1B 3L71D 1LWUA 1NTKD 3AE5C 5AW5B 1GD2E 1ZRTE 2FY8A 1H8AA 2Q9IA 3CWBD 3RL0B 3HRNA 2E74B 1BGYG 2FYUG 1Q82Q 1Q86Q 3WUUA 5APWA 3BCCG 4TT3H 3B8EB 1QVGO 3U59A 4EI2A 5CCGA 1BCCJ 1RE3C 4ZKPA 3B5ND 3CCUP 4ZKUA 4IFFA 1NU1K 3LW5J 3A2AA 3H1JD 3L71J 5B5EH 1NTKJ 3Q5PA 3CXHI 1IJDB 4NPEA 4DZOA 2JP3A 3CLQA 2B87B 5CCGD 2KUBA 1H88A 1HF9A 2P67A 1PGJA 2C9NY 2W27A 1H0TA 1FOSF 5AW7B 2HLOA 3PHLA 2HYNA 3IAOA 1HBWA 5KJ7C 1N73B 2QJPB 5AW1B 3H1JJ 2KLVA 1LGHB 2E75C 2D2CC 3VMYA 3CX5D 1XTGB 4C7NB 3TSIA 4N6JA 4R4LA 2A06G 2BCCD 2KLUA 3HE5A 5CBOA 3CC2P 1Q2NA 1G2CA 4HYTB 3GG2A 1U7MA 5AVSB 1JUNA 1JOCA 1LJ2A 2QG4A 1R8EA 1WMKA 1L0NK 1LTJC 2WPQA 3O6QB 5AVWB 3CMAP 2E76C 2KNCA 5TISE 3VMXA 1KB9D 2Z5IA 2BCCJ 4C46A 3H6PA 2IBZD 1HJBA 2WPRA 1OVUA 3KDPB 4L73A 4PV1B 3AE3C 1SQPE 1OW6A 3V4WA 2KSEA 2XDJA 2NRGA 2PGDA 3CCRP 1BDDA 1MFZA 1FZBA 3CXHE 3D71A 5B66E 4L74A 4QMAA 3TYYA 3WU2E 1LT1A 3OA7A 4I2LC 2HG5D 4OH8B 2NPSA 4UB6H 4KJMA 3RK3D 2PAJA 1LT9C 4GKGA 1NU1E 2Q3IA 1YITP 1IO4A 1N7SC 4Y28J 3CCEP 3P8MC 1LP1A 3FGAD 4M3LA 1ZXGA 3OW2O 3A0BE 2XU6A 2Z4EA 1DEEG 1RF1B 2VRSA 1Y47A 3GF3A 1SFCC 3A0HE 2M0BA 5CCHC 3M0DA 5GTIH 1HGVA 2QJKB 2O01J 1RY3A 2I1JA 3RK2B 2LXCB 2LR2A 1GZLA 1ZV8A 2ZFCA 3B71A 1BE3G 4DJGA 3SFDC 1KILE 1NTMK 4GODA 1ZW0A 1KC8Q 2QIWA 2HPCB 1YQ3C 3LW5H 2JDIH 3C8VA 1P84D 1FDMA 3VYIA 1GL2A 5APYA 2YKQA 1RH5B 3CCLP 3L4FA 3CCSP 5CMZA 2YKOA 3HUSA 4U7JA 2H89C 1L0NE 2GM4A 4RJTA 3U1CA 2O3JA 4N3YB 1GL2D 1NHLA 2A45I 5B5EE 2Z5HA 2CPSA 2YXRB 1NTZJ 3W67A 1KILB 1NKZB 4XE5B 1HWTC 3P32A 4B86A 1AJYA 2ZVNB 1ZR4A 4HH2A 1VQ6P 1KYOI 3ITKA 1QLED 3SFEC 1YHQP 1EZVD 1URQD 1KFNA 2V7QJ 1PV3A 5APXA 5CBNA 3H1ID 3TNUB 3VP8A 3WMM0 5BU8B 5C39A 2WSCJ 1BDCA 5KJ7A 4L76A 3AE9C 1FC2C 1T8ZA 3HD7C 3BATA 1LNQA 3R2PA 1KN7A 1Q90D 3L74D 2WMMA 1QL2A 1NWQA 3H1IJ 4UB8H 2ZT9B 1KMIZ 3AE6C 1YJNP 1E5WA 4HKZH 4YPCA 2N1TC 2C9LY 3T97B 3FXDA 2E75D 4LC1A 2C0XA 3VMAA 1KB9H 4IL6H 2C0WA 3A7OA 3KZIE 2ZYDA 3L74J 3RL0C 2E74C 3H1LD 4DCKA 1ZOYC 1FJPA 1NTME 1T6AA 1USDA 3HE4A 4XFJA 1ZMEC 1FZCB 1OIPA 3G4SP 2FYNB 2OTLP 2Q1KA 1CI6A 1ZN5A 3AE4C 2E76D 1SQXE 1PP9E 4UB6E 4PJ0E 2BASA 3H1LJ 1GW4A 1JCDA 2O01H 1QEXA 2FXPA 2MJZA 2AXCA 2IFNA 1N73C 5GTHH 1IFPA 1JMMA 2QJPC 2YKPA 2R44A 4N78D 3L73J 2FYUD 3L70J 5GTIE 2H43A 1N7SA 1SP4A 1OWAA 3R4YA 3HTKA 5KAIH 1QVFO 3CX5I 3MZWB 1NU1G 1BSNA 1SFCA 1AVYA 2KK7A 4JYCA 1BCCE 1VPCA 1S5LE 1SQVG 3M9HA 2XNDH 2WSFJ 1M56D 3L71E 2FYUJ 1T2KD 3N4XA 1NTKE 3BCCJ 2XZRA 1KQGB 3CWBE 3H1KG 4EOTA 3WUVA 2W8ZA 2IDBA 2WWWA 5H2FH 3A3YB 2IBZI 1UIIA 2V7QH 3H32B 3GMAA 1GU4A 1X9VA 3H1JE 4ZMDA 1DX7A 1G1IA 2QRXA 4OVNF 3V2NA 4H13D 3MUDC 1VQKP 4OWFA 1N7LA 1MZ9A 1SLQA 4GIFA 5AVTB 1JCCA 4NPDA 5AVRB 4ZNCA 2M5AB 3KHUA 5AW9B 2K9YA 3B5NB 2AEMA 3CX5E 1RF1C 2JKVA 1NTZK 2BCCE 1OVRA 5DJTB 4WY4D 4PD4H 2YIUB 4WBAA 2CPBA 3S4RA 1J1EB 2QJKC 3JC22 4H0LD 1Q7YQ 1KFMA 4UB8E 3GHGB 3RK2C 1K9MQ 2HFED 4IFMA 1SQBK 1VQNP 1DIPA 2I8DA 2AXTH 1KB9E 4IL6E 2LKMA 2V4HA 1KQSO 2IBZE 4U3FD 2Y0EA 1RQVA 3GLMA 1U57A 2N1TA 5AW0B 2IFMA 1P84I 1OW7A 2KS1A 1W5CE 2FKWB 2I1KA 2KIKA 1JY3N 1RE4C 2ITAA 3CI9A 2WSSH 2Y9ZA 5KLVD 1NO4A 2N1TD 1YJWP 4U3FJ 1KILC 3CC7P 3SWFA 4AUWA 2A45G 1NJIQ 3L75G 1HTLC 1MUUA 1S5LX 3AEDC 5AVVB 2B9BA 1AVOA 3RK3E 3AE2C 1NTMG 2E74D 2HODB 4MN4C 5AVUB 4KT0J 5GTHE 1NGMB 1WT6A 3AEAC 3NFQA 5KLVJ 3AEFC 2WZ7A 2QSIA 2KNCB 2WSFH 3L72D 4CPGA 1ZR2A 1SQXG 1AQTA 1PIXA 2Y0CA 1N73A 3MIWA 1VQ4P 4Y99B 3CCMP 1EDKA 1L4AC 1KTMA 2M8RA 1JB0J 4C7NA 3JSVC 3V2QA 5TJHA 2ZT9C 3CL3D 2QVAA 3RK3B 1S4XA 1MFTA 1PPJD 1YBKA 3L72J 1VQLP 1FZEA 2W6BA 