2ITAA

Solution structure of pufx from rhodobacter sphaeroides
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
70
structure length
70
Chain Sequence
MADKTIFNDHLNTNPKTNLRLWVAFQMMKGAGWAGGVFFGTLLLIGFFRVVGRMLPIQENQAPAPNITGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intrinsic membrane protein pufX
publication title The solution structure of the PufX polypeptide from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Photosynthesis,membrane protein
total genus 13
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2006-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11511 RhodobacterPufX Intrinsic membrane protein PufX
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.920 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces rhodobacter sphaeroides pufx membrane protein 2itaA01
2ITAA 2DW3A 2NRGA
chains in the Genus database with same CATH superfamily
3P7KA 1CSBA 1WRGA 4I6MC 2O01H 4WVZA 1E5WA 1YIJP 2KNCA 5AW1B 2XZRA 4KHXA 1H8AA 3AE3C 2ZXXA 1URQA 1PGJA 2ZYAA 4XA4A 3L74D 1S9KE 1S5LX 1LWUA 3NMDA 1CI6A 2W6BA 3OJAB 1EZVI 1X79B 2H8PD 5AVVB 4ZKPA 3AE2C 1YHQP 4H44B 1RE3C 4C7NB 4PD4E 4U3FD 4O9BA 5KJ7D 3H1ID 4H13C 1Y9BA 1PP9G 2NPSD 5AW7B 1IFPA 5B5EH 4R4LA 1NTKG 4NPFX 2H7HA 2WPQA 1U57A 1BGYE 2WTYA 5APVA 2YKQA 5APSA 1SQBG 2C9NY 3CC7P 3H1HE 3CCVP 1Y8AA 2R3SA 1N73C 1N7SB 1LTBC 2ZT9B 1NOHA 3CCUP 1NKZB 4D6TD 1SFCB 2QJYB 2GUVA 3G4SP 5APUA 1OWAA 2YKPA 1FJPA 1LTTC 1GK4A 1SQPJ 1H0TA 1BSNA 3B5NB 1XTGB 2JJLA 1VQNP 5KLIC 2ZVNB 3WU2E 1VQKP 1L4AA 1T6AA 3M0AA 5K5GB 3O6QA 3BVHA 2AXCA 1J1EC 1IFNA 5CHXA 3CPWO 1NTZG 1W2BO 3PHLA 2OTJP 5KAIH 4H13D 2KS1A 2W83C 2JO1A 1S9KD 1LT1A 2KZJA 1IK7A 2Y0CA 2J58A 4PV1C 2N9BA 1NAYA 1EXJA 1SS1A 2K3RA 3CC4P 1G1JA 2FXMA 4PD4D 5APWA 4IFDK 4DZOA 4CPGA 4PJ0E 3RGUA 1OVVA 2E76C 3O8ZA 4IFMA 3CCJP 1BGYD 4A7PA 3RK2C 3GHGA 4OVNF 5KKZB 2KLUA 3HUSA 3H1HD 2M5AB 5APTA 1S4XA 3C8VA 1GL2C 1RF1C 3II6A 2FFDA 1SQQG 1SQVG 1YJ9P 1JCCA 3JC22 1SQPE 2GM4A 5DJTB 2WSFJ 2W8ZA 1MKMA 1BE3G 1GU4A 3CCMP 1LTAC 