1HVVA

Self-association of the h3 region of syntaxin 1a: implications for snare complex assembly
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
67
structure length
67
Chain Sequence
QALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Endocytosis/exocytosis
molecule keywords SYNTAXIN 1A
publication title Self-association of the H3 region of syntaxin 1A. Implications for intermediates in SNARE complex assembly.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 30
structure length 67
sequence length 67
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-01-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1hvvA00
3B5NC 1N7SA 1URQB 3TSIA 1L4AD 1NHLA 3RK2D 5KJ7A 2WZ7A 5CCGA 1URQC 2HFED 3HD7A 5CCHA 1JTHB 4W7YA 4OH8B 4WY4A 5CCGD 3HD7D 2M8RA 5CCHD 1GL2B 4WY4D 2H8PD 3P8CE 1GL2C 1KILA 2NPSC 4LGDE 3M0DC 1HVVA 1XTGB 1L4AB 3RK3D 3RK2B 3VOPA 1N7SD 3RL0D 4W7ZA 5KJ7D 1L4AC 3HD7B 2XDJA 2NPSA 3B5NA 3PP5A 4WY4B 1SFCB 2N1TB 1URQA 4W80A 1URQD 1SFCC 2N1TC 1KILD 1JTHA 1N7SB 4N78E 3RL0B 2KOGA 1GL2A 4JF7A 1T3JA 1GL2D 1N7SC 3RK2C 3B5ND 2NPSD 5CCGC 3HD7C 5CCHC 3HTKB 4WY4C 1L4AA 1KILB 3KYQA 3RK3B 2PP6A 1KILC 2HG5D 3RK3C 1SFCA 3RL0C 2N1TA 3B5NB 2NPSB 1SFCD 5KJ7C 2N1TD 2YMYA
chains in the Genus database with same CATH superfamily
3OAKA 4PD4D 5CBOA 3M9BA 3JCUH 1JUNA 1FZCB 5CJ4A 1R5SA 1NTKJ 2K1AA 4U3FE 3S4RA 3W67A 1LTSC 3SWFA 1SQPK 1KILA 2ZVNB 3KPEA 1NH4A 1SQQE 3RL0D 3Q2YA 2FXPA 3H1LJ 2L5GB 3GHGC 2FYUG 3G9RA 5AVVB 4YXDC 1VQKP 4BRYB 5TISE 3TDKA 2WMMA 1JMMA 4IL6H 1S9KE 1AA0A 3HRNA 4U3FD 1PP9E 2ZVOB 2RH0A 3WUTA 1X0TA 1D7MA 3CLQA 5H2FE 3B5ND 1FC2C 4GOEA 1SQQD 2BCCG 2JWAA 1H89A 5AW3B 2HYNA 1SFCD 4L75A 4IFFA 1K04A 4UB8E 1URQB 3L74E 1SQXK 1USDA 1N2DC 1LT9B 2XV5A 3P7KA 1CZQA 5B66E 2C9NY 1H8AA 3P8CE 1GL2C 1NJIQ 2AXTE 3CXHI 5L8RJ 4JBZA 2A06E 2GA1A 2IYPA 1L0NK 1NKZB 1GW3A 3Q5PA 2I8DA 4WY4B 3A2AA 2KP8A 5APQA 2WSEJ 5APXA 3BASA 2ZAEB 2ITAA 1YJ9P 3H1JD 2E5TA 1BE3J 4PD4H 3JC22 4OVNF 4GOFA 3H1HE 2FFDB 1SQPD 1T3JA 3AECC 2WSCH 1WRGA 3L70G 4L74A 2E74B 2NPSD 2JEEA 2ZT9C 2KK7A 2HPCA 1RF0C 4GT1A 3V2NA 2B87A 4H44B 4CPGA 3TNUB 2YO2A 1K73Q 2Y9YA 1PGPA 1T6AA 2YXRB 5KAFH 1SQVK 3CWBG 1SQXE 3H1HD 1VQ5P 3CC4P 1SQBG 1JTHB 1DD4A 1K9MQ 2I1JA 3G3ZA 3HTKA 3SFDC 3HE5B 1RE4A 2FYUJ 3CCJP 4PV1B 2W8ZA 2FXOA 3H1JJ 1HJBA 3LW5H 1SQPJ 2JP3A 3D71A 5TISH 4YPCA 3B5NA 1YITP 1IFJA 2G8YA 1SQXD 3AEGC 2FYNC 1N73A 1KD1Q 1LNQA 1EZVG 4WWIA 3PRJA 1RQUA 1GW4A 3U1CA 2IPPA 1E79H 1Z56A 4IL6X 5H2FH 3M0DA 4I6MC 1NTMG 2IFMA 4DZOA 1L0ND 3WUVA 4AUWA 1J1EC 3HD7C 3FWNA 1FU1A 2P58A 1KV4A 2XZRA 3AE1C 1SQVE 1AQ5A 1NYHA 3EFGA 1EDJA 1GU5A 4HKZH 1ZV8A 4D6TD 1W5CE 2K9JA 4UB8H 1IFPA 2Y9ZA 4KHXA 3T97A 1T8ZA 1J1DC 2OTLP 3H1KG 2YXQB 2WTYA 1FOSF 4WY4D 2LXCB 1S4XA 1BGYD 3CI9A 4C46A 4RJTA 2AXTH 3WU2E 3B71A 1XTCC 2KYVA 3CCUP 1SQVD 1NTKK 3M0AA 3L73E 1TU3F 1L0LD 2O01N 3CMAP 2JO1A 3RK2B 2BASA 2WSFJ 3RGUA 1YYCA 3JCUE 3CX5E 2NPSA 2CPSA 1LP1B 1QVGO 1L0NJ 5AW0B 3CC7P 2JJLA 1IO4A 1BCCD 2Y0DA 1T2KC 1NU1E 2IBZG 4LC1A 5CHXA 1PGJA 1NTZE 1RF1C 2KI7B 2N1TC 1FZCA 3B8EB 2V7QJ 2P2UA 1G2CB 4B86A 1A02J 4TT3H 2E76C 3H1IE 5APWA 4D6TJ 2W6JH 2KSJA 3L73D 1VF5C 2RMZA 1AV1A 4QMAA 2IX7C 1AVYA 3CX5D 5KTBA 3L36A 4H13C 3V4WA 2WPRA 1KILC 3L75J 4RKUJ 5AW7B 1BGYJ 1BSNA 2R5BA 5B5EH 3IF4A 2QRXA 4BXLA 1CI6B 4ZNCA 3PHLA 4PV1D 1L0LJ 3H1ID 2Z4EA 1AJYA 5CCHA 3HUSC 2FXMA 4ASWA 2R5DA 3H6PA 1ZXGA 3WMM0 1BCCJ 1NOHA 3NMDA 1W2BO 3V2PA 4HH2A 4OGQC 3KQGA 2PRRA 2QM7A 1X22A 1NTKE 3VP9A 3RBXA 1OW7A 3L71G 5GTHE 2WPQA 1HVVA 1YIJP 4A7PA 1YQ4C 2QJYB 2M0BA 4DJGA 3PLNA 1SFCB 1URQA 2VRSA 3H1LE 3TF5A 2M5AB 1VL2A 1FBMA 1JY3P 1LT9A 3OA7A 3Q1MA 2W83C 3MP7B 4N78E 2RN0A 1Y8AA 1JCDA 3VMXA 3CPWO 2YKOA 1KB9E 1NTKD 2RKLA 1JCCA 2BEZF 1LT1A 4KJMA 1KYOD 3VYIA 2R44A 5AVTB 1VQNP 1JMBA 1S3JA 2K9YA 2PP6A 4PD4E 4U3FG 1OVUA 3U1AA 4O9BA 2E42A 5APSA 4EOTA 5AVYB 5M1BA 3QH9A 4N78D 1IFMA 4H0LC 3M91A 2A45H 1KB9D 2FFDA 3MHVA 3RK2D 3G4SP 1FE6A 1NO4A 3CC2P 4UB6E 5CCGD 3CCSP 3M9QA 4NPFX 3VMZA 2H8PD 