2ZXEB 2XV5A 1NTZE 1P84E 1PZQA 2G8YA 1ZLLA 1J1DB 4W7YA 3F5HA 1RHZB 2QM8A 3PP5A 2H8PD 2QM7A 5CHXA 5AW6B 1BCCG 2IZ1A 3AEEC 3O6QA 3D6YA 5DJUB 1TU3F 1D7MA 1LP1B 3L71G 1PGPA 1NTKG 1FZCC 5AVYB 2FYNC 3V2RA 2YNYA 4D6TD 4IFDK 3CWBG 2FYUK 2ZYGA 4I7ZB 5AW3B 5AW2B 2N9YB 3I56P 1VF5D 3H1HD 4OGQD 1EZVE 2ZXXA 4PV1D 1JTHB 2J59M 2KZIA 2NPSD 1KZUB 3MUDA 3H1IE 3MGNA 3JCUH 2E43A 1L0LG 3H1JG 1YQ4C 1NVOA 2RN0A 1FBMA 4D6TJ 2E5YA 2W6AA 3V4QA 3BRTB 3L37A 3BRVB 4YXDC 3H1HJ 1JEKA 1AQ5A 1VQ8P 2HR3A 2QE7H 1RF0C 3L74E 2BEZF 1T3JA 1NTZD 1RF1A 1S1CX 1FDOA 3CPWO 1URQB 3W68A 2FFDB 1M8OB 2E42A 2JWDA 2BCCG 3Q1MA 3MTUE 1GK4A 2J58A 1SQBD 3EFFK 2IZ0A 3H1LE 2IYPA 3L35A 1K05A 1RE3A 3RL0g 3WUTA 3RK2D 1GU5A 1EC5A 3EWKA 2Y9YA 3L73E 3PH0A 4RESB 2IBZG 3AE1C 3L70E 1SQBJ 2W6JH 1GTWA 1Q81Q 1SQVD 4W7ZA 3LIEA 1ZP0C 3IFMA 2JJLA 1E79H 2O1KA 4H44B 2IX7C 4PD4D 2FBWC 1LTTC 1NAYA 1L4AB 4N78E 2OYIB 5AW4B 3M0AA 2GUSA 3VP9A 2FYUE 3B5NC 3BCCE 3NTNA 2PRRA 5KJ7D 1IZNB 2K3RA 3P8CE 3VOPA 3PJSK 1SQVJ 3TNUA 2IYOA 1AA0A 2YIUC 3ZDMA 3TGUD 4K35A 1J1EC 2GUVA 2WT7B 2D2CD 1GK6A 5CCGC 3GHGC 1J2JB 1LTIC 2XNXA 1LTJA 1X0TA 1LTAC 3Q2YA 3V5BA 4JYBA 1CZQA 2YO2A 1IC2A 2WPVB 1VQ9P 3ABVC 3H1KJ 5BU5A 5KLVK 1YYCA 1K04A 3LIDA 2FXMA 1FZAA 1SQQD 2OGUA 2W90A 1IK9A 5APTA 1VQMP 3TGUJ 1PFIA 2POHA 1OFCX 3E1IA 3L73D
chains in the Genus database with same CATH topology
1MZ9A 5AVSB 3T97A 1FOSE 1JUNA 5AVQB 1JOCA 1SLQA 4GIFA 5AVTB 1NOHA 1JCCA 1L0NK 5AVRB 1NAFA 5CJ0A 1LTJC 1SQXK 2WPQA 1JY3P 5AW9B 2WTYA 3B5NB 5AVWB 2HPCA 1FU1A 1IFDA 1MV8A 2WPSA 3KYQA 3MD0A 3VMXA 2Z5IA 1RF1C 4C46A 1NTZK 2P1JA 2OARA 3H6PA 3II6A 1JY2N 1HJBA 2WPRA 2XKMA 1A02F 3KDPB 2WSEH 4WY4D 1M7LA 1URQA 4WBAA 2CPBA 2FFDA 1J1EB 3N7NA 1KFMA 3V4WA 1LT9A 3GHGB 3RK2C 2XDJA 3I5CA 1MFZA 1H89A 1FZBA 3U1AA 1M1JC 1RE4A 1LTSC 4WY4C 3M9QA 3P8CD 3VN0A 2HFED 4IFMA 4W80A 1SQBK 4GT1A 3TYYA 5CCHA 2LKMA 1KILA 2JEEA 5AVXB 3OA7A 2OYHC 4I2LC 1N7SD 2HG5D 4OH8B 2N1TA 3OJAB 5AW0B 1A02J 2IFMA 2NPSA 1T3UA 3RK3D 1GW3A 2PAJA 4Y99C 1LWUC 1LT9C 4GKGA 2FKWB 2Q3IA 1NTKK 5AVZB 1SFCD 2I1KA 1LTJB 5CCHD 1IO4A 1N7SC 3SWYA 1JY3N 1KILD 2L5GB 1RE4C 3P8MC 2M3BA 4M3LA 3CI9A 1RF0A 5APSA 3RK3C 2XU6A 2Z4EA 1NO4A 1CSBA 2N1TD 1RF1B 2VRSA 1JO5A 2PP6A 1SFCC 5CCHC 3HE4B 1X79B 1JY2O 1KILC 3IR9A 3SWFA 3M0DA 1J1DC 1HGVA 4AUWA 2A45G 3NXSA 1RY3A 3BVHA 1HTLC 1MUUA 2I1JA 3RK2B 1IFJA 1CI6B 5AVVB 1L0LK 1L4AA 2OYIA 1GZLA 1M1JB 1ZV8A 2HODB 2KOGA 2ZFCA 5AVUB 4WY4B 1DH3A 2WITA 2R5BA 1WT6A 1NTMK 3NFQA 1N86A 2WZ7A 2H7HA 2HPCB 3LW5H 2WSFH 3EFGA 1ZR2A 2OYHB 1L4AD 1FDMA 2R3CA 3VYIA 2WT7A 1GL2A 1HGZA 1N73A 3MIWA 5APYA 2YKQA 3H32A 3L4FA 1S9KD 4WB4A 1Z56A 1LTBC 4Y99B 5CMZA 1LWUB 2YKOA 1LT9B 3HUSA 2KYVA 1L4AC 2Q7CA 1N7SB 2M8RA 1XTCC 1JY3O 4LLHA 4C7NA 2GM4A 1W2EA 3V2QA 3U1CA 4N3YB 3CL3D 1GL2D 3HTKB 1NHLA 3RK3B 1FZCA 2A45I 1N2DC 2KP8A 4LGDE 1SFCB 2CPSA 2Z5HA 1FZEA 2W6BA 2ZXEB 2XV5A 1KILB 1LTGC 1NKZB 1ZLLA 4XE5B 1J1DB 4W7YA 3HD7A 2R5DA 1JNMA 3P32A 1HWTC 4B86A 2QM8A 1ZR4A 4HH2A 1S9KE 3PP5A 2H8PD 2QM7A 5CHXA 3VTPC 5AW6B 1URQD 1KFNA 3HUSC 3B5NA 5APXA 1EQ7A 1DEBA 4EIJA 5KTBA 3HD7D 4I1LA 3TNUB 3VP8A 3WMM0 1URQC 2IPPA 5BU8B 1FZCC 5CJ4A 2FFDC 5AVYB 3V2RA 2YNYA 5APUA 5KJ7A 4IFDK 2FYUK 1FZGA 3GHGA 4I6MC 1T8ZA 5AW3B 3HD7C 5AW8B 5AW2B 3BATA 4DOJA 5BVZA 1AFOA 3R2PA 2YO3A 2YMYA 3A5TA 1GDTA 1SQVK 1QL2A 4AYCA 1NWQA 1JTHB 2J59M 2NPSD 1KZUB 1WRGA 3KPEA 2R32A 3MUDA 2KSJA 3MGNA 3HE5B 2E43A 1IFMA 4KHXA 1G2CB 3P7KA 1E5WA 1JY2P 2N1TC 2C9LY 1FBMA 3RL0D 3NMDA 2NPSC 2W6AA 5APVA 3V4QA 3BRTB 1FZFA 3L37A 3BRVB 