1HVVA

Self-association of the h3 region of syntaxin 1a: implications for snare complex assembly
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
67
structure length
67
Chain Sequence
QALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SYNTAXIN 1A
publication title Self-association of the H3 region of syntaxin 1A. Implications for intermediates in SNARE complex assembly.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
total genus 30
structure length 67
sequence length 67
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-01-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1hvvA00
2HFED 5KJ7D 2WZ7A 4LGDE 3VOPA 4WY4D 1KILC 3RK3D 2N1TB 3B5NC 2N1TA 2PP6A 1N7SC 3B5NB 3RK2C 3HD7A 3RK2B 1JTHB 4N78E 1GL2B 1GL2A 2H8PD 2N1TD 1KILD 3B5ND 1N7SD 3RK2D 4W7YA 1SFCA 2N1TC 1HVVA 2NPSA 2KOGA 3HD7C 2M8RA 3HD7B 5CCGA 1GL2C 1NHLA 1URQB 1T3JA 1URQA 5CCHA 2XDJA 3HD7D 1SFCC 1SFCB 1URQD 1GL2D 3RL0B 2YMYA 3PP5A 2NPSC 2NPSB 5KJ7A 1SFCD 5CCGC 3RL0D 1XTGB 1URQC 4WY4A 1L4AB 3RK3B 1L4AA 5CCHC 2NPSD 3M0DC 5CCGD 3P8CE 2HG5D 3RL0C 1L4AD 1KILB 4JF7A 5CCHD 1KILA 3TSIA 5KJ7C 3B5NA 1N7SB 1N7SA 1JTHA 3HTKB 3KYQA 4W7ZA 4OH8B 4WY4C 4W80A 1L4AC 4WY4B 3RK3C
chains in the Genus database with same CATH superfamily
2WPRA 2JO1A 2Q6QA 2O01N 4ZKPA 2WSEH 2YKOA 1M7LA 1OVRA 3FXEA 1P84D 3CCJP 2G8YA 3TNUB 2K9JB 3H1JE 5KAIE 3O6QA 3CC4P 1QL2A 2XNXA 2IPPA 1H89A 1VQOP 1YJNP 1LTJC 4QMAA 1G1JA 4L73A 4H0LC 5AVXB 3HRNA 1YI2P 3H1LD 2E76C 1LTGC 3N4XA 3D70A 3CCLP 2PGDA 3H1ID 1NKNA 1URQA 3AE5C 2KSJA 3L71J 1KYOE 3E1RA 1ZLLA 3CWBG 5AW8B 1S1CX 4D6TE 3H1JD 1NTME 4IFFA 1VQ9P 3ABVC 2OQQA 1OVVA 1JUNA 2NPSD 3G6EP 1HTLC 1KB9D 4OGQB 5CCHD 1KILA 3AE1C 4AYCA 3B5NA 1EZVI 1BDDA 1AVYA 2H7HA 1KYOD 1LTJB 3GMAA 5AVRB 2Z5HA 4H0LB 2BASA 3CWBJ 1FZCC 1GDTA 1LTAC 2C9LY 1S5LH 3USSA 3RK2B 2E76B 2C0XA 1N73A 4N78E 1Q90D 1L0LG 1K9MQ 2XZRA 1L0NJ 2FXPA 4W7YA 3TGUD 1USDA 1HBWA 4LC1A 4RKUJ 2KLVA 5AW0B 4EI2A 3E1IA 3GHGC 4PJ0E 2QJYB 4H0LD 2G3AA 1T3JA 3CX5D 3CD6P 1KORA 2LXBA 3L74J 5KAFE 3IFMA 1LT1A 1QX8A 3I55P 1J1DB 1J1EB 1SQVE 4PD4H 5KTBA 3V5BA 2PAJA 3CCEP 3C1LA 3PJSK 2WVRA 1AV1A 2E5YA 2RKLA 2KS1A 1LT9B 1BCCE 4YTPC 5GTIE 3M0DC 2OTJP 3RL0C 4NPDA 3II6A 2E75C 3B71A 1S5LX 1SQQK 1LWUC 2W27A 2R3SA 1QGKB 3IR9A 1SQBJ 3NMDA 1EZVE 1VQ4P 1VF5C 2KI7B 4HJGH 5KLVD 1HWTC 1ZR2A 2GUSA 1FDIA 2I8DA 2ZFCA 4KT0J 1SQVD 5AVVB 3U59A 2ZAEB 4RESB 5AW6B 1NTZD 2N1TD 5EFWB 1SQPD 3FXDA 1QLED 3BVHA 4U3FG 3PLNA 3H1KD 4PV1C 4GOEA 3CC2P 1BE3J 2JWDA 2V7QJ 3CCQP 2KNCA 3KDPB 2D2CD 1LGHB 1M1JB 1UIIA 2Y0EA 5AW1B 1EC5A 2M0BA 1KZUB 3L73D 1BDCA 1JB0J 2BCCD 3RL0B 3V6IA 3VYIA 1NGMB 1EDIA 1KD1Q 1VF5B 3V2PA 4Y99B 3L72D 2Y0CA 3HE5A 3W68A 1DH3A 3CCVP 3CXHD 4KHXA 3CWBE 3M91A 3L70J 3CMEP 5KLIB 3LW5J 3HTKA 3MD0A 2E75D 1NOHA 1L4AC 1OXZA 3AEDC 4OVNF 1S3JA 1YQ3C 2ZXXA 4PV1B 2O01H 1VQLP 1L2PA 1GK4A 1AVOA 2Y9YA 1LJ2A 1OW7A 2KUBA 4C7NA 1PZQA 1FZFA 1NJIQ 3JCUE 4L76A 2AEJA 2RN0A 2HLOA 3U1CA 1N86A 3GLMA 3H1LJ 3VN0A 4UB6E 1EDLA 3H1IJ 4NPEA 1M8OB 3B8EB 4PV1D 1OIPA 2M5AA 4KJMA 2POHA 5APTA 2ZYGA 3H1JJ 1R8EA 1CI6B 1URQD 3A5TA 2P7JA 3UIAA 1L0LE 4WB4A 1VPCA 3A0BH 2AXCA 3KZIE 5CCGC 2PRRA 1NU1D 4HYTB 1H88A 1L4AB 2BEZF 3O8ZA 3T97B 3TGUG 1KMIZ 4MN4C 1SQXK 1P84I 2H43A 3Q5PA 1H0TA 3NTNA 2K37A 2R3CA 3R2PA 2QM8A 3JSVC 4WY4B 1ZW0A 3AE3C 3V2RA 2Z5IA 2FYUD 4XA4A 3VP9A 1L0NK 1SQQG 1L0LD 3I5CA 1FOSE 3OAKA 1VQNP 2FFDC 1RE4A 3AE7C 1H8AA 4LLHA 1BE3E 1G1IA 4GT1A 1RF1A 1GD2E 1VDFA 1YBKA 2AXTE 3TGUJ 1MFZA 3RL0g 4XFJA 4GODA 1ZRTD 1LP1B 2FBWC 2YO2A 3HD7B 3L4FA 5AVQB 1NHLA 4ZKUA 5M1BA 1LT9A 5KLVG 1JMMA 1HGVA 2ITAA 1AFOA 1KB9I 2JWAA 4L75A 2QJKB 5C39A 3H32A 4U3FE 1FU1A 1Y8AA 1NTKK 1T3UA 2OYIC 1HF9A 1NTZG 1YTZI 1N7LA 1SQPG 1SQBK 1HJBA 3S1KA 2W8ZA 3H1KG 2A45G 2P10A 2OTKE 1NAYA 5CCGD 2P1JA 5APUA 1P84E 2FFDB 3MZWB 2L91A 4EYYQ 1RF0A 3B4SA 2ZJSE 1DEBA 1KFMA 3L73G 1LTIC 1SQVJ 2YMKA 4N6JA 2DW3A 1EDJA 1M1JA 2YIUC 3EFFK 3H1LE 2OTLP 1GK6A 1NAFA 3L72G 4GOFA 4UB6H 3D6ZA 3CX5I 1N2DC 2XNDH 5H2FE 