4WVZA 3A3YB 1KMIZ 3TNUA 2WPSA 1SVFA 2KIKA 1PP9G 1EDLA 3RK3D 1L4AB 1FZBA 3NTNA 1PPJE 1QX8A 3CX5H 4W7ZA 1OXZA 2ZT9B 1VQ9P 2XDJA 1FDMA 2FYUK 3MZWB 1S1CX 1W2EA 3CCQP 2KNCA 2OYHB 1JTHA 2POHA 1Q82Q 3H32B 1RE3A 1M1KQ 5GTIE 1U7MA 2YKPA 3HE5A 1BE3E 1IFIA 1JY3N 1LTJB 2KS1A 1QEXA 1PPJD 3L74G 4M3LA 1PFIA 1HTLC 1X9VA 2K37A 5DJTB 1FZAA 1RE4C 3VN0A 3A7OA 1QGKB 1FJKA 5KKZC 2IZ0A 2YKQA 2O01J 2WPVB 3B5NC 1VQ7P 3BCCG 2A06G 1M1JB 1NHLA 3D6ZA 2WZ7A 1RHZB 2NRGA 1BE3D 2LKMA 1X79B 4EDFA 2M8RA 1ZP0C 4GKGA 3FWLA 3TGUJ 5GTHH 1S72P 2JR8A 3M0DC 2Y0CA 3OW2O 2DW3A 1J1EB 2FYUE 3HD7B 3D6YA 3H1JE 5CMZA 5EFWB 4Y99C 1SQPE 3CD6P 5KLIB 2P67A 3CCVP 1HH0A 1KORA 3FXDA 3AE8C 3NXSA 1KB9H 2Q3EA 1GL2D 3R4YA 2WVRA 2OYOA 1HGZA 2A45I 3GF3A 1JY3O 1VQPP 2FYUD 3E7KA 1PL5A 1VQ8P 1DH3A 2CPBA 4BWNA 1LTIC 2GUSA 2WQYC 2HR3A 1LP1A 1EC5A 5KJ7C 3QWOC 3EFFK 2H88C 3CX5I 1Q2NA 2KSEA 1OZHA 2D2CC 3AE6C 1L4AD 3AEDC 1DX7A 4UB6H 4EIJA 2R3SA 2ZT9D 5TJHA 1FZCC 1QLED 2BCCD 1L0LK 2IZ1A 5B5EE 3O8ZA 3Q5RA 1OX3A 2Q3IA 4LGDE 4GIFA 2OYIB 3CCMP 3PP5A 1VF5B 3LIDA 1CI6A 4JYBA 2QE7H 4K3AA 1JEKA 4H13B 4NPEA 3TYYA 5KAIE 3RBZA 1L0NE 2WSEH 1HJ0A 2MJZA 5GTIH 2P1JA 3HE4B 2PAJA 1GMJA 2FBWC 1PZQA 1U57A 4GODA 1MFTA 5CCHC 3AE5C 2Q6QA 2AEJA 5DJUB 2KLUA 1IK7A 4D6TE 3HUSB 1LTGC 2M3BA 2W27A 3MIWA 3GF7A 1N86A 3BCCJ 2GUVA 1SFCA 2BCCJ 2M5AA 4JQ0D 1KC8Q 1JOCA 3KXDA 4AQRD 2AXCA 2GM4A 1IC2A 4KT0J 2XKMA 1FZGA 3L75E 1BGYE 1LWUB 3L70D 3ABVC 4DCKA 1URQC 4XE5B 3MUDA 4Y28J 3HD7D 1LT9C 1S2EA 1L0LE 1NU1G 1ZR4A 4XFJA 2YIUB 1NTZG 3H25A 1KB9I 2QJPB 3LIEA 1E5WA 1EXIA 1BCCE 2W6AA 4C7RA 2KZIA 3H1IG 3CWBD 4NPDA 1JB0J 1HWTC 3GG2A 3L75D 4W80A 4PD4I 1N8RQ 5CJ0A 2P10A 4I7ZC 1SQBD 1S5LE 5APTA 5BVZA 5KLVG 2PFXA 1N7SB 2R32A 1BSHA 3BVHA 2B88A 2ZFCA 1PGQA 2FFDC 3BRVB 3AEFC 2R3CA 2FKWB 2OARA 2E74C 1L4AA 3F89A 1GK6A 2K3RA 3L70J 3RK3B 1OVVA 1RY3A 4H44C 1T2KD 1GD2E 2OTKE 4N3YB 1EZVD 1IK9A 2N1TD 1IFDA 2OYHA 1EDIA 3II6A 2KZJA 1R5LA 3IR9A 1QVFO 3H32A 2E76D 1IJDB 1NTMD 3Q3DA 3CWBJ 4BRYA 1VF5D 1Y9BA 1LTJA 1L2PA 3H1LG 3S1KA 1RE3C 4MN4C 4H13D 1SQBJ 1K05A 3KZIE 3GHGB 1YJNP 2G3AA 1G1IA 2H89C 3I5CA 2XNXA 1Q86Q 2WSFH 3L72G 1IFNA 5KAIH 1M1JA 1DEEG 3GW6A 4RESB 1ZLLA 1MZ9A 2IYOA 5KKZB 2NZ2A 1GZLA 2SPZA 1FDIA 1KYOE 1AVOA 3ZDMA 1RH5B 2V7QH 1X8YA 3AEBC 2ZXEB 5AVZB 5APYA 4DOJA 4TLFA 1Q7YQ 1EDKA 5AVXB 3KYQA 5E79E 1NTMJ 1WMKA 5CBNA 1CW5A 2KXPB 2IBZD 2HG5D 4XA4A 5AW5B 1KFMA 2C0WA 3FGAD 2LXBA 5AVWB 1OVRA 3A0HE 1PPJG 1Y47A 2KLVA 2JDIH 1FDOA 4WY4A 3B4SA 4IFDK 1GL2B 3N7NA 3RK3E 1FAVA 2O1JA 5AW9B 3CMEP 3WUUA 2PGDA 4LLHA 3H1KJ 1H0TB 1R8EA 1SQQG 1N7SD 1FZFA 1ZRTE 3TGUE 2FY8A 1NVOA 3SSUA 5K5GB 4IFMA 1LGHB 2OQQA 1YQ3C 5KLVJ 2E75C 2B89A 1BDCA 2P7JA 1S5LH 2HODB 1PIXA 1NAFA 1FZEA 4EI2A 1KQFB 1FS0E 3L71D 1MFZA 1M8OB 4C7NB 3AEEC 1ZMEC 1ZRTD 2KUBA 2Q5UA 4EYYQ 3TGUD 3M06A 3BATA 2OYIA 1VQLP 2WITA 3MD0A 1LJ2A 3N4XA 3RL0C 1KTMA 3VMYA 1DEBA 3Q5SA 2YMYA 4YXWH 2QJKC 1HF9A 2QG4A 4ASVA 1MV8A 2OTJP 3HE4A 2H7HA 3H1JG 4HYTB 1LTTC 4K35A 3CCLP 1SQPG 3KZIH 2WWWA 3HUSA 1ZOYC 3L37A 2W90A 5AW8B 2QIWA 1N73C 3VOPA 1YTZI 2I1KA 1GU4A 1PV3A 3L72J 1WT6A 5AW2B 2FYNB 4HJGH 3L71J 2IFNA 2QJYC 2YMKA 2IDBA 1ZW0A 1LWUA 3FX0A 1SFCC 4RO0A 2WSCJ 1YJWP 1G1JA 3H1HG 1KQGB 1KYOH 1S9KD 2QM8A 1AFOA 1P84E 2M3EA 1PP9D 3E1IA 3MUDC 5E79H 1SLQA 1OWAA 5APVA 3AEAC 3PTZA 5AVRB 3JSVC 1SQXG 3A0HH 3AE9C 1KFNA 4YTPC 3BCCE 1J1DB 1N7SA 4U3FJ 2BCCE 2O01H 4PJ0E 1P84D 1VPCA 4ZKPA 2BEQD 5CCGA 2WT7B 3UIAA 1EZVI 3A0BE 4OWFA 2YNYA 3M9HA 1KQLA 3L74D 4HB1A 1M7LA 5AW1B 4I7ZB 3A5TA 1SQQJ 2WSSH 4AYCA 3LW5J 3O6QB 1L0NG 2NPSC 1G2CA 3RL0g 2H43A 1HBWA 3P8CD 5KJ7D 1QL1A 1L4AC 3CL3D 3GMAA 1SQBK 3BCCD 2A06D 1RF1B 1PP9J 5APUA 2D2CD 2N1TB 4L73A 1JO5A 1HGVA 3CCRP 2JWDA 4D6TG 5AVSB 1LTAC 2Q9IA 3SFEC 1VQ6P 2E76B 2ZYGA 3MGNA 2KOGA 2OYHC 1A02F 1S5LX 1YBKA 2N9YB 3PH0A 4GDOA 1JY2P 3L75G 3GHGA 1BGYG 2J58A 1LTJC 1BDDA 1KILB 2KNCB 1KN7A 1SQVG 2MKVA 1HUCA 1L0LG 3L74J 2E5YA 3C8VA 2ZJSE 3L70E 1NGMB 1NAYA 2V4HA 5C39A 1NTMK 1M90Q 1BCCG 2KS1B 1NKNA 2IBZI 1T3UA 2A45G 1SS1A 