2C0XA 4LC1A 2N9BA 2C0WA 3A7OA 1KQLA 1AQ5A 3RL0C 1RF0C 4JF7A 1SVFA 4XA4A 1T3JA 1RF1A 1YTZT 2WSCH 1FJPA 3HE4A 3O8ZA 3M0DC 1URQB 1FZCB 2FFDB 2P7JA 2E42A 1CI6A 1ZN5A 3KQGA 2OYIC 3MTUE 3HD7B 1FJKA 1X8YA 1M1JA 1GK4A 2HODA 2KB7P 4WY4A 1SQQK 1YTZI 2J58A 2P2UA 3OAKA 3M06A 2BASA 1GW4A 1JCDA 2O01H 3L35A 1SQPK 1CW5A 3TK1A 1RE3A 3UIAA 2FYZA 1VDFA 3RK2D 2O1JA 1IFNA 1GU5A 2MJZA 2OYHA 5APQA 1GL2C 2IFNA 1N73C 1JMMA 3M9BA 2N1TB 1HVVA 2YKPA 1FAVA 2NPSB 4AQRD 3G3ZA 4N78D 1LWUA 4RESB 2A45H 5AW5B 2H43A 1N7SA 1SP4A 1GD2E 1H8AA 2Q9IA 1GTWA 3RL0B 1OWAA 3HRNA 3VMZA 3L36A 3HTKA 5APWA 3B8EB 1HUCA 4W7ZA 1OXZA 3LIEA 3U59A 1SFCA 5CCGA 3IFMA 4JYCA 1RE3C 2JJLA 4ZKPA 2Q5UA 3B5ND 1NKNA 1QL1A 4ZKUA 1VPCA 2O1KA 4IFFA 2IX7C 1NU1K 3M9HA 1LTTC 3A2AA 1L4AB 4N78E 2OYIB 5AW4B 3M0AA 2GUSA 1T2KD 3V2PA 3VP9A 3N4XA 1HH0A 3B5NC 1IJDB 4DZOA 2XZRA 3M91A 3CLQA 3NTNA 4C7RA 5KJ7D 5CCGD 4O9BA 1H88A 3P8CE 2P67A 2C9NY 4EOTA 2W27A 3VOPA 1FOSF 5AW7B 2HLOA 3TNUA 2WWWA 1T2KC 1J1EC 2HYNA 2GUVA 2WT7B 3A3YB 1HBWA 1GL2B 5KJ7C 1GK6A 1N73B 1G1JA 5CCGC 3GHGC 3H32B 1J2JB 1LTIC 2XNXA 1LTJA 1LTAC 5AW1B 3EQ2A 1GU4A 3V5BA 4JYBA 1CZQA 1X9VA 2YO2A 1IC2A 3HUSB 2KLVA 1LGHB 5BU5A 5KLVK 3C9IA 1YYCA 1DX7A 3VMYA 1G1IA 1NH4A 1XTGB 4C7NB 1JTHA 1IFIA 3LIDA 3TSIA 3V2NA 4N6JA 2FXMA 1FZAA 3HE5A 1IK9A 5APTA 1G2CA 1N7LA 1PFIA 2POHA 3BASA 3E1IA 4HYTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5APU A;  5AVS B;  3T97 A;  1FOS E;  4AUW A;  1FAV A;  1JUN A;  3NXS A;  5AVQ B;  1MUU A;  1SLQ A;  4I6M C;  1CI6 B;  4AQR D;  5AVV B;  5AVT B;  5AW3 B;  5AW8 B;  5AW2 B;  1GZL A;  5AVR B;  1NAF A;  4RES B;  2ZFC A;  2WPQ A;  5AVU B;  5AW5 B;  1DH3 A;  5AW9 B;  2YO3 A;  2WTY A;  1SP4 A;  3A5T A;  1GD2 E;  2R5B A;  5AVW B;  1H8A A;  4AYC A;  1GTW A;  1NWQ A;  1MV8 A;  2WPS A;  1OWA A;  3MD0 A;  3NFQ A;  3VMX A;  2R32 A;  2Z5I A;  3MGN A;  3VMZ A;  4C46 A;  3L36 A;  3HTK A;  3HE5 B;  2H7H A;  5APW A;  2E43 A;  4KHX A;  3B8E B;  1HUC A;  1HJB A;  2WPR A;  1G2C B;  1OXZ A;  3KDP B;  3LIE A;  3P7K A;  1A02 F;  4JYC A;  2JJL A;  2R3C A;  2Q5U A;  3VYI A;  2WT7 A;  2C9L Y;  3NMD A;  5APY A;  3V4W A;  2W6A A;  3M9H A;  5APV A;  3V4Q A;  3I5C A;  3L37 A;  1S9K D;  1MFZ A;  3A2A A;  4LC1 A;  1H89 A;  2N9B A;  5CMZ A;  5AW4 B;  3M0A A;  1T2K D;  3VN0 A;  3A7O A;  2Q7C A;  4DZO A;  1KQL A;  2XZR A;  3M91 A;  3NTN A;  4C7N A;  4GT1 A;  1H88 A;  2P67 A;  2C9N Y;  4EOT A;  3TYY A;  2W27 A;  1FOS F;  5AW7 B;  3TNU A;  2WWW A;  1T2K C;  5AVX B;  2KP8 A;  2Z5H A;  3HE4 A;  3O8Z A;  4I2L C;  2ZXE B;  2XV5 A;  2WT7 B;  3A3Y B;  1HBW A;  4XE5 B;  1GK6 A;  1HWT C;  2R5D A;  5AW0 B;  3P32 A;  1JNM A;  1A02 J;  1J2J B;  4B86 A;  2QM8 A;  2P7J A;  2E42 A;  1CI6 A;  3KQG A;  5AW1 B;  1S9K E;  1GU4 A;  3V5B A;  4JYB A;  1CZQ A;  1X8Y A;  2YO2 A;  2QM7 A;  4GKG A;  2Q3I A;  1GK4 A;  5AVZ B;  3VTP C;  1YYC A;  5AW6 B;  1IO4 A;  3P8M C;  5APX A;  3VMY A;  2P2U A;  3OAK A;  3M06 A;  4M3L A;  3LID A;  4C7N B;  2BAS A;  5APS A;  2XU6 A;  1CSB A;  3HE5 A;  3L35 A;  2VRS A;  3TK1 A;  3UIA A;  3TNU B;  5APT A;  1GU5 A;  3HE4 B;  2IPP A;  3IR9 A;  3SWF A;  5AVY B;  4HYT B;  5APQ A;  3M0D A;  2YNY A;  3M9B A; 
#chains in the Genus database with same CATH topology
