1HVVA

Self-association of the h3 region of syntaxin 1a: implications for snare complex assembly
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
67
structure length
67
Chain Sequence
b'QALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SYNTAXIN 1A
publication title Self-association of the H3 region of syntaxin 1A. Implications for intermediates in SNARE complex assembly.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
total genus 30
structure length 67
sequence length 67
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-01-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1hvvA00
1KILC 3RK2D 3P8CE 1SFCB 3RK3D 5KJ7C 2N1TD 3RL0B 3B5ND 2N1TA 2PP6A 3B5NA 2XDJA 4WY4C 3RL0C 4W7ZA 3HD7D 5CCHA 4OH8B 1SFCD 1JTHB 3PP5A 1GL2A 2H8PD 3M0DC 5CCGA 2WZ7A 4JF7A 1URQD 1HVVA 4WY4B 1N7SD 2NPSD 1URQA 1KILD 1L4AB 1XTGB 3KYQA 1N7SA 2NPSA 1KILA 5KJ7D 4W7YA 4LGDE 1GL2B 1L4AC 1T3JA 2YMYA 5KJ7A 2HG5D 3B5NC 3HD7A 4WY4D 5CCHC 3RL0D 1NHLA 1SFCA 1GL2C 3RK2B 2HFED 3RK3B 5CCGC 2N1TB 3B5NB 3RK2C 3VOPA 1URQC 2M8RA 3RK3C 2N1TC 1JTHA 3HD7B 3TSIA 4N78E 1L4AD 3HTKB 4WY4A 3HD7C 4W80A 1URQB 1L4AA 5CCHD 1SFCC 1N7SB 2NPSB 1KILB 1GL2D 2KOGA 5CCGD 1N7SC 2NPSC
chains in the Genus database with same CATH superfamily
1RQVA 2MKVA 1AJYA 1HBWA 1OW7A 1UIIA 1LTAC 3CCUP 3RL0B 2NRGA 5B5EH 3AEFC 3AE9C 3KDPB 5AVSB 2QM7A 2RKLA 4PD4I 1N8RQ 1H0TB 3CCVP 1QL1A 1CSBA 4B86A 2Q6QA 1SQVD 2RN0A 1FZAA 2WT7A 1Q86Q 2HR3A 1KYOH 1Y8AA 2ZYAA 3K5BA 3BVHA 3FWNA 5KAIE 1EZVG 2XNDH 3RL0g 4C7RA 2JP3A 4JPZB 2HODB 1BGYD 3L75D 2E75D 3M0AA 2M3BA 1S9KD 3AE3C 1EQ7A 1HF9A 3HTKA 3L74E 4JQ0D 1K8AQ 1M1JC 2IFNA 1EDKA 1LT9C 1L0LG 2KSEA 1S5LH 2POHA 3CXHE 1EZVI 5KAFE 2FXOA 1AV1A 1Y9BA 2KK7A 1FZEA 4DT0A 2JJLA 2E75C 2K37A 3M91A 1YBKA 2RH0A 1N7SC 4Y99B 1KILC 4BRYB 2C0XA 1S4XA 1DIPA 1BDCA 3SFEC 3EQ2A 1L0NG 4YTPC 2QM8A 3C8VA 1NYHA 4D6TG 2OYHC 2OTKE 1SFCD 3CL3D 2R44A 4U3FG 1NTZE 2KLVA 2XKMA 3TNUA 1SQPD 2B89A 3L73D 1DD3A 1VPCA 1SQBD 2P67A 1N2DC 3H32B 3CX5E 4KT0J 2YMYA 1S72P 2FYNB 1OZHA 1GD2E 3GMAA 2OYOA 2AEJA 5AW9B 1ZN5A 1NTME 1AVOA 1LWUC 2W27A 1PP9J 4PD4D 3VP8A 2Y9YA 2ZVNB 1QVGO 2N1TC 3HD7B 3H1KG 1JY2O 4I2LC 1KYOD 3CCEP 1AQTA 3MP7B 1IZNB 3LW5H 5AW5B 3WMM0 3CC2P 5AW8B 1NVOA 1PGPA 4HJGH 1JY3O 4EIJA 1SQQG 4RESB 3CMAP 1KQSO 1D7MA 2J59M 3C9IA 2WSFH 2ZYGA 1RF1B 1SQBJ 1NWQA 3IFMA 3QH9A 3EFFK 2Z4EA 2K9YA 5AVZB 1GMJA 2YXQB 3RL0C 4IFFA 3E1RA 2WMMA 5CJ4A 1JTHB 4GIFA 1QX8A 1AA0A 5AW6B 2AEMA 2QG4A 2K9JB 1J2JB 2V7QH 4IL6E 2QJKC 2WSCH 1WT6A 3A3YB 2Q7CA 3I55P 2E74D 2FYUG 3L70D 2W90A 3GLMA 4EDFA 5APWA 5AW4B 2Y0DA 5KJ7A 3KZIH 3U1AA 2OTJP 4IL6X 2ZXXA 2W6BA 3HD7A 1MFTA 1FAVA 1YTZT 4RO0A 3CMEP 3E1IA 4WWIA 4WVZA 3GF7A 3G71P 1NAYA 3HE5B 2KYVA 1KORA 3NXSA 5APXA 5GTIE 1DX7A 3UIAA 1NH4A 5KTBA 1IFJA 3TGUD 5EFWB 1BDDA 1VQ8P 5E79E 1VL2A 1FBMA 2KLUA 1LTJA 4I1LA 2NPSB 3F5HA 3L35A 5AW7B 4Y28J 3AE5C 3GHGA 2BEZF 2Q9IA 1KMIZ 2R3SA 3BCCD 1ZXGA 2H7HA 3JC22 3L70J 2K9JA 1LNQA 5B66H 4Y99C 1IK7A 2FY8A 5TISE 1SQBK 1Q81Q 3HE4B 3TK1A 1GW4A 3CX5I 2IYOA 2RMZA 1M8OB 3CCLP 1LTBC 3M9QA 1EDLA 2WPQA 2B87B 2QA4P 1YJNP 3H1IG 3NMDA 1SQXE 3HRNA 4U7JA 1ZOYC 1OIPA 1L4AB 3L37A 5KLVG 3KYQA 5KJ7D 1VQ4P 3FWLA 2IZ1A 4H13D 2HPCA 1X0TA 1LTGC 3II6A 1X8YA 3WU2E 4WY4D 3AE7C 2KNCB 2QIWA 3PLNA 1JM0A 1CW5A 3BCCJ 1HTLC 3FXEA 2MJZA 1GU4A 1NOHA 1OW8A 2XNXA 1NKZB 2D2CD 1M1JB 3L74D 1VQLP 3HD7C 4HKZH 1K73Q 3VP9A 4OVNF 2N9YB 5CCHD 2QEXP 2IDBA 3LW5J 5BU8B 3CXHD 5CCGD 2IZ0A 2E5YA 2AXTH 4RKUJ 3IN6A 3BATA 2WWWA 3RK3D 3FGAD 1BCCG 2OYIB 3CWBJ 2E75B 4DCKA 3USSA 3SWFA 4OGQD 3KQGA 2WSFJ 3Q5PA 4W7ZA 4GOFA 2QSIA 1SP4A 2NZ2A 1HGVA 4C46A 1EZVE 3RBZA 2E42A 2M3EA 2B88A 1JO5A 4W7YA 5AW3B 2V7QJ 5GTIH 3L74J 4DJGA 2WSCJ 2JEEA 1JCCA 4WB4A 1NTZD 3IR9A 1VQNP 3V4WA 3JCUH 1FOSE 1Q90D 3ABVC 1OVRA 3PH0A 1YJWP 1FZFA 1PP9G 2E76D 3FX0A 3SWKA 1LTTC 3W68A 4N78E 4OWFA 2WT7B 2N9BA 2YKOA 2OYIA 3AEGC 1NTMD 1JB0J 4PV1D 1NU1J 1GL2D 2O01N 3D70A 1NTKE 3HUSA 1EC5A 1VQ9P 4C7NB 2NPSC 1SLQA 4U3FE 2GM4A 4IOIH 