3CWBJ

Chicken cytochrome bc1 complex inhibited by an iodinated analogue of the polyketide crocacin-d
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title The role of molecular modeling in the design of analogues of the fungicidal natural products crocacins A and D.
pubmed doi rcsb
total genus 24
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2008-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3cwbJ00
3H1KJ 1SQVJ 2FYUJ 3L70J 1NTMJ 3L73J 1P84I 5KLVJ 1NTKJ 3L75J 1SQQJ 1BE3J 3TGUJ 1BGYJ 3H1HJ 1NTZJ 3L72J 2IBZI 3H1IJ 3CX5I 3L71J 1SQPJ 1L0LJ 4PD4I 1KYOI 3H1JJ 3H1LJ 1KB9I 3CWBJ 3L74J 4U3FJ 2BCCJ 3CXHI 1PP9J 1EZVI 1NU1J 1SQBJ 1L0NJ 1SQXJ 3BCCJ 4D6TJ 1BCCJ
chains in the Genus database with same CATH superfamily
1OVUA 2ITAA 1X8YA 3H1JD 3L75G 3C8VA 3TGUE 4WY4B 1S3JA 1L0LE 3RL0B 3TGUD 4D6TE 1L0LD 5M1BA 4D6TD 3V4QA 3USSA 3HE4B 1ZR4A 3P8CE 5B66H 3CCQP 3VTPC 2QJKB 4H0LB 1ZRTE 2QSIA 1IZNB 1OVVA 2OYIB 1M7LA 2E74D 3P8CD 3Q5PA 1ZRTD 3NXSA 3JC22 4I1LA 1GTWA 1FZAA 4K3AA 1Q81Q 1SFCB 2R5DA 2YO2A 1U7JA 1ZLLA 1Y9BA 2BCCJ 3BCCJ 2A45I 3L75E 1LT9B 1T6AA 3BVHA 1IFPA 4IL6H 3NFQA 3A0HE 2Y0CA 1HJ0A 2FFDB 1KFNA 2YXQB 1N7SB 1NU1E 5TISE 5APWA 4LC1A 3ABVC 3M9HA 3RBZA 3LW5H 4H0LC 2Z4EA 1CZQA 1L4AD 1NU1D 1MUUA 2H7HA 3M0AA 2RH0A 4U7JA 3S4RA 2XV5A 2O01J 1ZMEC 2OTJP 1SQVK 2OTLP 1EDIA 1OW8A 2Q3IA 1SQVG 2G8YA 5BU5A 2B89A 1HTLC 2KS1B 3WUVA 2E75D 1SFCC 3RK3E 1FZCB 1LJ2A 4L74A 2BEQD 5K5GB 3RK3D 3P8MC 2O01H 1JY3P 1P84E 3FXDA 3WUUA 2PGDA 3V5BA 1LT1A 5AW5B 4PJ0H 1P84D 1N7SC 1RE3C 3RBXA 1RHZB 1NTZJ 2C9NY 2ZYDA 3L74G 2PRRA 1SQPJ 3TF5A 3CL3D 1HF9A 1M8OB 1IFMA 4O9BA 2P1JA 1ZP0C 4RKUJ 1FDOA 3FX0A 2QJPB 2LKMA 1X9VA 1Z56A 3S1KA 3H32A 1FS0E 2E74C 1KILB 4HKZH 2W8ZA 3BCCG 4DCKA 4WWIA 1FZCC 1JOCA 1GW3A 3H25A 4EIJA 3AE9C 1T2KD 2AEFA 1VQKP 1KN7A 2KUBA 1AVOA 1IC2A 1SVFA 3A7OA 5BVZA 4CPGA 2NRGA 1BCCG 4I2LC 1LP1A 1FAVA 3GHGB 2QG4A 1M1JB 1GU5A 2FKWB 3V2NA 3HUSB 2SPZA 3HE5A 3W68A 5H2FE 2QEXP 3L72J 1L4AC 3KDPB 3L74E 2XZRA 2QJPC 1RF1B 4LGDE 3HD7A 1IFNA 4Y99B 3AECC 2OGUA 1L4AA 1URQD 2KZIA 1P84I 5AW7B 2E75C 3PP5A 1VQLP 1SQBE 1Q90D 3HTKA 2PAJA 1USDA 1NTZK 3L35A 1PZQA 2XDJA 1SQPK 1NTZG 3H1HG 1SQBD 3UIAA 1LNQA 3B8EB 2J58A 3GHGC 3V4WA 1DD4A 4YTPC 1K8AQ 2ZT9D 5AW3B 1ZR2A 4RESB 3CPWO 3D70A 3OA7A 1JMBA 3RGUA 1FZEA 2J59M 4Y99C 1UIXA 5KAFE 2KZJA 4H44B 1K9MQ 1J2JB 1E5WA 3CMEP 2HODB 4EOTA 2KSEA 2Q6QA 4NPEA 3MP7B 3C9IA 4HB1A 1R8EA 2WTYA 1AFOA 2RMZA 2KLVA 2Y0DA 1T2KC 4OWFA 3H1JJ 5B5EH 1OW6A 3CCEP 2A45H 3PRJA 2KSJA 3S9OA 4XE5B 3WU2H 1KTMA 5GTIH 3SFDC 5AVWB 2N1TD 5AW9B 3FXEA 2KOGA 2JWAA 5KAIH 4L75A 1L0LJ 2IZ0A 1BDCA 2GM4A 3RK2B 1NTKK 5KLIB 4K35A 3OJAB 1LTAC 2I1JA 1NTKG 1KYOE 2H88C 3M9BA 1QVGO 4H44C 1YJNP 5L8RJ 3L4FA 1M57D 1KYOD 2P58A 1URQC 1SS1A 5KKZC 1KB9I 1EDJA 1QLED 3G3ZA 1URQA 1SP4A 3P7KA 3MTUE 4PV1B 4DOJA 2N9YB 1GMJA 1PV3A 