2FKWB 4BRYB 1M1JA 4PV1D 4AQRD 5CCGA 5GTHE 1VQ9P 1LTJC 2CPSA 3D6YA 2N1TB 3TNUB 1VQ8P 3AE4C 4YPCA 2L5GB 3VP8A 1K8AQ 4UB8H 1KB9E 2E76D 1GD2E 4H0LC 3KXDA 2J5UA 3V5BA 2GA1A 1UIIA 1ZR2A 1IO4A 2IX7C 3RK2D 2YXRB 1YTZT 2AXTE 1KQGB 5KTBA 1GL2D 4Y28J 2LXBA 5TJHA 2E5YA 3AEGC 2KNCB 4EDFA 3L73G 1VPCA 1DH3A 2OYHC 4HH2A 3HD7C 1LWUB 1KYOE 2KK7A 1PL5A 1YBKA 3VMXA 5AW6B 1KFMA 1MFZA 4L73A 5AW0B 2XKMA 1TU3F 3KZIH 2KZIA 1PGPA 1SQPD 3QWOC 4DCKA 4H0LD 2Q1KA 1HH0A 2WT7B 2HODA 2A06G 1FOSE 1Q2NA 1USEA 1M7LA 3WUTA 4WY4A 1GZLA 1EDIA 3VN0A 3NTNA 2Q5UA 2POHA 3VMZA 2OTKE 3AE1C 1T3JA 2WPVB 2LXCB 3IN6A 2QVAA 1KB9D 3RL0B 2JWDA 2PRRA 1ZLLA 1NU1J 3GLMA 1RQVA 3HD7D 4N78E 2WSFH 2OQQA 2R44A 1H0TB 3L71J 5AVZB 3MIWA 3CMEP 3A0HE 4QMAA 1IC2A 1RQUA 2KUBA 2HLOA 1JOCA 2XNXA 3MUDA 1U7JA 1QEXA 3CCEP 2V7QH 3OA7A 1RHZB 2P1JA 1VQMP 1KYOD 3L74J 2ZFCA 3A5TA 1P84H 3JCUE 1YJWP 2XDJA 5BU5A 2HYNA 2W6JH 2QJKC 3PJSK 3B71A 4RJTA 4OH8B 4U3FG 1FZEA 2IBZE 1FDMA 3R4YA 1PGOA 3H1IG 2QSIA 4KT0J 3B5NA 4I1LA 2PP6A 1RY3A 1A02F 1JB0J 4GOFA 1FZCB 2OTLP 1JO5A 3EQ2A 4IOIH 3GHGB 1RE4A 2P58A 3S9OA 2IYOA 3VYIA 2P10A 4D6TG 3PTZA 2FFDB 2GUSA 1FZAA 3HTKB 1S2EA 2R32A 4N78D 3RK3E 1YTZI 1W2EA 1S5LH 1M1JB 1ZXGA 1M57D 2Y9ZA 1VDFA 1QL1A 1VQ7P 1HGVA 4ASVA 1VQOP 3CMAP 3U1CA 3TK1A 3D70A 1DD4A 2D2CB 5APQA 1FBMA 2E42A 5H2FE 2M5AA 1H89A 1JCDA 3RK3C 4XFJA 1M56D 3M0DA 5AW5B 2WSCH 2XNDH 2IBZD 1FC2C 4M3LA 2P2UA 2HFED 2YO3A 1FZFA 1J1DB 4OGQB 4BRYA 2QJPB 3H1JJ 1XTCC 1Z56A 1BGYG 3V6IA 1YQ3C 2N1TA 3H1HG 3BRVB 1M8OB 1NTMK 2WSEH 1MUUA 1Q90D 1KQLA 2PAJA 2Q3IA 3VOPA 1FE6A 1HJ0A 3RK3D 4WY4B 4NPDA 3KDPB 2Y0EA 2OYOA 1SVFA 1T8ZA 1LT9A 4YXWH 3VMAA 4XE5B 3FWNA 2QE7H 5KLVJ 3U59A 1E79H 4DJGA 1N8RQ 3WUVA 1BDDA 1JM0A 1SLQA 1GU5A 4EIJA 5TISH 4L75A 1NTME 2FXOA 3CCLP 3L4FA 1Q7YQ 1LTGC 3W67A 3Q5SA 3H1JE 5KLVK 2WT7A 1N7LA 1X9VA 1P84I 5GTIE 5AW2B 5DJUB 1BSHA 4N6JA 3PLNA 3IR9A 1GW4A 1GTWA 1YJNP 4H44C 1JY3O 2O1JA 3G6EP 3CC2P 3OAKA 1PPJE 2W90A 4NPEA 5AVUB 1EDLA 1EXIA 2ZVOB 1SQPG 2BCCE 1JUNA 3H1LJ 1JNMA 3LIEA 1OXZA 1KZUB 