2FFDA 1NTZJ 5DJTB 3AECC 2R3CA 1RE3C 2LKMA 1EXIA 2R32A 3PP5A 3P32A 4IFDK 1RE4A 3WU2H 1A02J 2Z5HA 1P84E 5AVWB 1L2PA 2KZIA 4EYYQ 1L4AC 4PD4H 3H1HD 1NTMJ 3M9HA 2QJKB 1SFCA 1G2CA 3WUVA 3H1KE 3G3ZA 3L72G 1X9VA 5K5GB 1JMBA 2WSEH 2IBZE 1BE3E 2KB7P 1SQQE 1R5SA 3RBXA 4C7NA 4EOTA 3TSIA 3B4SA 1OVUA 1Y47A 3TF5A 3CCSP 1HUCA 3TNUB 2YIUB 1KB9E 1FDMA 3C1LA 2WPRA 1AQ5A 1VQ5P 1FS0E 3AE6C 3V5BA 3CCJP 1NU1K 2E74B 3BRTB 3L71E 4ZNCA 2Q3EA 2O01J 1FC2C 1BSHA 1DEEG 1S2EA 3CC4P 4MN4C 2O1JA 5AVVB 3H1HJ 2OYIC 2BEQD 1NTZK 3F89A 4YXWH 1SQVJ 2FYUE 1M1KQ 4XE5B 3PJSK 4O9BA 2W6AA 1ZW0A 1VF5D 1HGZA 4L76A 1NTKG 1LTIC 3L36A 1BGYJ 3L75J 3S9OA 2FBWC 5AVYB 3WUUA 2FFDC 1RF0C 2BCCD 3MGNA 4UB6E 1N73A 1W5CE 4ZKPA 1SQXD 1Z56A 2HLOA 1RE4C 5AVTB 1JUNA 1J1DB 2OARA 4BXLA 1IO4A 1R5LA 1SFCC 1G1IA 1FZGA 1S3JA 2C9NY 4R4MA 3H1JD 2WQYC 3L4FA 3H1LG 3PTZA 2QJPB 2ZAEB 3EFGA 1GK4A 2YKPA 4H0LD 1SVFA 1M56D 4H13B 1GZLA 4HYTB 3GF3A 3H1IE 2LR2A 1P84I 4PJ0E 2IBZG 1CI6A 1KQLA 2BCCJ 3CWBG 3B5NA 1H88A 1FDIA 3I5CA 2ZT9D 1BE3G 4AQRD 1SQXJ 5KLVE 4AYCA 3A0BE 1HJ0A 1HWTC 1SQPJ 1SQVK 1AVYA 4JF7A 3Q1MA 2D2CB 3L73J 2XV5A 3KXDA 4Z1MH 1YI2P 3ZDMA 1LTJB 2IBZI 2XZRA 3S1KA 1A02F 4H0LC 3O6QA 3GHGB 3L71G 4LGDE 2SPZA 3G6EP 5KAIH 1EZVD 2G3AA 2KZJA 4HB1A 2P2UA 3H1JJ 2J5UA 1VQKP 1VQ7P 1KB9I 3RK3B 2YO3A 2P1JA 1Q7YQ 1KZUB 1DEBA 1JMMA 2K3RA 1TU3F 1L0LD 2WSEJ 3CXHH 2WTYA 2QVAA 3B71A 5KAFH 3OW2O 1N73C 4WY4A 1VQ6P 4L73A 1BCCE 3GW6A 3V6IA 1N7LA 2IPPA 3VMYA 2YIUC 2PRRA 1NU1G 2HPCB 1EDIA 2YXRB 4N78D 3RK2D 3V2PA 3P8CE 3EWKA 1ZMEC 2GUVA 2E74C 3B5ND 1L0ND 1KILE 2B9BA 1NTKD 5CCHA 4D6TD 1SQXK 2K1AA 3A2AA 3P8MC 3MZWB 1SS1A 5CCGA 2E76B 3V4QA 1IFIA 3KPEA 1T6AA 4U3FD 2AXCA 1SQPK 2WITA 1L0LJ 1EXJA 1XTGB 3BASA 1YJ9P 4PV1B 4H44D 3RGUA 2CPBA 4JBZA 1GL2B 3CX5H 3QWOC 3B5NC 3VMAA 1USDA 1PP9E 4GODA 1KV4A 1W2BO 3MTUE 3V2NA 4IFMA 5GTHE 1PPJG 1FDOA 2JWDA 4I7ZB 1FJKA 3M0DA 2JDIH 3TGUJ 1X22A 2Q1KA 2M5AA 1VQPP 3H1KD 1L0NJ 2IX7C 1FZCA 1J1DC 4H44C 4UB8E 5BVZA 4D6TJ 2IBZD 5AVQB 2A06G 2W6JH 3CI9A 5APUA 1SQQD 2DW3A 1OVVA 5KKZB 4YPCA 4NPEA 3MD0A 3NTNA 3A0BH 3M9BA 3M06A 1JOCA 4I6MC 1XTCC 2QJPC 2C9LY 5B5EE 5KJ7C 1JCDA 5APTA 1WMKA 2PP6A 4H13C 1YIJP 3A5TA 1T3UA 4WY4C 2HYNA 3L71D 2O01H 1X79B 1QL2A 1GL2A 2JKVA 3CCMP 2Y9ZA 1SQVG 3CPWO 2KS1A 1K9MQ 1IK9A 3G4SP 1URQA 4IL6H 1L0LK 3L72E 2D2CC 2FYUD 3HUSB 1LTJC 3PHLA 2JO1A 5CCHC 3GHGC 1GK6A 3AE1C 3SSUA 1FE6A 2Z5IA 2GA1A 5CCGC 2FFDB 3TYYA 4L74A 1PIXA 5AVRB 3RK3C 2OGUA 1IJDB 2XU6A 2QJYC 4OGQC 1L0NK 5E79H 3NFQA 3VN0A 2KSJA 1VF5B 2W8ZA 3CX5D 1U7MA 3MIWA 1LGHB 1JY2N 4M3LA 1SFCB 1G2CB 2ZVOB 1LT9A 2M0BA 2YKQA 1AFOA 2FYUJ 2A45H 4ASWA 4K3AA 1JY3N 5C39A 1ZRTE 5TISH 1FZCC 1EDJA 1MZ9A 3T97A 4KHXA 4JYCA 2GUSA 3H1ID 1LP1B 1URQD 2WVRA 5CBNA 1PFIA 2E76C 3L73G 1N7SA 1SQBG 1KILA 5KLVD 2OTLP 5APYA 2OQQA 4PV1C 1YQ3C 1PZQA 1H8AA 1FOSF 1YYCA 2IFMA 3I56P 4H0LB 4EI2A 1GL2C 4ZMDA 2OYHA 1U7JA 1DD4A 1LT1A 2H89C 2FXMA 1URQC 5KLIC 2P58A 3H1LE 4ASVA 4I7ZC 5M1BA 1VDFA 4HH2A 1NAFA 3AE2C 4W80A 1USEA 2G8YA 1MKMA 4WBAA 3H1IJ 3CWBE 1N73B 5APVA 1LWUA 1KYOI 1LP1A 1ZR2A 5KLVJ 2ZJSE 2KIKA 5KKZC 2E5TA 3A7OA 1BCCD 1IFPA 2ZXEB 2R5BA 2N1TA 1IC2A 2FYUK 1MV8A 1M57D 1OXZA 5APSA 2YNYA 1FJPA 4TT3H 2FKWB 3P8CD 3O8ZA 1KFNA 3OA7A 4N6JA 1KC8Q 1N7SD 3D6ZA 2ITAA 1NO4A 1KILD 4DOJA 3H6PA 1ZV8A 3L70G 3JSVC 3R4YA 2H88C 1YHQP 2I8DA 1OW6A 3KZIE 3VYIA 3OAKA 1QLED 2CK3H 2Y0CA 3SWYA 4CPGA 1JY2P 3HUSC 3RK3E 3RK2B 1CI6B 3B5NB 2JWAA 1FU1A 1JY3P 1OMIA 1H0TA 3PRJA 1PP9D 3TGUG 1BCCJ 2W83C 3GG2A 1E5WA 1J1EC 1NU1E 1NTMK 2IYPA 1R8EA 2LXCB 3VMXA 3R2PA 3O6QB 3MUDA 4H44B 3BCCG 2HODA 1VF5C 5B66E 2N1TD 1GTWA 3P7KA 1OFCX 5KLVK 1BSNA 1NJIQ 2KI7B 4OH8B 1NGMB 3CD6P 1WRGA 5L8RJ 2VRSA 3Q2YA 4WY4B 1GDTA 1KTMA 1P84H 3AE8C 1MUUA 1PPJE 1K05A 3VTPC 1T3JA 4LLHA 3Q3DA 1RHZB 3RL0D 4BRYA 1FZBA 3G9RA 3L72D 4TLFA 1M90Q 2KP8A 2JR8A 2M8RA 1UIXA 1HH0A 2A06E 3L74G 2Y0EA 1KN7A 5AW1B 2ZT9C 1PV3A 1MFZA 1KB9H 3AEAC 2QJYB 2AXTE 2L91A 3H32A 4OGQB 2H43A 3V2QA 3IF4A 3D6YA 3H1HE 1U57A 3Q5RA 1SQVE 3MHVA 1PGQA 