3CCMP 1JUNA 2OYHC 3CCUP 1S1CX 1QEXA 4JQ0D 2OYHA 2WSFH 1HGVA 2ZT9C 3RK2C 1JM0A 4H13B 3B4SA 1VPCA 1HWTC 1USEA 1OWAA 1SQXJ 2NPSB 2YKPA 2LXBA 4WY4D 3H1IE 3BRVB 3RL0D 1JY3O 4Y28J 3H1ID 4I7ZB 1BSNA 5APYA 1L0NJ 2AXTE 1J1EB 2B87A 3OAKA 3LIDA 1FC2C 2Q7CA 1KFMA 2E76B 2E42A 2A06E 2B88A 2K9JA 4GOEA 2HG5D 1AVYA 2KLUA 1PGPA 4H0LD 1JCDA 1KQGB 2A06D 2V4HA 2N1TC 3TYYA 4H13C 1Q82Q 2O1KA 3AEFC 1JTHA 2N1TA 1YYCA 1ZXGA 1PL5A 2JDIH 1HBWA 1S9KE 1SFCD 4KT0J 2YNYA 1VQOP 1G2CA 2YMYA 1H0TB 1RY3A 3L73E 1N73B 1S9KD 1P84H 3GG2A 2QVAA 3E1RA 1HVVA 4I7ZC 3VP8A 3L73D 2IBZI 1PP9G 3CWBE 1NH4A 1N7SD 2ZXEB 4W80A 1DIPA 2E76C 3V2RA 3A2AA 1KV4A 3G9RA 2KIKA 1CI6B 2ZVOB 5AVQB 5KJ7C 3CWBD 3CC4P 4ASWA 1IK9A 5AW4B 1SQXK 4EYYQ 2PFXA 4N78E 1JCCA 1HH0A 1SQXG 3WUTA 2M3BA 5AW6B 4EI2A 3N7NA 1CSBA 4N78D 1VF5B 3QWOC 3L37A 2W27A 4R4LA 2QE7H 2KK7A 1MFZA 3CXHE 5BU8B 3L71G 1L0NK 2YKQA 2ZVNB 2FXOA 1L0NG 1GD2E 1EXJA 5GTHE 3CXHD 1JY2O 3H1LJ 3L70G 4WY4C 3LW5J 3E1IA 2E5YA 1X79B 2GUSA 1R5LA 2IDBA 1T3UA 4PD4E 4QMAA 1JY3N 1BGYG 1EZVG 2WPRA 2C9LY 3RL0C 4RJTA 1S5LX 4PD4D 3L75D 3D6ZA 3IAOA 4DZOA 1SQBJ 1SQQK 2W90A 2OARA 5CCGC 1KILE 4YPCA 2QJKC 3VP9A 1SQQG 2M3EA 3SWFA 3A3YB 3HE4A 1GL2B 3A0BE 2OYIC 3CCVP 1KILD 2JR8A 3PTZA 3O6QB 1QVFO 1OFCX 3HRNA 2YKOA 4C7NB 3I56P 1FU1A 2OYIA 1JEKA 1EDKA 2QA4P 1GU4A 1MKMA 2FYUJ 1H89A 2Q1KA 1KORA 3ZDMA 4LLHA 1EC5A 1YHQP 3L71E 4RO0A 1SFCA 2B9BA 2I8DA 2YIUB 1KB9H 1LT9C 3L71D 3L70E 2WMMA 1IK7A 2FFDC 5CCHD 1LT9A 3GLMA 2IFMA 1BGYE 3L70D 2HR3A 2FFDA 2W6AA 2K1AA 3KHUA 1T8ZA 1N7SA 1BGYD 1AV1A 3CI9A 1RE3A 2WPQA 3CXHI 1GL2C 3VMAA 2Y0EA 2P7JA 2BEZF 4OGQB 3H1KJ 1KC8Q 1NTMJ 3IFMA 2JJLA 3FWNA 4ZKUA 1FZFA 3F89A 4JBZA 1WRGA 3U1CA 1OX3A 3CMAP 3AEDC 2BCCG 1Q7YQ 2GA1A 3HD7B 1G1IA 2AEJA 1SQVE 4HYTB 2KS1A 2W6JH 1W5CE 2D2CB 1JY2N 2YIUC 1FZCA 1KQLA 1NKZB 1YTZI 1LWUB 5KLVJ 1SQVD 1Q86Q 1OXZA 2FXMA 2DW3A 5AW0B 3SFEC 3MD0A 3MIWA 2YO3A 3Q1MA 1J1DB 2GUVA 3CX5E 3II6A 3U59A 4IL6X 5DJUB 3VMZA 3TDKA 1NGMB 4N3YB 1VDFA 2XNXA 3CX5D 3SWYA 4OGQC 1GZLA 1OIPA 2FYUK 1KYOH 1AA0A 4H44D 2HYNA 2FYUG 3N4XA 2WPSA 4U3FJ 3AEAC 1KMIZ 3IF4A 2Q5UA 3EWKA 2ZXXA 1KILC 1FJPA 4UB8E 2WZ7A 3L74D 4JYCA 3M0DC 2Y9YA 1KILA 1FDIA 2W83C 1FOSF 3BCCE 1JY2P 3T97B 3FWLA 4BRYB 3BCCD 2L5GB 1WMKA 2RKLA 3AE2C 4IFMA 1SQPG 2J5UA 1H8AA 1M1JC 3H1IJ 2IFNA 5C39A 1NTMK 5CCHC 3H1KG 3HUSC 1HJBA 1NWQA 1BCCE 3V6IA 3TNUA 1NTMG 3AE3C 3RK2D 3GHGA 1M1JA 3ITKA 2H8PD 5CCHA 4TT3H 3HUSA 4UB6E 1BCCD 1RF1C 1G1JA 1BE3J 3OW2O 1SLQA 2IYPA 4PJ0E 3AEGC 1GW4A 5AW1B 2KNCB 2IX7C 3TK1A 1RF1A 5KLVK 2HPCB 5CJ0A 3G71P 3JCUE 1W2EA 2C0XA 1N7LA 4OH8B 5KTBA 2IYOA 1K05A 3CC7P 1EDLA 1LTTC 4PV1D 1VQ7P 3VYIA 5CBNA 1YI2P 2KP8A 3D71A 3GW6A 3C1LA 2K9YA 2M5AB 1Y47A 3L73J 3MZWB 4XFJA 3A5TA 3L72G 1NTZE 3H1HE 3P32A 1S72P 1IO4A 3EFFK 3TGUJ 2O01N 1SQPE 3KPEA 4H13D 4U3FG 3RL0g 3B71A 2WT7B 1NTZD 3H1HD 2IBZG 2OQQA 3CWBJ 4GT1A 