5CJ4A 2E74C 2O1JA 2JJLA 2OYIB 1K05A 1JCDA 2CPBA 1JY2O 2JEEA 3GG2A 2Q5UA 1ZV8A 3KZIH 3L73J 2KIKA 3S4RA 4Z1MH 5E79H 1AQ5A 2BCCJ 2WWWA 5CJ0A 2QRXA 3SWKA 1KB9E 1CW5A 3G9RA 1OW6A 3HE4B 2NPSB 2M3EA 3FWNA 2PFXA 2P67A 3L72J 1AJYA 1KQSO 3BCCG 2KP8A 5L8RJ 2HYNA 3LIDA 2QJPC 2Q7CA 1EXIA 1KQGB 2O3JA 2QE7H 4K35A 2C0WA 2V7QH 1SQXG 1BGYG 5K5GB 3BATA 3VOPA 5KKZC 3BRVB 3CCSP 1VQKP 2YNYA 1RQUA 1PPJD 1NU1G 3TGUE 3A2AA 1YIJP 1VQ6P 1DIPA 5AVZB 3AECC 1Q86Q 2NRGA 4UB8E 1GL2A 3MUDA 1MZ9A 1GW3A 3PH0A 1QEXA 3G3ZA 1DX7A 2WT7B 3CX5E 3WU2E 2R32A 5TISE 2N1TC 3FWLA 3OA7A 1FAVA 1SQQE 2W6JH 3F5HA 2ZYAA 2FYUG 1USEA 3IN6A 3Q3DA 3W67A 2B9BA 3L37A 3MP7B 1S72P 2E74D 2D2CC 1SFCC 4I7ZC 1GZLA 3LW5H 5APSA 2B87B 3HUSC 2YXRB 3CXHI 5KJ7A 1YJWP 1P84H 3ZDMA 4WY4A 5AW7B 3I56P 1MKMA 3H1HG 5KLVE 1NTMK 1NTKG 1GU5A 3TSIA 1SQQD 1RF0C 2MKVA 2FYUJ 3RK3C 2WSCJ 4CPGA 1NTZE 2N9BA 1SQPE 1L0LJ 2GM4A 3H1KE 2N1TB 3C9IA 1FZCB 1NO4A 1N7SC 2IBZG 3HD7A 2QIWA 1M1KQ 2HODA 2I1JA 1TU3F 1GMJA 1S2EA 2K1AA 5KAIH 1A02F 2D2CB 4I7ZB 3SSUA 2B88A 3L73E 1KQFB 2BCCE 4EOTA 2R5BA 2W83C 4H44C 3WUVA 2LKMA 1WT6A 2R5DA 2B89A 3GHGB 4EDFA 2L5GB 3K5BA 3CL3D 2JDIH 1X22A 4H13C 2JP3A 3L72E 1CZQA 3V4WA 1FE6A 1E79H 1KYOH 3RK3E 1KQLA 4GDOA 3TYYA 2IX7C 1SFCD 3CXHE 3FX0A 3RBZA 1URQC 1GW4A 3RK3B 2IYOA 3AE2C 2OYHA 1FDMA 4I2LC 1GU4A 2E75B 1N7SB 1LWUB 4OWFA 1T2KD 1JY2P 1NKZB 1NWQA 2WPSA 2FKWB 1DD4A 5APVA 5DJTB 3U1AA 1VQMP 4U3FJ 4R4LA 1KILC 3RK3D 3TNUA 2K9JA 2FYZA 3B5NC 2N9YB 3O6QB 1PGQA 3S9OA 3CX5H 5TISH 3BCCE 3MUDC 5AW3B 1JY2N 1ZXGA 3TF5A 1VQ8P 1N7SD 4I1LA 1MV8A 3G4SP 5AVSB 1KFNA 1RE3A 1S4XA 1BGYE 3ITKA 1HVVA 2NPSA 3QH9A 1U7JA 1N73C 4XE5B 5AW4B 3RGUA 1URQB 1NU1E 4H44D 3L75G 5CCHA 2AEMA 4PJ0H 3VTPC 2YKPA 1PPJG 1JM0A 1EXJA 3TDKA 2J58A 4H13D 1FC2C 3BCCD 5AVUB 1Z56A 5DJUB 5KAFH 2HPCB 1KILE 4A7PA 4JPZB 2ZXEB 2FYUE 2RH0A 3M06A 1IO4A 3P8CE 2HG5D 5AVTB 1SQXD 1BGYD 5B66E 4EIJA 1X9VA 1KILB 2RMZA 2ZVOB 5GTIH 3RBXA 4BWNA 3KYQA 2XKMA 4D6TG 2KSEA 1NTMG 1LTJA 1L0ND 4ASWA 2IFMA 2ZYDA 1ZRTE 3H1HE 1XTCC 3WUUA 1N73B 1NTKE 1M57D 1KILD 3B5ND 3P8CD 2K3RA 1PIXA 2B87A 1K73Q 4N3YB 4DCKA 2QVAA 1JY3O 1T6AA 1RH5B 1OFCX 1Q82Q 3BRTB 3CI9A 2AEFA 4PD4I 3AEAC 2IBZE 3CXHH 2XDJA 1SS1A 1WRGA 3VMAA 3CPWO 3CCUP 1KV4A 1PP9G 3OJAB 3H1HD 1IFPA 1NTKD 3A3YB 4JQ0D 3G71P 1ZOYC 4I6MC 2XV5A 1SQBD 2OYHC 2E5TA 3P7KA 4GIFA 1FZBA 3CCRP 4WVZA 1HJ0A 4ASVA 1VL2A 1SQQJ 1FZCA 1J2JB 4K3AA 3D6YA 2MJZA 3M9QA 1Q7YQ 3MGNA 2KZIA 1PV3A 4DT0A 3A0HE 5BVZA 2IBZD 2IFNA 3Q5RA 1S5LE 5CHXA 2WZ7A 1NVOA 3N7NA 1FBMA 1R5LA 1BCCG 2WMMA 3P8MC 1RQVA 1HH0A 3GHGA 2CPSA 3PRJA 2FYNC 1PGJA 4TT3H 3EFGA 1U57A 5KLVJ 3C8VA 5AVYB 4BXLA 4YXDC 1RE3C 4M3LA 3M9BA 5GTHE 3JCUH 3M9HA 2KOGA 1FDOA 1NTZJ 2W90A 1SQPJ 1YJ9P 1YYCA 1T8ZA 4PD4E 4BRYB 1OMIA 1HGZA 3H1KJ 2Q3EA 3H6PA 2QEXP 3M0DA 1M90Q 1VQPP 2KYVA 3AEEC 2WSFJ 1G2CB 1OW8A 2WSCH 3IAOA 1LWUA 1IFMA 1DD3A 2OARA 3GF7A 3L70D 1LTTC 1RHZB 2Q1KA 3L71G 1R5SA 3CC7P 1D7MA 3VMXA 3HE5B 4OGQC 1ZP0C 2IZ0A 3L75E 4YPCA 3SWYA 3NFQA 1QVFO 1PPJE 3V4QA 2GUVA 3HTKB 2FYNB 3VMYA 5BU8B 1FOSF 3QWOC 4PD4D 3EQ2A 2O1KA 2UWJE 3H25A 2R44A 4DJGA 3RK2C 3V2QA 1JTHB 2YIUB 4C7NB 4IFMA 3L35A 1IFDA 4JBZA 3SWFA 5CMZA 2E42A 2YKQA 2H88C 3L75D 2Y9ZA 2A45I 2AXTH 2XU6A 1RE4C 2QA4P 1NH4A 1PGPA 2M8RA 2QJYC 2E74B 1RF1C 4R4MA 2M5AB 2KK7A 3LIEA 2HPCA 1L0NG 1FZGA 1ZN5A 1GTWA 1CI6A 1J1DC 1J1EC 1KC8Q 3BCCJ 3AE9C 2YXQB 2P58A 4DZOA 1LT9C 1YTZT 3GW6A 1L4AA 4YXWH 3T97A 1SQXJ 3A0HH 1BGYJ 3L74G 4D6TD 3AE6C 1H0TB 1NTMD 2WSSH 1BSNA 2QG4A 1OWAA 1NU1J 1JY3P 2QJPB 4OGQD 1PP9E 4W7ZA 1X79B 2K9YA 4LGDE 3R4YA 2FXMA 1IJDB 5KKZB 1T2KC 2I1KA 2BEQD 2OYOA 2PP6A 2SPZA 2Q3IA 1SQBG 3PTZA 5GTHH 4C46A 1JY3N 1RF1B 1BSHA 3E7KA 1ZMEC 2KXPB 2H8PD 4IL6E 1VQ5P 5APXA 3RK2D 2E76D 2QM7A 2YO3A 1Y9BA 1LP1A 2LXCB 3MTUE 3AEBC 1M1JC 2WSEJ 1FZAA 1DEEG 4N78D 1PP9D 2A06G 4HH2A 5CCGA 5H2FH 2H89C 3AE8C 1QVGO 1X0TA 3A0BE 4HB1A 1SLQA 1SFCB 1BE3G 3H1HJ 2Q9IA 3A7OA 3H32B 1NTKJ 1JEKA 3HUSB 3EWKA 1MUUA 1N8RQ 1KB9H 3OW2O 4JYBA 4Y99C 3SFDC 3D71A 1YQ4C 1FZEA 2NZ2A 