1KQFB 2XDJA 2M5AB 1NKNA 3CXHI 1YTZI 3L72J 1H89A 2UWJE 2P7JA 1RQUA 1BGYE 3L75E 4L75A 1HVVA 3MUDC 2PGDA 1FZCB 1S9KE 1G1JA 1ZRTD 1NTZG 2ZYDA 4K35A 4UB6H 1VQOP 4BWNA 3JCUE 2HFED 1RF1A 1RY3A 2CPSA 3Q5SA 2YMKA 3AEEC 3E7KA 3RK2C 5DJUB 3D71A 5H2FE 1OWAA 1PGJA 1JTHA 1Q82Q 2YO2A 3CCQP 2KS1B 3KHUA 1NTMG 1P84D 3TDKA 1URQB 5KLIB 1QGKB 4GT1A 2QE7H 3A0HE 2O3JA 2J58A 2KOGA 1LJ2A 1K04A 2FXPA 3H1LD 2BCCE 1GW3A 1IFDA 3LIEA 1NTKJ 3HE5A 4PJ0H 1N86A 1SQPE 2L5GB 1T8ZA 3CWBD 3U1CA 3HD7D 3L73E 1BE3D 4U3FJ 1VQMP 1SQBE 5CHXA 2H8PD 4QMAA 4DZOA 2WPSA 4LC1A 2PFXA 5AVUB 2QRXA 1KB9D 3U59A 2FYNC 4A7PA 1KFMA 1YITP 3B8EB 1JEKA 2NPSA 1CZQA 1KD1Q 1PL5A 3W67A 3H1JE 4ZKUA 4PD4E 1LTSC 3H1HG 1ZR4A 2O1KA 2HG5D 3CCRP 4AUWA 5CJ0A 4GDOA 1LT9B 1KYOE 5APQA 1RE3A 4XFJA 3H1LJ 2BASA 5TJHA 3HE4A 4GKGA 3T97B 1W2EA 3H1KJ 4RJTA 4GOEA 3SFDC 3AE4C 1BGYG 2B87A 3L75G 5CMZA 2I1KA 3BRVB 3WUTA 5CBOA 4JYBA 3AEDC 1OX3A 1BE3J 3H25A 1L4AA 1SQQJ 1PGOA 2V4HA 1N7SB 4XA4A 1KILB 2ZFCA 2AEFA 1YQ4C 2I1JA 1RF1C 1J1EB 1S5LE 2PAJA 2FYZA 1RH5B 1NU1D 1S1CX 3OJAB 4R4LA 4N3YB 1S5LX 2Q3IA 1KQGB 1IFMA 2OYHB 2Q5UA 2KNCA 3L71J 1NTKK 3N4XA 1QEXA 2WPVB 5AW0B 3FXDA 3L70E 1L0LE 3S4RA 1QVFO 2KUBA 3N7NA 2KXPB 2A45G 3M0DC 2WZ7A 1M1JA 3CLQA 3CC7P 2E43A 1JNMA 2NPSD 3VMZA 2C0WA 4NPDA 2BCCG 5AVXB 3IAOA 5H2FH 1SQXG 3AEBC 2P10A 1NHLA 1LWUB 1HJBA 2A45I 3TGUE 1SQPG 1T2KD 2N1TB 5GTHH 1PPJD 1DH3A 4NPFX 1L0NE 2WSSH 3VOPA 3A0HH 2K88A 1ZP0C 4D6TE 2LXBA 5AW2B 4KJMA 3ITKA 1E79H 2R5DA 3BCCE 1Q2NA 1IFNA 1L4AD 3HTKB 1RF0A 4UB8H 3H1JG 4YXDC 1ZLLA 1SQQK 1GU5A 2A06D 3V2RA 3LIDA 1M7LA 5BU5A 1T2KC 2ZT9B
chains in the Genus database with same CATH topology
2HODA 4N78D 3RK2D 3V2PA 3P8CE 3BATA 2WWWA 1HBWA 2GUVA 3RK3D 1LTAC 2OYIB 2N1TD 3RL0B 1GTWA 3B5ND 3P7KA 5KLVK 3SWFA 3KDPB 3KQGA 5AVSB 2QM7A 4W7ZA 5CCHA 4OH8B 1SP4A 1SQXK 1QL1A 1HGVA 4C46A 3A2AA 3P8MC 1CSBA 4B86A 5CCGA 3V4QA 1IFIA 3KPEA 1WRGA 2VRSA 1FZAA 1SQPK 2WT7A 2E42A 2WITA 4WY4B 1GDTA 1XTGB 3BVHA 3BASA 1JO5A 1MUUA 4W7YA 5AW3B 3VTPC 2CPBA 4C7RA 1GL2B 1T3JA 2JEEA 1JCCA 4WB4A 4LLHA 3B5NC 2HODB 3IR9A 3RL0D 3M0AA 2M3BA 1FZBA 3V4WA 1S9KD 3MTUE 1EQ7A 1FOSE 3V2NA 4IFMA 3HTKA 1M1JC 2IFNA 1FJKA 1LT9C 3M0DA 1FZFA 2KP8A 2M8RA 2POHA 1HH0A 1LTTC 2IX7C 4N78E 2WT7B 5AW1B 1J1DC 1FZCA 2N9BA 2YKOA 2OYIA 1FZEA 5BVZA 1MFZA 5AVQB 2JJLA 1GL2D 3CI9A 3M91A 3H32A 5APUA 3HUSA 2H43A 3V2QA 1N7SC 4C7NB 2NPSC 3MD0A 3NTNA 3M9BA 4Y99B 1KILC 3M06A 1SLQA 1JOCA 2C0XA 4I6MC 1XTCC 2C9LY 5KJ7C 1JCDA 5APTA 3EQ2A 2GM4A 2FFDA 2PP6A 2QM8A 3A5TA 1T3UA 2XDJA 4WY4C 2OYHC 2HYNA 2R3CA 1RE3C 1NKNA 2LKMA 1X79B 2O01H 1YTZI 1QL2A 2R32A 1SFCD 3PP5A 1GL2A 3P32A 4IFDK 3CL3D 1RE4A 1H89A 2P7JA 2KLVA 1A02J 2XKMA 1HVVA 1FZCB 1IK9A 3TNUA 1S9KE 2Z5HA 5AVWB 1URQA 1G1JA 1L0LK 1VPCA 2P67A 1N2DC 3H32B 3HUSB 1L4AC 2YMYA 1LTJC 3M9HA 5CCHC 3GHGC 1GD2E 1SFCA 1GK6A 1G2CA 3G3ZA 2HFED 1RF1A 2Z5IA 5CCGC 1RY3A 2FFDB 2CPSA 1X9VA 5AW9B 1ZN5A 3TYYA 2WSEH 1LWUC 2W27A 3VP8A 3RK2C 5AVRB 3RK3C 1OWAA 2N1TC 1JTHA 2KB7P 3HD7B 2YO2A 1JY2O 1IJDB 4I2LC 4C7NA 4EOTA 2XU6A 3TSIA 3LW5H 5AW5B 1HUCA 3TNUB 1L0NK 1URQB 3WMM0 3NFQA 1FDMA 4GT1A 5AW8B 2WPRA 1JY3O 2KSJA 3VN0A 1AQ5A 4EIJA 2J58A 4RESB 3MIWA 2KOGA 1NU1K 3V5BA 3BRTB 1LGHB 1JY2N 2J59M 1GW3A 4M3LA 1SFCB 1G2CB 3C9IA 1IFDA 1LT9A 2WSFH 3LIEA 1RF1B 2YKQA 1NWQA 1AFOA 3HE5A 3IFMA 2A45H 2O1JA 1N86A 2Z4EA 2L5GB 1JY3N 5AVVB 1T8ZA 5AVZB 1FZCC 2OYIC 3U1CA 1MZ9A 3T97A 3RL0C 3HD7D 1NTZK 4IFFA 5CJ4A 1JTHB 4GIFA 5CHXA 2H8PD 4KHXA 4DZOA 4JYCA 4XE5B 5AW6B 2GUSA 2WPSA 4LC1A 1URQD 5AVUB 4O9BA 2W6AA 3U59A 1J2JB 1KFMA 1PFIA 2WSCH 3B8EB 1WT6A 1HGZA 1N7SA 2NPSA 1CZQA 3A3YB 2Q7CA 1KILA 1LTIC 3L36A 4ZKUA 5APWA 2FFDC 1LTSC 5AVYB 5AW4B 1RF0C 5KJ7A 3MGNA 3U1AA 1ZR4A 1N73A 2O1KA 2HG5D 2W6BA 3HD7A 4ZKPA 1FAVA 4AUWA 5CJ0A 5APYA 1YTZT 1Z56A 1H8AA 3E1IA 1FOSF 1LT9B 1YYCA 2IFMA 2HLOA 1GL2C 5APQA 2OYHA 1RE3A 3HE5B 1RE4C 2KYVA 2BASA 2FXMA 3HE4A 4GKGA 5AVTB 3NXSA 5APXA 1URQC 1W2EA 1DX7A 3UIAA 1JUNA 1J1DB 1NH4A 5KTBA 5CMZA 2I1KA 3BRVB 1IFJA 1VDFA 4JYBA 