 3T97 A;  1FOS E;  3TDK A;  2QEX P;  1OW8 A;  1OMI A;  3L70 D;  2OTJ P;  1SQP G;  1NAF A;  1EDI A;  5E79 H;  1IFD A;  3KYQ A;  3Q3D A;  1SQQ J;  2P1J A;  2NZ2 A;  2OAR A;  2LXB A;  1JY2 N;  1A02 F;  2WSE H;  1M7L A;  1KQF B;  4EYY Q;  1BGY D;  1LT9 A;  1K73 Q;  3BCC D;  1OVV A;  2KXP B;  1H89 A;  1LTS C;  3P8C D;  4W80 A;  1U7J A;  3KXD A;  4GT1 A;  1QGK B;  5CCH A;  3C1L A;  2JEE A;  1EXJ A;  5AVX B;  1IK7 A;  2SPZ A;  1N7S D;  1EZV G;  3AEG C;  2ZYA A;  3OJA B;  1BGY J;  4H13 B;  1T3U A;  3H1I G;  4Y99 C;  2K9J B;  2ZAE B;  1SFC D;  5CCH D;  2QJY B;  2L5G B;  1MKM A;  3RBX A;  1RF0 A;  1KB9 I;  5APS A;  3RK3 C;  1X22 A;  5KKZ B;  1JO5 A;  3L75 D;  4JQ0 D;  4U3F E;  1J1D C;  3CXH H;  3L74 G;  3CCV P;  1S2E A;  1S72 P;  2A06 D;  3D6Z A;  1FE6 A;  1M1J B;  1W2B O;  4WY4 B;  2WIT A;  2P58 A;  3WU2 H;  2K37 A;  4HJG H;  5KLV E;  2E5T A;  4BRY B;  3L75 J;  3GF7 A;  2ZVO B;  1L0N G;  3EFG A;  2OYH B;  2AEJ A;  2RMZ A;  2R3C A;  5EFW B;  3H32 A;  4L75 A;  4I7Z C;  2AEF A;  1RQU A;  1S9K D;  1DD4 A;  1LWU B;  1K8A Q;  4WVZ A;  1JY3 O;  2JR8 A;  4LLH A;  1W2E A;  1PGO A;  1EDJ A;  1OX3 A;  2WVR A;  2KP8 A;  3L72 E;  1USE A;  1LTG C;  4GOF A;  3HD7 A;  2R5D A;  4ASW A;  2M5A A;  2K1A A;  3VTP C;  3HUS C;  3B5N A;  1EQ7 A;  3S1K A;  2H88 C;  1H0T B;  3HD7 D;  4JBZ A;  3CME P;  1M90 Q;  1PPJ E;  1URQ C;  2IPP A;  5CJ4 A;  2FFD C;  3RBZ A;  2RKL A;  5APU A;  1FZG A;  3GHG A;  2OYO A;  4I6M C;  2J5U A;  1EXI A;  4DOJ A;  3E7K A;  3SSU A;  1L0L D;  3A5T A;  1SQV K;  4AYC A;  1AV1 A;  1WRG A;  3KPE A;  4EDF A;  2QA4 P;  3HE5 B;  3CWB J;  1IFM A;  4KHX A;  1G2C B;  3P7K A;  1BE3 D;  1OZH A;  1DD3 A;  5E79 E;  1JY2 P;  4GDO A;  4IOI H;  3PLN A;  3RL0 D;  4D6T E;  5APV A;  3S9O A;  2N9B A;  2B87 A;  2O01 N;  3H1H E;  1EZV I;  1L0L J;  1KQL A;  3FWL A;  4RKU J;  4JF7 A;  2KZJ A;  3E1R A;  1YTZ T;  1PP9 G;  3RGU A;  1BE3 J;  5KAI E;  4H44 C;  3B4S A;  1YI2 P;  2OYI C;  1FJK A;  1X8Y A;  4PD4 I;  2HOD A;  2W83 C;  2KB7 P;  1JMB A;  1ZRT D;  1SQQ K;  3OAK A;  3M06 A;  4K3A A;  1QX8 A;  1CW5 A;  3MP7 B;  3TK1 A;  3MHV A;  2FYZ A;  1VDF A;  2O1J A;  1VF5 B;  3QWO C;  5APQ A;  4OGQ B;  4YTP C;  1FAV A;  4BWN A;  2NPS B;  1VQO P;  3G3Z A;  5H2F E;  3KZI H;  4BXL A;  1Y8A A;  1JM0 A;  2A45 H;  2OTK E;  1SQB E;  2M3E A;  3VMZ A;  3PRJ A;  3L36 A;  1YJ9 P;  2K88 A;  1HUC A;  1OXZ A;  4GOE A;  1KYO H;  5M1B A;  2Q5U A;  3AE7 C;  1NKN A;  1QL1 A;  1S3J A;  3D70 A;  2CK3 H;  5KLI B;  2B88 A;  4ASV A;  2RH0 A;  1R5S A;  4PJ0 H;  3V2P A;  1HH0 A;  4U3F G;  3M91 A;  3CC4 P;  1KV4 A;  4C7R A;  4IL6 X;  4O9B A;  4Z1M H;  1SQV E;  1T2K C;  1M1K Q;  3TF5 A;  4WWI A;  1GL2 B;  2WSE J;  4A7P A;  1G1J A;  4PD4 E;  5KLV G;  3EQ2 A;  2DW3 A;  1GMJ A;  3HUS B;  5KAF H;  3Q5R A;  3C9I A;  3H1K E;  2Q6Q A;  1NH4 A;  1JTH A;  1IFI A;  1PL5 A;  2AXT E;  1S5L H;  4HB1 A;  1SQP D;  3BAS A;  3TGU E;  4H13 C;  5AVQ B;  2P10 A;  3CXH D;  1NOH A;  5CJ0 A;  4R4M A;  1SQX K;  3L72 G;  1JY3 P;  2QJY C;  2WTY A;  2HPC A;  1FU1 A;  1MV8 A;  2WPS A;  3MD0 A;  5KKZ C;  1SQQ E;  3II6 A;  2XKM A;  1KOR A;  1URQ A;  1SQP J;  2FFD A;  4TLF A;  3N7N A;  2G3A A;  3I5C A;  1NU1 D;  3U1A A;  1M1J C;  1RE4 A;  4WY4 C;  1PPJ G;  3M9Q A;  3VN0 A;  3CCQ P;  2E75 B;  2D2C B;  2L91 A;  4H0L C;  3G6E P;  1KIL A;  2OYH C;  1A02 J;  3H1K D;  1BGY E;  3H25 A;  1GW3 A;  1LWU C;  1NU1 J;  5L8R J;  3FX0 A;  5AVZ B;  1HJ0 A;  1NTK K;  1LTJ B;  2FXO A;  3CX5 H;  3QH9 A;  3SWY A;  1KIL D;  3FWN A;  4YXW H;  2E76 B;  2M3B A;  4D6T G;  1CSB A;  2OQQ A;  2PP6 A;  1FDI A;  3HE4 B;  1X79 B;  3H1H G;  1JY2 O;  3IR9 A;  3USS A;  2R3S A;  3NXS A;  3BVH A;  1IFJ A;  1CI6 B;  1L0L K;  1YIJ P;  1L4A A;  2OYI A;  1PGQ A;  2KOG A;  2PFX A;  1DH3 A;  1L0N D;  2R5B A;  1N86 A;  3K5B A;  4H44 D;  2H7H A;  3L75 E;  1Y9B A;  1L4A D;  2WT7 A;  1HGZ A;  3IN6 A;  2A06 E;  1R5L A;  2ZT9 D;  4WB4 A;  1Z56 A;  1NTZ G;  1LTB C;  1KYO E;  1LT9 B;  2KYV A;  2Q7C A;  1N7S B;  1L0N J;  1XTC C;  3HTK B;  1FZC A;  1N2D C;  4LGD E;  1SFC B;  3JCU E;  2YXQ B;  1SQB G;  1JNM A;  3FXE A;  2KI7 B;  3CCJ P;  3I55 P;  1S9K E;  2JO1 A;  1L2P A;  1UIX A;  3G71 P;  1DEB A;  4EIJ A;  2Q3E A;  5KTB A;  1VL2 A;  2GA1 A;  4I1L A;  5KAF E;  3GW6 A;  4RO0 A;  3F89 A;  1VQ7 P;  5TIS H;  3Q5S A;  1KD1 Q;  5AW8 B;  2MKV A;  5BVZ A;  1AFO A;  2YO3 A;  1BSH A;  2YMY A;  1GDT A;  2BEQ D;  2R32 A;  2KSJ A;  1NYH A;  1NTM D;  1P84 H;  1VF5 C;  4OGQ C;  4PV1 C;  1KYO D;  4NPF X;  3NMD A;  2NPS C;  5B66 H;  1FZF A;  4JPZ B;  2YMK A;  2K9J A;  2Y0D A;  1SQX D;  4H0L B;  3CD6 P;  3TGU G;  1VQ5 P;  1PP9 D;  3IF4 A;  5K5G B;  1L0L E;  1SVF A;  1VQP P;  4XA4 A;  2WQY C;  3PTZ A;  2UWJ E;  1NTM J;  2WSC H;  3V6I A;  3AE8 C;  3O8Z A;  1FS0 E;  1BE3 E;  3H1L G;  3M0D C;  1M57 D;  5KLI C;  4DT0 A;  2P7J A;  3KQG A;  3A0B H;  1SQQ G;  3HD7 B;  1M1J A;  3SWK A;  1SQX J;  3AEC C;  4WY4 A;  3A0H H;  1PP9 J;  1YTZ I;  2P2U A;  3L73 G;  1EDL A;  3G9R A;  2ZJS E;  1SQP K;  3L70 G;  4BRY A;  2JWA A;  3UIA A;  3AEB C;  1IFN A;  1BCC D;  2OYH A;  2B89 A;  1GL2 C;  3M9B A;  2N1T B;  1HVV A;  1SS1 A;  4AQR D;  1N8R Q;  2KS1 B;  3L71 D;  1LWU A;  1NTK D;  3AE5 C;  5AW5 B;  1GD2 E;  1ZRT E;  2FY8 A;  1H8A A;  2Q9I A;  3CWB D;  3RL0 B;  3HRN A;  2E74 B;  1BGY G;  2FYU G;  1Q82 Q;  1Q86 Q;  3WUU A;  5APW A;  3BCC G;  4TT3 H;  3B8E B;  1QVG O;  3U59 A;  4EI2 A;  5CCG A;  1BCC J;  1RE3 C;  4ZKP A;  3B5N D;  3CCU P;  4ZKU A;  4IFF A;  1NU1 K;  3LW5 J;  3A2A A;  3H1J D;  3L71 J;  5B5E H;  1NTK J;  3Q5P A;  3CXH I;  1IJD B;  4NPE A;  4DZO A;  2JP3 A;  3CLQ A;  2B87 B;  5CCG D;  2KUB A;  1H88 A;  1HF9 A;  2P67 A;  1PGJ A;  2C9N Y;  2W27 A;  1H0T A;  1FOS F;  5AW7 B;  2HLO A;  3PHL A;  2HYN A;  3IAO A;  1HBW A;  5KJ7 C;  1N73 B;  2QJP B;  5AW1 B;  3H1J J;  2KLV A;  1LGH B;  2E75 C;  2D2C C;  3VMY A;  3CX5 D;  1XTG B;  4C7N B;  3TSI A;  4N6J A;  4R4L A;  2A06 G;  2BCC D;  2KLU A;  3HE5 A;  5CBO A;  3CC2 P;  1Q2N A;  1G2C A;  4HYT B;  3GG2 A;  1U7M A;  5AVS B;  1JUN A;  1JOC A;  1LJ2 A;  2QG4 A;  1R8E A;  1WMK A;  1L0N K;  1LTJ C;  2WPQ A;  3O6Q B;  5AVW B;  3CMA P;  2E76 C;  2KNC A;  5TIS E;  3VMX A;  1KB9 D;  2Z5I A;  2BCC J;  4C46 A;  3H6P A;  2IBZ D;  1HJB A;  2WPR A;  1OVU A;  3KDP B;  4L73 A;  4PV1 B;  3AE3 C;  1SQP E;  1OW6 A;  3V4W A;  2KSE A;  2XDJ A;  2NRG A;  2PGD A;  3CCR P;  1BDD A;  1MFZ A;  1FZB A;  3CXH E;  3D71 A;  5B66 E;  4L74 A;  4QMA A;  3TYY A;  3WU2 E;  1LT1 A;  3OA7 A;  4I2L C;  2HG5 D;  4OH8 B;  2NPS A;  4UB6 H;  4KJM A;  3RK3 D;  2PAJ A;  1LT9 C;  4GKG A;  1NU1 E;  2Q3I A;  1YIT P;  1IO4 A;  1N7S C;  4Y28 J;  3CCE P;  3P8M C;  1LP1 A;  3FGA D;  4M3L A;  1ZXG A;  3OW2 O;  3A0B E;  2XU6 A;  2Z4E A;  1DEE G;  1RF1 B;  2VRS A;  1Y47 A;  3GF3 A;  1SFC C;  3A0H E;  2M0B A;  5CCH C;  3M0D A;  5GTI H;  1HGV A;  2QJK B;  2O01 J;  1RY3 A;  2I1J A;  3RK2 B;  2LXC B;  2LR2 A;  1GZL A;  1ZV8 A;  2ZFC A;  3B71 A;  1BE3 G;  4DJG A;  3SFD C;  1KIL E;  1NTM K;  4GOD A;  1ZW0 A;  1KC8 Q;  2QIW A;  2HPC B;  1YQ3 C;  3LW5 H;  2JDI H;  3C8V A;  1P84 D;  1FDM A;  3VYI A;  1GL2 A;  5APY A;  2YKQ A;  1RH5 B;  3CCL P;  3L4F A;  3CCS P;  5CMZ A;  2YKO