4IFDK 1LTBC 2HR3A 4WBAA 2FFDA 1YITP 3MIWA 5KLIC 1BCCD 1KN7A 1JOCA 3BASA 5TJHA 4C7RA 1Q2NA 1IC2A 1VQ7P 2HFED 5KLVK 1IK7A 3FGAD 3VMZA 3L71E 5BU5A 1Q81Q 1SQVK 3L70G 5B5EE 1EZVD 2KZJA 2LR2A 1PGOA 5AW2B 1NTZK 4O9BA 1AQTA 1SQPK 2ZT9C 4BRYA 5APYA 3PHLA 4UB8H 1OVUA 2IDBA 2W6BA 1G2CA 1IK9A 2Z4EA 2Y0DA 4H44B 5APWA 3WU2H 2OYIA 4ZNCA 3Q5SA 1GL2C 4NPFX 4H13B 1EDKA 3L71D 3H1LG 3PP5A 1FJPA 1SQXE 3HE4A 3H1IG 1QL1A 4RJTA 2W6AA 1MFTA 3RL0D 3WUTA 1XTGB 1PL5A 1YHQP 1IFJA 2IBZI 1SVFA 1IZNB 3SFEC 3H1JG 1W2BO 1VF5D 1L0NE 1NYHA 4JF7A 4ZMDA 2WPQA 4DOJA 5KJ7C 1W5CE 3CMAP 1JTHA 3L36A 4WY4C 2OGUA 4WWIA 3NXSA 2VRSA 2ZT9B 2K88A 4JYCA 1LNQA 1OX3A 2WQYC 1K8AQ 4IL6H 4RO0A 1S9KE 1JO5A 3JC22 4IOIH 3P32A 3CWBD 1FJKA 3L74E 3KXDA 1LTSC 3B5NB 2WITA 2A45H 3WMM0 1GL2B 4Y28J 2WSFH 1PFIA 3L75J 1IFIA 2WT7A 1HUCA 3AEFC 2V4HA 2ZT9D 4TLFA 4B86A 3HD7C 1FS0E 5E79E 4L74A 2WPVB 2J59M 5AW5B 2IZ1A 3Q1MA 1SQBE 1IFNA 1A02J 1S9KD 2CK3H 1GL2D 2E43A 3GF3A 3F89A 2QJKC 4GKGA 3L74D 1K04A 3V2NA 1NU1K 1ZR4A 2A06E 1UIXA 4D6TJ 4IL6X 1NTMJ 3IF4A 1L4AD 5CBNA 2WTYA 1SP4A 3AEGC 4OH8B 4W80A 2KS1B 2FYUK 1EQ7A 5B5EH 2FXOA 5KJ7D 1RY3A 3MHVA 5AVWB 1W2EA 1L0LK 4WY4D 1Y47A 3CLQA 2N1TA 3TK1A 5APQA 1JMBA 2HODB 2ZVNB 1E5WA 2A06D 2FY8A 2GA1A 2IYPA 1SQVG 1U7MA 1KTMA 4U7JA 1OZHA 1SFCA 3KHUA 3M0AA 4HKZH 2KLUA 3Q2YA 1PP9J 1BE3D 3HUSA 2O01J 1X8YA 1KYOI 3L70E 1JCCA 4AUWA 3HD7D 2C9NY 2YMYA 2JKVA 1CSBA 2NPSC 3KPEA 1EZVG 2KNCB 3CCMP 4AQRD 1WMKA 5CBOA 3VP8A 3KQGA 2P2UA 5AW9B 2OYHB 5CCHC 2BCCG 2J5UA 2M3BA 1AA0A 4U3FD 1JNMA 3AE4C 1BCCJ 1M56D 1N7SA 2KB7P 5B66H 2QSIA 2JR8A 3H1IE
chains in the Genus database with same CATH topology
2WPSA 2WPRA 2FKWB 3VP9A 4ZKPA 5APVA 2WSEH 1L0NK 4LGDE 2YKOA 3U1AA 2FXMA 1M7LA 1IJDB 1T2KC 2I1KA 1KILC 3RK3D 3TNUB 3I5CA 3TNUA 3OAKA 1FOSE 2FYZA 3B5NC 2FFDC 2PP6A 1RE4A 2Q3IA 1H8AA 4LLHA 4C46A 1JY3N 1RF1B 1G1IA 1QL2A 2IPPA 2XNXA 4GT1A 1RF1A 1H89A 1GD2E 5AW3B 1JY2N 2H8PD 1VDFA 1LTJC 5APXA 1N7SD 3RK2D 1G1JA 4I1LA 2QM7A 2YO3A 1MV8A 1MFZA 5AVSB 5AVXB 3HRNA 1KFNA 1RE3A 1HVVA 2NPSA 3MTUE 1M1JC 1FZAA 2YO2A 4N78D 3HD7B 3N4XA 1LTGC 1N73C 3L4FA 4HH2A 5AVQB 5CCGA 4XE5B 5AW4B 1NHLA 4ZKUA 1LT9A 1URQB 1NKNA 1URQA 2KSJA 5CCHA 1JMMA 1HGVA 1AFOA 3VTPC 2YKPA 1SLQA 1SFCB 1ZLLA 2Q9IA 3A7OA 5AW8B 3H32B 2J58A 3H32A 1FU1A 1NTKK 3HUSB 1MUUA 1T3UA 4IFFA 5AVUB 2OYIC 1Z56A 1YTZI 1N7LA 1SQBK 1HJBA 4JYBA 1JUNA 4Y99C 2NPSD 2HPCB 1HTLC 2A45G 2ZXEB 1FZEA 3M06A 5CCGD 1IO4A 4IFDK 2P1JA 2HG5D 3P8CE 5APUA 5AVTB 4EIJA 1LTBC 1X9VA 1KILB 5CCHD 1KILA 4AYCA 2FFDB 4WBAA 3B5NA 2FFDA 3MIWA 1RF0A 3KYQA 1JOCA 2H7HA 3BASA 4C7RA 1DEBA 1KFMA 2XKMA 1IC2A 2HFED 1LTIC 5KLVK 1LTJB 1LTJA 5AVRB 2Z5HA 3VMZA 5BU5A 2BASA 1SQVK 2IFMA 1FZCC 4N6JA 1GDTA 1LTAC 2C9LY 1XTCC 1M1JA 3RK2B 1N73B 2C0XA 1N73A 4N78E 1GK6A 5AW2B 1NTZK 4O9BA 1NAFA 1KILD 1SQPK 3B5ND 5APYA 2XZRA 3P8CD 1N2DC 4W7YA 2W6BA 1G2CA 1IK9A 5CJ4A 1HBWA 4LC1A 2Z4EA 2KLVA 5AW0B 4N3YB 2O1JA 3E1IA 5APWA 3GHGC 2JJLA 1JY3O 2OYIB 2OYIA 1JCDA 1GL2C 2CPBA 1JY2O 2JEEA 1T3JA 3BRTB 3CI9A 2Q5UA 1ZV8A 2XDJA 1WRGA 1AQ5A 2WWWA 5CJ0A 3IFMA 1J1DB 3PP5A 1CW5A 1J1EB 1FJPA 3OJAB 5KTBA 3V5BA 3HE4B 2NPSB 2PAJA 3HE4A 1QL1A 3A3YB 2W6AA 3RL0D 4I6MC 1XTGB 2P67A 1LT9B 2XV5A 1IFJA 3P7KA 2OYHC 4GIFA 1SVFA 1FZBA 3M0DC 3RL0C 3II6A 2KP8A 2HYNA 3LIDA 4JF7A 1SQQK 2WPQA 1FZCA 1J2JB 4DOJA 5KJ7C 2MJZA 3M9QA 2Q7CA 1LWUC 2W27A 3MGNA 1JTHA 3L36A 3IR9A 3NMDA 4WY4C 5BVZA 2C0WA 3NXSA 2VRSA 4JYCA 2IFNA 1HWTC 1ZR2A 3BATA 5CHXA 2WZ7A 2GUSA 3VOPA 3N7NA 2ZFCA 1FBMA 1S9KE 1JO5A 3BRVB 2YNYA 3P32A 5AVVB 1FJKA 3U59A 1LTSC 3A2AA 3B5NB 3P8MC 2WITA 1HH0A 3GHGA 2CPSA 4RESB 5AVZB 2A45H 3WMM0 1GL2B 1GL2A 5AW6B 2N1TD 3EFGA 3MUDA 1MZ9A 1GW3A 2WSFH 5AVYB 1PFIA 3G3ZA 1DX7A 3BVHA 2WT7B 1IFIA 2WT7A 1RE3C 1HUCA 4M3LA 2R32A 3M9BA 3M9HA 2N1TC 3KDPB 4B86A 3OA7A 2KOGA 1LGHB 1FAVA 3HD7C 1M1JB 2J59M 5AW5B 3L37A 1YYCA 5AW1B 1IFNA 1T8ZA 1HGZA 1SFCC 3H6PA 1KZUB 1A02J 3M0DA 1GZLA 1S9KD 1GL2D 3RL0B 2E43A 4GKGA 2KYVA 3LW5H 1G2CB 5APSA 3HUSC 3V2NA 2WSCH 5KJ7A 