3CWBJ

Chicken cytochrome bc1 complex inhibited by an iodinated analogue of the polyketide crocacin-d
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of molecular modeling in the design of analogues of the fungicidal natural products crocacins A and D.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 24
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2008-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3cwbJ00
3CXHI 3H1HJ 1KYOI 1PP9J 1NU1J 3TGUJ 1EZVI 1P84I 3H1KJ 4D6TJ 1NTKJ 1BE3J 3L70J 1KB9I 4U3FJ 1L0LJ 5KLVJ 1NTZJ 1SQBJ 1BGYJ 1SQQJ 3L75J 3H1LJ 3L72J 3L73J 1SQXJ 3BCCJ 3L71J 3CX5I 1L0NJ 3H1JJ 2FYUJ 1NTMJ 1SQPJ 3H1IJ 1BCCJ 3L74J 2BCCJ 3CWBJ 4PD4I 1SQVJ 2IBZI
chains in the Genus database with same CATH superfamily
1K05A 1SQPK 2ZYGA 1RF1A 1XTCC 1LJ2A 1Y9BA 4I1LA 2WPQA 1EXIA 2XZRA 1SQBD 2Y9YA 2KS1A 1GL2C 2NPSD 4KHXA 4PV1D 2D2CB 2K9YA 1YI2P 1KTMA 1NTZD 3H1HD 3U59A 1E5WA 2NRGA 2VRSA 1RF1C 5AVWB 3H1HG 3RL0D 1NH4A 4NPFX 1S3JA 5KLIC 1EQ7A 1BE3D 1PGQA 1L0ND 1ZRTE 3L73J 3P32A 3R4YA 1GL2B 3V4QA 4Z1MH 1M57D 3M0AA 3BCCJ 1LTBC 3L74D 2WSFJ 1J2JB 1KFNA 2PGDA 2W6JH 3EQ2A 3KXDA 5M1BA 4D6TG 3Q2YA 1JOCA 1MKMA 2YIUB 1NJIQ 1KILE 1LTJB 1SQQG 4I6MC 2Q3IA 2WSCJ 1MUUA 1N7SB 3GMAA 1YJ9P 5BU8B 4N78E 2M3BA 1D7MA 1PV3A 1ZRTD 2BCCG 2RH0A 5GTHH 5AW8B 1PPJG 1K04A 1BDDA 1LWUA 3RL0C 4R4LA 2POHA 1GW4A 3A0HH 3CCSP 2N9YB 1HGZA 3CC4P 2QE7H 4JYBA 2P67A 4K3AA 1A02F 1XTGB 1GU5A 4JQ0D 2JKVA 1ZLLA 4EI2A 1KYOE 1NO4A 4I7ZC 2JO1A 1LP1A 2KS1B 5CCHC 3TF5A 2R3CA 2H7HA 3GHGA 4WY4C 3G3ZA 3F89A 1SQPG 1EDIA 1M1KQ 3JCUE 2HPCB 4YTPC 3V2NA 2FYUE 2P10A 3KPEA 3L71J 4OWFA 1H8AA 2OYIC 4QMAA 2YNYA 3H6PA 1IJDB 2RMZA 1PZQA 3L72D 1L4AA 3AEAC 3M9BA 2OQQA 4JBZA 1DD4A 2ZVOB 3AEEC 5BVZA 3AE6C 2E76D 3L75E 3CCMP 4C7RA 3CCRP 4PD4I 1PPJE 3L70J 1KYOH 3L73D 4WWIA 3I55P 1JMBA 1SLQA 1ZP0C 3H1HJ 1YIJP 3FXDA 5KJ7C 2GM4A 4XFJA 1T8ZA 1L4AC 1KB9E 3GG2A 3H1JD 3NXSA 5CCHD 1K73Q 1S9KE 5APXA 1NTZK 1VL2A 4WY4D 1BE3J 3CCJP 4DZOA 3LIEA 1HTLC 1LT9C 5GTHE 2IBZG 4RESB 1SQBK 2OYHA 5GTIE 1NAYA 2JWAA 1KC8Q 2WITA 1SQPE 2Z5IA 1U7JA 1S5LH 5AVTB 4UB8E 5TISH 4CPGA 3CWBD 3HRNA 1H0TA 3CXHH 1VQKP 4RO0A 3RK3E 2A45H 1FC2C 1FZCA 1X9VA 1Q90D 3KZIH 1KILA 3CX5I 5AVXB 3S9OA 5AW5B 5CCGD 3Q5PA 2H89C 4N78D 4YPCA 3CI9A 3L72G 2Y0EA 3H1IJ 3FX0A 1J1DC 4JYCA 4EYYQ 1JNMA 2PRRA 5AW0B 3PP5A 1SQVJ 3V2PA 1NWQA 1FU1A 1HVVA 1GL2A 1X8YA 1KFMA 2LXBA 4AYCA 1HUCA 5DJUB 1JY2O 3KZIE 3Q5RA 3IFMA 1NTMK 1KB9D 4L76A 3AEBC 1L0NE 4LGDE 3PLNA 5KAFE 1T2KC 3CXHE 1NKNA 3VP9A 2J58A 4H44D 3VOPA 1Z56A 2O01H 1EZVD 2WVRA 1KB9I 1W2EA 2BASA 2KSEA 1GZLA 2M8RA 1W5CE 2ZJSE 4UB6E 5CCGC 3CX5E 1BCCE 3T97A 2CPBA 3V2RA 4DOJA 4IFDK 1S2EA 1NTZJ 2YMYA 3L72E 2FFDB 1M56D 3LW5H 1PL5A 2MJZA 1QGKB 3RBZA 2KLVA 4BRYB 3AEGC 3U1AA 2NPSB 5H2FE 1NVOA 1ZMEC 1PGJA 1YITP 3IAOA 5APQA 2QEXP 4I2LC 2C9NY 1S1CX 1IFPA 3B5NC 