A;  3HUS A;  4U7J A;  2H89 C;  1L0N E;  2GM4 A;  4RJT A;  3U1C A;  2O3J A;  4N3Y B;  1GL2 D;  1NHL A;  2A45 I;  5B5E E;  2Z5H A;  2CPS A;  2YXR B;  1NTZ J;  3W67 A;  1KIL B;  1NKZ B;  4XE5 B;  1HWT C;  3P32 A;  4B86 A;  1AJY A;  2ZVN B;  1ZR4 A;  4HH2 A;  1VQ6 P;  1KYO I;  3ITK A;  1QLE D;  3SFE C;  1YHQ P;  1EZV D;  1URQ D;  1KFN A;  2V7Q J;  1PV3 A;  5APX A;  5CBN A;  3H1I D;  3TNU B;  3VP8 A;  3WMM 0;  5BU8 B;  5C39 A;  2WSC J;  1BDC A;  5KJ7 A;  4L76 A;  3AE9 C;  1FC2 C;  1T8Z A;  3HD7 C;  3BAT A;  1LNQ A;  3R2P A;  1KN7 A;  1Q90 D;  3L74 D;  2WMM A;  1QL2 A;  1NWQ A;  3H1I J;  4UB8 H;  2ZT9 B;  1KMI Z;  3AE6 C;  1YJN P;  1E5W A;  4HKZ H;  4YPC A;  2N1T C;  2C9L Y;  3T97 B;  3FXD A;  2E75 D;  4LC1 A;  2C0X A;  3VMA A;  1KB9 H;  4IL6 H;  2C0W A;  3A7O A;  3KZI E;  2ZYD A;  3L74 J;  3RL0 C;  2E74 C;  3H1L D;  4DCK A;  1ZOY C;  1FJP A;  1NTM E;  1T6A A;  1USD A;  3HE4 A;  4XFJ A;  1ZME C;  1FZC B;  1OIP A;  3G4S P;  2FYN B;  2OTL P;  2Q1K A;  1CI6 A;  1ZN5 A;  3AE4 C;  2E76 D;  1SQX E;  1PP9 E;  4UB6 E;  4PJ0 E;  2BAS A;  3H1L J;  1GW4 A;  1JCD A;  2O01 H;  1QEX A;  2FXP A;  2MJZ A;  2AXC A;  2IFN A;  1N73 C;  5GTH H;  1IFP A;  1JMM A;  2QJP C;  2YKP A;  2R44 A;  4N78 D;  3L73 J;  2FYU D;  3L70 J;  5GTI E;  2H43 A;  1N7S A;  1SP4 A;  1OWA A;  3R4Y A;  3HTK A;  5KAI H;  1QVF O;  3CX5 I;  3MZW B;  1NU1 G;  1BSN A;  1SFC A;  1AVY A;  2KK7 A;  4JYC A;  1BCC E;  1VPC A;  1S5L E;  1SQV G;  3M9H A;  2XND H;  2WSF J;  1M56 D;  3L71 E;  2FYU J;  1T2K D;  3N4X A;  1NTK E;  3BCC J;  2XZR A;  1KQG B;  3CWB E;  3H1K G;  4EOT A;  3WUV A;  2W8Z A;  2IDB A;  2WWW A;  5H2F H;  3A3Y B;  2IBZ I;  1UII A;  2V7Q H;  3H32 B;  3GMA A;  1GU4 A;  1X9V A;  3H1J E;  4ZMD A;  1DX7 A;  1G1I A;  2QRX A;  4OVN F;  3V2N A;  4H13 D;  3MUD C;  1VQK P;  4OWF A;  1N7L A;  1MZ9 A;  1SLQ A;  4GIF A;  5AVT B;  1JCC A;  4NPD A;  5AVR B;  4ZNC A;  2M5A B;  3KHU A;  5AW9 B;  2K9Y A;  3B5N B;  2AEM A;  3CX5 E;  1RF1 C;  2JKV A;  1NTZ K;  2BCC E;  1OVR A;  5DJT B;  4WY4 D;  4PD4 H;  2YIU B;  4WBA A;  2CPB A;  3S4R A;  1J1E B;  2QJK C;  3JC2 2;  4H0L D;  1Q7Y Q;  1KFM A;  4UB8 E;  3GHG B;  3RK2 C;  1K9M Q;  2HFE D;  4IFM A;  1SQB K;  1VQN P;  1DIP A;  2I8D A;  2AXT H;  1KB9 E;  4IL6 E;  2LKM A;  2V4H A;  1KQS O;  2IBZ E;  4U3F D;  2Y0E A;  1RQV A;  3GLM A;  1U57 A;  2N1T A;  5AW0 B;  2IFM A;  1P84 I;  1OW7 A;  2KS1 A;  1W5C E;  2FKW B;  2I1K A;  2KIK A;  1JY3 N;  1RE4 C;  2ITA A;  3CI9 A;  2WSS H;  2Y9Z A;  5KLV D;  1NO4 A;  2N1T D;  1YJW P;  4U3F J;  1KIL C;  3CC7 P;  3SWF A;  4AUW A;  2A45 G;  1NJI Q;  3L75 G;  1HTL C;  1MUU A;  1S5L X;  3AED C;  5AVV B;  2B9B A;  1AVO A;  3RK3 E;  3AE2 C;  1NTM G;  2E74 D;  2HOD B;  4MN4 C;  5AVU B;  4KT0 J;  5GTH E;  1NGM B;  1WT6 A;  3AEA C;  3NFQ A;  5KLV J;  3AEF C;  2WZ7 A;  2QSI A;  2KNC B;  2WSF H;  3L72 D;  4CPG A;  1ZR2 A;  1SQX G;  1AQT A;  1PIX A;  2Y0C A;  1N73 A;  3MIW A;  1VQ4 P;  4Y99 B;  3CCM P;  1EDK A;  1L4A C;  1KTM A;  2M8R A;  1JB0 J;  4C7N A;  3JSV C;  3V2Q A;  5TJH A;  2ZT9 C;  3CL3 D;  2QVA A;  3RK3 B;  1S4X A;  1MFT A;  1PPJ D;  1YBK A;  3L72 J;  1VQL P;  1FZE A;  2W6B A;  2ZXE B;  2XV5 A;  1NTZ E;  1P84 E;  1PZQ A;  2G8Y A;  1ZLL A;  1J1D B;  4W7Y A;  3F5H A;  1RHZ B;  2QM8 A;  3PP5 A;  2H8P D;  2QM7 A;  5CHX A;  5AW6 B;  1BCC G;  2IZ1 A;  3AEE C;  3O6Q A;  3D6Y A;  5DJU B;  1TU3 F;  1D7M A;  1LP1 B;  3L71 G;  1PGP A;  1NTK G;  1FZC C;  5AVY B;  2FYN C;  