1NU1K 3VYIA 1LWUA 1IFMA 2OARA 1LTTC 4WY4A 5AW7B 1ZR4A 3V2PA 4Y99B 3VMXA 3HE5B 3HE5A 1NTMK 1L4AD 3SWYA 1DH3A 1GU5A 3NFQA 3TSIA 2WTYA 4KHXA 1RF0C 1SP4A 2GUVA 3M91A 3V4QA 3HTKB 4OH8B 3HTKA 4W80A 3MD0A 1NOHA 1L4AC 1OXZA 2FYUK 3RK3C 1EQ7A 3VMYA 5BU8B 1FOSF 5KJ7D 2N9BA 1RY3A 5AVWB 3EQ2A 2GM4A 3V2RA 1W2EA 2O1KA 1L0LK 4WY4D 2O01H 3CLQA 2N1TB 1GK4A 3C9IA 1FZCB 2N1TA 1NO4A 1N7SC 3RK2C 3TK1A 3V2QA 3HD7A 5APQA 1JTHB 4C7NB 4IFMA 4C7NA 2HODB 1FZFA 2HODA 2I1JA 3L35A 1IFDA 1E5WA 3SWFA 5CMZA 1A02F 2E42A 2YKQA 2HLOA 1SFCA 3U1CA 3M0AA 2A45I 1N86A 4EOTA 2R5BA 2XU6A 1RE4C 3VN0A 3HUSA 1NH4A 2M8RA 2LKMA 1WT6A 2R5DA 1RF1C 3GHGB 2L5GB 1X8YA 3B8EB 3CL3D 3LIEA 2HPCA 1JCCA 4AUWA 1FZGA 3HD7D 2POHA 1ZN5A 5APTA 1GTWA 2C9NY 1CZQA 1CI6B 3V4WA 1URQD 3A5TA 1CI6A 1J1DC 1J1EC 2YMYA 2P7JA 3UIAA 4WB4A 1CSBA 2NPSC 3KPEA 1KQLA 1VPCA 4AQRD 3TYYA 2IX7C 1SFCD 5CCGC 4DZOA 1LT9C 1YTZT 4HYTB 3VP8A 1URQC 1H88A 1GW4A 3KQGA 1L4AB 2P2UA 5AW9B 3RK3B 1L4AA 5CCHC 2OYHB 2OYHA 1FDMA 3O8ZA 3T97A 2M3BA 4I2LC 1SQXK 1GU4A 2H43A 3NTNA 2R3CA 1JNMA 3R2PA 1OWAA 1N7SB 1N7SA 2KB7P 1JY3P 2QM8A 1LWUB 4W7ZA 1T2KD 1JY2P 4WY4B 1X79B 2Z5IA 1NKZB 1NWQA 4XA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HFE D;  5KJ7 D;  2WZ7 A;  4LGD E;  3VOP A;  4WY4 D;  1KIL C;  3RK3 D;  2N1T B;  3B5N C;  2N1T A;  2PP6 A;  1N7S C;  3B5N B;  3RK2 C;  3HD7 A;  3RK2 B;  1JTH B;  4N78 E;  1GL2 B;  1GL2 A;  2H8P D;  2N1T D;  1KIL D;  3B5N D;  1N7S D;  3RK2 D;  4W7Y A;  1SFC A;  2N1T C;  1HVV A;  2NPS A;  2KOG A;  3HD7 C;  2M8R A;  3HD7 B;  5CCG A;  1GL2 C;  1NHL A;  1URQ B;  1T3J A;  1URQ A;  5CCH A;  2XDJ A;  3HD7 D;  1SFC C;  1SFC B;  1URQ D;  1GL2 D;  3RL0 B;  2YMY A;  3PP5 A;  2NPS C;  2NPS B;  5KJ7 A;  1SFC D;  5CCG C;  3RL0 D;  1XTG B;  1URQ C;  4WY4 A;  1L4A B;  3RK3 B;  1L4A A;  5CCH C;  2NPS D;  3M0D C;  5CCG D;  3P8C E;  2HG5 D;  3RL0 C;  1L4A D;  1KIL B;  4JF7 A;  5CCH D;  1KIL A;  3TSI A;  5KJ7 C;  3B5N A;  1N7S B;  1N7S A;  1JTH A;  3HTK B;  3KYQ A;  4W7Z A;  4OH8 B;  4WY4 C;  4W80 A;  1L4A C;  4WY4 B;  3RK3 C; 
#chains in the Genus database with same CATH topology
 2WPR A;  2JO1 A;  2Q6Q A;  2O01 N;  4ZKP A;  2WSE H;  2YKO A;  1M7L A;  1OVR A;  3FXE A;  1P84 D;  3CCJ P;  2G8Y A;  3TNU B;  2K9J B;  3H1J E;  5KAI E;  3O6Q A;  3CC4 P;  1QL2 A;  2XNX A;  2IPP A;  1H89 A;  1VQO P;  1YJN P;  1LTJ C;  4QMA A;  1G1J A;  4L73 A;  4H0L C;  5AVX B;  3HRN A;  1YI2 P;  3H1L D;  2E76 C;  1LTG C;  3N4X A;  3D70 A;  3CCL P;  2PGD A;  3H1I D;  1NKN A;  1URQ A;  3AE5 C;  2KSJ A;  3L71 J;  1KYO E;  3E1R A;  1ZLL A;  3CWB G;  5AW8 B;  1S1C X;  4D6T E;  3H1J D;  1NTM E;  4IFF A;  1VQ9 P;  3ABV C;  2OQQ A;  1OVV A;  1JUN A;  2NPS D;  3G6E P;  1HTL C;  1KB9 D;  4OGQ B;  5CCH D;  1KIL A;  3AE1 C;  4AYC A;  3B5N A;  1EZV I;  1BDD A;  1AVY A;  2H7H A;  1KYO D;  1LTJ B;  3GMA A;  5AVR B;  2Z5H A;  4H0L B;  2BAS A;  3CWB J;  1FZC C;  1GDT A;  1LTA C;  2C9L Y;  1S5L H;  3USS A;  3RK2 B;  2E76 B;  2C0X A;  1N73 A;  4N78 E;  1Q90 D;  1L0L G;  1K9M Q;  2XZR A;  1L0N J;  2FXP A;  4W7Y A;  3TGU D;  1USD A;  1HBW A;  4LC1 A;  4RKU J;  2KLV A;  5AW0 B;  4EI2 A;  3E1I A;  3GHG C;  4PJ0 E;  2QJY B;  4H0L D;  2G3A A;  1T3J A;  3CX5 D;  3CD6 P;  1KOR A;  2LXB A;  3L74 J;  5KAF E;  3IFM A;  1LT1 A;  1QX8 A;  3I55 P;  1J1D B;  1J1E B;  1SQV E;  4PD4 H;  5KTB A;  3V5B A;  2PAJ A;  3CCE P;  3C1L A;  3PJS K;  2WVR A;  1AV1 A;  2E5Y A;  2RKL A;  2KS1 A;  1LT9 B;  1BCC E;  4YTP C;  5GTI E;  3M0D C;  2OTJ P;  3RL0 C;  4NPD A;  3II6 A;  2E75 C;  3B71 A;  1S5L X;  1SQQ K;  1LWU C;  2W27 A;  2R3S A;  1QGK B;  3IR9 A;  1SQB J;  3NMD A;  1EZV E;  1VQ4 P;  1VF5 C;  2KI7 B;  4HJG H;  5KLV D;  1HWT C;  1ZR2 A;  2GUS A;  1FDI A;  2I8D A;  2ZFC A;  4KT0 J;  1SQV D;  5AVV B;  3U59 A;  2ZAE B;  4RES B;  5AW6 B;  1NTZ D;  2N1T D;  5EFW B;  1SQP D;  3FXD A;  1QLE D;  3BVH A;  4U3F G;  3PLN A;  3H1K D;  4PV1 C;  4GOE A;  3CC2 P;  1BE3 J;  2JWD A;  2V7Q