2N1TB 2ZXEB 3A3YB 1QVGO 1H0TB 4D6TD 3CX5H 1KYOD 2E5TA 3AEDC 4JF7A 2WMMA 2IBZI 2IX7C 1X0TA 3I56P 1NYHA 2WQYC 1LT1A 1QVFO 4U3FG 2Q3EA 1URQD 4L75A 2AEJA 3SWFA 2L91A 3SSUA 1NHLA 5APTA 1FBMA 4OGQB 1LT9B 1WRGA 4GODA 1L0LJ 3CLQA 3R2PA 1JTHA 1PP9G 5CJ0A 4DJGA 1DH3A 3WUVA 5AVYB 1IFDA 3B5ND 3NTNA 1VDFA 1FZAA 1K9MQ 1LTJA 3PH0A 2B87B 3GW6A 3CC7P 1N7SA 3JSVC 1SQVD 2FYNC 1QLED 3T97B 3A0HE 3G71P 4PJ0H 4IFMA 1BE3E 2UWJE 4H0LC 1NAFA 2A06E 1VQMP 1M1JA 1OVRA 3JC22 3TSIA 1A02J 3D70A 4GOEA 1SQXG 1USEA 2KZIA 2E76C 1BGYG 5EFWB 3H1HE 3M0DC 2DW3A 3NMDA 1NGMB 5C39A 2B9BA 5GTIH 2KIKA 3N4XA 2KZJA 5B5EE 1PP9J 2WSFH 3RL0B 3H25A 1URQB 1FDMA 4D6TJ 1OFCX 2Q5UA 3L71E 3BVHA 3I5CA 3H32A 2Y9ZA 3H1LG 1DEBA 1HJ0A 1T6AA 3M9HA 3S1KA 1FDIA 3VTPC 2V7QH 3H1LD 1HWTC 1PFIA 1FAVA 1JY3O 3BCCD 3EFFK 3MGNA 2A06G 1BGYJ 1L0NK 2FFDC 3AE4C 2FBWC 3KYQA 3PTZA 3CCQP 4AQRD 4YXWH 4OGQD 1R8EA 1M7LA 1S5LE 2K88A 2OGUA 4MN4C 5E79E 3L35A 1GTWA 5CBNA 2OYIB 1SQPJ 5KKZC 2Y0DA 3SWKA 1S5LX 2AXTH 2QM7A 2WWWA 1LTGC 3B8EB 3GF7A 2Q6QA 3LIDA 2IZ0A 3O8ZA 3U1CA 1KMIZ 1SQXD 1TU3F 5APWA 2BEQD 1N8RQ 3BRTB 2XNXA 1FZFA 3H1IG 4HB1A 4M3LA 2AEMA 3EWKA 3HE4A 2FYUG 2HR3A 4U7JA 1JCCA 2GUSA 1CI6B 1G2CA 3ABVC 1NTKJ 1Q82Q 2Z5HA 3E1IA 2QRXA 3O6QA 1LWUC 4H13D 1J1EC 1Y47A 4OGQC 1SFCA 1PP9D 2ZFCA 3TGUG 1KN7A 1RQUA 1AV1A 1VF5C 1ZXGA 2FKWB 1BSNA 1VPCA 2IYPA 2YXRB 4U3FD 4ZMDA 1YYCA 2FYUK 2JWDA 1RQVA 1SQQJ 1SFCD 2WSEJ 5KAFH 2O1KA 1N7LA 1EDLA 2ZYDA 5CCHA 1MFZA 1NU1D 1PGPA 2GA1A 1EXJA 2KNCB 3GHGC 4WY4A 1RE4A 3OAKA 4XE5B 1VF5B 4IL6E 2KB7P 2I8DA 3HD7C 5AW4B 5KLIB 1NTMD 3TGUE 3VMAA 5KLVG 3HTKB 1URQC 1EZVI 3RGUA 1P84I 3LW5J 3HD7A 3MP7B 2PP6A 1N7SD 1ZV8A 2K37A 1E79H 2JP3A 1JM0A 1EZVG 2NPSA 3L37A 4IL6H 5B66H 3TYYA 2E5YA 2BEZF 1OZHA 4H44B 4O9BA 1T2KD 1CW5A 1VQOP 2OARA 1M1JC 1FE6A 4GDOA 1OW7A 1Q86Q 1IFIA 2PFXA 3E1RA 1L0LG 4A7PA 1KB9H 5APSA 3H32B 1AQTA 2W6BA 3M0DA 2QJPB 3AEFC 5L8RJ 3D71A 2A45I 2NZ2A 4GT1A 4OH8B 2FYUJ 1BSHA 4L74A 2ZXXA 2D2CC 1U57A 3P8CE 5KLVE 4WBAA 3V6IA 5APUA 1SQQE 2QJYC 4PV1B 3KQGA 1RHZB 2I1KA 1IK7A 3CWBG 1NOHA 3RK3B 1LTIC 3H1KD 3H1KE 3TNUA 1M8OB 1MV8A 2E74B 3VP8A 3W68A 2WPRA 3L70E 1L0LK 2B87A 2ITAA 3H1KJ 1HH0A 4UB6H 5TISE 3D6ZA 4W80A 1MFTA 4HJGH 3VMXA 4Y28J 2QJYB 3IF4A 4PV1C 1IC2A 5AVRB 5B66E 5CBOA 3C1LA 1J1EB 4HYTB 1GK4A 4ASVA 3OW2O 2IBZD 1RF0A 2K9JB 3HD7B 4TT3H 1VQ5P 1AJYA 2FXPA 5KTBA 1VQ7P 5AW3B 2KP8A 1DEEG 3AE2C 4BXLA 2P2UA 1NTKE 4ZNCA 1Q7YQ 3AE8C 3H1KG 3B71A 4GOFA 1SFCB 1JCDA 2H88C 3WUTA 1RF0C 4L73A 3GHGB 2E76B 4C46A 1LTAC 2QA4P 2JEEA 2WZ7A 1ZN5A 1HBWA 3CWBJ 1R5SA 4EDFA 1AFOA 4H0LD 5CJ4A 1NKZB 1AVOA 2QJKC 4PD4D 1KYOI 2KSJA 2LR2A 2ZT9B 3B5NA 3H1IE 2IFMA 2V7QJ 3KHUA 2HLOA 1VQPP 2JJLA 2KNCA 2O1JA 3HE5A 4WY4B 2RN0A 3ZDMA 1L0LD 1GU4A 3M91A 1LGHB 3VMZA 3M9QA 3II6A 2XKMA 2OTJP 1BGYE 2JR8A 1NU1E 5CHXA 2OYIA 3MUDA 4N3YB 1JEKA 3CCVP 1OVVA 5AW9B 1DD3A 1IK9A 