3D70A 4OH8B 1M1JC 5CCHD 4OGQB 1GTWA 3C9IA 1DD3A 1NU1K 2YO3A 3CWBE 1IZNB 3IN6A 1KYOI 1M56D 3L73G 3ITKA 1NTZK 2Z5IA 3I56P 1VDFA 3EQ2A 3SWKA 2CK3H 2Q7CA 1SQBE 1DIPA 2Q1KA 1SP4A 1OW6A 3OJAB 3H1HJ 2J59M 3IFMA 1URQD 3KHUA 1ZR2A 4Z1MH 2QVAA 3AE3C 5KLIC 1GL2A 1P84H 4IOIH 5KLVK 3CXHE 2KB7P 3USSA 3MTUE 3P8MC 4N6JA 2XNDH 2ZXXA 1H0TA 1LTBC 3VP8A 4WY4C 1EZVE 1VQOP 2O3JA 1GK4A 1MUUA 1H88A 4DT0A 3C1LA 1SQXJ 5B66H 1JY2N 1K8AQ 1MKMA 1NTME 4H0LB 2HODA 3W68A 4PJ0H 1EQ7A 2Y0EA 3TK1A 3G6EP 1OMIA 3TSIA 3CXHD 5KJ7A 3A0BH 1JNMA 1USEA 3S9OA 2HFED 3U59A 1RF0A 4W7YA 2E75B 5AVUB 1KILE 3R2PA 3BRTB 4C7NA 2E74D 1KZUB 3AE2C 1RQVA 3VMAA 3IAOA 1NTKG 1KQSO 4H44D 2HPCB 1FOSE 3CCEP 2B87B 2UWJE 2XU6A 4ZMDA 3PJSK 1GDTA 3P32A 3H1KE 1M57D 1FJPA 2JKVA 2OYIC 1PGOA 2W6BA 4IL6E 3V4QA 1CSBA 1KILD 5KLVE 3RL0B 1OIPA 1NU1D 1U7JA 4PV1C 3SWYA 1YI2P 3KDPB 2QJKB 2B9BA 2N9BA 1NTZD 4I1LA 4JPZB 3EWKA 1VQ4P 2C9LY 3GLMA 2QA4P 2C0XA 2IBZE 1UIIA 1SQVJ 3HTKB 1J2JB 1OW8A 3H1KD 2AEFA 3V5BA 4WB4A 5AVQB 4OGQD 1N7LA 3E1RA 1OFCX 4U7JA 2L91A 2QSIA 3B5NB 1JY2O 1N73B 5KLVD 1UIXA 3F5HA 2E43A 3TGUG 1Q90D 3HD7A 1NWQA 1YHQP 1LWUC 3V2QA 2J5UA 4R4MA 2ZYAA 3L73J 3VTPC 4I2LC 2O1KA 1JM0A 2ZYDA 4R4LA 3L35A 1VQMP 1P84I 2YIUC 1Q81Q 1XTGB 1YTZT 3V2RA 1AQTA 1NU1J 5AW4B 5AW6B 3V6IA 2QJPC 1SQQK 1QL2A 1NTZJ 4Y99B 5BU5A 3FXEA 2AEMA 2OGUA 3L72E 3I55P 3G71P 2HLOA 2FYZA 2Z5HA 3H1IJ 2K9JB 3L71E 2WT7A 3AE7C 2QEXP 4WBAA 3T97B 3CXHH 2K88A 3H1LD 4JF7A 4ZKUA 1N7SC 3RK2C 5BU8B 1BE3G 3O6QA 4H0LD 5CCGC 4L76A 3K5BA 1EXJA 4JYCA 3L72D 2E75D 3L4FA 3RK3C 1RF1A 1ZN5A 2N1TA 3WU2H 5KAFE 2NPSB 3NFQA 2LR2A 3AE4C 2D2CB
chains in the Genus database with same CATH topology
2XKMA 1FZGA 3OAKA 1KFNA 1J1DB 1N7SA 2O01H 1LWUB 3M9BA 1VPCA 1JUNA 4ZKPA 5CCGA 2WT7B 1FZCB 1URQC 3UIAA 2Z4EA 5CJ4A 5CCHA 4XE5B 3HUSC 3MUDA 2FXMA 3HD7D 2R5DA 1LT9C 2YNYA 3H6PA 3WMM0 3M9HA 1KQLA 1ZR4A 1NOHA 3NMDA 1M7LA 5AW1B 3A5TA 3V2PA 1LTSC 4HH2A 3KQGA 2QM7A 4AYCA 3SWFA 3VP9A 1SQPK 1KILA 2NPSC 2WPQA 3LIEA 1E5WA 1HVVA 3KPEA 1NH4A 2W6AA 4C7RA 1G2CA 2H43A 3RL0D 1HBWA 2L5GB 3GHGC 3P8CD 5KJ7D 1QL1A 1L4AC 5AVVB 3CL3D 1HWTC 1SQBK 1RF1B 1SFCB 5APUA 2N1TB 1JMMA 1URQA 4W80A 2VRSA 1S9KE 5CJ0A 1HGVA 1JO5A 1FBMA 1JY3P 1LT9A 3OA7A 5AVSB 1LTAC 2Q9IA 3HRNA 5APTA 5BVZA 1N7SB 4N78E 3MGNA 2KOGA 2R32A 2OYHC 1A02F 1JCDA 3VMXA 3CLQA 2YKOA 3BVHA 2ZFCA 2FFDC 3BRVB 3B5ND 1JY2P 1JCCA 2R3CA 2FKWB 3GHGA 2OARA 1L4AA 2J58A 1GK6A 1LTJC 1KILB 3VYIA 5AVTB 3RK3B 1H89A 1RY3A 1T2KD 2PP6A 1HUCA 5AW3B 1GD2E 3U1AA 4N3YB 4O9BA 2E42A 5APSA 4EOTA 1IK9A 1SFCD 2HYNA 2N1TD 4IFFA 5AVYB 1IFDA 1NTMK 2OYHA 4N78D 1IFMA 3II6A 3IR9A 1URQB 1SQXK 3H32A 3M91A 2A45H 2FFDA 1N2DC 1IJDB 1NKNA 1LT9B 3RK2D 1T3UA 2A45G 1NO4A 2XV5A 4OH8B 1M1JC 5CCGD 3P7KA 5CCHD 3M9QA 1LTJA 1GTWA 1CZQA 3C9IA 3VMZA 2C9NY 2H8PD 1NU1K 3P8CE 1GL2C 1H8AA 2YO3A 1RE3C 3A3YB 3TNUA 2WPSA 1SVFA 3GHGB 1NTZK 2Z5IA 1VDFA 1L4AB 1FZBA 1L0NK 1NKZB 3EQ2A 3NTNA 3RK3D 1GW3A 2Q7CA 1G1IA 4W7ZA 1OXZA 3I5CA 2XDJA 1SP4A 2XNXA 1FDMA 4WY4B 2WSFH 2FYUK 3OJAB 3A2AA 2KP8A 5APQA 1IFNA 5APXA 2J59M 1W2EA 3IFMA 1M1JA 1URQD 3BASA 4RESB 2OYHB 1ZLLA 1ZR2A 1JTHA 1MZ9A 2POHA 1GZLA 1GL2A 3H32B 1RE3A 5KLVK 2FFDB 1T3JA 2YKPA 2KB7P 2WSCH 1WRGA 3HE5A 3MTUE 3P8MC 4N6JA 2NPSD 1IFIA 1X8YA 2JEEA 1JY3N 1LTJB 2HPCA 1RF0C 2ZXEB 1LTBC 5AVZB 3VP8A 4GT1A 4WY4C 5APYA 3V2NA 4DOJA 4M3LA 1GK4A 1PFIA 1HTLC 1X9VA 5AVXB 3KYQA 1MUUA 3TNUB 1FZAA 1H88A 2YO2A 1CW5A 1RE4C 2HG5D 1JY2N 4XA4A 3VN0A 1SQVK 3A7OA 1FJKA 5AW5B 2YKQA 1KFMA 2C0WA 2HODA 3B5NC 5AVWB 1EQ7A 3TK1A 3TSIA 1M1JB 5KJ7A 1NHLA 2WZ7A 1JNMA 2KLVA 2HFED 3U59A 1RF0A 2LKMA 1X79B 1JTHB 4W7YA 4WY4A 5AVUB 2M8RA 4IFDK 3R2PA 1GL2B 2I1JA 3BRTB 3N7NA 3G3ZA 4C7NA 1KZUB 1FAVA 2O1JA 3HTKA 5AW9B 3HE5B 4GKGA 4LLHA 1RE4A 3M0DC 2HPCB 1FOSE 1HJBA 1N7SD 2XU6A 3LW5H 1FZFA 1GDTA 3P32A 1J1EB 3B5NA 3HD7B 1IFJA 1FJPA 4IFMA 5CMZA 1N73A 1LGHB 2OYIC 4Y99C 2P7JA 2W6BA 2HODB 3V4QA 1CSBA 2P67A 1HH0A 1KILD 1GW4A 3U1CA 1NAFA 3RL0B 2IPPA 1FZEA 1Z56A 3NXSA 3SWYA 3KDPB 1GL2D 2N9BA 