1A02F 4JPZB 4D6TJ 1SQPD 2P67A 5TJHA 4KHXA 1ZW0A 2NPSD 2O1JA 3KZIH 4GIFA 4ZNCA 2OTKE 4C46A 1YQ3C 4HH2A 3EQ2A 2WSFJ 3L36A 3NTNA 1JO5A 3KXDA 1EQ7A 1HUCA 2E76D 1MV8A 5KJ7D 1NAYA 4WB4A 4A7PA 1CW5A 1QL2A 1NVOA 2G3AA 1K73Q 3B5NB 1RQUA 1LTGC 3BRTB 3VOPA 1PFIA 3L72E 3L75J 2A45G 1IFJA 1LTJB 5KLIC 3GF3A 3M9QA 1N86A 1PGOA 3CXHH 1NU1J 2NZ2A 2Z5HA 1U7MA 1AQTA 1UIIA 5GTHH 1NTKE 1ZV8A 2AXCA 3H1JG 4PD4H 2CK3H 1AQ5A 1NTKD 3JSVC 3A0HH 4PV1C 5E79E 3IR9A 4NPDA 1OVRA 3TGUG 1EXIA 3F5HA 1L0LK 5TISH 2XU6A 2Y9ZA 2K3RA 3Q5RA 1KD1Q 4M3LA 1VQNP 3BASA 1L0LG 5CCGD 3W67A 4D6TG 4GDOA 4YXDC 1KYOI 2KB7P 3A0BH 4AYCA 1XTGB 2R3SA 1D7MA 5CMZA 1VF5D 2W6BA 5EFWB 2Q9IA 4BWNA 1VQ4P 2NPSC 2Z5IA 3WU2E 3GF7A 2WWWA 5AVZB 4DT0A 5GTIE 1BSHA 1M90Q 2ZYAA 5AVTB 3E7KA 2NPSA 2FY8A 2H43A 1X0TA 1E79H 1FE6A 1PPJG 2XKMA 2KI7B 1RH5B 1J1EC 1LTBC 2XNDH 4I6MC 5AVSB 1T3JA 1NKNA 2ZFCA 5AW2B 3VN0A 1SQVJ 4EDFA 2LXCB 1KQSO 3LIEA 3PHLA 1NU1K 1GL2D 1U57A 4IFDK 2VRSA 1NU1G 5KJ7A 2WSEJ 1OZHA 5AVYB 3CCLP 3AE4C 1YJ9P 2WSSH 3QH9A 1VQ9P 1N73C 2ZJSE 4L73A 1VQMP 3L74J 2WPVB 4B86A 2JP3A 1H0TA 5APTA 3O8ZA 1N73A 2WSEH 1PPJE 3WMM0 3I55P 2M8RA 4WY4A 3VMYA 1DEEG 3CX5H 4OVNF 1IFIA 1H88A 1PP9E 1PPJD 5H2FH 4WBAA 2Q3EA 1NAFA 4OGQD 1CI6A 1YTZT 1JMMA 1PP9D 1S5LE 1M56D 1YJWP 5CCGA 4JF7A 4UB8H 1VF5C 1PIXA 2RN0A 1X22A 1SQXE 2JO1A 3HD7D 2POHA 4GKGA 1BCCJ 1SQXD 2D2CD 1N8RQ 3H32B 2O3JA 3MGNA 1VQPP 3CC2P 2WVRA 1BDDA 3SWKA 1L0NE 4JYBA 2E74B 3CCJP 1KQFB 2V7QJ 1L0ND 1VQ6P 1EZVE 5APVA 1WT6A 2WQYC 3AE7C 3VMXA 2MJZA 1QGKB 4UB6H 2WITA 1EZVD 1LP1B 5KAFH 3FGAD 2P10A 5CHXA 3HE5B 5AVRB 1SQQE 3JCUH 1GL2A 2V7QH 1FZBA 1KZUB 3H1HJ 3H1LG 3O6QA 1SQQD 4PD4I 4C7NA 1MZ9A 3PJSK 4W7ZA 5B66E 2UWJE 1L4AB 1S2EA 3V2QA 3Q5SA 1DD3A 2N9BA 1SQBK 2E5TA 1NO4A 1YITP 5CBOA 1SQBG 3HTKB 3MUDC 2E75B 2BASA 3MUDA 2QIWA 1FZGA 1ZN5A 2I1KA 3R2PA 3RK3B 2HLOA 4ASVA 1AJYA 3TNUB 2WSCJ 4IL6E 1GDTA 4MN4C 5AVXB 4KJMA 3HD7C 4DJGA 5APQA 3H1LE 1A02J 2BCCE 2D2CC 2P2UA 5AVVB 3M0DA 1LWUC 1EZVI 2KYVA 2QJYB 3H1LD 5AVUB 2WSCH 2BCCD 1LWUA 3M06A 1NTKJ 2KXPB 1J1DC 3CLQA 3RK3C 1KB9E 2M0BA 1PGJA 1N2DC 2YXRB 3CD6P 2ZAEB 2QRXA 1R5SA 1GK6A 1K04A 1YBKA 1KB9D 2FYNB 1DH3A 3U1AA 2R3CA 1IJDB 2FYUE 2R5BA 5KLVG 2OYOA 1FOSE 2MKVA 2FYUD 4AQRD 4IFFA 1VQ8P 1YQ4C 2AXTH 3EFGA 5E79H 1JNMA 3I5CA 2QJYC 5AW8B 3CX5I 4YXWH 2H89C 1RE4C 3T97A 1FDMA 1URQB 3B5ND 4BRYA 4R4MA 5KKZB 1RE4A 1S4XA 2PP6A 2QM7A 1OMIA 3MHVA 3KYQA 3AE5C 2AEMA 2JEEA 1LTIC 3H1KE 2JKVA 4AUWA 3M91A 1NTME 2OYHB 2CPBA 1L2PA 2FYNC 3PLNA 3H1KD 1NTMD 3D6YA 3PH0A 2KNCA 2ZT9B 3NMDA 3K5BA 2HPCA 2HODA 2K88A 3GMAA 5KLVE 3H1IG 3H6PA 3TSIA 1QX8A 1JB0J 3Q3DA 1GK4A 5KLVD 3G6EP 5APUA 2JWDA 2YMKA 4IOIH 1NOHA 1NJIQ 3R4YA 3AEBC 2B87B 1XTCC 1TU3F 3SSUA 2IPPA 3AE8C 1BE3G 2M5AA 3BATA 2FBWC 2A06G 3AE1C 3V2PA 2K9JB 1LTSC 3AE6C 4NPFX 4Z1MH 4ZKPA 3IN6A 1DX7A 1OW7A 4U3FE 1RF0C 2WT7A 3L72D 1PP9J 2IBZE 