4DCKA 2WTYA 2N9BA 4Y99C 1KQSO 4AUWA 2OYHB 2W8ZA 4EIJA 1VQ6P 3AE3C 1KQFB 2L5GB 4BWNA 1SQQD 5AVZB 1P84D 3MHVA 2BCCD 1PGOA 2K9JA 3HUSB 2IZ1A 5KLVD 1CI6A 2HFED 2Q9IA 1IFNA 3HD7D 1OIPA 1SS1A 3A7OA 3N7NA 1ZW0A 2ZT9D 3K5BA 1L4AD 1OXZA 1P84E 1U7MA 2BCCE 3QWOC 1CSBA 2A45G 3L74G 1BDCA 4LLHA 1VQLP 1L0NG 2AEFA 2KI7B 1BE3G 1LP1B 2O3JA 2P7JA 2ZYAA 2E74D 2Z4EA 1GD2E 1RY3A 1JMMA 1OW8A 3BASA 2HPCA 3OJAB 1YBKA 1SQBG 4W7YA 1YJNP 1NTZG 1UIXA 1KQGB 4NPEA 1S4XA 5CMZA 4H13B 5B5EH 2W90A 1L0LE 2E75B 2FYNB 3CMAP 2M3EA 2ZT9C 2W27A 1R5LA 1VF5D 3H1LE 3H1ID 4N6JA 2FFDA 1JY3P 3L36A 1VQ8P 1WT6A 4NPDA 3RK2D 2RKLA 5KAIE 4B86A 3RBXA 4BRYA 1ZR2A 1FOSF 2N1TD 5AW7B 1S72P 4KT0J 3SWYA 5KAIH 1FZCC 1KILC 4JPZB 4PD4H 2Q1KA 2N1TA 3AE1C 4OVNF 2HG5D 5APYA 1MZ9A 2QVAA 2YKPA 2IDBA 5AVUB 3MZWB 5APVA 2KOGA 3BCCG 3CCUP 2IBZE 3A5TA 1AQ5A 4H44C 5E79H 3CCLP 3B5NB 3WUUA 1GDTA 5KLVJ 1KILB 4ZKPA 1G1JA 4ZKUA 3JCUH 2W83C 3HE5B 2KXPB 5AVSB 2YKQA 1YQ4C 3P7KA 3BATA 3CD6P 2P58A 2YO2A 3L70D 4Y99B 3TDKA 3TNUB 4C7NB 3WMM0 1PIXA 2R44A 3AECC 1T3JA 2QJPC 1L0NJ 2V4HA 3EFGA 3CPWO 1NU1K 1P84H 3H1JJ 1N73C 2C9LY 1NTMJ 2E42A 1LNQA 3L74J 4EOTA 1BGYD 2IPPA 1Q81Q 2B88A 1OW6A 4TLFA 3IR9A 3PHLA 3AE7C 1FDOA 1RE4C 1VQNP 1QX8A 3MIWA 1LTTC 2YKOA 2KYVA 1N73A 2XV5A 3FXEA 3SFEC 1JY2P 1Y8AA 2AXCA 3MUDC 2M5AB 3RK2B 4DT0A 3L71G 4PD4E 1JY3N 1RE3C 1M90Q 2W6AA 1URQA 3L75G 1DIPA 4WB4A 2G3AA 2HODB 3BRVB 2FYZA 2R3SA 1L2PA 4GKGA 1OWAA 1FJKA 2JDIH 1NTKD 2J5UA 1KQLA 1VQ9P 1FZCB 2GUVA 3D6YA 1CZQA 1SQXJ 3A0BE 3V2QA 1BCCD 2KK7A 5KLVK 2IFNA 1SQVK 1SQQK 3ITKA 1OX3A 2IYOA 2WSEH 3G4SP 1LTJC 3MD0A 3C8VA 1SQXK 1H89A 2XNDH 1X22A 2BCCJ 2XU6A 3CXHD 3G9RA 1HJBA 1HF9A 2P1JA 2K1AA 2R5BA 1KV4A 2LKMA 4UB8H 1LT9A 3A0BH 1NU1J 4H0LB 5AW6B 1JTHB 3F5HA 4PJ0E 4IFFA 2WT7A 2R5DA 1EDJA 2HYNA 1YQ3C 5AVVB 1LTSC 2WSSH 1OVUA 3V4WA 3WU2E 3SFDC 1W2BO 3HUSA 3P8CD 4K35A 4HH2A 1N73B 1AA0A 1G2CB 1M1JB 2QIWA 2I1JA 2M5AA 1YTZT 4I7ZB 5H2FH 1USDA 1NTKK 2FXMA 3CWBE 3H1LJ 1JO5A 3O6QB 1NTMG 2WSCH 5BU5A 1IFMA 1KD1Q 2HODA 2FXOA 3E7KA 3HUSC 1FZGA 4YXDC 2M0BA 2Q7CA 2CPSA 1G1IA 1FZEA 4IOIH 3RK2C 3W67A 1NU1G 3S4RA 1GW3A 2N1TC 2QM8A 3A2AA 3V5BA 4C7NA 3VMYA 2OTLP 1ZOYC 2E75D 3CC2P 2KUBA 3FGAD 3CXHI 3QH9A 3IN6A 5AW1B 3Q5SA 3CL3D 3CMEP 2YXQB 2FY8A 1BCCG 1AVYA 2J59M 2LXCB 4KJMA 3TGUJ 3PRJA 1IO4A 1FS0E 1L4AB 3FWNA 4ASWA 3M06A 5CCGA 1KZUB 1NTKG 3CX5D 1SP4A 3BCCE 3GF3A 3L75D 3OA7A 5KKZB 1NTME 2MKVA 2OTKE 3TGUD 1EZVE 1DX7A 2Y0CA 4U3FJ 3NFQA 1EDKA 3HTKA 2O01N 2AXTE 3PJSK 3Q3DA 2H8PD 5DJTB 3MTUE 2FYUD 4H13C 5AW2B 3RL0g 5K5GB 2WT7B 1HGVA 2E74C 2CK3H 1SQBJ 2WPVB 1QL1A 3L71D 1ZR4A 3L72J 2E75C 4IL6X 1N86A 1EC5A 3C9IA 2O01J 3AE9C 3H1JG 4R4MA 2B89A 1JY2N 1SFCC 2SPZA 1T3UA 1LWUB 4U3FE 1N2DC 2YIUC 1FJPA 1RF1B 2K3RA 3L73G 1J1DB 1KORA 3B4SA 1PP9E 3HE4B 4LC1A 4RJTA 1Q2NA 4XA4A 1H88A 2ZVNB 3TK1A 3G6EP 3AE5C 3P8MC 1RH5B 2H43A 3L70G 