3V2R A;  2YNY A;  4D6T D;  4IFD K;  3CWB G;  2FYU K;  2ZYG A;  4I7Z B;  5AW3 B;  5AW2 B;  2N9Y B;  3I56 P;  1VF5 D;  3H1H D;  4OGQ D;  1EZV E;  2ZXX A;  4PV1 D;  1JTH B;  2J59 M;  2KZI A;  2NPS D;  1KZU B;  3MUD A;  3H1I E;  3MGN A;  3JCU H;  2E43 A;  1L0L G;  3H1J G;  1YQ4 C;  1NVO A;  2RN0 A;  1FBM A;  4D6T J;  2E5Y A;  2W6A A;  3V4Q A;  3BRT B;  3L37 A;  3BRV B;  4YXD C;  3H1H J;  1JEK A;  1AQ5 A;  1VQ8 P;  2HR3 A;  2QE7 H;  1RF0 C;  3L74 E;  2BEZ F;  1T3J A;  1NTZ D;  1RF1 A;  1S1C X;  1FDO A;  3CPW O;  1URQ B;  3W68 A;  2FFD B;  1M8O B;  2E42 A;  2JWD A;  2BCC G;  3Q1M A;  3MTU E;  1GK4 A;  2J58 A;  1SQB D;  3EFF K;  2IZ0 A;  3H1L E;  2IYP A;  3L35 A;  1K05 A;  1RE3 A;  3RL0 g;  3WUT A;  3RK2 D;  1GU5 A;  1EC5 A;  3EWK A;  2Y9Y A;  3L73 E;  3PH0 A;  4RES B;  2IBZ G;  3AE1 C;  3L70 E;  1SQB J;  2W6J H;  1GTW A;  1Q81 Q;  1SQV D;  4W7Z A;  3LIE A;  1ZP0 C;  3IFM A;  2JJL A;  1E79 H;  2O1K A;  4H44 B;  2IX7 C;  4PD4 D;  2FBW C;  1LTT C;  1NAY A;  1L4A B;  4N78 E;  2OYI B;  5AW4 B;  3M0A A;  2GUS A;  3VP9 A;  2FYU E;  3B5N C;  3BCC E;  3NTN A;  2PRR A;  5KJ7 D;  1IZN B;  2K3R A;  3P8C E;  3VOP A;  3PJS K;  1SQV J;  3TNU A;  2IYO A;  1AA0 A;  2YIU C;  3ZDM A;  3TGU D;  4K35 A;  1J1E C;  2GUV A;  2WT7 B;  2D2C D;  1GK6 A;  5CCG C;  3GHG C;  1J2J B;  1LTI C;  2XNX A;  1LTJ A;  1X0T A;  1LTA C;  3Q2Y A;  3V5B A;  4JYB A;  1CZQ A;  2YO2 A;  1IC2 A;  2WPV B;  1VQ9 P;  3ABV C;  3H1K J;  5BU5 A;  5KLV K;  1YYC A;  1K04 A;  3LID A;  2FXM A;  1FZA A;  1SQQ D;  2OGU A;  2W90 A;  1IK9 A;  5APT A;  1VQM P;  3TGU J;  1PFI A;  2POH A;  1OFC X;  3E1I A;  3L73 D; 
#chains in the Genus database with same CATH homology
 1MZ9 A;  5AVS B;  3T97 A;  1FOS E;  1JUN A;  5AVQ B;  1JOC A;  1SLQ A;  4GIF A;  5AVT B;  1NOH A;  1JCC A;  1L0N K;  5AVR B;  1NAF A;  5CJ0 A;  1LTJ C;  1SQX K;  2WPQ A;  1JY3 P;  5AW9 B;  2WTY A;  3B5N B;  5AVW B;  2HPC A;  1FU1 A;  1IFD A;  1MV8 A;  2WPS A;  3KYQ A;  3MD0 A;  3VMX A;  2Z5I A;  1RF1 C;  4C46 A;  1NTZ K;  2P1J A;  2OAR A;  3H6P A;  3II6 A;  1JY2 N;  1HJB A;  2WPR A;  2XKM A;  1A02 F;  3KDP B;  2WSE H;  4WY4 D;  1M7L A;  1URQ A;  4WBA A;  2CPB A;  2FFD A;  1J1E B;  3N7N A;  1KFM A;  3V4W A;  1LT9 A;  3GHG B;  3RK2 C;  2XDJ A;  3I5C A;  1MFZ A;  1H89 A;  1FZB A;  3U1A A;  1M1J C;  1RE4 A;  1LTS C;  4WY4 C;  3M9Q A;  3P8C D;  3VN0 A;  2HFE D;  4IFM A;  4W80 A;  1SQB K;  4GT1 A;  3TYY A;  5CCH A;  2LKM A;  1KIL A;  2JEE A;  5AVX B;  3OA7 A;  2OYH C;  4I2L C;  1N7S D;  2HG5 D;  4OH8 B;  2N1T A;  3OJA B;  5AW0 B;  1A02 J;  2IFM A;  2NPS A;  1T3U A;  3RK3 D;  1GW3 A;  2PAJ A;  4Y99 C;  1LWU C;  1LT9 C;  4GKG A;  2FKW B;  2Q3I A;  1NTK K;  5AVZ B;  1SFC D;  2I1K A;  1LTJ B;  5CCH D;  1IO4 A;  1N7S C;  3SWY A;  1JY3 N;  1KIL D;  2L5G B;  1RE4 C;  3P8M C;  2M3B A;  4M3L A;  3CI9 A;  1RF0 A;  5APS A;  3RK3 C;  2XU6 A;  2Z4E A;  1NO4 A;  1CSB A;  2N1T D;  1RF1 B;  2VRS A;  1JO5 A;  2PP6 A;  1SFC C;  5CCH C;  3HE4 B;  1X79 B;  1JY2 O;  1KIL C;  3IR9 A;  3SWF A;  3M0D A;  1J1D C;  1HGV A;  4AUW A;  2A45 G;  3NXS A;  1RY3 A;  3BVH A;  1HTL C;  1MUU A;  2I1J A;  3RK2 B;  1IFJ A;  1CI6 B;  5AVV B;  1L0L K;  1L4A A;  2OYI A;  1GZL A;  1M1J B;  1ZV8 A;  2HOD B;  2KOG A;  2ZFC A;  5AVU B;  4WY4 B;  1DH3 A;  2WIT A;  2R5B A;  1WT6 A;  1NTM K;  3NFQ A;  1N86 A;  2WZ7 A;  2H7H A;  2HPC B;  3LW5 H;  2WSF H;  3EFG A;  1ZR2 A;  2OYH B;  1L4A D;  1FDM A;  2R3C A;  3VYI A;  2WT7 A;  