J;  3CCQ P;  2KNC A;  3KDP B;  2D2C D;  1LGH B;  1M1J B;  1UII A;  2Y0E A;  5AW1 B;  1EC5 A;  2M0B A;  1KZU B;  3L73 D;  1BDC A;  1JB0 J;  2BCC D;  3RL0 B;  3V6I A;  3VYI A;  1NGM B;  1EDI A;  1KD1 Q;  1VF5 B;  3V2P A;  4Y99 B;  3L72 D;  2Y0C A;  3HE5 A;  3W68 A;  1DH3 A;  3CCV P;  3CXH D;  4KHX A;  3CWB E;  3M91 A;  3L70 J;  3CME P;  5KLI B;  3LW5 J;  3HTK A;  3MD0 A;  2E75 D;  1NOH A;  1L4A C;  1OXZ A;  3AED C;  4OVN F;  1S3J A;  1YQ3 C;  2ZXX A;  4PV1 B;  2O01 H;  1VQL P;  1L2P A;  1GK4 A;  1AVO A;  2Y9Y A;  1LJ2 A;  1OW7 A;  2KUB A;  4C7N A;  1PZQ A;  1FZF A;  1NJI Q;  3JCU E;  4L76 A;  2AEJ A;  2RN0 A;  2HLO A;  3U1C A;  1N86 A;  3GLM A;  3H1L J;  3VN0 A;  4UB6 E;  1EDL A;  3H1I J;  4NPE A;  1M8O B;  3B8E B;  4PV1 D;  1OIP A;  2M5A A;  4KJM A;  2POH A;  5APT A;  2ZYG A;  3H1J J;  1R8E A;  1CI6 B;  1URQ D;  3A5T A;  2P7J A;  3UIA A;  1L0L E;  4WB4 A;  1VPC A;  3A0B H;  2AXC A;  3KZI E;  5CCG C;  2PRR A;  1NU1 D;  4HYT B;  1H88 A;  1L4A B;  2BEZ F;  3O8Z A;  3T97 B;  3TGU G;  1KMI Z;  4MN4 C;  1SQX K;  1P84 I;  2H43 A;  3Q5P A;  1H0T A;  3NTN A;  2K37 A;  2R3C A;  3R2P A;  2QM8 A;  3JSV C;  4WY4 B;  1ZW0 A;  3AE3 C;  3V2R A;  2Z5I A;  2FYU D;  4XA4 A;  3VP9 A;  1L0N K;  1SQQ G;  1L0L D;  3I5C A;  1FOS E;  3OAK A;  1VQN P;  2FFD C;  1RE4 A;  3AE7 C;  1H8A A;  4LLH A;  1BE3 E;  1G1I A;  4GT1 A;  1RF1 A;  1GD2 E;  1VDF A;  1YBK A;  2AXT E;  3TGU J;  1MFZ A;  3RL0 g;  4XFJ A;  4GOD A;  1ZRT D;  1LP1 B;  2FBW C;  2YO2 A;  3HD7 B;  3L4F A;  5AVQ B;  1NHL A;  4ZKU A;  5M1B A;  1LT9 A;  5KLV G;  1JMM A;  1HGV A;  2ITA A;  1AFO A;  1KB9 I;  2JWA A;  4L75 A;  2QJK B;  5C39 A;  3H32 A;  4U3F E;  1FU1 A;  1Y8A A;  1NTK K;  1T3U A;  2OYI C;  1HF9 A;  1NTZ G;  1YTZ I;  1N7L A;  1SQP G;  1SQB K;  1HJB A;  3S1K A;  2W8Z A;  3H1K G;  2A45 G;  2P10 A;  2OTK E;  1NAY A;  5CCG D;  2P1J A;  5APU A;  1P84 E;  2FFD B;  3MZW B;  2L91 A;  4EYY Q;  1RF0 A;  3B4S A;  2ZJS E;  1DEB A;  1KFM A;  3L73 G;  1LTI C;  1SQV J;  2YMK A;  4N6J A;  2DW3 A;  1EDJ A;  1M1J A;  2YIU C;  3EFF K;  3H1L E;  2OTL P;  1GK6 A;  1NAF A;  3L72 G;  4GOF A;  4UB6 H;  3D6Z A;  3CX5 I;  1N2D C;  2XND H;  5H2F E;  5CJ4 A;  2E74 C;  2O1J A;  2JJL A;  2OYI B;  1K05 A;  1JCD A;  2CPB A;  1JY2 O;  2JEE A;  3GG2 A;  2Q5U A;  1ZV8 A;  3KZI H;  3L73 J;  2KIK A;  3S4R A;  4Z1M H;  5E79 H;  1AQ5 A;  2BCC J;  2WWW A;  5CJ0 A;  2QRX A;  3SWK A;  1KB9 E;  1CW5 A;  3G9R A;  1OW6 A;  3HE4 B;  2NPS B;  2M3E A;  3FWN A;  2PFX A;  2P67 A;  3L72 J;  1AJY A;  1KQS O;  3BCC G;  2KP8 A;  5L8R J;  2HYN A;  3LID A;  2QJP C;  2Q7C A;  1EXI A;  1KQG B;  2O3J A;  2QE7 H;  4K35 A;  2C0W A;  2V7Q H;  1SQX G;  1BGY G;  5K5G B;  3BAT A;  3VOP A;  5KKZ C;  3BRV B;  3CCS P;  1VQK P;  2YNY A;  1RQU A;  1PPJ D;  1NU1 G;  3TGU E;  3A2A A;  1YIJ P;  1VQ6 P;  1DIP A;  5AVZ B;  3AEC C;  1Q86 Q;  2NRG A;  4UB8 E;  1GL2 A;  3MUD A;  1MZ9 A;  1GW3 A;  3PH0 A;  1QEX A;  3G3Z A;  1DX7 A;  2WT7 B;  3CX5 E;  3WU2 E;  2R32 A;  5TIS E;  2N1T C;  3FWL A;  3OA7 A;  1FAV A;  1SQQ E;  2W6J H;  3F5H A;  2ZYA A;  2FYU G;  1USE A;  3IN6 A;  3Q3D A;  3W67 A;  2B9B A;  3L37 A;  3MP7 B;  1S72 P;  2E74 D;  2D2C C;  1SFC C;  4I7Z C;  1GZL A;  3LW5 H;  5APS A;  2B87 B;  3HUS C;  2YXR B;  3CXH I;  5KJ7 A;  1YJW P;  1P84 H;  3ZDM A;  4WY4 A;  5AW7 B;  3I56 P;  1MKM A;  3H1H G;  5KLV E;  1NTM K;  1NTK G;  1GU5 A;  3TSI A;  1SQQ D;  1RF0 C;  2MKV A;  2FYU J;  3RK3 C;  2WSC J;  4CPG A;  1NTZ E;  2N9B A;  1SQP E;  1L0L J;  2GM4 A;  3H1K E;  2N1T B;  3C9I A;  1FZC B;  1NO4 A;  1N7S C;  2IBZ G;  3HD7 A;  2QIW A;  1M1K Q;  2HOD A;  2I1J A;  1TU3 F;  1GMJ A;  1S2E A;  2K1A A;  5KAI H;  1A02 F;  2D2C B;  4I7Z B;  3SSU A;  2B88 A;  3L73 E;  1KQF B;  2BCC E;  4EOT A;  2R5B A;  2W83 C;  4H44 C;  3WUV A;  2LKM A;  1WT6 A;  2R5D A;  2B89 A;  3GHG B;  4EDF A;  2L5G B;  3K5B A;  3CL3 D;  2JDI H;  1X22 A;  4H13 C;  2JP3 A;  3L72 E;  1CZQ A;  3V4W