3RK3D 3UIAA 4W7ZA 2C0WA 5KJ7D 2A06D 1RE3A 4WVZA 1IFJA 2C0XA 5TJHA 1YHQP 1YJWP 2KLUA 1SQVE 2G8YA 1IZNB 1SQPD 3VN0A 1JUNA 1SQXE 5KJ7A 1KILD 1QEXA 1UIIA 1N7SC 1SVFA 3GLMA 2OYOA 2QJKB 2QG4A 2YO3A 3L74E 3VYIA 1S9KD 3H1JE 1X79B 2ZAEB 2QSIA 2R32A 3KDPB 3Q1MA 1K8AQ 2OYHC 1GL2D 2NPSC 3L75J 1FOSE 1VQ4P 3CCEP 3RK3C 3USSA 1OMIA 2XDJA 3L4FA 1GMJA 1PPJD 2YMKA 3L73E 3FWLA 1QL2A 1FZBA 2PAJA 1YTZI 4HKZH 1JB0J 1NTZE 5AVQB 3WU2H 4RKUJ 2WPSA 2E43A 1BCCJ 4D6TE 1WMKA 1GK6A 1SQBE 2D2CD 4GIFA 1SQVG
chains in the Genus database with same CATH topology
3CXHI 3H1HJ 1KYOI 1PP9J 1NU1J 3TGUJ 1EZVI 1P84I 3H1KJ 4D6TJ 1NTKJ 1BE3J 3L70J 1KB9I 4U3FJ 1L0LJ 5KLVJ 1NTZJ 1SQBJ 1BGYJ 1SQQJ 3L75J 3H1LJ 3L72J 3L73J 1SQXJ 3BCCJ 3L71J 3CX5I 1L0NJ 3H1JJ 2FYUJ 1NTMJ 1SQPJ 3H1IJ 1BCCJ 3L74J 2BCCJ 3CWBJ 4PD4I 1SQVJ 2IBZI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXH I;  3H1H J;  1KYO I;  1PP9 J;  1NU1 J;  3TGU J;  1EZV I;  1P84 I;  3H1K J;  4D6T J;  1NTK J;  1BE3 J;  3L70 J;  1KB9 I;  4U3F J;  1L0L J;  5KLV J;  1NTZ J;  1SQB J;  1BGY J;  1SQQ J;  3L75 J;  3H1L J;  3L72 J;  3L73 J;  1SQX J;  3BCC J;  3L71 J;  3CX5 I;  1L0N J;  3H1J J;  2FYU J;  1NTM J;  1SQP J;  3H1I J;  1BCC J;  3L74 J;  2BCC J;  3CWB J;  4PD4 I;  1SQV J;  2IBZ I; 
#chains in the Genus database with same CATH topology
 1K05 A;  1SQP K;  2ZYG A;  1RF1 A;  1XTC C;  1LJ2 A;  1Y9B A;  4I1L A;  2WPQ A;  1EXI A;  2XZR A;  1SQB D;  2Y9Y A;  2KS1 A;  1GL2 C;  2NPS D;  4KHX A;  4PV1 D;  2D2C B;  2K9Y A;  1YI2 P;  1KTM A;  1NTZ D;  3H1H D;  3U59 A;  1E5W A;  2NRG A;  2VRS A;  1RF1 C;  5AVW B;  3H1H G;  3RL0 D;  1NH4 A;  4NPF X;  1S3J A;  5KLI C;  1EQ7 A;  1BE3 D;  1PGQ A;  1L0N D;  1ZRT E;  3L73 J;  3P32 A;  3R4Y A;  1GL2 B;  3V4Q A;  4Z1M H;  1M57 D;  3M0A A;  3BCC J;  1LTB C;  3L74 D;  2WSF J;  1J2J B;  1KFN A;  2PGD A;  2W6J H;  3EQ2 A;  3KXD A;  5M1B A;  4D6T G;  3Q2Y A;  1JOC A;  1MKM A;  2YIU B;  1NJI Q;  1KIL E;  1LTJ B;  1SQQ G;  4I6M C;  2Q3I A;  2WSC J;  1MUU A;  1N7S B;  3GMA A;  1YJ9 P;  5BU8 B;  4N78 E;  2M3B A;  1D7M A;  1PV3 A;  1ZRT D;  2BCC G;  2RH0 A;  5GTH H;  5AW8 B;  1PPJ G;  1K04 A;  1BDD A;  1LWU A;  3RL0 C;  4R4L A;  2POH A;  1GW4 A;  3A0H H;  3CCS P;  2N9Y B;  1HGZ A;  3CC4 P;  2QE7 H;  4JYB A;  2P67 A;  4K3A A;  1A02 F;  1XTG B;  1GU5 A;  4JQ0 D;  2JKV A;  1ZLL A;  4EI2 A;  1KYO E;  1NO4 A;  4I7Z C;  2JO1 A;  1LP1 A;  2KS1 B;  5CCH C;  3TF5 A;  2R3C A;  2H7H A;  3GHG A;  4WY4 C;  3G3Z A;  3F89 A;  1SQP G;  1EDI A;  1M1K Q;  3JCU E;  2HPC B;  4YTP C;  3V2N A;  2FYU E;  2P10 A;  3KPE A;  3L71 J;  4OWF A;  1H8A A;  2OYI C;  4QMA A;  2YNY A;  3H6P A;  1IJD B;  2RMZ A;  1PZQ A;  3L72 D;  1L4A A;  3AEA C;  3M9B A;  2OQQ A;  4JBZ A;  1DD4 A;  2ZVO B;  3AEE C;  5BVZ A;  3AE6 C;  2E76 D;  3L75 E;  3CCM P;  4C7R A;  3CCR P;  4PD4 