3M0DA 4I6MC 4I1LA 2IFMA 4DZOA 1MFZA 1HGZA 2C9LY 4AUWA 2C0XA 1J1EC 2A45I 3HD7C 4C7NB 3HTKB 1J2JB 1FU1A 2Q5UA 1JY3O 3M06A 3BATA 2OYIA 3V5BA 2CPBA 1DH3A 4WB4A 1LTIC 2WITA 2XZRA 2GUSA 1AQ5A 3MD0A 3EFGA 5AVQB 1GU5A 1N7LA 1ZV8A 3N4XA 3RL0C 3B5NB 3VMYA 5KJ7C 1JY2O 1DEBA 2YMYA 1N73B 1MV8A 4KHXA 3T97A 3HE4A 2E43A 1L4AD 1DX7A 2H7HA 1T8ZA 1J1DC 3HD7A 4EIJA 1NWQA 1LWUC 3V2QA 2WTYA 4HYTB 1FZCC 1FOSF 4WY4D 3VTPC 1LTTC 4I2LC 2O1KA 3CI9A 4C46A 1L0LK 3O8ZA 2WWWA 3HUSA 1XTCC 3L37A 3L35A 2KYVA 2Q3IA 1NTKK 3M0AA 4LGDE 5AW8B 4GIFA 1XTGB 1YTZT 3V2RA 1N73C 5AW4B 3RK2B 3VOPA 1YTZI 2BASA 2I1KA 5AW6B 1GU4A 1WT6A 5AW2B 1YYCA 1SQQK 2OYIB 1QL2A 3PP5A 2NPSA 4Y99B 2CPSA 5BU5A 3LIDA 2IFNA 5AW0B 2JJLA 1CI6A 1IO4A 4JYBA 1T2KC 4LC1A 5CHXA 1LWUA 2HLOA 2FYZA 3TYYA 2Z5HA 1RF1C 1SFCC 2N1TC 2WT7A 1FZCA 2WSEH 1G1JA 3B8EB 4WBAA 2P2UA 2MJZA 1G2CB 2P1JA 4B86A 1A02J 3HE4B 2PAJA 4JF7A 1S9KD 2QM8A 1AFOA 5APWA 4ZKUA 1N7SC 3RK2C 5BU8B 2KSJA 5CCGC 5CCHC 3E1IA 2IX7C 3HUSB 5KTBA 3L36A 1SLQA 1LTGC 3V4WA 2M3BA 2W27A 2WPRA 3MIWA 4JYCA 1KILC 1OWAA 5APVA 1N86A 3L4FA 5AW7B 3RK3C 1RF1A 2GUVA 1SFCA 2R5BA 1ZN5A 2N1TA 2NPSB 5AVRB 1JOCA 3NFQA 4AQRD 2GM4A 1IC2A 1CI6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B5N C;  1N7S A;  1URQ B;  3TSI A;  1L4A D;  1NHL A;  3RK2 D;  5KJ7 A;  2WZ7 A;  5CCG A;  1URQ C;  2HFE D;  3HD7 A;  5CCH A;  1JTH B;  4W7Y A;  4OH8 B;  4WY4 A;  5CCG D;  3HD7 D;  2M8R A;  5CCH D;  1GL2 B;  4WY4 D;  2H8P D;  3P8C E;  1GL2 C;  1KIL A;  2NPS C;  4LGD E;  3M0D C;  1HVV A;  1XTG B;  1L4A B;  3RK3 D;  3RK2 B;  3VOP A;  1N7S D;  3RL0 D;  4W7Z A;  5KJ7 D;  1L4A C;  3HD7 B;  2XDJ A;  2NPS A;  3B5N A;  3PP5 A;  4WY4 B;  1SFC B;  2N1T B;  1URQ A;  4W80 A;  1URQ D;  1SFC C;  2N1T C;  1KIL D;  1JTH A;  1N7S B;  4N78 E;  3RL0 B;  2KOG A;  1GL2 A;  4JF7 A;  1T3J A;  1GL2 D;  1N7S C;  3RK2 C;  3B5N D;  2NPS D;  5CCG C;  3HD7 C;  5CCH C;  3HTK B;  4WY4 C;  1L4A A;  1KIL B;  3KYQ A;  3RK3 B;  2PP6 A;  1KIL C;  2HG5 D;  3RK3 C;  1SFC A;  3RL0 C;  2N1T A;  3B5N B;  2NPS B;  1SFC D;  5KJ7 C;  2N1T D;  2YMY A; 
#chains in the Genus database with same CATH topology
 3OAK A;  4PD4 D;  5CBO A;  3M9B A;  3JCU H;  1JUN A;  1FZC B;  5CJ4 A;  1R5S A;  1NTK J;  2K1A A;  4U3F E;  3S4R A;  3W67 A;  1LTS C;  3SWF A;  1SQP K;  1KIL A;  2ZVN B;  3KPE A;  1NH4 A;  1SQQ E;  3RL0 D;  3Q2Y A;  2FXP A;  3H1L J;  2L5G B;  3GHG C;  2FYU G;  3G9R A;  5AVV B;  4YXD C;  1VQK P;  4BRY B;  5TIS E;  3TDK A;  2WMM A;  1JMM A;  4IL6 H;  1S9K E;  1AA0 A;  3HRN A;  4U3F D;  1PP9 E;  2ZVO B;  2RH0 A;  3WUT A;  1X0T A;  1D7M A;  3CLQ A;  5H2F E;  3B5N D;  1FC2 C;  4GOE A;  1SQQ D;  2BCC G;  2JWA A;  1H89 A;  5AW3 B;  2HYN A;  1SFC D;  4L75 A;  4IFF A;  1K04 A;  4UB8 E;  1URQ B;  3L74 E;  1SQX K;  1USD A;  1N2D C;  1LT9 B;  2XV5 A;  3P7K A;  1CZQ A;  5B66 E;  2C9N Y;  1H8A A;  3P8C E;  1GL2 C;  1NJI Q;  2AXT E;  3CXH I;  5L8R J;  4JBZ A;  2A06 E;  2GA1 A;  2IYP A;  1L0N K;  1NKZ B;  1GW3 A;  3Q5P A;  2I8D A;  4WY4 B;  3A2A A;  2KP8 A;  5APQ A;  2WSE J;  5APX A;  3BAS A;  2ZAE B;  2ITA A;  1YJ9 P;  3H1J D;  2E5T A;  1BE3 J;  4PD4 H;  3JC2 2;  4OVN F;  4GOF A;  3H1H E;  2FFD B;  1SQP D;  1T3J A;  3AEC C;  2WSC H;  1WRG A;  3L70 G;  4L74 A;  2E74 B;  2NPS D;  2JEE A;  2ZT9 C;  2KK7 A;  2HPC A;  1RF0 C;  4GT1 A;  3V2N A;  2B87 A;  4H44 B;  4CPG A;  3TNU B;  2YO2 A;  1K73 Q;  2Y9Y A;  1PGP A;  1T6A A;  2YXR B;  5KAF H;  1SQV K;  3CWB G;  1SQX E;  3H1H D;  1VQ5 P;  3CC4 P;  1SQB G;  1JTH B;  1DD4 A;  1K9M Q;  2I1J A;  3G3Z A;  3HTK A;  3SFD C;  3HE5 B;  1RE4 A;  2FYU J;  3CCJ P;  4PV1 B;  2W8Z A;  2FXO A;  3H1J J;  1HJB A;  3LW5 H;  1SQP J;  2JP3 A;  3D71 A;  5TIS H;  4YPC A;  3B5N A;  1YIT P;  1IFJ A;  2G8Y A;  1SQX D;  3AEG C;  2FYN C;  1N73 A;  1KD1 Q;  1LNQ A;  1EZV G;  4WWI A;  3PRJ A;  1RQU A;  1GW4 A;  3U1C A;  2IPP A;  1E79 H;  1Z56 A;  4IL6 X;  5H2F H;  3M0D A;  4I6M C;  1NTM G;  2IFM A;  4DZO A;  1L0N D;  