4ZMDA 1RF0A 4U3FD 4BXLA 2E43A 1VQ5P 1JTHB 2N1TB 1IFDA 2IBZD 1YIJP 2IZ1A 1PGQA 3CCSP 2K37A 4GODA 1G2CB 3L73G 1QL1A 4W7YA 1Y8AA 2FYZA 2QM8A 5APXA 4TLFA 4N6JA 3AEEC 3CWBG 3B5NC 3L71J 1ZOYC 1S5LH 2CPSA 3CCRP 1NYHA 1VL2A 2FXPA 3B5NA 2LR2A 3KQGA 1LTJC 3L70J 4HJGH 1BE3E 5B5EE 1BGYJ 1DEBA 5CJ4A 2R32A 1LTJA 2ZYGA 1FBMA 1BE3D 1M1KQ 1NHLA 3Q2YA 2R44A 3G4SP 2HFED 4L76A 4WVZA 4XA4A 5DJTB 5KAIE 1MFTA 1SQQJ 1HGZA 1W2BO 1Q2NA 3H1JE 1FJKA 5APSA 4C7RA 3KZIE 2L91A 2C0WA 1RQVA 1LGHB 4GOFA
chains in the Genus database with same CATH topology
3H1KJ 1SQVJ 2FYUJ 3L70J 1NTMJ 3L73J 1P84I 5KLVJ 1NTKJ 3L75J 1SQQJ 1BE3J 3TGUJ 1BGYJ 3H1HJ 1NTZJ 3L72J 2IBZI 3H1IJ 3CX5I 3L71J 1SQPJ 1L0LJ 4PD4I 1KYOI 3H1JJ 3H1LJ 1KB9I 3CWBJ 3L74J 4U3FJ 2BCCJ 3CXHI 1PP9J 1EZVI 1NU1J 1SQBJ 1L0NJ 1SQXJ 3BCCJ 4D6TJ 1BCCJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1K J;  1SQV J;  2FYU J;  3L70 J;  1NTM J;  3L73 J;  1P84 I;  5KLV J;  1NTK J;  3L75 J;  1SQQ J;  1BE3 J;  3TGU J;  1BGY J;  3H1H J;  1NTZ J;  3L72 J;  2IBZ I;  3H1I J;  3CX5 I;  3L71 J;  1SQP J;  1L0L J;  4PD4 I;  1KYO I;  3H1J J;  3H1L J;  1KB9 I;  3CWB J;  3L74 J;  4U3F J;  2BCC J;  3CXH I;  1PP9 J;  1EZV I;  1NU1 J;  1SQB J;  1L0N J;  1SQX J;  3BCC J;  4D6T J;  1BCC J; 
#chains in the Genus database with same CATH topology
 1OVU A;  2ITA A;  1X8Y A;  3H1J D;  3L75 G;  3C8V A;  3TGU E;  4WY4 B;  1S3J A;  1L0L E;  3RL0 B;  3TGU D;  4D6T E;  1L0L D;  5M1B A;  4D6T D;  3V4Q A;  3USS A;  3HE4 B;  1ZR4 A;  3P8C E;  5B66 H;  3CCQ P;  3VTP C;  2QJK B;  4H0L B;  1ZRT E;  2QSI A;  1IZN B;  1OVV A;  2OYI B;  1M7L A;  2E74 D;  3P8C D;  3Q5P A;  1ZRT D;  3NXS A;  3JC2 2;  4I1L A;  1GTW A;  1FZA A;  4K3A A;  1Q81 Q;  1SFC B;  2R5D A;  2YO2 A;  1U7J A;  1ZLL A;  1Y9B A;  2BCC J;  3BCC J;  2A45 I;  3L75 E;  1LT9 B;  1T6A A;  3BVH A;  1IFP A;  4IL6 H;  3NFQ A;  3A0H E;  2Y0C A;  1HJ0 A;  2FFD B;  1KFN A;  2YXQ B;  1N7S B;  1NU1 E;  5TIS E;  5APW A;  4LC1 A;  3ABV C;  3M9H A;  3RBZ A;  3LW5 H;  4H0L C;  2Z4E A;  1CZQ A;  1L4A D;  1NU1 D;  1MUU A;  2H7H A;  3M0A A;  2RH0 A;  4U7J A;  3S4R A;  2XV5 A;  2O01 J;  1ZME C;  2OTJ P;  1SQV K;  2OTL P;  1EDI A;  1OW8 A;  2Q3I A;  1SQV G;  2G8Y A;  5BU5 A;  2B89 A;  1HTL C;  2KS1 B;  3WUV A;  2E75 D;  1SFC C;  3RK3 E;  1FZC B;  1LJ2 A;  4L74 A;  2BEQ D;  5K5G B;  3RK3 D;  3P8M C;  2O01 H;  1JY3 P;  1P84 E;  3FXD A;  3WUU A;  2PGD A;  3V5B A;  1LT1 A;  5AW5 B;  4PJ0 H;  1P84 D;  1N7S C;  1RE3 C;  3RBX A;  1RHZ B;  1NTZ J;  2C9N Y;  2ZYD A;  3L74 G;  2PRR A;  1SQP J;  3TF5 A;  3CL3 D;  1HF9 A;  1M8O B;  1IFM A;  4O9B A;  2P1J A;  1ZP0 C;  4RKU J;  1FDO A;  3FX0 A;  2QJP B;  2LKM A;  1X9V A;  1Z56 A;  3S1K A;  3H32 A;  1FS0 E;  2E74 C;  1KIL B;  4HKZ H;  2W8Z A;  3BCC G;  4DCK A;  4WWI A;  1FZC C;  1JOC A;  1GW3 A;  3H25 A;  4EIJ A;  3AE9 C;  1T2K D;  2AEF A;  1VQK P;  1KN7 A;  2KUB A;  1AVO A;  1IC2 A;  1SVF A;  3A7O A;  5BVZ A;  4CPG A;  2NRG A;  1BCC G;  4I2L C;  1LP1 A;  1FAV A;  3GHG B;  2QG4 A;  1M1J B;  1GU5 A;  2FKW B;  3V2N A;  3HUS B;  2SPZ A;  3HE5 A;  3W68 A;  5H2F E;  2QEX P;  3L72 J;  1L4A C;  3KDP B;  3L74 E;  2XZR A;  2QJP C;  1RF1 B;  4LGD E;  3HD7 A;  1IFN A;  4Y99 B;  3AEC C;  2OGU A;  1L4A A;  1URQ D;  2KZI A;  1P84 I;  5AW7 B;  2E75 C;  3PP5 A;  1VQL P;  1SQB E;  1Q90 D;  3HTK A;  2PAJ A;  1USD A;  1NTZ K;  3L35 A;  1PZQ A;  2XDJ A;  1SQP K;  1NTZ G;  3H1H G;  1SQB D;  3UIA A;  1LNQ A;  3B8E B;  2J58 A;  3GHG C;  3V4W A;  1DD4 A;  4YTP C;  1K8A Q;  2ZT9 D;  5AW3 B;  1ZR2 A;  4RES B;  3CPW O;  3D70 A;  3OA7 A;  1JMB A;  3RGU A;  1FZE A;  2J59 M;  4Y99 C;  1UIX A;  5KAF E;  2KZJ A;  4H44 B;  1K9M Q;  1J2J B;  1E5W A;  3CME P;  2HOD B;  4EOT A;  2KSE A;  2Q6Q A;  4NPE A;  3MP7 B;  3C9I A;  4HB1 A;  1R8E A;  2WTY A;  1AFO A;  2RMZ A;  2KLV A;  2Y0D A;  1T2K C;  4OWF A;  3H1J J;  5B5E H;  1OW6 A;  3CCE P;  2A45 H;  3PRJ A;  2KSJ A;  3S9O A;  4XE5 B;  3WU2 H;  1KTM A;  5GTI H;  3SFD C;  5AVW B;  2N1T D;  5AW9 B;  3FXE A;  2KOG A;  2JWA A;  5KAI H;  4L75 A;  1L0L J;  2IZ0 A;  1BDC A;  2GM4 A;  3RK2 B;  1NTK K;  5KLI B;  4K35 A;  3OJA B;  1LTA C;  2I1J A;  1NTK G;  1KYO E;  2H88 C;  3M9B A;  1QVG O;  4H44 C;  1YJN P;  5L8R J;  3L4F A;  1M57 D;  1KYO D;  2P58 A;  1URQ C;  1SS1 A;  5KKZ C;  1KB9 I;  1EDJ A;  1QLE D;  3G3Z A;  1URQ A;  1SP4 A;  3P7K A;  3MTU E;  4PV1 B;  4DOJ A;  2N9Y B;  1GMJ A;  1PV3 A;  3CCM P;  1JUN A;  2OYH C;  3CCU P;  1S1C X;  1QEX A;  4JQ0 D;  2OYH A;  2WSF H;  1HGV A;  2ZT9 C;  3RK2 C;  1JM0 A;  4H13 B;  3B4S A;  1VPC A;  1HWT C;  1USE A;  1OWA A;  1SQX J;  2NPS B;  2YKP A;  2LXB A;  4WY4 D;  3H1I E;  3BRV B;  3RL0 D;  1JY3 O;  4Y28 J;  3H1I D;  4I7Z B;  1BSN A;  5APY A;  1L0N J;  2AXT E;  1J1E B;  2B87 A;  3OAK A;  3LID A;  1FC2 C;  2Q7C A;  1KFM A;  2E76 B;  2E42 A;  2A06 E;  2B88 A;  2K9J A;  4GOE A;  2HG5 D;  1AVY A;  2KLU A;  1PGP A;  4H0L D;  1JCD A;  1KQG B;  2A06 D;  2V4H A;  2N1T C;  3TYY A;  4H13 C;  1Q82 Q;  2O1K A;  3AEF C;  1JTH A;  2N1T A;  1YYC A;  1ZXG A;  1PL5 A;  2JDI H;  1HBW A;  1S9K E;  1SFC D;  4KT0 J;  2YNY A;  1VQO P;  1G2C A;  2YMY A;  1H0T B;  1RY3 A;  3L73 E;  1N73 B;  1S9K D;  1P84 H;  3GG2 A;  2QVA A;  3E1R A;  1HVV A;  4I7Z C;  3VP8 A;  3L73 D;  2IBZ I;  1PP9 G;  3CWB E;  1NH4 A;  1N7S D;  2ZXE B;  4W80 A;  1DIP A;  2E76 C;  3V2R A;  3A2A A;  1KV4 A;  3G9R A;  2KIK A;  1CI6 B;  2ZVO B;  5AVQ B;  5KJ7 C;  3CWB D;  3CC4 P;  4ASW A;  1IK9 A;  5AW4 B;  1SQX K;  4EYY Q;  2PFX A;  4N78 E;  1JCC A;  1HH0 A;  1SQX G;  3WUT A;  2M3B A;  5AW6 B;  4EI2 A;  3N7N A;  1CSB A;  4N78 D;  1VF5 B;  3QWO C;  3L37 A;  2W27 A;  4R4L A;  2QE7 H;  