A;  1FE6 A;  1E79 H;  1KYO H;  3RK3 E;  1KQL A;  4GDO A;  3TYY A;  2IX7 C;  1SFC D;  3CXH E;  3FX0 A;  3RBZ A;  1URQ C;  1GW4 A;  3RK3 B;  2IYO A;  3AE2 C;  2OYH A;  1FDM A;  4I2L C;  1GU4 A;  2E75 B;  1N7S B;  1LWU B;  4OWF A;  1T2K D;  1JY2 P;  1NKZ B;  1NWQ A;  2WPS A;  2FKW B;  1DD4 A;  5APV A;  5DJT B;  3U1A A;  1VQM P;  4U3F J;  4R4L A;  1KIL C;  3RK3 D;  3TNU A;  2K9J A;  2FYZ A;  3B5N C;  2N9Y B;  3O6Q B;  1PGQ A;  3S9O A;  3CX5 H;  5TIS H;  3BCC E;  3MUD C;  5AW3 B;  1JY2 N;  1ZXG A;  3TF5 A;  1VQ8 P;  1N7S D;  4I1L A;  1MV8 A;  3G4S P;  5AVS B;  1KFN A;  1RE3 A;  1S4X A;  1BGY E;  3ITK A;  1HVV A;  2NPS A;  3QH9 A;  1U7J A;  1N73 C;  4XE5 B;  5AW4 B;  3RGU A;  1URQ B;  1NU1 E;  4H44 D;  3L75 G;  5CCH A;  2AEM A;  4PJ0 H;  3VTP C;  2YKP A;  1PPJ G;  1JM0 A;  1EXJ A;  3TDK A;  2J58 A;  4H13 D;  1FC2 C;  3BCC D;  5AVU B;  1Z56 A;  5DJU B;  5KAF H;  2HPC B;  1KIL E;  4A7P A;  4JPZ B;  2ZXE B;  2FYU E;  2RH0 A;  3M06 A;  1IO4 A;  3P8C E;  2HG5 D;  5AVT B;  1SQX D;  1BGY D;  5B66 E;  4EIJ A;  1X9V A;  1KIL B;  2RMZ A;  2ZVO B;  5GTI H;  3RBX A;  4BWN A;  3KYQ A;  2XKM A;  4D6T G;  2KSE A;  1NTM G;  1LTJ A;  1L0N D;  4ASW A;  2IFM A;  2ZYD A;  1ZRT E;  3H1H E;  1XTC C;  3WUU A;  1N73 B;  1NTK E;  1M57 D;  1KIL D;  3B5N D;  3P8C D;  2K3R A;  1PIX A;  2B87 A;  1K73 Q;  4N3Y B;  4DCK A;  2QVA A;  1JY3 O;  1T6A A;  1RH5 B;  1OFC X;  1Q82 Q;  3BRT B;  3CI9 A;  2AEF A;  4PD4 I;  3AEA C;  2IBZ E;  3CXH H;  2XDJ A;  1SS1 A;  1WRG A;  3VMA A;  3CPW O;  3CCU P;  1KV4 A;  1PP9 G;  3OJA B;  3H1H D;  1IFP A;  1NTK D;  3A3Y B;  4JQ0 D;  3G71 P;  1ZOY C;  4I6M C;  2XV5 A;  1SQB D;  2OYH C;  2E5T A;  3P7K A;  4GIF A;  1FZB A;  3CCR P;  4WVZ A;  1HJ0 A;  4ASV A;  1VL2 A;  1SQQ J;  1FZC A;  1J2J B;  4K3A A;  3D6Y A;  2MJZ A;  3M9Q A;  1Q7Y Q;  3MGN A;  2KZI A;  1PV3 A;  4DT0 A;  3A0H E;  5BVZ A;  2IBZ D;  2IFN A;  3Q5R A;  1S5L E;  5CHX A;  2WZ7 A;  1NVO A;  3N7N A;  1FBM A;  1R5L A;  1BCC G;  2WMM A;  3P8M C;  1RQV A;  1HH0 A;  3GHG A;  2CPS A;  3PRJ A;  2FYN C;  1PGJ A;  4TT3 H;  3EFG A;  1U57 A;  5KLV J;  3C8V A;  5AVY B;  4BXL A;  4YXD C;  1RE3 C;  4M3L A;  3M9B A;  5GTH E;  3JCU H;  3M9H A;  2KOG A;  1FDO A;  1NTZ J;  2W90 A;  1SQP J;  1YJ9 P;  1YYC A;  1T8Z A;  4PD4 E;  4BRY B;  1OMI A;  1HGZ A;  3H1K J;  2Q3E A;  3H6P A;  2QEX P;  3M0D A;  1M90 Q;  1VQP P;  2KYV A;  3AEE C;  2WSF J;  1G2C B;  1OW8 A;  2WSC H;  3IAO A;  1LWU A;  1IFM A;  1DD3 A;  2OAR A;  3GF7 A;  3L70 D;  1LTT C;  1RHZ B;  2Q1K A;  3L71 G;  1R5S A;  3CC7 P;  1D7M A;  3VMX A;  3HE5 B;  4OGQ C;  1ZP0 C;  2IZ0 A;  3L75 E;  4YPC A;  3SWY A;  3NFQ A;  1QVF O;  1PPJ E;  3V4Q A;  2GUV A;  3HTK B;  2FYN B;  3VMY A;  5BU8 B;  1FOS F;  3QWO C;  4PD4 D;  3EQ2 A;  2O1K A;  2UWJ E;  3H25 A;  2R44 A;  4DJG A;  3RK2 C;  3V2Q A;  1JTH B;  2YIU B;  4C7N B;  4IFM A;  3L35 A;  1IFD A;  4JBZ A;  3SWF A;  5CMZ A;  2E42 A;  2YKQ A;  2H88 C;  3L75 D;  2Y9Z A;  2A45 I;  2AXT H;  2XU6 A;  1RE4 C;  2QA4 P;  1NH4 A;  1PGP A;  2M8R A;  2QJY C;  2E74 B;  1RF1 C;  4R4M A;  2M5A B;  2KK7 A;  3LIE A;  2HPC A;  1L0N G;  1FZG A;  1ZN5 A;  1GTW A;  1CI6 A;  1J1D C;  1J1E C;  1KC8 Q;  3BCC J;  3AE9 C;  2YXQ B;  2P58 A;  4DZO A;  1LT9 C;  1YTZ T;  3GW6 A;  1L4A A;  4YXW H;  3T97 A;  1SQX J;  3A0H H;  1BGY J;  3L74 G;  4D6T D;  3AE6 C;  1H0T B;  1NTM D;  2WSS H;  1BSN A;  2QG4 A;  1OWA A;  1NU1 J;  1JY3 P;  2QJP B;  4OGQ D;  1PP9 E;  4W7Z A;  1X79 B;  2K9Y A;  4LGD E;  3R4Y A;  2FXM A;  1IJD B;  5KKZ B;  1T2K C;  2I1K A;  2BEQ D;  2OYO A;  2PP6 A;  2SPZ A;  2Q3I A;  1SQB G;  3PTZ A;  5GTH H;  4C46 A;  1JY3 N;  1RF1 B;  1BSH A;  3E7K A;  1ZME C;  2KXP B;  2H8P D;  4IL6 E;  1VQ5 P;  5APX A;  3RK2 D;  2E76 D;  2QM7 A;  2YO3 A;  1Y9B A;  1LP1 A;  2LXC B;  3MTU E;  3AEB C;  1M1J C;  2WSE J;  1FZA A;  1DEE G;  4N78 D;  1PP9 D;  2A06 G;  4HH2 A;  5CCG A;  5H2F H;  2H89 C;  3AE8 C;  1QVG O;  1X0T A;  