2OARA 1IO4A 4HH2A 1NAFA 4W80A 1FBMA 1L4AA 1SFCC 1G1IA 1LTJA 1FZGA 1N7SB 4I1LA 2NPSB 4XA4A 2C9NY 3L35A 5AW7B 1KILB 2ZFCA 3L4FA 2I1JA 3GHGA 1RF1C 4WBAA 1J1EB 2PAJA 2Q9IA 2FYZA 3EFGA 1N73B 1GK4A 5APVA 2YKPA 1SVFA 1GZLA 1LWUA 3OJAB 2H7HA 4HYTB 4N3YB 1ZR2A 2Q3IA 1IFMA 2OYHB 2Q5UA 3A7OA 1CI6A 1KQLA 4Y99C 2ZXEB 2R5BA 2N1TA 1NTKK 1SQBK 1IC2A 2FYUK 3HE4B 3TK1A 1MV8A 3B5NA 3N4XA 1H88A 3I5CA 4AQRD 5AW0B 1GW4A 1OXZA 4AYCA 5APSA 1LTBC 3M9QA 2YNYA 2WPQA 1FJPA 3N7NA 2FKWB 3P8CD 3O8ZA 2A45G 3M0DC 1HWTC 1SQVK 2WZ7A 1KFNA 1M1JA 3CLQA 3OA7A 3NMDA 4JF7A 4N6JA 3HRNA 1JNMA 2E43A 2XV5A 1N7SD 2NPSD 1NO4A 3VMZA 1KILD 1L4AB 4DOJA 3L37A 1LTJB 2C0WA 3H6PA 1ZV8A 3KYQA 1A02F 2XZRA 3GHGB 5KJ7D 4LGDE 3VYIA 3OAKA 5AVXB 2HPCA 1LTGC 3SWYA 3II6A 1X8YA 4WY4D 1JY2P 1NHLA 2P2UA 1LWUB 1HJBA 2A45I 3HUSC 3RK2B 1T2KD 3RK3B 2YO3A 2P1JA 1CI6B 2N1TB 1CW5A 1DH3A 3B5NB 1KZUB 1DEBA 1JMMA 1FU1A 1JY3P 3VOPA 1HTLC 2MJZA 1GU4A 1NOHA 5AW2B 2XNXA 1NKZB 1E5WA 2WTYA 1J1EC 1M1JB 2R5DA 1NTMK 1IFNA 1L4AD 1N73C 3HTKB 4WY4A 3HD7C 3VP9A 1RF0A 5CCHD 3VMXA 3R2PA 1ZLLA 5BU8B 1SQQK 1GU5A 1N7LA 2IPPA 3VMYA 3V2RA 3LIDA 1M7LA 5CCGD 5BU5A 3MUDA 1T2KC 2HPCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KIL C;  3RK2 D;  3P8C E;  1SFC B;  3RK3 D;  5KJ7 C;  2N1T D;  3RL0 B;  3B5N D;  2N1T A;  2PP6 A;  3B5N A;  2XDJ A;  4WY4 C;  3RL0 C;  4W7Z A;  3HD7 D;  5CCH A;  4OH8 B;  1SFC D;  1JTH B;  3PP5 A;  1GL2 A;  2H8P D;  3M0D C;  5CCG A;  2WZ7 A;  4JF7 A;  1URQ D;  1HVV A;  4WY4 B;  1N7S D;  2NPS D;  1URQ A;  1KIL D;  1L4A B;  1XTG B;  3KYQ A;  1N7S A;  2NPS A;  1KIL A;  5KJ7 D;  4W7Y A;  4LGD E;  1GL2 B;  1L4A C;  1T3J A;  2YMY A;  5KJ7 A;  2HG5 D;  3B5N C;  3HD7 A;  4WY4 D;  5CCH C;  3RL0 D;  1NHL A;  1SFC A;  1GL2 C;  3RK2 B;  2HFE D;  3RK3 B;  5CCG C;  2N1T B;  3B5N B;  3RK2 C;  3VOP A;  1URQ C;  2M8R A;  3RK3 C;  2N1T C;  1JTH A;  3HD7 B;  3TSI A;  4N78 E;  1L4A D;  3HTK B;  4WY4 A;  3HD7 C;  4W80 A;  1URQ B;  1L4A A;  5CCH D;  1SFC C;  1N7S B;  2NPS B;  1KIL B;  1GL2 D;  2KOG A;  5CCG D;  1N7S C;  2NPS C; 
#chains in the Genus database with same CATH topology
 1RQV A;  2MKV A;  1AJY A;  1HBW A;  1OW7 A;  1UII A;  1LTA C;  3CCU P;  3RL0 B;  2NRG A;  5B5E H;  3AEF C;  3AE9 C;  3KDP B;  5AVS B;  2QM7 A;  2RKL A;  4PD4 I;  1N8R Q;  1H0T B;  3CCV P;  1QL1 A;  1CSB A;  4B86 A;  2Q6Q A;  1SQV D;  2RN0 A;  1FZA A;  2WT7 A;  1Q86 Q;  2HR3 A;  1KYO H;  1Y8A A;  2ZYA A;  3K5B A;  3BVH A;  3FWN A;  5KAI E;  1EZV G;  2XND H;  3RL0 g;  4C7R A;  2JP3 A;  4JPZ B;  2HOD B;  1BGY D;  3L75 D;  2E75 D;  3M0A A;  2M3B A;  1S9K D;  3AE3 C;  1EQ7 A;  1HF9 A;  3HTK A;  3L74 E;  4JQ0 D;  1K8A Q;  1M1J C;  2IFN A;  1EDK A;  1LT9 C;  1L0L G;  2KSE A;  1S5L H;  2POH A;  3CXH E;  1EZV I;  5KAF E;  2FXO A;  1AV1 A;  1Y9B A;  2KK7 A;  1FZE A;  4DT0 A;  2JJL A;  2E75 C;  2K37 A;  3M91 A;  1YBK A;  2RH0 A;  1N7S C;  4Y99 B;  1KIL C;  4BRY B;  2C0X A;  1S4X A;  1DIP A;  1BDC A;  3SFE C;  3EQ2 A;  1L0N G;  4YTP C;  2QM8 A;  3C8V A;  1NYH A;  4D6T G;  2OYH C;  2OTK E;  1SFC D;  3CL3 D;  2R44 A;  4U3F G;  1NTZ E;  2KLV A;  2XKM A;  3TNU A;  1SQP D;  2B89 A;  3L73 D;  1DD3 A;  1VPC A;  1SQB D;  2P67 A;  1N2D C;  3H32 B;  3CX5 E;  4KT0 J;  2YMY A;  1S72 P;  2FYN B;  1OZH A;  1GD2 E;  3GMA A;  2OYO A;  2AEJ A;  5AW9 B;  1ZN5 A;  1NTM E;  1AVO A;  1LWU C;  2W27 A;  1PP9 J;  4PD4 D;  3VP8 A;  2Y9Y A;  2ZVN B;  1QVG O;  2N1T C;  3HD7 B;  3H1K G;  1JY2 O;  4I2L C;  1KYO D;  3CCE P;  1AQT A;  3MP7 B;  1IZN B;  3LW5 H;  5AW5 B;  3WMM 0;  3CC2 P;  5AW8 B;  1NVO A;  1PGP A;  4HJG H;  1JY3 O;  4EIJ A;  1SQQ G;  4RES B;  3CMA P;  1KQS O;  1D7M A;  2J59 M;  3C9I A;  2WSF H;  2ZYG A;  1RF1 B;  1SQB J;  1NWQ A;  3IFM A;  3QH9 A;  3EFF K;  2Z4E A;  2K9Y A;  5AVZ B;  1GMJ A;  2YXQ B;  3RL0 C;  4IFF A;  3E1R A;  2WMM A;  5CJ4 A;  1JTH B;  4GIF A;  1QX8 A;  1AA0 A;  5AW6 B;  2AEM A;  2QG4 A;  2K9J B;  1J2J B;  2V7Q H;  4IL6 E;  2QJK C;  2WSC