2KK7 A;  1MFZ A;  3CXH E;  5BU8 B;  3L71 G;  1L0N K;  2YKQ A;  2ZVN B;  2FXO A;  1L0N G;  1GD2 E;  1EXJ A;  5GTH E;  3CXH D;  1JY2 O;  3H1L J;  3L70 G;  4WY4 C;  3LW5 J;  3E1I A;  2E5Y A;  1X79 B;  2GUS A;  1R5L A;  2IDB A;  1T3U A;  4PD4 E;  4QMA A;  1JY3 N;  1BGY G;  1EZV G;  2WPR A;  2C9L Y;  3RL0 C;  4RJT A;  1S5L X;  4PD4 D;  3L75 D;  3D6Z A;  3IAO A;  4DZO A;  1SQB J;  1SQQ K;  2W90 A;  2OAR A;  5CCG C;  1KIL E;  4YPC A;  2QJK C;  3VP9 A;  1SQQ G;  2M3E A;  3SWF A;  3A3Y B;  3HE4 A;  1GL2 B;  3A0B E;  2OYI C;  3CCV P;  1KIL D;  2JR8 A;  3PTZ A;  3O6Q B;  1QVF O;  1OFC X;  3HRN A;  2YKO A;  4C7N B;  3I56 P;  1FU1 A;  2OYI A;  1JEK A;  1EDK A;  2QA4 P;  1GU4 A;  1MKM A;  2FYU J;  1H89 A;  2Q1K A;  1KOR A;  3ZDM A;  4LLH A;  1EC5 A;  1YHQ P;  3L71 E;  4RO0 A;  1SFC A;  2B9B A;  2I8D A;  2YIU B;  1KB9 H;  1LT9 C;  3L71 D;  3L70 E;  2WMM A;  1IK7 A;  2FFD C;  5CCH D;  1LT9 A;  3GLM A;  2IFM A;  1BGY E;  3L70 D;  2HR3 A;  2FFD A;  2W6A A;  2K1A A;  3KHU A;  1T8Z A;  1N7S A;  1BGY D;  1AV1 A;  3CI9 A;  1RE3 A;  2WPQ A;  3CXH I;  1GL2 C;  3VMA A;  2Y0E A;  2P7J A;  2BEZ F;  4OGQ B;  3H1K J;  1KC8 Q;  1NTM J;  3IFM A;  2JJL A;  3FWN A;  4ZKU A;  1FZF A;  3F89 A;  4JBZ A;  1WRG A;  3U1C A;  1OX3 A;  3CMA P;  3AED C;  2BCC G;  1Q7Y Q;  2GA1 A;  3HD7 B;  1G1I A;  2AEJ A;  1SQV E;  4HYT B;  2KS1 A;  2W6J H;  1W5C E;  2D2C B;  1JY2 N;  2YIU C;  1FZC A;  1KQL A;  1NKZ B;  1YTZ I;  1LWU B;  5KLV J;  1SQV D;  1Q86 Q;  1OXZ A;  2FXM A;  2DW3 A;  5AW0 B;  3SFE C;  3MD0 A;  3MIW A;  2YO3 A;  3Q1M A;  1J1D B;  2GUV A;  3CX5 E;  3II6 A;  3U59 A;  4IL6 X;  5DJU B;  3VMZ A;  3TDK A;  1NGM B;  4N3Y B;  1VDF A;  2XNX A;  3CX5 D;  3SWY A;  4OGQ C;  1GZL A;  1OIP A;  2FYU K;  1KYO H;  1AA0 A;  4H44 D;  2HYN A;  2FYU G;  3N4X A;  2WPS A;  4U3F J;  3AEA C;  1KMI Z;  3IF4 A;  2Q5U A;  3EWK A;  2ZXX A;  1KIL C;  1FJP A;  4UB8 E;  2WZ7 A;  3L74 D;  4JYC A;  3M0D C;  2Y9Y A;  1KIL A;  1FDI A;  2W83 C;  1FOS F;  3BCC E;  1JY2 P;  3T97 B;  3FWL A;  4BRY B;  3BCC D;  2L5G B;  1WMK A;  2RKL A;  3AE2 C;  4IFM A;  1SQP G;  2J5U A;  1H8A A;  1M1J C;  3H1I J;  2IFN A;  5C39 A;  1NTM K;  5CCH C;  3H1K G;  3HUS C;  1HJB A;  1NWQ A;  1BCC E;  3V6I A;  3TNU A;  1NTM G;  3AE3 C;  3RK2 D;  3GHG A;  1M1J A;  3ITK A;  2H8P D;  5CCH A;  4TT3 H;  3HUS A;  4UB6 E;  1BCC D;  1RF1 C;  1G1J A;  1BE3 J;  3OW2 O;  1SLQ A;  2IYP A;  4PJ0 E;  3AEG C;  1GW4 A;  5AW1 B;  2KNC B;  2IX7 C;  3TK1 A;  1RF1 A;  5KLV K;  2HPC B;  5CJ0 A;  3G71 P;  3JCU E;  1W2E A;  2C0X A;  1N7L A;  4OH8 B;  5KTB A;  2IYO A;  1K05 A;  3CC7 P;  1EDL A;  1LTT C;  4PV1 D;  1VQ7 P;  3VYI A;  5CBN A;  1YI2 P;  2KP8 A;  3D71 A;  3GW6 A;  3C1L A;  2K9Y A;  2M5A B;  1Y47 A;  3L73 J;  3MZW B;  4XFJ A;  3A5T A;  3L72 G;  1NTZ E;  3H1H E;  3P32 A;  