3A0B E;  4HB1 A;  1SLQ A;  1SFC B;  1BE3 G;  3H1H J;  2Q9I A;  3A7O A;  3H32 B;  1NTK J;  1JEK A;  3HUS B;  3EWK A;  1MUU A;  1N8R Q;  1KB9 H;  3OW2 O;  4JYB A;  4Y99 C;  3SFD C;  3D71 A;  1YQ4 C;  1FZE A;  2NZ2 A;  4IFD K;  1LTB C;  2HR3 A;  4WBA A;  2FFD A;  1YIT P;  3MIW A;  5KLI C;  1BCC D;  1KN7 A;  1JOC A;  3BAS A;  5TJH A;  4C7R A;  1Q2N A;  1IC2 A;  1VQ7 P;  2HFE D;  5KLV K;  1IK7 A;  3FGA D;  3VMZ A;  3L71 E;  5BU5 A;  1Q81 Q;  1SQV K;  3L70 G;  5B5E E;  1EZV D;  2KZJ A;  2LR2 A;  1PGO A;  5AW2 B;  1NTZ K;  4O9B A;  1AQT A;  1SQP K;  2ZT9 C;  4BRY A;  5APY A;  3PHL A;  4UB8 H;  1OVU A;  2IDB A;  2W6B A;  1G2C A;  1IK9 A;  2Z4E A;  2Y0D A;  4H44 B;  5APW A;  3WU2 H;  2OYI A;  4ZNC A;  3Q5S A;  1GL2 C;  4NPF X;  4H13 B;  1EDK A;  3L71 D;  3H1L G;  3PP5 A;  1FJP A;  1SQX E;  3HE4 A;  3H1I G;  1QL1 A;  4RJT A;  2W6A A;  1MFT A;  3RL0 D;  3WUT A;  1XTG B;  1PL5 A;  1YHQ P;  1IFJ A;  2IBZ I;  1SVF A;  1IZN B;  3SFE C;  3H1J G;  1W2B O;  1VF5 D;  1L0N E;  1NYH A;  4JF7 A;  4ZMD A;  2WPQ A;  4DOJ A;  5KJ7 C;  1W5C E;  3CMA P;  1JTH A;  3L36 A;  4WY4 C;  2OGU A;  4WWI A;  3NXS A;  2VRS A;  2ZT9 B;  2K88 A;  4JYC A;  1LNQ A;  1OX3 A;  2WQY C;  1K8A Q;  4IL6 H;  4RO0 A;  1S9K E;  1JO5 A;  3JC2 2;  4IOI H;  3P32 A;  3CWB D;  1FJK A;  3L74 E;  3KXD A;  1LTS C;  3B5N B;  2WIT A;  2A45 H;  3WMM 0;  1GL2 B;  4Y28 J;  2WSF H;  1PFI A;  3L75 J;  1IFI A;  2WT7 A;  1HUC A;  3AEF C;  2V4H A;  2ZT9 D;  4TLF A;  4B86 A;  3HD7 C;  1FS0 E;  5E79 E;  4L74 A;  2WPV B;  2J59 M;  5AW5 B;  2IZ1 A;  3Q1M A;  1SQB E;  1IFN A;  1A02 J;  1S9K D;  2CK3 H;  1GL2 D;  2E43 A;  3GF3 A;  3F89 A;  2QJK C;  4GKG A;  3L74 D;  1K04 A;  3V2N A;  1NU1 K;  1ZR4 A;  2A06 E;  1UIX A;  4D6T J;  4IL6 X;  1NTM J;  3IF4 A;  1L4A D;  5CBN A;  2WTY A;  1SP4 A;  3AEG C;  4OH8 B;  4W80 A;  2KS1 B;  2FYU K;  1EQ7 A;  5B5E H;  2FXO A;  5KJ7 D;  1RY3 A;  3MHV A;  5AVW B;  1W2E A;  1L0L K;  4WY4 D;  1Y47 A;  3CLQ A;  2N1T A;  3TK1 A;  5APQ A;  1JMB A;  2HOD B;  2ZVN B;  1E5W A;  2A06 D;  2FY8 A;  2GA1 A;  2IYP A;  1SQV G;  1U7M A;  1KTM A;  4U7J A;  1OZH A;  1SFC A;  3KHU A;  3M0A A;  4HKZ H;  2KLU A;  3Q2Y A;  1PP9 J;  1BE3 D;  3HUS A;  2O01 J;  1X8Y A;  1KYO I;  3L70 E;  1JCC A;  4AUW A;  3HD7 D;  2C9N Y;  2YMY A;  2JKV A;  1CSB A;  2NPS C;  3KPE A;  1EZV G;  2KNC B;  3CCM P;  4AQR D;  1WMK A;  5CBO A;  3VP8 A;  3KQG A;  2P2U A;  5AW9 B;  2OYH B;  5CCH C;  2BCC G;  2J5U A;  2M3B A;  1AA0 A;  4U3F D;  1JNM A;  3AE4 C;  1BCC J;  1M56 D;  1N7S A;  2KB7 P;  5B66 H;  2QSI A;  2JR8 A;  3H1I E; 
#chains in the Genus database with same CATH homology
 2WPS A;  2WPR A;  2FKW B;  3VP9 A;  4ZKP A;  5APV A;  2WSE H;  1L0N K;  4LGD E;  2YKO A;  3U1A A;  2FXM A;  1M7L A;  1IJD B;  1T2K C;  2I1K A;  1KIL C;  3RK3 D;  3TNU B;  3I5C A;  3TNU A;  3OAK A;  1FOS E;  2FYZ A;  3B5N C;  2FFD C;  2PP6 A;  1RE4 A;  2Q3I A;  1H8A A;  4LLH A;  4C46 A;  1JY3 N;  1RF1 B;  1G1I A;  1QL2 A;  2IPP A;  2XNX A;  4GT1 A;  1RF1 A;  1H89 A;  1GD2 E;  5AW3 B;  1JY2 N;  2H8P D;  1VDF A;  1LTJ C;  5APX A;  1N7S D;  3RK2 D;  1G1J A;  4I1L A;  2QM7 A;  2YO3 A;  1MV8 A;  1MFZ A;  5AVS B;  5AVX B;  3HRN A;  1KFN A;  1RE3 A;  1HVV A;  2NPS A;  3MTU E;  1M1J C;  1FZA A;  2YO2 A;  4N78 D;  3HD7 B;  3N4X A;  1LTG C;  1N73 C;  3L4F A;  4HH2 A;  5AVQ B;  5CCG A;  4XE5 B;  5AW4 B;  1NHL A;  4ZKU A;  1LT9 A;  1URQ B;  1NKN A;  1URQ A;  2KSJ A;  5CCH A;  1JMM A;  1HGV A;  1AFO A;  3VTP C;  2YKP A;  1SLQ A;  1SFC B;  1ZLL A;  2Q9I A;  3A7O A;  5AW8 B;  3H32 B;  2J58 A;  3H32 A;  1FU1 A;  1NTK K;  3HUS B;  1MUU A;  1T3U A;  4IFF A;  5AVU B;  2OYI C;  1Z56 A;  1YTZ I;  1N7L A;  1SQB K;  1HJB A;  4JYB A;  1JUN A;  4Y99 C;  2NPS D;  2HPC B;  1HTL C;  2A45 G;  2ZXE B;  1FZE A;  3M06 A;  5CCG D;  1IO4 A;  4IFD K;  2P1J A;  2HG5 D;  3P8C E;  5APU A;  5AVT B;  4EIJ A;  1LTB C;  1X9V A;  1KIL B;  5CCH D;  1KIL A;  4AYC A;  2FFD