5AVYB 2PGDA 2JKVA 3TGUJ 1LTIC 2R5DA 2N9YB 4PD4H 1N7SC 3L75J 1BCCJ 4JYBA 1QLED 3H6PA 2FXPA 1NGMB 1L0LJ 3LW5J 1SFCC 5KLVE 3CX5E 3WUUA 4W7ZA 2YIUC 3AE9C 3EFFK 3HRNA 3B5NC 3V2QA 4DOJA 3I56P 4GT1A 2AEJA 1SQBK 2KXPB 1NTMD 2JP3A 4H44D 2C0WA 1L0LK 3JSVC 2JWAA 2AEFA 1YI2P 1IFIA 1M90Q 4GDOA 2A45I 3AECC 2E76B 2ITAA 3H1JD 3KYQA 2WMMA 1J2JB 3G71P 3WU2H 2OYIA 1FZCA 2QM8A 3RL0g 3MZWB 3CCQP 1N7SD 3AEBC 1HF9A 3H1LE 3HE4A 1KILA 1SFCD 2KSEA 3T97A 1PPJD 1USDA 3SWYA 2J59M 2BCCD 3TGUE 4AUWA 1NVOA 2I1KA 5E79E 1SQBE 2IFMA 3HTKA 4EYYQ 3L75E 3B5ND 1BCCE 2PFXA 3CCRP 1L0LE 1D7MA 3CXHE 2CPBA 1LTJB 1VQ6P 1YQ4C 2IZ0A 4PJ0H 2QEXP 3FX0A 2M3EA 5KAFE 3PH0A 5KLVD 5CBOA 1QVFO 2FYUJ 1OIPA 4GOEA 3CX5D 1IFJA 3VP9A 1HTLC 1RF0A 5CJ4A 1K9MQ 3K5BA 1NYHA 3V4WA 1JY3N 3L72J 3MHVA 2I8DA 5M1BA 2B9BA 1EDJA 2FYUK 3AEDC 3AE8C 1AJYA 4JQ0D 2K1AA 1WMKA 1OW7A 4HJGH 3QH9A 5GTHH 1LT9B 2W27A 3BCCJ 1K04A 1GDTA 1ZV8A 1KMIZ 1VF5B 1ZMEC 2WITA 5KJ7A 1KB9H 3H1LD 3L70E 1IFDA 1KTMA 1IFMA 2YXQB 2NPSA 3AE5C 2WPRA 1URQC 2IBZG 1MV8A 3ITKA 4DT0A 2WWWA 1X0TA 3TGUD 1R5LA 1SQBD 1LWUC 2G3AA 3L75D 1G2CA 2YO2A 1BCCD 2AXTH 3VMYA 4IL6E 4K3AA 1IZNB 1N2DC 1L0LD 4L74A 3CXHD 1BDCA 2FYUE 2N1TD 2ZYGA 3CWBJ 2B88A 2A45G 1T2KC 1UIXA 4I2LC 4PD4I 1EZVE 1NU1G 3BRTB 1U7MA 1KYOH 2ZJSE 3L72E 3H25A 3H1KJ 3L71G 4OWFA 5AVWB 1LP1B 1RE3A 1KC8Q 2XU6A 4YTPC 2FYNB 1URQD 3BCCE 2JDIH 3L74G 1KQSO 1Q86Q 2NZ2A 2ZAEB 3SWKA 4JPZB 1N73A 3KPEA 1L4AC 3S1KA 2BASA 3D6ZA 2JEEA 3UIAA 3L70D 4Y99B 3TYYA 3G9RA 2KOGA 1T2KD 1GK6A 4UB6E 3CWBE 2OYIB 1PV3A 3N4XA 2B87A 4EI2A 2CK3H 3A0HH 2WSSH 2FYUD 4WWIA 5B66E 1NAFA 2E74B 3S4RA 3SFEC 2E75B 3RL0D 1OZHA 3HE4B 1JMBA 1SQXJ 2WZ7A 2O01J 3H1KE 1KILB 1EZVD 3T97B 2WQYC 3LIDA 5APYA 1L2PA 2M3BA 3L72D 1FZCC 2K37A 3Q1MA 3JCUH 2ZXEB 3GHGC 3M9HA 4LLHA 3HUSC 4RKUJ 1M1KQ 1L4AD 2YKOA 3GG2A 2R5BA 2KYVA 1VQLP 3H32A 1SQXK 2FFDC 5AVRB 2QM7A 5CBNA 3BCCD 3P8CE 3R2PA 2XV5A 1PZQA 4ZNCA 2P67A 3IFMA 1JY2O 1M1JC 2IYPA 5CCGC 2QIWA 2A45H 2H43A 1GL2A 4IL6X 3CXHI 5CCHA 2IDBA 3SFDC 3Q3DA 1PIXA 1NTMJ 3A0BE 