H;  1WT6 A;  3A3Y B;  2Q7C A;  3I55 P;  2E74 D;  2FYU G;  3L70 D;  2W90 A;  3GLM A;  4EDF A;  5APW A;  5AW4 B;  2Y0D A;  5KJ7 A;  3KZI H;  3U1A A;  2OTJ P;  4IL6 X;  2ZXX A;  2W6B A;  3HD7 A;  1MFT A;  1FAV A;  1YTZ T;  4RO0 A;  3CME P;  3E1I A;  4WWI A;  4WVZ A;  3GF7 A;  3G71 P;  1NAY A;  3HE5 B;  2KYV A;  1KOR A;  3NXS A;  5APX A;  5GTI E;  1DX7 A;  3UIA A;  1NH4 A;  5KTB A;  1IFJ A;  3TGU D;  5EFW B;  1BDD A;  1VQ8 P;  5E79 E;  1VL2 A;  1FBM A;  2KLU A;  1LTJ A;  4I1L A;  2NPS B;  3F5H A;  3L35 A;  5AW7 B;  4Y28 J;  3AE5 C;  3GHG A;  2BEZ F;  2Q9I A;  1KMI Z;  2R3S A;  3BCC D;  1ZXG A;  2H7H A;  3JC2 2;  3L70 J;  2K9J A;  1LNQ A;  5B66 H;  4Y99 C;  1IK7 A;  2FY8 A;  5TIS E;  1SQB K;  1Q81 Q;  3HE4 B;  3TK1 A;  1GW4 A;  3CX5 I;  2IYO A;  2RMZ A;  1M8O B;  3CCL P;  1LTB C;  3M9Q A;  1EDL A;  2WPQ A;  2B87 B;  2QA4 P;  1YJN P;  3H1I G;  3NMD A;  1SQX E;  3HRN A;  4U7J A;  1ZOY C;  1OIP A;  1L4A B;  3L37 A;  5KLV G;  3KYQ A;  5KJ7 D;  1VQ4 P;  3FWL A;  2IZ1 A;  4H13 D;  2HPC A;  1X0T A;  1LTG C;  3II6 A;  1X8Y A;  3WU2 E;  4WY4 D;  3AE7 C;  2KNC B;  2QIW A;  3PLN A;  1JM0 A;  1CW5 A;  3BCC J;  1HTL C;  3FXE A;  2MJZ A;  1GU4 A;  1NOH A;  1OW8 A;  2XNX A;  1NKZ B;  2D2C D;  1M1J B;  3L74 D;  1VQL P;  3HD7 C;  4HKZ H;  1K73 Q;  3VP9 A;  4OVN F;  2N9Y B;  5CCH D;  2QEX P;  2IDB A;  3LW5 J;  5BU8 B;  3CXH D;  5CCG D;  2IZ0 A;  2E5Y A;  2AXT H;  4RKU J;  3IN6 A;  3BAT A;  2WWW A;  3RK3 D;  3FGA D;  1BCC G;  2OYI B;  3CWB J;  2E75 B;  4DCK A;  3USS A;  3SWF A;  4OGQ D;  3KQG A;  2WSF J;  3Q5P A;  4W7Z A;  4GOF A;  2QSI A;  1SP4 A;  2NZ2 A;  1HGV A;  4C46 A;  1EZV E;  3RBZ A;  2E42 A;  2M3E A;  2B88 A;  1JO5 A;  4W7Y A;  5AW3 B;  2V7Q J;  5GTI H;  3L74 J;  4DJG A;  2WSC J;  2JEE A;  1JCC A;  4WB4 A;  1NTZ D;  3IR9 A;  1VQN P;  3V4W A;  3JCU H;  1FOS E;  1Q90 D;  3ABV C;  1OVR A;  3PH0 A;  1YJW P;  1FZF A;  1PP9 G;  2E76 D;  3FX0 A;  3SWK A;  1LTT C;  3W68 A;  4N78 E;  4OWF A;  2WT7 B;  2N9B A;  2YKO A;  2OYI A;  3AEG C;  1NTM D;  1JB0 J;  4PV1 D;  1NU1 J;  1GL2 D;  2O01 N;  3D70 A;  1NTK E;  3HUS A;  1EC5 A;  1VQ9 P;  4C7N B;  2NPS C;  1SLQ A;  4U3F E;  2GM4 A;  4IOI H;  2FFD A;  1NTZ J;  5DJT B;  3AEC C;  2R3C A;  1RE3 C;  2LKM A;  1EXI A;  2R32 A;  3PP5 A;  3P32 A;  4IFD K;  1RE4 A;  3WU2 H;  1A02 J;  2Z5H A;  1P84 E;  5AVW B;  1L2P A;  2KZI A;  4EYY Q;  1L4A C;  4PD4 H;  3H1H D;  1NTM J;  3M9H A;  2QJK B;  1SFC A;  1G2C A;  3WUV A;  3H1K E;  3G3Z A;  3L72 G;  1X9V A;  5K5G B;  1JMB A;  2WSE H;  2IBZ E;  1BE3 E;  2KB7 P;  1SQQ E;  1R5S A;  3RBX A;  4C7N A;  4EOT A;  3TSI A;  3B4S A;  1OVU A;  1Y47 A;  3TF5 A;  3CCS P;  1HUC A;  3TNU B;  2YIU B;  1KB9 E;  1FDM A;  3C1L A;  2WPR A;  1AQ5 A;  1VQ5 P;  1FS0 E;  3AE6 C;  3V5B A;  3CCJ P;  1NU1 K;  2E74 B;  3BRT B;  3L71 E;  4ZNC A;  2Q3E A;  2O01 J;  1FC2 C;  1BSH A;  1DEE G;  1S2E A;  3CC4 P;  4MN4 C;  2O1J A;  5AVV B;  3H1H J;  2OYI C;  2BEQ D;  1NTZ K;  3F89 A;  4YXW H;  1SQV J;  2FYU E;  1M1K Q;  4XE5 B;  3PJS K;  4O9B A;  2W6A A;  1ZW0 A;  1VF5 D;  1HGZ A;  4L76 A;  1NTK G;  1LTI C;  3L36 A;  1BGY J;  3L75 J;  3S9O A;  2FBW C;  5AVY B;  3WUU A;  2FFD C;  1RF0 C;  2BCC D;  3MGN A;  4UB6 E;  1N73 A;  1W5C E;  4ZKP A;  1SQX D;  1Z56 A;  2HLO A;  1RE4 C;  5AVT B;  1JUN A;  1J1D B;  2OAR A;  4BXL A;  1IO4 A;  1R5L A;  1SFC C;  1G1I A;  1FZG A;  1S3J A;  2C9N Y;  4R4M A;  3H1J D;  2WQY C;  3L4F A;  3H1L G;  3PTZ A;  2QJP B;  2ZAE B;  3EFG A;  1GK4 A;  2YKP A;  4H0L D;  1SVF A;  1M56 D;  4H13 B;  1GZL A;  4HYT B;  3GF3 A;  3H1I E;  2LR2 A;  1P84 I;  4PJ0 E;  2IBZ G;  1CI6 A;  1KQL A;  2BCC J;  3CWB G;  3B5N A;  1H88 A;  1FDI A;  3I5C A;  2ZT9 D;  1BE3 G;  4AQR D;  1SQX J;  5KLV E;  4AYC A;  3A0B E;  1HJ0 A;  1HWT C;  1SQP J;  1SQV K;  1AVY A;  4JF7 A;  3Q1M A;  2D2C B;  3L73 J;  2XV5 A;  3KXD A;  4Z1M H;  1YI2 P;  3ZDM A;  1LTJ B;  2IBZ I;  2XZR A;  3S1K A;  1A02 F;  4H0L C;  