3WUV A;  4AUW A;  1J1E C;  3HD7 C;  3FWN A;  1FU1 A;  2P58 A;  1KV4 A;  2XZR A;  3AE1 C;  1SQV E;  1AQ5 A;  1NYH A;  3EFG A;  1EDJ A;  1GU5 A;  4HKZ H;  1ZV8 A;  4D6T D;  1W5C E;  2K9J A;  4UB8 H;  1IFP A;  2Y9Z A;  4KHX A;  3T97 A;  1T8Z A;  1J1D C;  2OTL P;  3H1K G;  2YXQ B;  2WTY A;  1FOS F;  4WY4 D;  2LXC B;  1S4X A;  1BGY D;  3CI9 A;  4C46 A;  4RJT A;  2AXT H;  3WU2 E;  3B71 A;  1XTC C;  2KYV A;  3CCU P;  1SQV D;  1NTK K;  3M0A A;  3L73 E;  1TU3 F;  1L0L D;  2O01 N;  3CMA P;  2JO1 A;  3RK2 B;  2BAS A;  2WSF J;  3RGU A;  1YYC A;  3JCU E;  3CX5 E;  2NPS A;  2CPS A;  1LP1 B;  1QVG O;  1L0N J;  5AW0 B;  3CC7 P;  2JJL A;  1IO4 A;  1BCC D;  2Y0D A;  1T2K C;  1NU1 E;  2IBZ G;  4LC1 A;  5CHX A;  1PGJ A;  1NTZ E;  1RF1 C;  2KI7 B;  2N1T C;  1FZC A;  3B8E B;  2V7Q J;  2P2U A;  1G2C B;  4B86 A;  1A02 J;  4TT3 H;  2E76 C;  3H1I E;  5APW A;  4D6T J;  2W6J H;  2KSJ A;  3L73 D;  1VF5 C;  2RMZ A;  1AV1 A;  4QMA A;  2IX7 C;  1AVY A;  3CX5 D;  5KTB A;  3L36 A;  4H13 C;  3V4W A;  2WPR A;  1KIL C;  3L75 J;  4RKU J;  5AW7 B;  1BGY J;  1BSN A;  2R5B A;  5B5E H;  3IF4 A;  2QRX A;  4BXL A;  1CI6 B;  4ZNC A;  3PHL A;  4PV1 D;  1L0L J;  3H1I D;  2Z4E A;  1AJY A;  5CCH A;  3HUS C;  2FXM A;  4ASW A;  2R5D A;  3H6P A;  1ZXG A;  3WMM 0;  1BCC J;  1NOH A;  3NMD A;  1W2B O;  3V2P A;  4HH2 A;  4OGQ C;  3KQG A;  2PRR A;  2QM7 A;  1X22 A;  1NTK E;  3VP9 A;  3RBX A;  1OW7 A;  3L71 G;  5GTH E;  2WPQ A;  1HVV A;  1YIJ P;  4A7P A;  1YQ4 C;  2QJY B;  2M0B A;  4DJG A;  3PLN A;  1SFC B;  1URQ A;  2VRS A;  3H1L E;  3TF5 A;  2M5A B;  1VL2 A;  1FBM A;  1JY3 P;  1LT9 A;  3OA7 A;  3Q1M A;  2W83 C;  3MP7 B;  4N78 E;  2RN0 A;  1Y8A A;  1JCD A;  3VMX A;  3CPW O;  2YKO A;  1KB9 E;  1NTK D;  2RKL A;  1JCC A;  2BEZ F;  1LT1 A;  4KJM A;  1KYO D;  3VYI A;  2R44 A;  5AVT B;  1VQN P;  1JMB A;  1S3J A;  2K9Y A;  2PP6 A;  4PD4 E;  4U3F G;  1OVU A;  3U1A A;  4O9B A;  2E42 A;  5APS A;  4EOT A;  5AVY B;  5M1B A;  3QH9 A;  4N78 D;  1IFM A;  4H0L C;  3M91 A;  2A45 H;  1KB9 D;  2FFD A;  3MHV A;  3RK2 D;  3G4S P;  1FE6 A;  1NO4 A;  3CC2 P;  4UB6 E;  5CCG D;  3CCS P;  3M9Q A;  4NPF X;  3VMZ A;  2H8P D;  4WVZ A;  3A3Y B;  1KMI Z;  3TNU A;  2WPS A;  1SVF A;  2KIK A;  1PP9 G;  1EDL A;  3RK3 D;  1L4A B;  1FZB A;  3NTN A;  1PPJ E;  1QX8 A;  3CX5 H;  4W7Z A;  1OXZ A;  2ZT9 B;  1VQ9 P;  2XDJ A;  1FDM A;  2FYU K;  3MZW B;  1S1C X;  1W2E A;  3CCQ P;  2KNC A;  2OYH B;  1JTH A;  2POH A;  1Q82 Q;  3H32 B;  1RE3 A;  1M1K Q;  5GTI E;  1U7M A;  2YKP A;  3HE5 A;  1BE3 E;  1IFI A;  1JY3 N;  1LTJ B;  2KS1 A;  1QEX A;  1PPJ D;  3L74 G;  4M3L A;  1PFI A;  1HTL C;  1X9V A;  2K37 A;  5DJT B;  1FZA A;  1RE4 C;  3VN0 A;  3A7O A;  1QGK B;  1FJK A;  5KKZ C;  2IZ0 A;  2YKQ A;  2O01 J;  2WPV B;  3B5N C;  1VQ7 P;  3BCC G;  2A06 G;  1M1J B;  1NHL A;  3D6Z A;  2WZ7 A;  1RHZ B;  2NRG A;  1BE3 D;  2LKM A;  1X79 B;  4EDF A;  2M8R A;  1ZP0 C;  4GKG A;  3FWL A;  3TGU J;  5GTH H;  1S72 P;  2JR8 A;  3M0D C;  2Y0C A;  3OW2 O;  2DW3 A;  1J1E B;  2FYU E;  3HD7 B;  3D6Y A;  3H1J E;  5CMZ A;  5EFW B;  4Y99 C;  1SQP E;  3CD6 P;  5KLI B;  2P67 A;  3CCV P;  1HH0 A;  1KOR A;  3FXD A;  3AE8 C;  3NXS A;  1KB9 H;  2Q3E A;  1GL2 D;  3R4Y A;  2WVR A;  2OYO A;  1HGZ A;  2A45 I;  3GF3 A;  1JY3 O;  1VQP P;  2FYU D;  3E7K A;  1PL5 A;  1VQ8 P;  1DH3 A;  2CPB A;  4BWN A;  1LTI C;  2GUS A;  2WQY C;  2HR3 A;  1LP1 A;  1EC5 A;  5KJ7 C;  3QWO C;  3EFF K;  2H88 C;  3CX5 I;  1Q2N A;  2KSE A;  1OZH A;  2D2C C;  3AE6 C;  1L4A D;  3AED C;  1DX7 A;  4UB6 H;  4EIJ A;  2R3S A;  2ZT9 D;  5TJH A;  1FZC C;  1QLE D;  2BCC D;  1L0L K;  2IZ1 A;  5B5E E;  3O8Z A;  3Q5R A;  1OX3 A;  2Q3I A;  4LGD E;  4GIF A;  2OYI B;  3CCM P;  3PP5 A;  1VF5 B;  3LID A;  1CI6 A;  4JYB A;  2QE7 H;  4K3A A;  1JEK A;  4H13 B;  4NPE A;  3TYY A;  5KAI E;  3RBZ A;  1L0N E;  2WSE H;  1HJ0 A;  2MJZ A;  5GTI H;  2P1J A;  3HE4 B;  2PAJ A;  1GMJ A;  2FBW C;  1PZQ A;  1U57 A;  4GOD A;  