I;  1PPJ E;  3L70 J;  1KYO H;  3L73 D;  4WWI A;  3I55 P;  1JMB A;  1SLQ A;  1ZP0 C;  3H1H J;  1YIJ P;  3FXD A;  5KJ7 C;  2GM4 A;  4XFJ A;  1T8Z A;  1L4A C;  1KB9 E;  3GG2 A;  3H1J D;  3NXS A;  5CCH D;  1K73 Q;  1S9K E;  5APX A;  1NTZ K;  1VL2 A;  4WY4 D;  1BE3 J;  3CCJ P;  4DZO A;  3LIE A;  1HTL C;  1LT9 C;  5GTH E;  2IBZ G;  4RES B;  1SQB K;  2OYH A;  5GTI E;  1NAY A;  2JWA A;  1KC8 Q;  2WIT A;  1SQP E;  2Z5I A;  1U7J A;  1S5L H;  5AVT B;  4UB8 E;  5TIS H;  4CPG A;  3CWB D;  3HRN A;  1H0T A;  3CXH H;  1VQK P;  4RO0 A;  3RK3 E;  2A45 H;  1FC2 C;  1FZC A;  1X9V A;  1Q90 D;  3KZI H;  1KIL A;  3CX5 I;  5AVX B;  3S9O A;  5AW5 B;  5CCG D;  3Q5P A;  2H89 C;  4N78 D;  4YPC A;  3CI9 A;  3L72 G;  2Y0E A;  3H1I J;  3FX0 A;  1J1D C;  4JYC A;  4EYY Q;  1JNM A;  2PRR A;  5AW0 B;  3PP5 A;  1SQV J;  3V2P A;  1NWQ A;  1FU1 A;  1HVV A;  1GL2 A;  1X8Y A;  1KFM A;  2LXB A;  4AYC A;  1HUC A;  5DJU B;  1JY2 O;  3KZI E;  3Q5R A;  3IFM A;  1NTM K;  1KB9 D;  4L76 A;  3AEB C;  1L0N E;  4LGD E;  3PLN A;  5KAF E;  1T2K C;  3CXH E;  1NKN A;  3VP9 A;  2J58 A;  4H44 D;  3VOP A;  1Z56 A;  2O01 H;  1EZV D;  2WVR A;  1KB9 I;  1W2E A;  2BAS A;  2KSE A;  1GZL A;  2M8R A;  1W5C E;  2ZJS E;  4UB6 E;  5CCG C;  3CX5 E;  1BCC E;  3T97 A;  2CPB A;  3V2R A;  4DOJ A;  4IFD K;  1S2E A;  1NTZ J;  2YMY A;  3L72 E;  2FFD B;  1M56 D;  3LW5 H;  1PL5 A;  2MJZ A;  1QGK B;  3RBZ A;  2KLV A;  4BRY B;  3AEG C;  3U1A A;  2NPS B;  5H2F E;  1NVO A;  1ZME C;  1PGJ A;  1YIT P;  3IAO A;  5APQ A;  2QEX P;  4I2L C;  2C9N Y;  1S1C X;  1IFP A;  3B5N C;  2N1T B;  2ZXE B;  3A3Y B;  1QVG O;  1H0T B;  4D6T D;  3CX5 H;  1KYO D;  2E5T A;  3AED C;  4JF7 A;  2WMM A;  2IBZ I;  2IX7 C;  1X0T A;  3I56 P;  1NYH A;  2WQY C;  1LT1 A;  1QVF O;  4U3F G;  2Q3E A;  1URQ D;  4L75 A;  2AEJ A;  3SWF A;  2L91 A;  3SSU A;  1NHL A;  5APT A;  1FBM A;  4OGQ B;  1LT9 B;  1WRG A;  4GOD A;  1L0L J;  3CLQ A;  3R2P A;  1JTH A;  1PP9 G;  5CJ0 A;  4DJG A;  1DH3 A;  3WUV A;  5AVY B;  1IFD A;  3B5N D;  3NTN A;  1VDF A;  1FZA A;  1K9M Q;  1LTJ A;  3PH0 A;  2B87 B;  3GW6 A;  3CC7 P;  1N7S A;  3JSV C;  1SQV D;  2FYN C;  1QLE D;  3T97 B;  3A0H E;  3G71 P;  4PJ0 H;  4IFM A;  1BE3 E;  2UWJ E;  4H0L C;  1NAF A;  2A06 E;  1VQM P;  1M1J A;  1OVR A;  3JC2 2;  3TSI A;  1A02 J;  3D70 A;  4GOE A;  1SQX G;  1USE A;  2KZI A;  2E76 C;  1BGY G;  5EFW B;  3H1H E;  3M0D C;  2DW3 A;  3NMD A;  1NGM B;  5C39 A;  2B9B A;  5GTI H;  2KIK A;  3N4X A;  2KZJ A;  5B5E E;  1PP9 J;  2WSF H;  3RL0 B;  3H25 A;  1URQ B;  1FDM A;  4D6T J;  1OFC X;  2Q5U A;  3L71 E;  3BVH A;  3I5C A;  3H32 A;  2Y9Z A;  3H1L G;  1DEB A;  1HJ0 A;  1T6A A;  3M9H A;  3S1K A;  1FDI A;  3VTP C;  2V7Q H;  3H1L D;  1HWT C;  1PFI A;  1FAV A;  1JY3 O;  3BCC D;  3EFF K;  3MGN A;  2A06 G;  1BGY J;  1L0N K;  2FFD C;  3AE4 C;  