3H1JG 2V4HA 4ZKUA 3C9IA 5EFWB 3VTPC 1KB9I 4TT3H 2G8YA 4GIFA 4L76A 2VRSA 1LTJA 3B8EB 3CWBD 1N86A 1IJDB 1SQXE 2M8RA 4I7ZB 3HE5B 3CD6P 1Y47A 4WBAA 3IF4A 3MTUE 1PPJG 3D71A 3H1KD 4OGQC 2M0BA 5H2FH 2QJPC 2NPSB 2SPZA 4W80A 2YMKA 1MFTA 2WVRA 2BCCJ 1G2CB 5CCGD 1JY2P 3ABVC 1X8YA 1KYOI 3M91A 2R3CA 1L0NJ 3TSIA 5KLVG 1Q81Q 1LGHB 3C1LA 3E1IA 2P7JA 1AQTA 2OYHA 1W5CE 3P8CD 4B86A 3HD7A 2RKLA 2I1JA 4TLFA 5B5EE 5AVXB 1ZR4A 1QX8A 2IZ1A 2KIKA 4WY4C 1X22A 4K35A 1OX3A 1VQPP 2ZYDA 3KQGA 2IPPA 1HUCA 1L0NK 3CL3D 2QG4A 1JTHB 1LNQA 4IFFA 1HBWA 1HJBA 4H13B 4OGQD 3PRJA 4JF7A 2Q6QA 5BVZA 1FDOA 1ZN5A 1SQXD 3AE6C 2IFNA 1ZP0C 1N73B 3H1LG 3TF5A 3AEFC 4AYCA 2FY8A 3MUDC 5KAIE 1VQ4P 3TGUG 1PP9J 1JY2N 3L75G 1NKNA 1BCCG 1LP1A 1NTKJ 4WY4D 1L0LG 1L0NE 5KLIB 3I5CA 1SQBJ 2ZT9C 1AVYA 2B87B 1DD3A 1DEBA 2H88C 3GF3A 5CMZA 1J1EB 2Z5HA 5GTIH 1ZRTE 2QJYC 4C46A 2YIUB 2O01N 2IBZI 3PP5A 3U1AA 1OVRA 2KI7B 2O1KA 1NTKK 1KN7A 2BEQD 4PV1B 1S1CX 1FOSF 2LKMA 3NXSA 1RE4C 5APXA 4GODA 5CJ0A 2WPSA 2HPCA 1NWQA 1FZGA 1JY3P 2UWJE 1SP4A 1SQPK 1NTZJ 1FZBA 3H32B 2K9JB 5AW8B 1NHLA 3CI9A 3F5HA 3RK2B 2MKVA 3CX5H 3FWLA 2ZT9D 3E1RA 1OVUA 1YYCA 1CW5A 2NRGA 3BASA 1FJKA 3SWFA 1GL2B 1RF1B 1NTZK 3L70G 1PP9E 1NTKE 2W6AA 4UB8E 1VL2A 3L70J 1OW8A 3BATA 1HWTC 5KKZC 1R5SA 1L0ND 1HGZA 2FYUG 3V2PA 5CCHC 2H89C 3M0DC 3E7KA 1S72P 1ZRTD 1SQQJ 1DIPA 1SQVJ 1ZOYC 1PFIA 4H0LB 1EZVG 3N7NA 2QRXA 3M06A 3L72G 3V2RA 1BE3J 4MN4C 3TDKA 2Q7CA 2N1TC 3F89A 1NTZE 1DEEG 4BWNA 3V4QA 2KB7P 1OFCX 5E79H 1SQQK 2V7QJ 3FGAD 4KJMA 1SQVK 3KZIE 3BCCG 3LW5H 3CXHH 2E5TA 5C39A 3A3YB 2OYHB 4RO0A 3I55P 3WMM0 4WB4A 3HD7B 5KAFH 1AV1A 1FDIA 3HE5A 4ASWA 2JR8A 5CCHD 3MD0A 1NO4A 1QL2A 1Q82Q 5AW3B 1PP9D 3M9BA 2K9YA 1LT9C 1URQB 1AQ5A 2Z5IA 1NTKD 3ZDMA 2Q3EA 5AVSB 1JEKA 3L73J 1FAVA 1AA0A 2AEMA 1CI6B 3EFGA 1KQFB 1VF5C 3CWBG 4N3YB 3V2NA 2FBWC 4JBZA 1SQQE 3MP7B 1SQVE 2L91A 1R8EA 2YMYA 4GKGA 1OW6A 4U7JA 3H1KG 1BE3E 2KLVA 1DX7A 2C0XA 4Z1MH 5AVTB 2FYZA 2Y0DA 4LGDE 1G1IA 1WT6A 1NTZD 3MGNA 1H88A 1P84E 2RH0A 1JTHA 1EQ7A 1KV4A 3AE7C 3RL0C 2OARA 2LR2A 2O3JA 4IL6H 3IAOA 3RBXA 3NFQA 4EOTA 2WSCJ 1PGQA 2YNYA 3SSUA 4C7NA 1VF5D 3Q5RA 1L4AB 1LJ2A 3Q5PA 1IK9A 1GMJA 2FYNC 3O6QB 3L37A 1EC5A 2QJKB 2C9LY 3L73E 1NU1K 1CZQA 2QA4P 2HPCB 2KS1B 3CX5I 1AVOA 1FU1A 1KORA 1K05A 3EWKA 2WSEJ 1N7SA 1RH5B 4HB1A 2E43A 2HG5D 3W68A 1SFCA 4Y99C 1SQQD 4JYCA 1SQVD 1SQXG 1S5LE 2MJZA 1KILE 3A7OA 3L36A 3RBZA 4U3FJ 2A06E 3AEAC 1BE3D 3H1IJ 2OYIC 1QVGO 1KD1Q 5L8RJ 3HUSB 3OW2O 1LTSC 1OMIA 2E74C 1EDKA 3P32A 3KHUA 1QGKB 3CLQA 1K73Q 4RESB 2E75C 5AW4B 1NU1E 1P84D 3GW6A 1KILC 1AFOA 4R4MA 2RN0A 2K9JA 3L71E 1VQ5P 2Y9YA 4UB6H 1NH4A 4D6TJ 5AVQB 4LC1A 3P8MC 1S3JA 5B66H 3L35A 1KFNA 2DW3A 4HYTB 3RK3B 3AEEC 2B89A 4ZMDA 2Q9IA 1NTMG 3FXEA 1RF1A 2BEZF 5BU8B 1NJIQ 2Z4EA 3L73D 3L74E 4BXLA 1T3UA 1RF0C 2D2CC 3B4SA 1ZW0A 3GMAA 3A2AA 1MZ9A 2KSJA 1A02J 4HKZH 1HVVA 4C7RA 2E74D 4U3FE 3USSA 2E75D 1KILD 3H1IE 5AW9B 4YXDC 1GW3A 2OGUA 3GF7A 2HR3A 1J1DC 2A06D 2KP8A 1YITP 2BCCG 3G3ZA 3FXDA 3Q2YA 2RMZA 3TNUA 4I7ZC 1BGYJ 5TISE 1L0NG 3CCSP 2K88A 3A0BH 3H1HJ 5KJ7C 4W7YA 4D6TE 1NU1D 2NPSC 3M9QA 3L71D 1FS0E 1JMMA 2D2CD 2HODB
chains in the Genus database with same CATH topology
2ITAA 2DW3A 2NRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ITA A;  2DW3 A;  2NRG A; 
#chains in the Genus database with same CATH topology
 3P7K A;  1CSB A;  1WRG A;  4I6M C;  2O01 H;  4WVZ A;  1E5W A;  1YIJ P;  2KNC A;  5AW1 B;  2XZR A;  4KHX A;  1H8A A;  3AE3 C;  2ZXX A;  1URQ A;  1PGJ A;  2ZYA A;  4XA4 A;  3L74 D;  1S9K E;  1S5L X;  1LWU A;  3NMD A;  1CI6 A;  2W6B A;  3OJA B;  1EZV I;  1X79 B;  2H8P D;  5AVV B;  4ZKP A;  3AE2 C;  1YHQ P;  4H44 B;  1RE3 C;  4C7N B;  4PD4 E;  4U3F D;  4O9B A;  5KJ7 D;  3H1I D;  4H13 C;  1Y9B A;  1PP9 G;  2NPS D;  5AW7 B;  1IFP A;  5B5E H;  4R4L A;  1NTK G;  4NPF X;  2H7H A;  2WPQ A;  1U57 A;  1BGY E;  2WTY A;  5APV A;  2YKQ A;  5APS A;  1SQB G;  2C9N Y;  3CC7 P;  3H1H E;  3CCV P;  1Y8A A;  2R3S A;  1N73 C;  1N7S B;  1LTB C;  2ZT9 B;  1NOH A;  3CCU P;  1NKZ B;  4D6T D;  1SFC B;  2QJY B;  2GUV A;  