1GL2 A;  1HGZ A;  1N73 A;  3MIW A;  5APY A;  2YKQ A;  3H32 A;  3L4F A;  1S9K D;  4WB4 A;  1Z56 A;  1LTB C;  4Y99 B;  5CMZ A;  1LWU B;  2YKO A;  1LT9 B;  3HUS A;  2KYV A;  1L4A C;  2Q7C A;  1N7S B;  2M8R A;  1XTC C;  1JY3 O;  4LLH A;  4C7N A;  2GM4 A;  1W2E A;  3V2Q A;  3U1C A;  4N3Y B;  3CL3 D;  1GL2 D;  3HTK B;  1NHL A;  3RK3 B;  1FZC A;  2A45 I;  1N2D C;  2KP8 A;  4LGD E;  1SFC B;  2CPS A;  2Z5H A;  1FZE A;  2W6B A;  2ZXE B;  2XV5 A;  1KIL B;  1LTG C;  1NKZ B;  1ZLL A;  4XE5 B;  1J1D B;  4W7Y A;  3HD7 A;  2R5D A;  1JNM A;  3P32 A;  1HWT C;  4B86 A;  2QM8 A;  1ZR4 A;  4HH2 A;  1S9K E;  3PP5 A;  2H8P D;  2QM7 A;  5CHX A;  3VTP C;  5AW6 B;  1URQ D;  1KFN A;  3HUS C;  3B5N A;  5APX A;  1EQ7 A;  1DEB A;  4EIJ A;  5KTB A;  3HD7 D;  4I1L A;  3TNU B;  3VP8 A;  3WMM 0;  1URQ C;  2IPP A;  5BU8 B;  1FZC C;  5CJ4 A;  2FFD C;  5AVY B;  3V2R A;  2YNY A;  5APU A;  5KJ7 A;  4IFD K;  2FYU K;  1FZG A;  3GHG A;  4I6M C;  1T8Z A;  5AW3 B;  3HD7 C;  5AW8 B;  5AW2 B;  3BAT A;  4DOJ A;  5BVZ A;  1AFO A;  3R2P A;  2YO3 A;  2YMY A;  3A5T A;  1GDT A;  1SQV K;  1QL2 A;  4AYC A;  1NWQ A;  1JTH B;  2J59 M;  2NPS D;  1KZU B;  1WRG A;  3KPE A;  2R32 A;  3MUD A;  2KSJ A;  3MGN A;  3HE5 B;  2E43 A;  1IFM A;  4KHX A;  1G2C B;  3P7K A;  1E5W A;  1JY2 P;  2N1T C;  2C9L Y;  1FBM A;  3RL0 D;  3NMD A;  2NPS C;  2W6A A;  5APV A;  3V4Q A;  3BRT B;  1FZF A;  3L37 A;  3BRV B;  2C0X A;  4LC1 A;  2N9B A;  2C0W A;  3A7O A;  1KQL A;  1AQ5 A;  3RL0 C;  1RF0 C;  4JF7 A;  1SVF A;  4XA4 A;  1T3J A;  1RF1 A;  1YTZ T;  2WSC H;  1FJP A;  3HE4 A;  3O8Z A;  3M0D C;  1URQ B;  1FZC B;  2FFD B;  2P7J A;  2E42 A;  1CI6 A;  1ZN5 A;  3KQG A;  2OYI C;  3MTU E;  3HD7 B;  1FJK A;  1X8Y A;  1M1J A;  1GK4 A;  2HOD A;  2KB7 P;  4WY4 A;  1SQQ K;  1YTZ I;  2J58 A;  2P2U A;  3OAK A;  3M06 A;  2BAS A;  1GW4 A;  1JCD A;  2O01 H;  3L35 A;  1SQP K;  1CW5 A;  3TK1 A;  1RE3 A;  3UIA A;  2FYZ A;  1VDF A;  3RK2 D;  2O1J A;  1IFN A;  1GU5 A;  2MJZ A;  2OYH A;  5APQ A;  1GL2 C;  2IFN A;  1N73 C;  1JMM A;  3M9B A;  2N1T B;  1HVV A;  2YKP A;  1FAV A;  2NPS B;  4AQR D;  3G3Z A;  4N78 D;  1LWU A;  4RES B;  2A45 H;  5AW5 B;  2H43 A;  1N7S A;  1SP4 A;  1GD2 E;  1H8A A;  2Q9I A;  1GTW A;  3RL0 B;  1OWA A;  3HRN A;  3VMZ A;  3L36 A;  3HTK A;  5APW A;  3B8E B;  1HUC A;  4W7Z A;  1OXZ A;  3LIE A;  3U59 A;  1SFC A;  5CCG A;  3IFM A;  4JYC A;  1RE3 C;  2JJL A;  4ZKP A;  2Q5U A;  3B5N D;  1NKN A;  1QL1 A;  4ZKU A;  1VPC A;  2O1K A;  4IFF A;  2IX7 C;  1NU1 K;  3M9H A;  1LTT C;  3A2A A;  1L4A B;  4N78 E;  2OYI B;  5AW4 B;  3M0A A;  2GUS A;  1T2K D;  3V2P A;  3VP9 A;  3N4X A;  1HH0 A;  3B5N C;  1IJD B;  4DZO A;  2XZR A;  3M91 A;  3CLQ A;  3NTN A;  4C7R A;  5KJ7 D;  5CCG D;  4O9B A;  1H88 A;  3P8C E;  2P67 A;  2C9N Y;  4EOT A;  2W27 A;  3VOP A;  1FOS F;  5AW7 B;  2HLO A;  3TNU A;  2WWW A;  1T2K C;  1J1E C;  2HYN A;  2GUV A;  2WT7 B;  3A3Y B;  1HBW A;  1GL2 B;  5KJ7 C;  1GK6 A;  1N73 B;  1G1J A;  5CCG C;  3GHG C;  3H32 B;  1J2J B;  1LTI C;  2XNX A;  1LTJ A;  1LTA C;  5AW1 B;  3EQ2 A;  1GU4 A;  3V5B A;  4JYB A;  1CZQ A;  1X9V A;  2YO2 A;  1IC2 A;  3HUS B;  2KLV A;  1LGH B;  5BU5 A;  5KLV K;  3C9I A;  1YYC A;  1DX7 A;  3VMY A;  1G1I A;  1NH4 A;  1XTG B;  4C7N B;  1JTH A;  1IFI A;  3LID A;  3TSI A;  3V2N A;  4N6J A;  2FXM A;  1FZA A;  3HE5 A;  1IK9 A;  5APT A;  1G2C A;  1N7L A;  1PFI A;  2POH A;  3BAS A;  3E1I A;  4HYT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...