3O6Q A;  3GHG B;  3L71 G;  4LGD E;  2SPZ A;  3G6E P;  5KAI H;  1EZV D;  2G3A A;  2KZJ A;  4HB1 A;  2P2U A;  3H1J J;  2J5U A;  1VQK P;  1VQ7 P;  1KB9 I;  3RK3 B;  2YO3 A;  2P1J A;  1Q7Y Q;  1KZU B;  1DEB A;  1JMM A;  2K3R A;  1TU3 F;  1L0L D;  2WSE J;  3CXH H;  2WTY A;  2QVA A;  3B71 A;  5KAF H;  3OW2 O;  1N73 C;  4WY4 A;  1VQ6 P;  4L73 A;  1BCC E;  3GW6 A;  3V6I A;  1N7L A;  2IPP A;  3VMY A;  2YIU C;  2PRR A;  1NU1 G;  2HPC B;  1EDI A;  2YXR B;  4N78 D;  3RK2 D;  3V2P A;  3P8C E;  3EWK A;  1ZME C;  2GUV A;  2E74 C;  3B5N D;  1L0N D;  1KIL E;  2B9B A;  1NTK D;  5CCH A;  4D6T D;  1SQX K;  2K1A A;  3A2A A;  3P8M C;  3MZW B;  1SS1 A;  5CCG A;  2E76 B;  3V4Q A;  1IFI A;  3KPE A;  1T6A A;  4U3F D;  2AXC A;  1SQP K;  2WIT A;  1L0L J;  1EXJ A;  1XTG B;  3BAS A;  1YJ9 P;  4PV1 B;  4H44 D;  3RGU A;  2CPB A;  4JBZ A;  1GL2 B;  3CX5 H;  3QWO C;  3B5N C;  3VMA A;  1USD A;  1PP9 E;  4GOD A;  1KV4 A;  1W2B O;  3MTU E;  3V2N A;  4IFM A;  5GTH E;  1PPJ G;  1FDO A;  2JWD A;  4I7Z B;  1FJK A;  3M0D A;  2JDI H;  3TGU J;  1X22 A;  2Q1K A;  2M5A A;  1VQP P;  3H1K D;  1L0N J;  2IX7 C;  1FZC A;  1J1D C;  4H44 C;  4UB8 E;  5BVZ A;  4D6T J;  2IBZ D;  5AVQ B;  2A06 G;  2W6J H;  3CI9 A;  5APU A;  1SQQ D;  2DW3 A;  1OVV A;  5KKZ B;  4YPC A;  4NPE A;  3MD0 A;  3NTN A;  3A0B H;  3M9B A;  3M06 A;  1JOC A;  4I6M C;  1XTC C;  2QJP C;  2C9L Y;  5B5E E;  5KJ7 C;  1JCD A;  5APT A;  1WMK A;  2PP6 A;  4H13 C;  1YIJ P;  3A5T A;  1T3U A;  4WY4 C;  2HYN A;  3L71 D;  2O01 H;  1X79 B;  1QL2 A;  1GL2 A;  2JKV A;  3CCM P;  2Y9Z A;  1SQV G;  3CPW O;  2KS1 A;  1K9M Q;  1IK9 A;  3G4S P;  1URQ A;  4IL6 H;  1L0L K;  3L72 E;  2D2C C;  2FYU D;  3HUS B;  1LTJ C;  3PHL A;  2JO1 A;  5CCH C;  3GHG C;  1GK6 A;  3AE1 C;  3SSU A;  1FE6 A;  2Z5I A;  2GA1 A;  5CCG C;  2FFD B;  3TYY A;  4L74 A;  1PIX A;  5AVR B;  3RK3 C;  2OGU A;  1IJD B;  2XU6 A;  2QJY C;  4OGQ C;  1L0N K;  5E79 H;  3NFQ A;  3VN0 A;  2KSJ A;  1VF5 B;  2W8Z A;  3CX5 D;  1U7M A;  3MIW A;  1LGH B;  1JY2 N;  4M3L A;  1SFC B;  1G2C B;  2ZVO B;  1LT9 A;  2M0B A;  2YKQ A;  1AFO A;  2FYU J;  2A45 H;  4ASW A;  4K3A A;  1JY3 N;  5C39 A;  1ZRT E;  5TIS H;  1FZC C;  1EDJ A;  1MZ9 A;  3T97 A;  4KHX A;  4JYC A;  2GUS A;  3H1I D;  1LP1 B;  1URQ D;  2WVR A;  5CBN A;  1PFI A;  2E76 C;  3L73 G;  1N7S A;  1SQB G;  1KIL A;  5KLV D;  2OTL P;  5APY A;  2OQQ A;  4PV1 C;  1YQ3 C;  1PZQ A;  1H8A A;  1FOS F;  1YYC A;  2IFM A;  3I56 P;  4H0L B;  4EI2 A;  1GL2 C;  4ZMD A;  2OYH A;  1U7J A;  1DD4 A;  1LT1 A;  2H89 C;  2FXM A;  1URQ C;  5KLI C;  2P58 A;  3H1L E;  4ASV A;  4I7Z C;  5M1B A;  1VDF A;  4HH2 A;  1NAF A;  3AE2 C;  4W80 A;  1USE A;  2G8Y A;  1MKM A;  4WBA A;  3H1I J;  3CWB E;  1N73 B;  5APV A;  1LWU A;  1KYO I;  1LP1 A;  1ZR2 A;  5KLV J;  2ZJS E;  2KIK A;  5KKZ C;  2E5T A;  3A7O A;  1BCC D;  1IFP A;  2ZXE B;  2R5B A;  2N1T A;  1IC2 A;  2FYU K;  1MV8 A;  1M57 D;  1OXZ A;  5APS A;  2YNY A;  1FJP A;  4TT3 H;  2FKW B;  3P8C D;  3O8Z A;  1KFN A;  3OA7 A;  4N6J A;  1KC8 Q;  1N7S D;  3D6Z A;  2ITA A;  1NO4 A;  1KIL D;  4DOJ A;  3H6P A;  1ZV8 A;  3L70 G;  3JSV C;  3R4Y A;  2H88 C;  1YHQ P;  2I8D A;  1OW6 A;  3KZI E;  3VYI A;  3OAK A;  1QLE D;  2CK3 H;  2Y0C A;  3SWY A;  4CPG A;  1JY2 P;  3HUS C;  3RK3 E;  3RK2 B;  1CI6 B;  3B5N B;  2JWA A;  1FU1 A;  1JY3 P;  1OMI A;  1H0T A;  3PRJ A;  1PP9 D;  3TGU G;  1BCC J;  2W83 C;  3GG2 A;  1E5W A;  1J1E C;  1NU1 E;  1NTM K;  2IYP A;  1R8E A;  2LXC B;  3VMX A;  3R2P A;  3O6Q B;  3MUD A;  4H44 B;  3BCC G;  2HOD A;  1VF5 C;  5B66 E;  2N1T D;  1GTW A;  3P7K A;  1OFC X;  5KLV K;  1BSN A;  1NJI Q;  2KI7 B;  4OH8 B;  1NGM B;  3CD6 P;  1WRG A;  5L8R J;  2VRS A;  3Q2Y A;  4WY4 B;  1GDT A;  1KTM A;  1P84 H;  3AE8 C;  1MUU A;  1PPJ E;  1K05 A;  3VTP C;  1T3J A;  4LLH A;  3Q3D A;  1RHZ B;  3RL0 D;  4BRY A;  1FZB A;  3G9R A;  3L72 D;  4TLF A;  1M90 Q;  2KP8 A;  2JR8 A;  2M8R A;  1UIX A;  1HH0 A;  2A06 E;  3L74 G;  