3G4S P;  5APU A;  1OWA A;  2YKP A;  1FJP A;  1LTT C;  1GK4 A;  1SQP J;  1H0T A;  1BSN A;  3B5N B;  1XTG B;  2JJL A;  1VQN P;  5KLI C;  2ZVN B;  3WU2 E;  1VQK P;  1L4A A;  1T6A A;  3M0A A;  5K5G B;  3O6Q A;  3BVH A;  2AXC A;  1J1E C;  1IFN A;  5CHX A;  3CPW O;  1NTZ G;  1W2B O;  3PHL A;  2OTJ P;  5KAI H;  4H13 D;  2KS1 A;  2W83 C;  2JO1 A;  1S9K D;  1LT1 A;  2KZJ A;  1IK7 A;  2Y0C A;  2J58 A;  4PV1 C;  2N9B A;  1NAY A;  1EXJ A;  1SS1 A;  2K3R A;  3CC4 P;  1G1J A;  2FXM A;  4PD4 D;  5APW A;  4IFD K;  4DZO A;  4CPG A;  4PJ0 E;  3RGU A;  1OVV A;  2E76 C;  3O8Z A;  4IFM A;  3CCJ P;  1BGY D;  4A7P A;  3RK2 C;  3GHG A;  4OVN F;  5KKZ B;  2KLU A;  3HUS A;  3H1H D;  2M5A B;  5APT A;  1S4X A;  3C8V A;  1GL2 C;  1RF1 C;  3II6 A;  2FFD A;  1SQQ G;  1SQV G;  1YJ9 P;  1JCC A;  3JC2 2;  1SQP E;  2GM4 A;  5DJT B;  2WSF J;  2W8Z A;  1MKM A;  1BE3 G;  1GU4 A;  3CCM P;  1LTA C;  2FKW B;  4BRY B;  1M1J A;  4PV1 D;  4AQR D;  5CCG A;  5GTH E;  1VQ9 P;  1LTJ C;  2CPS A;  3D6Y A;  2N1T B;  3TNU B;  1VQ8 P;  3AE4 C;  4YPC A;  2L5G B;  3VP8 A;  1K8A Q;  4UB8 H;  1KB9 E;  2E76 D;  1GD2 E;  4H0L C;  3KXD A;  2J5U A;  3V5B A;  2GA1 A;  1UII A;  1ZR2 A;  1IO4 A;  2IX7 C;  3RK2 D;  2YXR B;  1YTZ T;  2AXT E;  1KQG B;  5KTB A;  1GL2 D;  4Y28 J;  2LXB A;  5TJH A;  2E5Y A;  3AEG C;  2KNC B;  4EDF A;  3L73 G;  1VPC A;  1DH3 A;  2OYH C;  4HH2 A;  3HD7 C;  1LWU B;  1KYO E;  2KK7 A;  1PL5 A;  1YBK A;  3VMX A;  5AW6 B;  1KFM A;  1MFZ A;  4L73 A;  5AW0 B;  2XKM A;  1TU3 F;  3KZI H;  2KZI A;  1PGP A;  1SQP D;  3QWO C;  4DCK A;  4H0L D;  2Q1K A;  1HH0 A;  2WT7 B;  2HOD A;  2A06 G;  1FOS E;  1Q2N A;  1USE A;  1M7L A;  3WUT A;  4WY4 A;  1GZL A;  1EDI A;  3VN0 A;  3NTN A;  2Q5U A;  2POH A;  3VMZ A;  2OTK E;  3AE1 C;  1T3J A;  2WPV B;  2LXC B;  3IN6 A;  2QVA A;  1KB9 D;  3RL0 B;  2JWD A;  2PRR A;  1ZLL A;  1NU1 J;  3GLM A;  1RQV A;  3HD7 D;  4N78 E;  2WSF H;  2OQQ A;  2R44 A;  1H0T B;  3L71 J;  5AVZ B;  3MIW A;  3CME P;  3A0H E;  4QMA A;  1IC2 