1MFT A;  5CCH C;  3AE5 C;  2Q6Q A;  2AEJ A;  5DJU B;  2KLU A;  1IK7 A;  4D6T E;  3HUS B;  1LTG C;  2M3B A;  2W27 A;  3MIW A;  3GF7 A;  1N86 A;  3BCC J;  2GUV A;  1SFC A;  2BCC J;  2M5A A;  4JQ0 D;  1KC8 Q;  1JOC A;  3KXD A;  4AQR D;  2AXC A;  2GM4 A;  1IC2 A;  4KT0 J;  2XKM A;  1FZG A;  3L75 E;  1BGY E;  1LWU B;  3L70 D;  3ABV C;  4DCK A;  1URQ C;  4XE5 B;  3MUD A;  4Y28 J;  3HD7 D;  1LT9 C;  1S2E A;  1L0L E;  1NU1 G;  1ZR4 A;  4XFJ A;  2YIU B;  1NTZ G;  3H25 A;  1KB9 I;  2QJP B;  3LIE A;  1E5W A;  1EXI A;  1BCC E;  2W6A A;  4C7R A;  2KZI A;  3H1I G;  3CWB D;  4NPD A;  1JB0 J;  1HWT C;  3GG2 A;  3L75 D;  4W80 A;  4PD4 I;  1N8R Q;  5CJ0 A;  2P10 A;  4I7Z C;  1SQB D;  1S5L E;  5APT A;  5BVZ A;  5KLV G;  2PFX A;  1N7S B;  2R32 A;  1BSH A;  3BVH A;  2B88 A;  2ZFC A;  1PGQ A;  2FFD C;  3BRV B;  3AEF C;  2R3C A;  2FKW B;  2OAR A;  2E74 C;  1L4A A;  3F89 A;  1GK6 A;  2K3R A;  3L70 J;  3RK3 B;  1OVV A;  1RY3 A;  4H44 C;  1T2K D;  1GD2 E;  2OTK E;  4N3Y B;  1EZV D;  1IK9 A;  2N1T D;  1IFD A;  2OYH A;  1EDI A;  3II6 A;  2KZJ A;  1R5L A;  3IR9 A;  1QVF O;  3H32 A;  2E76 D;  1IJD B;  1NTM D;  3Q3D A;  3CWB J;  4BRY A;  1VF5 D;  1Y9B A;  1LTJ A;  1L2P A;  3H1L G;  3S1K A;  1RE3 C;  4MN4 C;  4H13 D;  1SQB J;  1K05 A;  3KZI E;  3GHG B;  1YJN P;  2G3A A;  1G1I A;  2H89 C;  3I5C A;  2XNX A;  1Q86 Q;  2WSF H;  3L72 G;  1IFN A;  5KAI H;  1M1J A;  1DEE G;  3GW6 A;  4RES B;  1ZLL A;  1MZ9 A;  2IYO A;  5KKZ B;  2NZ2 A;  1GZL A;  2SPZ A;  1FDI A;  1KYO E;  1AVO A;  3ZDM A;  1RH5 B;  2V7Q H;  1X8Y A;  3AEB C;  2ZXE B;  5AVZ B;  5APY A;  4DOJ A;  4TLF A;  1Q7Y Q;  1EDK A;  5AVX B;  3KYQ A;  5E79 E;  1NTM J;  1WMK A;  5CBN A;  1CW5 A;  2KXP B;  2IBZ D;  2HG5 D;  4XA4 A;  5AW5 B;  1KFM A;  2C0W A;  3FGA D;  2LXB A;  5AVW B;  1OVR A;  3A0H E;  1PPJ G;  1Y47 A;  2KLV A;  2JDI H;  1FDO A;  4WY4 A;  3B4S A;  4IFD K;  1GL2 B;  3N7N A;  3RK3 E;  1FAV A;  2O1J A;  5AW9 B;  3CME P;  3WUU A;  2PGD A;  4LLH A;  3H1K J;  1H0T B;  1R8E A;  1SQQ G;  1N7S D;  1FZF A;  1ZRT E;  3TGU E;  2FY8 A;  1NVO A;  3SSU A;  5K5G B;  4IFM A;  1LGH B;  2OQQ A;  1YQ3 C;  5KLV J;  2E75 C;  2B89 A;  1BDC A;  2P7J A;  1S5L H;  2HOD B;  1PIX A;  1NAF A;  1FZE A;  4EI2 A;  1KQF B;  1FS0 E;  3L71 D;  1MFZ A;  1M8O B;  4C7N B;  3AEE C;  1ZME C;  1ZRT D;  2KUB A;  2Q5U A;  4EYY Q;  3TGU D;  3M06 A;  3BAT A;  2OYI A;  1VQL P;  2WIT A;  3MD0 A;  1LJ2 A;  3N4X A;  3RL0 C;  1KTM A;  3VMY A;  1DEB A;  3Q5S A;  2YMY A;  4YXW H;  2QJK C;  1HF9 A;  2QG4 A;  4ASV A;  1MV8 A;  2OTJ P;  3HE4 A;  2H7H A;  3H1J G;  4HYT B;  1LTT C;  4K35 A;  3CCL P;  1SQP G;  3KZI H;  2WWW A;  3HUS A;  1ZOY C;  3L37 A;  2W90 A;  5AW8 B;  2QIW A;  1N73 C;  3VOP A;  1YTZ I;  2I1K A;  1GU4 A;  1PV3 A;  3L72 J;  1WT6 A;  5AW2 B;  2FYN B;  4HJG H;  3L71 J;  2IFN A;  2QJY C;  2YMK A;  2IDB A;  1ZW0 A;  1LWU A;  3FX0 A;  1SFC C;  4RO0 A;  2WSC J;  1YJW P;  1G1J A;  3H1H G;  1KQG B;  1KYO H;  1S9K D;  2QM8 A;  1AFO A;  1P84 E;  2M3E A;  1PP9 D;  3E1I A;  3MUD C;  5E79 H;  1SLQ A;  1OWA A;  5APV A;  3AEA C;  3PTZ A;  5AVR B;  3JSV C;  1SQX G;  3A0H H;  3AE9 C;  1KFN A;  4YTP C;  3BCC E;  1J1D B;  1N7S A;  4U3F J;  2BCC E;  2O01 H;  4PJ0 E;  1P84 D;  1VPC A;  4ZKP A;  2BEQ D;  5CCG A;  2WT7 B;  3UIA A;  1EZV I;  3A0B E;  4OWF A;  2YNY A;  3M9H A;  1KQL A;  3L74 D;  4HB1 A;  1M7L A;  5AW1 B;  4I7Z B;  3A5T A;  1SQQ J;  2WSS H;  4AYC A;  3LW5 J;  3O6Q B;  1L0N G;  2NPS C;  1G2C A;  3RL0 g;  2H43 A;  1HBW A;  3P8C D;  5KJ7 D;  1QL1 A;  1L4A C;  3CL3 D;  3GMA A;  1SQB K;  3BCC D;  2A06 D;  1RF1 B;  1PP9 J;  5APU A;  2D2C D;  2N1T B;  4L73 A;  1JO5 A;  1HGV A;  3CCR P;  2JWD A;  4D6T G;  5AVS B;  1LTA C;  2Q9I A;  3SFE C;  1VQ6 P;  2E76 B;  2ZYG A;  3MGN A;  2KOG A;  2OYH C;  1A02 F;  1S5L X;  1YBK A;  2N9Y B;  3PH0 A;  4GDO A;  1JY2 P;  3L75 G;  3GHG A;  1BGY G;  2J58 A;  1LTJ C;  1BDD A;  1KIL B;  2KNC B;  1KN7 A;  1SQV G;  2MKV