B;  4WBA A;  3B5N A;  2FFD A;  3MIW A;  1RF0 A;  3KYQ A;  1JOC A;  2H7H A;  3BAS A;  4C7R A;  1DEB A;  1KFM A;  2XKM A;  1IC2 A;  2HFE D;  1LTI C;  5KLV K;  1LTJ B;  1LTJ A;  5AVR B;  2Z5H A;  3VMZ A;  5BU5 A;  2BAS A;  1SQV K;  2IFM A;  1FZC C;  4N6J A;  1GDT A;  1LTA C;  2C9L Y;  1XTC C;  1M1J A;  3RK2 B;  1N73 B;  2C0X A;  1N73 A;  4N78 E;  1GK6 A;  5AW2 B;  1NTZ K;  4O9B A;  1NAF A;  1KIL D;  1SQP K;  3B5N D;  5APY A;  2XZR A;  3P8C D;  1N2D C;  4W7Y A;  2W6B A;  1G2C A;  1IK9 A;  5CJ4 A;  1HBW A;  4LC1 A;  2Z4E A;  2KLV A;  5AW0 B;  4N3Y B;  2O1J A;  3E1I A;  5APW A;  3GHG C;  2JJL A;  1JY3 O;  2OYI B;  2OYI A;  1JCD A;  1GL2 C;  2CPB A;  1JY2 O;  2JEE A;  1T3J A;  3BRT B;  3CI9 A;  2Q5U A;  1ZV8 A;  2XDJ A;  1WRG A;  1AQ5 A;  2WWW A;  5CJ0 A;  3IFM A;  1J1D B;  3PP5 A;  1CW5 A;  1J1E B;  1FJP A;  3OJA B;  5KTB A;  3V5B A;  3HE4 B;  2NPS B;  2PAJ A;  3HE4 A;  1QL1 A;  3A3Y B;  2W6A A;  3RL0 D;  4I6M C;  1XTG B;  2P67 A;  1LT9 B;  2XV5 A;  1IFJ A;  3P7K A;  2OYH C;  4GIF A;  1SVF A;  1FZB A;  3M0D C;  3RL0 C;  3II6 A;  2KP8 A;  2HYN A;  3LID A;  4JF7 A;  1SQQ K;  2WPQ A;  1FZC A;  1J2J B;  4DOJ A;  5KJ7 C;  2MJZ A;  3M9Q A;  2Q7C A;  1LWU C;  2W27 A;  3MGN A;  1JTH A;  3L36 A;  3IR9 A;  3NMD A;  4WY4 C;  5BVZ A;  2C0W A;  3NXS A;  2VRS A;  4JYC A;  2IFN A;  1HWT C;  1ZR2 A;  3BAT A;  5CHX A;  2WZ7 A;  2GUS A;  3VOP A;  3N7N A;  2ZFC A;  1FBM A;  1S9K E;  1JO5 A;  3BRV B;  2YNY A;  3P32 A;  5AVV B;  1FJK A;  3U59 A;  1LTS C;  3A2A A;  3B5N B;  3P8M C;  2WIT A;  1HH0 A;  3GHG A;  2CPS A;  4RES B;  5AVZ B;  2A45 H;  3WMM 0;  1GL2 B;  1GL2 A;  5AW6 B;  2N1T D;  3EFG A;  3MUD A;  1MZ9 A;  1GW3 A;  2WSF H;  5AVY B;  1PFI A;  3G3Z A;  1DX7 A;  3BVH A;  2WT7 B;  1IFI A;  2WT7 A;  1RE3 C;  1HUC A;  4M3L A;  2R32 A;  3M9B A;  3M9H A;  2N1T C;  3KDP B;  4B86 A;  3OA7 A;  2KOG A;  1LGH B;  1FAV A;  3HD7 C;  1M1J B;  2J59 M;  5AW5 B;  3L37 A;  1YYC A;  5AW1 B;  1IFN A;  1T8Z A;  1HGZ A;  1SFC C;  3H6P A;  1KZU B;  1A02 J;  3M0D A;  1GZL A;  1S9K D;  1GL2 D;  3RL0 B;  2E43 A;  4GKG A;  2KYV A;  3LW5 H;  1G2C B;  5APS A;  3HUS C;  3V2N A;  2WSC H;  5KJ7 A;  1NU1 K;  3VYI A;  1LWU A;  1IFM A;  2OAR A;  1LTT C;  4WY4 A;  5AW7 B;  1ZR4 A;  3V2P A;  4Y99 B;  3VMX A;  3HE5 B;  3HE5 A;  1NTM K;  1L4A D;  3SWY A;  1DH3 A;  1GU5 A;  3NFQ A;  3TSI A;  2WTY A;  4KHX A;  1RF0 C;  1SP4 A;  2GUV A;  3M91 A;  3V4Q A;  3HTK B;  4OH8 B;  3HTK A;  4W80 A;  3MD0 A;  1NOH A;  1L4A C;  1OXZ A;  2FYU K;  3RK3 C;  1EQ7 A;  3VMY A;  5BU8 B;  1FOS F;  5KJ7 D;  2N9B A;  1RY3 A;  5AVW B;  3EQ2 A;  2GM4 A;  3V2R A;  1W2E A;  2O1K A;  1L0L K;  4WY4 D;  2O01 H;  3CLQ A;  2N1T B;  1GK4 A;  3C9I A;  1FZC B;  2N1T A;  1NO4 A;  1N7S C;  3RK2 C;  3TK1 A;  3V2Q A;  3HD7 A;  5APQ A;  1JTH B;  4C7N B;  4IFM A;  4C7N A;  2HOD B;  1FZF A;  2HOD A;  2I1J A;  3L35 A;  1IFD A;  1E5W A;  3SWF A;  5CMZ A;  1A02 F;  2E42 A;  2YKQ A;  2HLO A;  1SFC A;  3U1C A;  3M0A A;  2A45 I;  1N86 A;  4EOT A;  2R5B A;  2XU6 A;  1RE4 C;  3VN0 A;  3HUS A;  1NH4 A;  2M8R A;  2LKM A;  1WT6 A;  2R5D A;  1RF1 C;  3GHG B;  2L5G B;  1X8Y A;  3B8E B;  3CL3 D;  3LIE A;  2HPC A;  1JCC A;  4AUW A;  1FZG A;  3HD7 D;  2POH A;  1ZN5 A;  5APT A;  1GTW A;  2C9N Y;  1CZQ A;  1CI6 B;  3V4W A;  1URQ D;  3A5T A;  1CI6 A;  1J1D C;  1J1E C;  2YMY A;  2P7J A;  3UIA A;  4WB4 A;  1CSB A;  2NPS C;  3KPE A;  1KQL A;  1VPC A;  4AQR D;  3TYY A;  2IX7 C;  1SFC D;  5CCG C;  4DZO A;  1LT9 C;  1YTZ T;  4HYT B;  3VP8 A;  1URQ C;  1H88 A;  1GW4 A;  3KQG A;  1L4A B;  2P2U A;  5AW9 B;  3RK3 B;  1L4A A;  5CCH C;  2OYH B;  2OYH A;  1FDM A;  3O8Z A;  3T97 A;  2M3B A;  4I2L C;  1SQX K;  1GU4 A;  2H43 A;  3NTN A;  2R3C A;  1JNM A;  3R2P A;  1OWA A;  1N7S B;  1N7S A;  2KB7 P;  1JY3 P;  2QM8 A;  1LWU B;  4W7Z A;  1T2K D;  1JY2 P;  4WY4 B;  1X79 B;  2Z5I A;  1NKZ B;  1NWQ A;  4XA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...