A;  1RQU A;  2KUB A;  2HLO A;  1JOC A;  2XNX A;  3MUD A;  1U7J A;  1QEX A;  3CCE P;  2V7Q H;  3OA7 A;  1RHZ B;  2P1J A;  1VQM P;  1KYO D;  3L74 J;  2ZFC A;  3A5T A;  1P84 H;  3JCU E;  1YJW P;  2XDJ A;  5BU5 A;  2HYN A;  2W6J H;  2QJK C;  3PJS K;  3B71 A;  4RJT A;  4OH8 B;  4U3F G;  1FZE A;  2IBZ E;  1FDM A;  3R4Y A;  1PGO A;  3H1I G;  2QSI A;  4KT0 J;  3B5N A;  4I1L A;  2PP6 A;  1RY3 A;  1A02 F;  1JB0 J;  4GOF A;  1FZC B;  2OTL P;  1JO5 A;  3EQ2 A;  4IOI H;  3GHG B;  1RE4 A;  2P58 A;  3S9O A;  2IYO A;  3VYI A;  2P10 A;  4D6T G;  3PTZ A;  2FFD B;  2GUS A;  1FZA A;  3HTK B;  1S2E A;  2R32 A;  4N78 D;  3RK3 E;  1YTZ I;  1W2E A;  1S5L H;  1M1J B;  1ZXG A;  1M57 D;  2Y9Z A;  1VDF A;  1QL1 A;  1VQ7 P;  1HGV A;  4ASV A;  1VQO P;  3CMA P;  3U1C A;  3TK1 A;  3D70 A;  1DD4 A;  2D2C B;  5APQ A;  1FBM A;  2E42 A;  5H2F E;  2M5A A;  1H89 A;  1JCD A;  3RK3 C;  4XFJ A;  1M56 D;  3M0D A;  5AW5 B;  2WSC H;  2XND H;  2IBZ D;  1FC2 C;  4M3L A;  2P2U A;  2HFE D;  2YO3 A;  1FZF A;  1J1D B;  4OGQ B;  4BRY A;  2QJP B;  3H1J J;  1XTC C;  1Z56 A;  1BGY G;  3V6I A;  1YQ3 C;  2N1T A;  3H1H G;  3BRV B;  1M8O B;  1NTM K;  2WSE H;  1MUU A;  1Q90 D;  1KQL A;  2PAJ A;  2Q3I A;  3VOP A;  1FE6 A;  1HJ0 A;  3RK3 D;  4WY4 B;  4NPD A;  3KDP B;  2Y0E A;  2OYO A;  1SVF A;  1T8Z A;  1LT9 A;  4YXW H;  3VMA A;  4XE5 B;  3FWN A;  2QE7 H;  5KLV J;  3U59 A;  1E79 H;  4DJG A;  1N8R Q;  3WUV A;  1BDD A;  1JM0 A;  1SLQ A;  1GU5 A;  4EIJ A;  5TIS H;  4L75 A;  1NTM E;  2FXO A;  3CCL P;  3L4F A;  1Q7Y Q;  1LTG C;  3W67 A;  3Q5S A;  3H1J E;  5KLV K;  2WT7 A;  1N7L A;  1X9V A;  1P84 I;  5GTI E;  5AW2 B;  5DJU B;  1BSH A;  4N6J A;  3PLN A;  3IR9 A;  1GW4 A;  1GTW A;  1YJN P;  4H44 C;  1JY3 O;  2O1J A;  3G6E P;  3CC2 P;  3OAK A;  1PPJ E;  2W90 A;  4NPE A;  5AVU B;  1EDL A;  1EXI A;  2ZVO B;  1SQP G;  2BCC E;  1JUN A;  3H1L J;  1JNM A;  3LIE A;  1OXZ A;  1KZU B;  5AVY B;  2PGD A;  2JKV A;  3TGU J;  1LTI C;  2R5D A;  2N9Y B;  4PD4 H;  1N7S C;  3L75 J;  1BCC