A;  1HUC A;  1L0L G;  3L74 J;  2E5Y A;  3C8V A;  2ZJS E;  3L70 E;  1NGM B;  1NAY A;  2V4H A;  5C39 A;  1NTM K;  1M90 Q;  1BCC G;  2KS1 B;  1NKN A;  2IBZ I;  1T3U A;  2A45 G;  1SS1 A;  3D70 A;  4OH8 B;  1M1J C;  5CCH D;  4OGQ B;  1GTW A;  3C9I A;  1DD3 A;  1NU1 K;  2YO3 A;  3CWB E;  1IZN B;  3IN6 A;  1KYO I;  1M56 D;  3L73 G;  3ITK A;  1NTZ K;  2Z5I A;  3I56 P;  1VDF A;  3EQ2 A;  3SWK A;  2CK3 H;  2Q7C A;  1SQB E;  1DIP A;  2Q1K A;  1SP4 A;  1OW6 A;  3OJA B;  3H1H J;  2J59 M;  3IFM A;  1URQ D;  3KHU A;  1ZR2 A;  4Z1M H;  2QVA A;  3AE3 C;  5KLI C;  1GL2 A;  1P84 H;  4IOI H;  5KLV K;  3CXH E;  2KB7 P;  3USS A;  3MTU E;  3P8M C;  4N6J A;  2XND H;  2ZXX A;  1H0T A;  1LTB C;  3VP8 A;  4WY4 C;  1EZV E;  1VQO P;  2O3J A;  1GK4 A;  1MUU A;  1H88 A;  4DT0 A;  3C1L A;  1SQX J;  5B66 H;  1JY2 N;  1K8A Q;  1MKM A;  1NTM E;  4H0L B;  2HOD A;  3W68 A;  4PJ0 H;  1EQ7 A;  2Y0E A;  3TK1 A;  3G6E P;  1OMI A;  3TSI A;  3CXH D;  5KJ7 A;  3A0B H;  1JNM A;  1USE A;  3S9O A;  2HFE D;  3U59 A;  1RF0 A;  4W7Y A;  2E75 B;  5AVU B;  1KIL E;  3R2P A;  3BRT B;  4C7N A;  2E74 D;  1KZU B;  3AE2 C;  1RQV A;  3VMA A;  3IAO A;  1NTK G;  1KQS O;  4H44 D;  2HPC B;  1FOS E;  3CCE P;  2B87 B;  2UWJ E;  2XU6 A;  4ZMD A;  3PJS K;  1GDT A;  3P32 A;  3H1K E;  1M57 D;  1FJP A;  2JKV A;  2OYI C;  1PGO A;  2W6B A;  4IL6 E;  3V4Q A;  1CSB A;  1KIL D;  5KLV E;  3RL0 B;  1OIP A;  1NU1 D;  1U7J A;  4PV1 C;  3SWY A;  1YI2 P;  3KDP B;  2QJK B;  2B9B A;  2N9B A;  1NTZ D;  4I1L A;  4JPZ B;  3EWK A;  1VQ4 P;  2C9L Y;  3GLM A;  2QA4 P;  2C0X A;  2IBZ E;  1UII A;  1SQV J;  3HTK B;  1J2J B;  1OW8 A;  3H1K D;  2AEF A;  3V5B A;  4WB4 A;  5AVQ B;  4OGQ D;  1N7L A;  3E1R A;  1OFC X;  4U7J A;  2L91 A;  2QSI A;  3B5N B;  1JY2 O;  1N73 B;  5KLV D;  1UIX A;  3F5H A;  2E43 A;  3TGU G;  1Q90 D;  3HD7 A;  1NWQ A;  1YHQ P;  1LWU C;  3V2Q A;  2J5U A;  4R4M A;  2ZYA A;  3L73 J;  3VTP C;  4I2L C;  2O1K A;  1JM0 A;  2ZYD A;  4R4L A;  3L35 A;  1VQM P;  1P84 I;  2YIU C;  1Q81 Q;  1XTG B;  1YTZ T;  3V2R A;  1AQT A;  1NU1 J;  5AW4 B;  5AW6 B;  3V6I A;  2QJP C;  1SQQ K;  1QL2 A;  1NTZ J;  4Y99 B;  5BU5 A;  3FXE A;  2AEM A;  2OGU A;  3L72 E;  3I55 P;  3G71 P;  2HLO A;  2FYZ A;  2Z5H A;  3H1I J;  2K9J B;  3L71 E;  2WT7 A;  3AE7 C;  2QEX P;  4WBA A;  3T97 B;  3CXH H;  2K88 A;  3H1L D;  4JF7 A;  4ZKU A;  1N7S C;  3RK2 C;  5BU8 B;  1BE3 G;  3O6Q A;  4H0L D;  5CCG C;  4L76 A;  3K5B A;  1EXJ A;  4JYC A;  3L72 D;  2E75 D;  3L4F A;  3RK3 C;  1RF1 A;  1ZN5 A;  2N1T A;  3WU2 H;  5KAF E;  2NPS B;  3NFQ A;  2LR2 A;  3AE4 C;  2D2C B; 
#chains in the Genus database with same CATH homology
 2XKM A;  1FZG A;  3OAK A;  1KFN A;  1J1D B;  1N7S A;  2O01 H;  1LWU B;  3M9B A;  1VPC A;  1JUN A;  4ZKP A;  5CCG A;  2WT7 B;  1FZC B;  1URQ C;  3UIA A;  2Z4E A;  5CJ4 A;  5CCH A;  4XE5 B;  3HUS C;  3MUD A;  2FXM A;  3HD7 D;  2R5D A;  1LT9 C;  2YNY A;  3H6P A;  3WMM 0;  3M9H A;  1KQL A;  1ZR4 A;  1NOH A;  3NMD A;  1M7L A;  5AW1 B;  3A5T A;  3V2P A;  1LTS C;  4HH2 A;  3KQG A;  2QM7 A;  4AYC A;  3SWF A;  3VP9 A;  1SQP K;  1KIL A;  2NPS C;  2WPQ A;  3LIE A;  1E5W A;  1HVV A;  3KPE A;  1NH4 A;  2W6A A;  4C7R A;  1G2C A;  2H43 A;  3RL0 D;  1HBW A;  2L5G B;  3GHG C;  3P8C D;  5KJ7 D;  1QL1 A;  1L4A C;  5AVV B;  3CL3 D;  1HWT C;  1SQB K;  1RF1 B;  1SFC B;  5APU A;  2N1T B;  1JMM A;  1URQ A;  4W80 A;  2VRS A;  1S9K E;  5CJ0 A;  1HGV A;  1JO5 A;  1FBM A;  1JY3 P;  1LT9 A;  3OA7 A;  5AVS B;  1LTA C;  2Q9I A;  3HRN A;  5APT A;  5BVZ A;  1N7S B;  4N78 E;  3MGN A;  2KOG A;  2R32 A;  2OYH C;  1A02 F;  1JCD A;  3VMX A;  3CLQ A;  2YKO A;  3BVH A;  2ZFC A;  2FFD C;  3BRV B;  3B5N D;  1JY2 P;  1JCC A;  2R3C A;  2FKW B;  3GHG A;  2OAR A;  1L4A A;  2J58 A;  1GK6 A;  1LTJ C;  1KIL B;  3VYI A;  5AVT B;  3RK3 B;  1H89 A;  1RY3 A;  1T2K D;  2PP6 A;  1HUC A;  5AW3 B;  1GD2 E;  3U1A A;  4N3Y B;  4O9B A;  2E42 A;  5APS A;  4EOT A;  1IK9 A;  1SFC D;  2HYN