2Y0E A;  1KN7 A;  5AW1 B;  2ZT9 C;  1PV3 A;  1MFZ A;  1KB9 H;  3AEA C;  2QJY B;  2AXT E;  2L91 A;  3H32 A;  4OGQ B;  2H43 A;  3V2Q A;  3IF4 A;  3D6Y A;  3H1H E;  1U57 A;  3Q5R A;  1SQV E;  3MHV A;  1PGQ A;  1KQF B;  2XDJ A;  2M5A B;  1NKN A;  3CXH I;  1YTZ I;  3L72 J;  1H89 A;  2UWJ E;  2P7J A;  1RQU A;  1BGY E;  3L75 E;  4L75 A;  1HVV A;  3MUD C;  2PGD A;  1FZC B;  1S9K E;  1G1J A;  1ZRT D;  1NTZ G;  2ZYD A;  4K35 A;  4UB6 H;  1VQO P;  4BWN A;  3JCU E;  2HFE D;  1RF1 A;  1RY3 A;  2CPS A;  3Q5S A;  2YMK A;  3AEE C;  3E7K A;  3RK2 C;  5DJU B;  3D71 A;  5H2F E;  1OWA A;  1PGJ A;  1JTH A;  1Q82 Q;  2YO2 A;  3CCQ P;  2KS1 B;  3KHU A;  1NTM G;  1P84 D;  3TDK A;  1URQ B;  5KLI B;  1QGK B;  4GT1 A;  2QE7 H;  3A0H E;  2O3J A;  2J58 A;  2KOG A;  1LJ2 A;  1K04 A;  2FXP A;  3H1L D;  2BCC E;  1GW3 A;  1IFD A;  3LIE A;  1NTK J;  3HE5 A;  4PJ0 H;  1N86 A;  1SQP E;  2L5G B;  1T8Z A;  3CWB D;  3U1C A;  3HD7 D;  3L73 E;  1BE3 D;  4U3F J;  1VQM P;  1SQB E;  5CHX A;  2H8P D;  4QMA A;  4DZO A;  2WPS A;  4LC1 A;  2PFX A;  5AVU B;  2QRX A;  1KB9 D;  3U59 A;  2FYN C;  4A7P A;  1KFM A;  1YIT P;  3B8E B;  1JEK A;  2NPS A;  1CZQ A;  1KD1 Q;  1PL5 A;  3W67 A;  3H1J E;  4ZKU A;  4PD4 E;  1LTS C;  3H1H G;  1ZR4 A;  2O1K A;  2HG5 D;  3CCR P;  4AUW A;  5CJ0 A;  4GDO A;  1LT9 B;  1KYO E;  5APQ A;  1RE3 A;  4XFJ A;  3H1L J;  2BAS A;  5TJH A;  3HE4 A;  4GKG A;  3T97 B;  1W2E A;  3H1K J;  4RJT A;  4GOE A;  3SFD C;  3AE4 C;  1BGY G;  2B87 A;  3L75 G;  5CMZ A;  2I1K A;  3BRV B;  3WUT A;  5CBO A;  4JYB A;  3AED C;  1OX3 A;  1BE3 J;  3H25 A;  1L4A A;  1SQQ J;  1PGO A;  2V4H A;  1N7S B;  4XA4 A;  1KIL B;  2ZFC A;  2AEF A;  1YQ4 C;  2I1J A;  1RF1 C;  1J1E B;  1S5L E;  2PAJ A;  2FYZ A;  1RH5 B;  1NU1 D;  1S1C X;  3OJA B;  4R4L A;  4N3Y B;  1S5L X;  2Q3I A;  1KQG B;  1IFM A;  2OYH B;  2Q5U A;  2KNC A;  3L71 J;  1NTK K;  3N4X A;  1QEX A;  2WPV B;  5AW0 B;  3FXD A;  3L70 E;  1L0L E;  3S4R A;  1QVF O;  2KUB A;  3N7N A;  2KXP B;  2A45 G;  3M0D C;  2WZ7 A;  1M1J A;  3CLQ A;  3CC7 P;  2E43 A;  1JNM A;  2NPS D;  3VMZ A;  2C0W A;  4NPD A;  2BCC G;  5AVX B;  3IAO A;  5H2F H;  1SQX G;  3AEB C;  2P10 A;  1NHL A;  1LWU B;  1HJB A;  2A45 I;  3TGU E;  1SQP G;  1T2K D;  2N1T B;  5GTH H;  1PPJ D;  1DH3 A;  4NPF X;  1L0N E;  2WSS H;  3VOP A;  3A0H H;  2K88 A;  1ZP0 C;  4D6T E;  2LXB A;  5AW2 B;  4KJM A;  3ITK A;  1E79 H;  2R5D A;  3BCC E;  1Q2N A;  1IFN A;  1L4A D;  3HTK B;  1RF0 A;  4UB8 H;  3H1J G;  4YXD C;  1ZLL A;  1SQQ K;  1GU5 A;  2A06 D;  3V2R A;  3LID A;  1M7L A;  5BU5 A;  1T2K C;  2ZT9 B; 
#chains in the Genus database with same CATH homology
 2HOD A;  4N78 D;  3RK2 D;  3V2P A;  3P8C E;  3BAT A;  2WWW A;  1HBW A;  2GUV A;  3RK3 D;  1LTA C;  2OYI B;  2N1T D;  3RL0 B;  1GTW A;  3B5N D;  3P7K A;  5KLV K;  3SWF A;  3KDP B;  3KQG A;  5AVS B;  2QM7 A;  4W7Z A;  5CCH A;  4OH8 B;  1SP4 A;  1SQX K;  1QL1 A;  1HGV A;  4C46 A;  3A2A A;  3P8M C;  1CSB A;  4B86 A;  5CCG A;  3V4Q A;  1IFI A;  3KPE A;  1WRG A;  2VRS A;  1FZA A;  1SQP K;  2WT7 A;  2E42 A;  2WIT A;  4WY4 B;  1GDT A;  1XTG B;  3BVH A;  3BAS A;  1JO5 A;  1MUU A;  4W7Y A;  5AW3 B;  3VTP C;  2CPB A;  4C7R A;  1GL2 B;  1T3J A;  2JEE A;  1JCC A;  4WB4 A;  4LLH A;  3B5N C;  2HOD B;  3IR9 A;  3RL0 D;  3M0A A;  2M3B A;  1FZB A;  3V4W A;  1S9K D;  3MTU E;  1EQ7 A;  1FOS E;  3V2N A;  4IFM A;  3HTK A;  1M1J C;  2IFN A;  1FJK A;  1LT9 C;  3M0D A;  1FZF A;  2KP8 A;  2M8R A;  2POH A;  1HH0 A;  1LTT C;  2IX7 C;  4N78 E;  2WT7 B;  5AW1 B;  1J1D C;  1FZC A;  2N9B A;  2YKO A;  2OYI A;  1FZE A;  5BVZ A;  1MFZ A;  5AVQ B;  2JJL A;  1GL2 D;  3CI9 A;  3M91 A;  3H32 A;  5APU A;  3HUS A;  2H43 A;  3V2Q A;  1N7S C;  4C7N B;  2NPS C;  3MD0 A;  3NTN A;  3M9B A;  4Y99 B;  1KIL C;  3M06 A;  1SLQ A;  1JOC A;  2C0X A;  4I6M C;  1XTC C;  2C9L Y;  5KJ7 C;  1JCD A;  5APT A;  3EQ2 A;  2GM4 A;  2FFD A;  2PP6 A;  2QM8 A;  3A5T A;  1T3U A;  2XDJ A;  4WY4 C;  