1S72 P;  1IO4 A;  3EFF K;  3TGU J;  2O01 N;  1SQP E;  3KPE A;  4H13 D;  4U3F G;  3RL0 g;  3B71 A;  2WT7 B;  1NTZ D;  3H1H D;  2IBZ G;  2OQQ A;  3CWB J;  4GT1 A;  1A02 F;  4JPZ B;  4D6T J;  1SQP D;  2P67 A;  5TJH A;  4KHX A;  1ZW0 A;  2NPS D;  2O1J A;  3KZI H;  4GIF A;  4ZNC A;  2OTK E;  4C46 A;  1YQ3 C;  4HH2 A;  3EQ2 A;  2WSF J;  3L36 A;  3NTN A;  1JO5 A;  3KXD A;  1EQ7 A;  1HUC A;  2E76 D;  1MV8 A;  5KJ7 D;  1NAY A;  4WB4 A;  4A7P A;  1CW5 A;  1QL2 A;  1NVO A;  2G3A A;  1K73 Q;  3B5N B;  1RQU A;  1LTG C;  3BRT B;  3VOP A;  1PFI A;  3L72 E;  3L75 J;  2A45 G;  1IFJ A;  1LTJ B;  5KLI C;  3GF3 A;  3M9Q A;  1N86 A;  1PGO A;  3CXH H;  1NU1 J;  2NZ2 A;  2Z5H A;  1U7M A;  1AQT A;  1UII A;  5GTH H;  1NTK E;  1ZV8 A;  2AXC A;  3H1J G;  4PD4 H;  2CK3 H;  1AQ5 A;  1NTK D;  3JSV C;  3A0H H;  4PV1 C;  5E79 E;  3IR9 A;  4NPD A;  1OVR A;  3TGU G;  1EXI A;  3F5H A;  1L0L K;  5TIS H;  2XU6 A;  2Y9Z A;  2K3R A;  3Q5R A;  1KD1 Q;  4M3L A;  1VQN P;  3BAS A;  1L0L G;  5CCG D;  3W67 A;  4D6T G;  4GDO A;  4YXD C;  1KYO I;  2KB7 P;  3A0B H;  4AYC A;  1XTG B;  2R3S A;  1D7M A;  5CMZ A;  1VF5 D;  2W6B A;  5EFW B;  2Q9I A;  4BWN A;  1VQ4 P;  2NPS C;  2Z5I A;  3WU2 E;  3GF7 A;  2WWW A;  5AVZ B;  4DT0 A;  5GTI E;  1BSH A;  1M90 Q;  2ZYA A;  5AVT B;  3E7K A;  2NPS A;  2FY8 A;  2H43 A;  1X0T A;  1E79 H;  1FE6 A;  1PPJ G;  2XKM A;  2KI7 B;  1RH5 B;  1J1E C;  1LTB C;  2XND H;  4I6M C;  5AVS B;  1T3J A;  1NKN A;  2ZFC A;  5AW2 B;  3VN0 A;  1SQV J;  4EDF A;  2LXC B;  1KQS O;  3LIE A;  3PHL A;  1NU1 K;  1GL2 D;  1U57 A;  4IFD K;  2VRS A;  1NU1 G;  5KJ7 A;  2WSE J;  1OZH A;  5AVY B;  3CCL P;  3AE4 C;  1YJ9 P;  2WSS H;  3QH9 A;  1VQ9 P;  1N73 C;  2ZJS E;  4L73 A;  1VQM P;  3L74 J;  2WPV B;  4B86 A;  2JP3 A;  1H0T A;  5APT A;  3O8Z A;  1N73 A;  2WSE H;  1PPJ E;  3WMM 0;  3I55 P;  2M8R A;  4WY4 A;  3VMY A;  1DEE G;  3CX5 H;  4OVN F;  1IFI A;  1H88 A;  1PP9 E;  1PPJ D;  5H2F H;  4WBA A;  2Q3E A;  1NAF A;  4OGQ D;  1CI6 A;  1YTZ T;  1JMM A;  1PP9 D;  1S5L E;  1M56 D;  1YJW P;  5CCG A;  4JF7 A;  4UB8 H;  1VF5 C;  1PIX A;  2RN0 A;  1X22 A;  1SQX E;  2JO1 A;  3HD7 D;  2POH A;  4GKG A;  1BCC J;  1SQX D;  2D2C D;  1N8R Q;  3H32 B;  2O3J A;  3MGN A;  1VQP P;  3CC2 P;  2WVR A;  1BDD A;  3SWK A;  1L0N E;  4JYB A;  2E74 B;  3CCJ P;  1KQF B;  2V7Q J;  1L0N D;  1VQ6 P;  1EZV E;  5APV A;  1WT6 A;  2WQY C;  3AE7 C;  3VMX A;  2MJZ A;  1QGK B;  4UB6 H;  2WIT A;  1EZV D;  1LP1 B;  5KAF H;  3FGA D;  2P10 A;  5CHX A;  3HE5 B;  5AVR B;  1SQQ E;  3JCU H;  1GL2 A;  2V7Q H;  1FZB A;  1KZU B;  3H1H J;  3H1L G;  3O6Q A;  1SQQ D;  4PD4 I;  4C7N A;  1MZ9 A;  3PJS K;  4W7Z A;  5B66 E;  2UWJ E;  1L4A B;  1S2E A;  3V2Q A;  3Q5S A;  1DD3 A;  2N9B A;  1SQB K;  2E5T A;  1NO4 A;  1YIT P;  5CBO A;  1SQB G;  3HTK B;  3MUD C;  2E75 B;  2BAS