A;  2N1T D;  4IFF A;  5AVY B;  1IFD A;  1NTM K;  2OYH A;  4N78 D;  1IFM A;  3II6 A;  3IR9 A;  1URQ B;  1SQX K;  3H32 A;  3M91 A;  2A45 H;  2FFD A;  1N2D C;  1IJD B;  1NKN A;  1LT9 B;  3RK2 D;  1T3U A;  2A45 G;  1NO4 A;  2XV5 A;  4OH8 B;  1M1J C;  5CCG D;  3P7K A;  5CCH D;  3M9Q A;  1LTJ A;  1GTW A;  1CZQ A;  3C9I A;  3VMZ A;  2C9N Y;  2H8P D;  1NU1 K;  3P8C E;  1GL2 C;  1H8A A;  2YO3 A;  1RE3 C;  3A3Y B;  3TNU A;  2WPS A;  1SVF A;  3GHG B;  1NTZ K;  2Z5I A;  1VDF A;  1L4A B;  1FZB A;  1L0N K;  1NKZ B;  3EQ2 A;  3NTN A;  3RK3 D;  1GW3 A;  2Q7C A;  1G1I A;  4W7Z A;  1OXZ A;  3I5C A;  2XDJ A;  1SP4 A;  2XNX A;  1FDM A;  4WY4 B;  2WSF H;  2FYU K;  3OJA B;  3A2A A;  2KP8 A;  5APQ A;  1IFN A;  5APX A;  2J59 M;  1W2E A;  3IFM A;  1M1J A;  1URQ D;  3BAS A;  4RES B;  2OYH B;  1ZLL A;  1ZR2 A;  1JTH A;  1MZ9 A;  2POH A;  1GZL A;  1GL2 A;  3H32 B;  1RE3 A;  5KLV K;  2FFD B;  1T3J A;  2YKP A;  2KB7 P;  2WSC H;  1WRG A;  3HE5 A;  3MTU E;  3P8M C;  4N6J A;  2NPS D;  1IFI A;  1X8Y A;  2JEE A;  1JY3 N;  1LTJ B;  2HPC A;  1RF0 C;  2ZXE B;  1LTB C;  5AVZ B;  3VP8 A;  4GT1 A;  4WY4 C;  5APY A;  3V2N A;  4DOJ A;  4M3L A;  1GK4 A;  1PFI A;  1HTL C;  1X9V A;  5AVX B;  3KYQ A;  1MUU A;  3TNU B;  1FZA A;  1H88 A;  2YO2 A;  1CW5 A;  1RE4 C;  2HG5 D;  1JY2 N;  4XA4 A;  3VN0 A;  1SQV K;  3A7O A;  1FJK A;  5AW5 B;  2YKQ A;  1KFM A;  2C0W A;  2HOD A;  3B5N C;  5AVW B;  1EQ7 A;  3TK1 A;  3TSI A;  1M1J B;  5KJ7 A;  1NHL A;  2WZ7 A;  1JNM A;  2KLV A;  2HFE D;  3U59 A;  1RF0 A;  2LKM A;  1X79 B;  1JTH B;  4W7Y A;  4WY4 A;  5AVU B;  2M8R A;  4IFD K;  3R2P A;  1GL2 B;  2I1J A;  3BRT B;  3N7N A;  3G3Z A;  4C7N A;  1KZU B;  1FAV A;  2O1J A;  3HTK A;  5AW9 B;  3HE5 B;  4GKG A;  4LLH A;  1RE4 A;  3M0D C;  2HPC B;  1FOS E;  1HJB A;  1N7S D;  2XU6 A;  3LW5 H;  1FZF A;  1GDT A;  3P32 A;  1J1E B;  3B5N A;  3HD7 B;  1IFJ A;  1FJP A;  4IFM A;  5CMZ A;  1N73 A;  1LGH B;  2OYI C;  4Y99 C;  2P7J A;  2W6B A;  2HOD B;  3V4Q A;  1CSB A;  2P67 A;  1HH0 A;  1KIL D;  1GW4 A;  3U1C A;  1NAF A;  3RL0 B;  2IPP A;  1FZE A;  1Z56 A;  3NXS A;  3SWY A;  3KDP B;  1GL2 D;  2N9B A;  3M0D A;  4I6M C;  4I1L A;  2IFM A;  4DZO A;  1MFZ A;  1HGZ A;  2C9L Y;  4AUW A;  2C0X A;  1J1E C;  2A45 I;  3HD7 C;  4C7N B;  3HTK B;  1J2J B;  1FU1 A;  2Q5U A;  1JY3 O;  3M06 A;  3BAT A;  2OYI A;  3V5B A;  2CPB A;  1DH3 A;  4WB4 A;  1LTI C;  2WIT A;  2XZR A;  2GUS A;  1AQ5 A;  3MD0 A;  3EFG A;  5AVQ B;  1GU5 A;  1N7L A;  1ZV8 A;  3N4X A;  3RL0 C;  3B5N B;  3VMY A;  5KJ7 C;  1JY2 O;  1DEB A;  2YMY A;  1N73 B;  1MV8 A;  4KHX A;  3T97 A;  3HE4 A;  2E43 A;  1L4A D;  1DX7 A;  2H7H A;  1T8Z A;  1J1D C;  3HD7 A;  4EIJ A;  1NWQ A;  1LWU C;  3V2Q A;  2WTY A;  4HYT B;  1FZC C;  1FOS F;  4WY4 D;  3VTP C;  1LTT C;  4I2L C;  2O1K A;  3CI9 A;  4C46 A;  1L0L K;  3O8Z A;  2WWW A;  3HUS A;  1XTC C;  3L37 A;  3L35 A;  2KYV A;  2Q3I A;  1NTK K;  3M0A A;  4LGD E;  5AW8 B;  4GIF A;  1XTG B;  1YTZ T;  3V2R A;  1N73 C;  5AW4 B;  3RK2 B;  3VOP A;  1YTZ I;  2BAS A;  2I1K A;  5AW6 B;  1GU4 A;  1WT6 A;  5AW2 B;  1YYC A;  1SQQ K;  2OYI B;  1QL2 A;  3PP5 A;  2NPS A;  4Y99 B;  2CPS A;  5BU5 A;  3LID A;  2IFN A;  5AW0 B;  2JJL A;  1CI6 A;  1IO4 A;  4JYB A;  1T2K C;  4LC1 A;  5CHX A;  1LWU A;  2HLO A;  2FYZ A;  3TYY A;  2Z5H A;  1RF1 C;  1SFC C;  2N1T C;  2WT7 A;  1FZC A;  2WSE H;  1G1J A;  3B8E B;  4WBA A;  2P2U A;  2MJZ A;  1G2C B;  2P1J A;  4B86 A;  1A02 J;  3HE4 B;  2PAJ A;  4JF7 A;  1S9K D;  2QM8 A;  1AFO A;  5APW A;  4ZKU A;  1N7S C;  3RK2 C;  5BU8 B;  2KSJ A;  5CCG C;  5CCH C;  3E1I A;  2IX7 C;  3HUS B;  5KTB A;  3L36 A;  1SLQ A;  1LTG C;  3V4W A;  2M3B A;  2W27 A;  2WPR A;  3MIW A;  4JYC A;  1KIL C;  1OWA A;  5APV A;  1N86 A;  3L4F A;  5AW7 B;  3RK3 C;  1RF1 A;  2GUV A;  1SFC A;  2R5B A;  1ZN5 A;  2N1T A;  2NPS B;  5AVR B;  1JOC A;  3NFQ A;  4AQR D;  2GM4 A;  1IC2 A;  1CI6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...