2FBW C;  3KYQ A;  3PTZ A;  3CCQ P;  4AQR D;  4YXW H;  4OGQ D;  1R8E A;  1M7L A;  1S5L E;  2K88 A;  2OGU A;  4MN4 C;  5E79 E;  3L35 A;  1GTW A;  5CBN A;  2OYI B;  1SQP J;  5KKZ C;  2Y0D A;  3SWK A;  1S5L X;  2AXT H;  2QM7 A;  2WWW A;  1LTG C;  3B8E B;  3GF7 A;  2Q6Q A;  3LID A;  2IZ0 A;  3O8Z A;  3U1C A;  1KMI Z;  1SQX D;  1TU3 F;  5APW A;  2BEQ D;  1N8R Q;  3BRT B;  2XNX A;  1FZF A;  3H1I G;  4HB1 A;  4M3L A;  2AEM A;  3EWK A;  3HE4 A;  2FYU G;  2HR3 A;  4U7J A;  1JCC A;  2GUS A;  1CI6 B;  1G2C A;  3ABV C;  1NTK J;  1Q82 Q;  2Z5H A;  3E1I A;  2QRX A;  3O6Q A;  1LWU C;  4H13 D;  1J1E C;  1Y47 A;  4OGQ C;  1SFC A;  1PP9 D;  2ZFC A;  3TGU G;  1KN7 A;  1RQU A;  1AV1 A;  1VF5 C;  1ZXG A;  2FKW B;  1BSN A;  1VPC A;  2IYP A;  2YXR B;  4U3F D;  4ZMD A;  1YYC A;  2FYU K;  2JWD A;  1RQV A;  1SQQ J;  1SFC D;  2WSE J;  5KAF H;  2O1K A;  1N7L A;  1EDL A;  2ZYD A;  5CCH A;  1MFZ A;  1NU1 D;  1PGP A;  2GA1 A;  1EXJ A;  2KNC B;  3GHG C;  4WY4 A;  1RE4 A;  3OAK A;  4XE5 B;  1VF5 B;  4IL6 E;  2KB7 P;  2I8D A;  3HD7 C;  5AW4 B;  5KLI B;  1NTM D;  3TGU E;  3VMA A;  5KLV G;  3HTK B;  1URQ C;  1EZV I;  3RGU A;  1P84 I;  3LW5 J;  3HD7 A;  3MP7 B;  2PP6 A;  1N7S D;  1ZV8 A;  2K37 A;  1E79 H;  2JP3 A;  1JM0 A;  1EZV G;  2NPS A;  3L37 A;  4IL6 H;  5B66 H;  3TYY A;  2E5Y A;  2BEZ F;  1OZH A;  4H44 B;  4O9B A;  1T2K D;  1CW5 A;  1VQO P;  2OAR A;  1M1J C;  1FE6 A;  4GDO A;  1OW7 A;  1Q86 Q;  1IFI A;  2PFX A;  3E1R A;  1L0L G;  4A7P A;  1KB9 H;  5APS A;  3H32 B;  1AQT A;  2W6B A;  3M0D A;  2QJP B;  3AEF C;  5L8R J;  3D71 A;  2A45 I;  2NZ2 A;  4GT1 A;  4OH8 B;  2FYU J;  1BSH A;  4L74 A;  2ZXX A;  2D2C C;  1U57 A;  3P8C E;  5KLV E;  4WBA A;  3V6I A;  5APU A;  1SQQ E;  2QJY C;  4PV1 B;  3KQG A;  1RHZ B;  2I1K A;  1IK7 A;  3CWB G;  1NOH A;  3RK3 B;  1LTI C;  3H1K D;  3H1K E;  3TNU A;  1M8O B;  1MV8 A;  2E74 B;  3VP8 A;  3W68 A;  2WPR A;  3L70 E;  1L0L K;  2B87 A;  2ITA A;  3H1K J;  1HH0 A;  4UB6 H;  5TIS E;  3D6Z A;  4W80 A;  1MFT A;  4HJG H;  3VMX A;  4Y28 J;  2QJY B;  3IF4 A;  4PV1 C;  1IC2 A;  5AVR B;  5B66 E;  5CBO A;  3C1L A;  1J1E B;  4HYT B;  1GK4 A;  4ASV A;  3OW2 O;  2IBZ D;  1RF0 A;  2K9J B;  3HD7 B;  4TT3 H;  1VQ5 P;  1AJY A;  2FXP A;  5KTB A;  1VQ7 P;  5AW3 B;  2KP8 A;  1DEE G;  3AE2 C;  4BXL A;  2P2U A;  1NTK E;  4ZNC A;  1Q7Y Q;  3AE8 C;  3H1K G;  3B71 A;  4GOF A;  1SFC B;  1JCD A;  2H88 C;  3WUT A;  1RF0 C;  4L73 A;  3GHG B;  2E76 B;  4C46 A;  1LTA C;  2QA4 P;  2JEE A;  2WZ7 A;  1ZN5 A;  1HBW A;  3CWB J;  1R5S A;  4EDF A;  1AFO A;  4H0L D;  5CJ4 A;  1NKZ B;  1AVO A;  2QJK C;  4PD4 D;  1KYO I;  2KSJ A;  2LR2 A;  2ZT9 B;  3B5N A;  3H1I E;  2IFM A;  2V7Q J;  3KHU A;  2HLO A;  1VQP P;  2JJL A;  2KNC A;  2O1J A;  3HE5 A;  4WY4 B;  2RN0 A;  3ZDM A;  1L0L D;  1GU4 A;  3M91 A;  1LGH B;  3VMZ A;  3M9Q A;  3II6 A;  2XKM A;  2OTJ P;  1BGY E;  2JR8 A;  1NU1 E;  5CHX A;  2OYI A;  3MUD A;  4N3Y B;  1JEK A;  3CCV P;  1OVV A;  5AW9 B;  1DD3 A;  1IK9 A;  4DCK A;  2WTY A;  2N9B A;  4Y99 C;  1KQS O;  4AUW A;  2OYH B;  2W8Z A;  4EIJ A;  1VQ6 P;  3AE3 C;  1KQF B;  2L5G B;  4BWN A;  1SQQ D;  5AVZ B;  1P84 D;  3MHV A;  2BCC D;  1PGO A;  2K9J A;  3HUS B;  2IZ1 A;  5KLV D;  1CI6 A;  2HFE D;  2Q9I A;  1IFN A;  3HD7 D;  1OIP A;  1SS1 A;  3A7O A;  3N7N A;  1ZW0 A;  2ZT9 D;  3K5B A;  1L4A D;  1OXZ A;  1P84 E;  1U7M A;  2BCC E;  3QWO C;  1CSB A;  2A45 G;  3L74 G;  1BDC A;  4LLH A;  1VQL P;  1L0N G;  2AEF A;  2KI7 B;  1BE3 G;  1LP1 B;  2O3J A;  2P7J A;  2ZYA A;  2E74 D;  2Z4E A;  1GD2 E;  1RY3 A;  1JMM A;  1OW8 A;  3BAS A;  2HPC A;  3OJA B;  1YBK A;  1SQB G;  4W7Y A;  1YJN P;  1NTZ G;  1UIX A;  1KQG B;  4NPE A;  1S4X A;  5CMZ A;  4H13 B;  5B5E H;  2W90 A;  1L0L E;  2E75 B;  2FYN B;  3CMA P;  2M3E A;  2ZT9 C;  2W27 A;  1R5L A;  1VF5 D;  3H1L E;  3H1I D;  4N6J A;  2FFD A;  1JY3 P;  3L36 A;  1VQ8 P;  1WT6 A;  4NPD A;  3RK2 D;  2RKL A;  5KAI E;  4B86 A;  3RBX A;  4BRY A;  1ZR2 A;  1FOS F;  2N1T D;  5AW7 B;  1S72 P;  4KT0 J;  3SWY A;  5KAI H;  1FZC C;  1KIL C;  4JPZ B;  4PD4 H;  2Q1K A;  2N1T A;  3AE1 C;  4OVN F;  2HG5 D;  5APY A;  1MZ9 A;  2QVA A;  2YKP A;  2IDB A;  5AVU B;  3MZW B;  5APV A;  2KOG A;  3BCC G;  3CCU P;  2IBZ E;  3A5T A;  1AQ5 A;  4H44 C;  5E79 H;  3CCL P;  3B5N B;  3WUU A;  1GDT A;  5KLV J;  1KIL B;  4ZKP A;  1G1J A;  4ZKU A;  3JCU H;  2W83 C;  3HE5 B;  2KXP B;  5AVS B;  2YKQ A;  1YQ4 C;  3P7K A;  3BAT A;  3CD6 P;  2P58 A;  2YO2 A;  3L70 D;  4Y99 B;  3TDK A;  3TNU B;  4C7N B;  3WMM 0;  1PIX A;  2R44 A;  3AEC C;  1T3J A;  2QJP C;  1L0N J;  2V4H A;  3EFG A;  3CPW O;  1NU1 K;  1P84 H;  3H1J J;  1N73 C;  2C9L Y;  1NTM J;  2E42 A;  1LNQ A;  3L74 J;  4EOT A;  1BGY D;  2IPP A;  1Q81 Q;  2B88 A;  1OW6 A;  4TLF A;  3IR9 A;  3PHL A;  3AE7 C;  1FDO A;  1RE4 C;  1VQN P;  1QX8 A;  3MIW A;  1LTT C;  2YKO A;  2KYV A;  1N73 A;  2XV5 A;  3FXE A;  3SFE C;  1JY2 P;  1Y8A A;  2AXC A;  3MUD C;  2M5A B;  3RK2 B;  4DT0 A;  3L71 G;  4PD4 E;  1JY3 N;  1RE3 C;  1M90 Q;  2W6A A;  1URQ A;  3L75 G;  1DIP A;  4WB4 A;  2G3A A;  2HOD B;  3BRV B;  2FYZ A;  2R3S A;  1L2P A;  4GKG A;  1OWA A;  1FJK A;  2JDI H;  1NTK D;  2J5U A;  1KQL A;  1VQ9 P;  1FZC B;  2GUV A;  3D6Y A;  1CZQ A;  1SQX J;  3A0B E;  3V2Q A;  1BCC D;  2KK7 A;  5KLV K;  2IFN A;  1SQV K;  1SQQ K;  3ITK A;  1OX3 A;  2IYO A;  2WSE H;  3G4S P;  1LTJ C;  3MD0 A;  3C8V A;  1SQX K;  1H89 A;  2XND H;  1X22 A;  2BCC J;  2XU6 A;  3CXH D;  3G9R A;  1HJB A;  1HF9 A;  2P1J A;  2K1A A;  2R5B A;  1KV4 A;  2LKM A;  4UB8 H;  1LT9 A;  3A0B H;  1NU1 J;  4H0L B;  5AW6 B;  1JTH B;  3F5H A;  4PJ0 E;  4IFF A;  2WT7 A;  2R5D A;  1EDJ A;  2HYN A;  1YQ3 C;  