A;  3MUD A;  2QIW A;  1FZG A;  1ZN5 A;  2I1K A;  3R2P A;  3RK3 B;  2HLO A;  4ASV A;  1AJY A;  3TNU B;  2WSC J;  4IL6 E;  1GDT A;  4MN4 C;  5AVX B;  4KJM A;  3HD7 C;  4DJG A;  5APQ A;  3H1L E;  1A02 J;  2BCC E;  2D2C C;  2P2U A;  5AVV B;  3M0D A;  1LWU C;  1EZV I;  2KYV A;  2QJY B;  3H1L D;  5AVU B;  2WSC H;  2BCC D;  1LWU A;  3M06 A;  1NTK J;  2KXP B;  1J1D C;  3CLQ A;  3RK3 C;  1KB9 E;  2M0B A;  1PGJ A;  1N2D C;  2YXR B;  3CD6 P;  2ZAE B;  2QRX A;  1R5S A;  1GK6 A;  1K04 A;  1YBK A;  1KB9 D;  2FYN B;  1DH3 A;  3U1A A;  2R3C A;  1IJD B;  2FYU E;  2R5B A;  5KLV G;  2OYO A;  1FOS E;  2MKV A;  2FYU D;  4AQR D;  4IFF A;  1VQ8 P;  1YQ4 C;  2AXT H;  3EFG A;  5E79 H;  1JNM A;  3I5C A;  2QJY C;  5AW8 B;  3CX5 I;  4YXW H;  2H89 C;  1RE4 C;  3T97 A;  1FDM A;  1URQ B;  3B5N D;  4BRY A;  4R4M A;  5KKZ B;  1RE4 A;  1S4X A;  2PP6 A;  2QM7 A;  1OMI A;  3MHV A;  3KYQ A;  3AE5 C;  2AEM A;  2JEE A;  1LTI C;  3H1K E;  2JKV A;  4AUW A;  3M91 A;  1NTM E;  2OYH B;  2CPB A;  1L2P A;  2FYN C;  3PLN A;  3H1K D;  1NTM D;  3D6Y A;  3PH0 A;  2KNC A;  2ZT9 B;  3NMD A;  3K5B A;  2HPC A;  2HOD A;  2K88 A;  3GMA A;  5KLV E;  3H1I G;  3H6P A;  3TSI A;  1QX8 A;  1JB0 J;  3Q3D A;  1GK4 A;  5KLV D;  3G6E P;  5APU A;  2JWD A;  2YMK A;  4IOI H;  1NOH A;  1NJI Q;  3R4Y A;  3AEB C;  2B87 B;  1XTC C;  1TU3 F;  3SSU A;  2IPP A;  3AE8 C;  1BE3 G;  2M5A A;  3BAT A;  2FBW C;  2A06 G;  3AE1 C;  3V2P A;  2K9J B;  1LTS C;  3AE6 C;  4NPF X;  4Z1M H;  4ZKP A;  3IN6 A;  1DX7 A;  1OW7 A;  4U3F E;  1RF0 C;  2WT7 A;  3L72 D;  1PP9 J;  2IBZ E;  4ZMD A;  1RF0 A;  4U3F D;  4BXL A;  2E43 A;  1VQ5 P;  1JTH B;  2N1T B;  1IFD A;  2IBZ D;  1YIJ P;  2IZ1 A;  1PGQ A;  3CCS P;  2K37 A;  4GOD A;  1G2C B;  3L73 G;  1QL1 A;  4W7Y A;  1Y8A A;  2FYZ A;  2QM8 A;  5APX A;  4TLF A;  4N6J A;  3AEE C;  3CWB G;  3B5N C;  3L71 J;  1ZOY C;  1S5L H;  2CPS A;  3CCR P;  1NYH A;  1VL2 A;  2FXP A;  3B5N A;  2LR2 A;  3KQG A;  1LTJ C;  3L70 J;  4HJG H;  1BE3 E;  5B5E E;  1BGY J;  1DEB A;  5CJ4 A;  2R32 A;  1LTJ A;  2ZYG A;  1FBM A;  1BE3 D;  1M1K Q;  1NHL A;  3Q2Y A;  2R44 A;  3G4S P;  2HFE D;  4L76 A;  4WVZ A;  4XA4 A;  5DJT B;  5KAI E;  1MFT A;  1SQQ J;  1HGZ A;  1W2B O;  1Q2N A;  3H1J E;  1FJK A;  5APS A;  4C7R A;  3KZI E;  2L91 A;  2C0W A;  1RQV A;  1LGH B;  4GOF A; 
#chains in the Genus database with same CATH homology
 3H1K J;  1SQV J;  2FYU J;  3L70 J;  1NTM J;  3L73 J;  1P84 I;  5KLV J;  1NTK J;  3L75 J;  1SQQ J;  1BE3 J;  3TGU J;  1BGY J;  3H1H J;  1NTZ J;  3L72 J;  2IBZ I;  3H1I J;  3CX5 I;  3L71 J;  1SQP J;  1L0L J;  4PD4 I;  1KYO I;  3H1J J;  3H1L J;  1KB9 I;  3CWB J;  3L74 J;  4U3F J;  2BCC J;  3CXH I;  1PP9 J;  1EZV I;  1NU1 J;  1SQB J;  1L0N J;  1SQX J;  3BCC J;  4D6T J;  1BCC J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...