2OYH C;  2HYN A;  2R3C A;  1RE3 C;  1NKN A;  2LKM A;  1X79 B;  2O01 H;  1YTZ I;  1QL2 A;  2R32 A;  1SFC D;  3PP5 A;  1GL2 A;  3P32 A;  4IFD K;  3CL3 D;  1RE4 A;  1H89 A;  2P7J A;  2KLV A;  1A02 J;  2XKM A;  1HVV A;  1FZC B;  1IK9 A;  3TNU A;  1S9K E;  2Z5H A;  5AVW B;  1URQ A;  1G1J A;  1L0L K;  1VPC A;  2P67 A;  1N2D C;  3H32 B;  3HUS B;  1L4A C;  2YMY A;  1LTJ C;  3M9H A;  5CCH C;  3GHG C;  1GD2 E;  1SFC A;  1GK6 A;  1G2C A;  3G3Z A;  2HFE D;  1RF1 A;  2Z5I A;  5CCG C;  1RY3 A;  2FFD B;  2CPS A;  1X9V A;  5AW9 B;  1ZN5 A;  3TYY A;  2WSE H;  1LWU C;  2W27 A;  3VP8 A;  3RK2 C;  5AVR B;  3RK3 C;  1OWA A;  2N1T C;  1JTH A;  2KB7 P;  3HD7 B;  2YO2 A;  1JY2 O;  1IJD B;  4I2L C;  4C7N A;  4EOT A;  2XU6 A;  3TSI A;  3LW5 H;  5AW5 B;  1HUC A;  3TNU B;  1L0N K;  1URQ B;  3WMM 0;  3NFQ A;  1FDM A;  4GT1 A;  5AW8 B;  2WPR A;  1JY3 O;  2KSJ A;  3VN0 A;  1AQ5 A;  4EIJ A;  2J58 A;  4RES B;  3MIW A;  2KOG A;  1NU1 K;  3V5B A;  3BRT B;  1LGH B;  1JY2 N;  2J59 M;  1GW3 A;  4M3L A;  1SFC B;  1G2C B;  3C9I A;  1IFD A;  1LT9 A;  2WSF H;  3LIE A;  1RF1 B;  2YKQ A;  1NWQ A;  1AFO A;  3HE5 A;  3IFM A;  2A45 H;  2O1J A;  1N86 A;  2Z4E A;  2L5G B;  1JY3 N;  5AVV B;  1T8Z A;  5AVZ B;  1FZC C;  2OYI C;  3U1C A;  1MZ9 A;  3T97 A;  3RL0 C;  3HD7 D;  1NTZ K;  4IFF A;  5CJ4 A;  1JTH B;  4GIF A;  5CHX A;  2H8P D;  4KHX A;  4DZO A;  4JYC A;  4XE5 B;  5AW6 B;  2GUS A;  2WPS A;  4LC1 A;  1URQ D;  5AVU B;  4O9B A;  2W6A A;  3U59 A;  1J2J B;  1KFM A;  1PFI A;  2WSC H;  3B8E B;  1WT6 A;  1HGZ A;  1N7S A;  2NPS A;  1CZQ A;  3A3Y B;  2Q7C A;  1KIL A;  1LTI C;  3L36 A;  4ZKU A;  5APW A;  2FFD C;  1LTS C;  5AVY B;  5AW4 B;  1RF0 C;  5KJ7 A;  3MGN A;  3U1A A;  1ZR4 A;  1N73 A;  2O1K A;  2HG5 D;  2W6B A;  3HD7 A;  4ZKP A;  1FAV A;  4AUW A;  5CJ0 A;  5APY A;  1YTZ T;  1Z56 A;  1H8A A;  3E1I A;  1FOS F;  1LT9 B;  1YYC A;  2IFM A;  2HLO A;  1GL2 C;  5APQ A;  2OYH A;  1RE3 A;  3HE5 B;  1RE4 C;  2KYV A;  2BAS A;  2FXM A;  3HE4 A;  4GKG A;  5AVT B;  3NXS A;  5APX A;  1URQ C;  1W2E A;  1DX7 A;  3UIA A;  1JUN A;  1J1D B;  1NH4 A;  5KTB A;  5CMZ A;  2I1K A;  3BRV B;  1IFJ A;  1VDF A;  4JYB A;  2OAR A;  1IO4 A;  4HH2 A;  1NAF A;  4W80 A;  1FBM A;  1L4A A;  1SFC C;  1G1I A;  1LTJ A;  1FZG A;  1N7S B;  4I1L A;  2NPS B;  4XA4 A;  2C9N Y;  3L35 A;  5AW7 B;  1KIL B;  2ZFC A;  3L4F A;  2I1J A;  3GHG A;  1RF1 C;  4WBA A;  1J1E B;  2PAJ A;  2Q9I A;  2FYZ A;  3EFG A;  1N73 B;  1GK4 A;  5APV A;  2YKP A;  1SVF A;  1GZL A;  1LWU A;  3OJA B;  2H7H A;  4HYT B;  4N3Y B;  1ZR2 A;  2Q3I A;  1IFM A;  2OYH B;  2Q5U A;  3A7O A;  1CI6 A;  1KQL A;  4Y99 C;  2ZXE B;  2R5B A;  2N1T A;  1NTK K;  1SQB K;  1IC2 A;  2FYU K;  3HE4 B;  3TK1 A;  1MV8 A;  3B5N A;  3N4X A;  1H88 A;  3I5C A;  4AQR D;  5AW0 B;  1GW4 A;  1OXZ A;  4AYC A;  5APS A;  1LTB C;  3M9Q A;  2YNY A;  2WPQ A;  1FJP A;  3N7N A;  2FKW B;  3P8C D;  3O8Z A;  2A45 G;  3M0D C;  1HWT C;  1SQV K;  2WZ7 A;  1KFN A;  1M1J A;  3CLQ A;  3OA7 A;  3NMD A;  4JF7 A;  4N6J A;  3HRN A;  1JNM A;  2E43 A;  2XV5 A;  1N7S D;  2NPS D;  1NO4 A;  3VMZ A;  1KIL D;  1L4A B;  4DOJ A;  3L37 A;  1LTJ B;  2C0W A;  3H6P A;  1ZV8 A;  3KYQ A;  1A02 F;  2XZR A;  3GHG B;  5KJ7 D;  4LGD E;  3VYI A;  3OAK A;  5AVX B;  2HPC A;  1LTG C;  3SWY A;  3II6 A;  1X8Y A;  4WY4 D;  1JY2 P;  1NHL A;  2P2U A;  1LWU B;  1HJB A;  2A45 I;  3HUS C;  3RK2 B;  1T2K D;  3RK3 B;  2YO3 A;  2P1J A;  1CI6 B;  2N1T B;  1CW5 A;  1DH3 A;  3B5N B;  1KZU B;  1DEB A;  1JMM A;  1FU1 A;  1JY3 P;  3VOP A;  1HTL C;  2MJZ A;  1GU4 A;  1NOH A;  5AW2 B;  2XNX A;  1NKZ B;  1E5W A;  2WTY A;  1J1E C;  1M1J B;  2R5D A;  1NTM K;  1IFN A;  1L4A D;  1N73 C;  3HTK B;  4WY4 A;  3HD7 C;  3VP9 A;  1RF0 A;  5CCH D;  3VMX A;  3R2P A;  1ZLL A;  5BU8 B;  1SQQ K;  1GU5 A;  1N7L A;  2IPP A;  3VMY A;  3V2R A;  3LID A;  1M7L A;  5CCG D;  5BU5 A;  3MUD A;  1T2K C;  2HPC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...