5AVV B;  1LTS C;  2WSS H;  1OVU A;  3V4W A;  3WU2 E;  3SFD C;  1W2B O;  3HUS A;  3P8C D;  4K35 A;  4HH2 A;  1N73 B;  1AA0 A;  1G2C B;  1M1J B;  2QIW A;  2I1J A;  2M5A A;  1YTZ T;  4I7Z B;  5H2F H;  1USD A;  1NTK K;  2FXM A;  3CWB E;  3H1L J;  1JO5 A;  3O6Q B;  1NTM G;  2WSC H;  5BU5 A;  1IFM A;  1KD1 Q;  2HOD A;  2FXO A;  3E7K A;  3HUS C;  1FZG A;  4YXD C;  2M0B A;  2Q7C A;  2CPS A;  1G1I A;  1FZE A;  4IOI H;  3RK2 C;  3W67 A;  1NU1 G;  3S4R A;  1GW3 A;  2N1T C;  2QM8 A;  3A2A A;  3V5B A;  4C7N A;  3VMY A;  2OTL P;  1ZOY C;  2E75 D;  3CC2 P;  2KUB A;  3FGA D;  3CXH I;  3QH9 A;  3IN6 A;  5AW1 B;  3Q5S A;  3CL3 D;  3CME P;  2YXQ B;  2FY8 A;  1BCC G;  1AVY A;  2J59 M;  2LXC B;  4KJM A;  3TGU J;  3PRJ A;  1IO4 A;  1FS0 E;  1L4A B;  3FWN A;  4ASW A;  3M06 A;  5CCG A;  1KZU B;  1NTK G;  3CX5 D;  1SP4 A;  3BCC E;  3GF3 A;  3L75 D;  3OA7 A;  5KKZ B;  1NTM E;  2MKV A;  2OTK E;  3TGU D;  1EZV E;  1DX7 A;  2Y0C A;  4U3F J;  3NFQ A;  1EDK A;  3HTK A;  2O01 N;  2AXT E;  3PJS K;  3Q3D A;  2H8P D;  5DJT B;  3MTU E;  2FYU D;  4H13 C;  5AW2 B;  3RL0 g;  5K5G B;  2WT7 B;  1HGV A;  2E74 C;  2CK3 H;  1SQB J;  2WPV B;  1QL1 A;  3L71 D;  1ZR4 A;  3L72 J;  2E75 C;  4IL6 X;  1N86 A;  1EC5 A;  3C9I A;  2O01 J;  3AE9 C;  3H1J G;  4R4M A;  2B89 A;  1JY2 N;  1SFC C;  2SPZ A;  1T3U A;  1LWU B;  4U3F E;  1N2D C;  2YIU C;  1FJP A;  1RF1 B;  2K3R A;  3L73 G;  1J1D B;  1KOR A;  3B4S A;  1PP9 E;  3HE4 B;  4LC1 A;  4RJT A;  1Q2N A;  4XA4 A;  1H88 A;  2ZVN B;  3TK1 A;  3G6E P;  3AE5 C;  3P8M C;  1RH5 B;  2H43 A;  3L70 G;  3RK3 D;  3UIA A;  4W7Z A;  2C0W A;  5KJ7 D;  2A06 D;  1RE3 A;  4WVZ A;  1IFJ A;  2C0X A;  5TJH A;  1YHQ P;  1YJW P;  2KLU A;  1SQV E;  2G8Y A;  1IZN B;  1SQP D;  3VN0 A;  1JUN A;  1SQX E;  5KJ7 A;  1KIL D;  1QEX A;  1UII A;  1N7S C;  1SVF A;  3GLM A;  2OYO A;  2QJK B;  2QG4 A;  2YO3 A;  3L74 E;  3VYI A;  1S9K D;  3H1J E;  1X79 B;  2ZAE B;  2QSI A;  2R32 A;  3KDP B;  3Q1M A;  1K8A Q;  2OYH C;  1GL2 D;  2NPS C;  3L75 J;  1FOS E;  1VQ4 P;  3CCE P;  3RK3 C;  3USS A;  1OMI A;  2XDJ A;  3L4F A;  1GMJ A;  1PPJ D;  2YMK A;  3L73 E;  3FWL A;  1QL2 A;  1FZB A;  2PAJ A;  1YTZ I;  4HKZ H;  1JB0 J;  1NTZ E;  5AVQ B;  3WU2 H;  4RKU J;  2WPS A;  2E43 A;  1BCC J;  4D6T E;  1WMK A;  1GK6 A;  1SQB E;  2D2C D;  4GIF A;  1SQV G; 
#chains in the Genus database with same CATH homology
 3CXH I;  3H1H J;  1KYO I;  1PP9 J;  1NU1 J;  3TGU J;  1EZV I;  1P84 I;  3H1K J;  4D6T J;  1NTK J;  1BE3 J;  3L70 J;  1KB9 I;  4U3F J;  1L0L J;  5KLV J;  1NTZ J;  1SQB J;  1BGY J;  1SQQ J;  3L75 J;  3H1L J;  3L72 J;  3L73 J;  1SQX J;  3BCC J;  3L71 J;  3CX5 I;  1L0N J;  3H1J J;  2FYU J;  1NTM J;  1SQP J;  3H1I J;  1BCC J;  3L74 J;  2BCC J;  3CWB J;  4PD4 I;  1SQV J;  2IBZ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...