J;  4JYB A;  1QLE D;  3H6P A;  2FXP A;  1NGM B;  1L0L J;  3LW5 J;  1SFC C;  5KLV E;  3CX5 E;  3WUU A;  4W7Z A;  2YIU C;  3AE9 C;  3EFF K;  3HRN A;  3B5N C;  3V2Q A;  4DOJ A;  3I56 P;  4GT1 A;  2AEJ A;  1SQB K;  2KXP B;  1NTM D;  2JP3 A;  4H44 D;  2C0W A;  1L0L K;  3JSV C;  2JWA A;  2AEF A;  1YI2 P;  1IFI A;  1M90 Q;  4GDO A;  2A45 I;  3AEC C;  2E76 B;  2ITA A;  3H1J D;  3KYQ A;  2WMM A;  1J2J B;  3G71 P;  3WU2 H;  2OYI A;  1FZC A;  2QM8 A;  3RL0 g;  3MZW B;  3CCQ P;  1N7S D;  3AEB C;  1HF9 A;  3H1L E;  3HE4 A;  1KIL A;  1SFC D;  2KSE A;  3T97 A;  1PPJ D;  1USD A;  3SWY A;  2J59 M;  2BCC D;  3TGU E;  4AUW A;  1NVO A;  2I1K A;  5E79 E;  1SQB E;  2IFM A;  3HTK A;  4EYY Q;  3L75 E;  3B5N D;  1BCC E;  2PFX A;  3CCR P;  1L0L E;  1D7M A;  3CXH E;  2CPB A;  1LTJ B;  1VQ6 P;  1YQ4 C;  2IZ0 A;  4PJ0 H;  2QEX P;  3FX0 A;  2M3E A;  5KAF E;  3PH0 A;  5KLV D;  5CBO A;  1QVF O;  2FYU J;  1OIP A;  4GOE A;  3CX5 D;  1IFJ A;  3VP9 A;  1HTL C;  1RF0 A;  5CJ4 A;  1K9M Q;  3K5B A;  1NYH A;  3V4W A;  1JY3 N;  3L72 J;  3MHV A;  2I8D A;  5M1B A;  2B9B A;  1EDJ A;  2FYU K;  3AED C;  3AE8 C;  1AJY A;  4JQ0 D;  2K1A A;  1WMK A;  1OW7 A;  4HJG H;  3QH9 A;  5GTH H;  1LT9 B;  2W27 A;  3BCC J;  1K04 A;  1GDT A;  1ZV8 A;  1KMI Z;  1VF5 B;  1ZME C;  2WIT A;  5KJ7 A;  1KB9 H;  3H1L D;  3L70 E;  1IFD A;  1KTM A;  1IFM A;  2YXQ B;  2NPS A;  3AE5 C;  2WPR A;  1URQ C;  2IBZ G;  1MV8 A;  3ITK A;  4DT0 A;  2WWW A;  1X0T A;  3TGU D;  1R5L A;  1SQB D;  1LWU C;  2G3A A;  3L75 D;  1G2C A;  2YO2 A;  1BCC D;  2AXT H;  3VMY A;  4IL6 E;  4K3A A;  1IZN B;  1N2D C;  1L0L D;  4L74 A;  3CXH D;  1BDC A;  2FYU E;  2N1T D;  2ZYG A;  3CWB J;  2B88 A;  2A45 G;  1T2K C;  1UIX A;  4I2L C;  4PD4 I;  1EZV E;  1NU1 G;  3BRT B;  1U7M A;  1KYO H;  2ZJS E;  3L72 E;  3H25 A;  3H1K J;  3L71 G;  4OWF A;  5AVW B;  1LP1 B;  1RE3 A;  1KC8 Q;  2XU6 A;  4YTP C;  2FYN B;  1URQ D;  3BCC E;  2JDI H;  3L74 G;  1KQS O;  1Q86 Q;  2NZ2 A;  2ZAE B;  3SWK A;  4JPZ B;  1N73 A;  3KPE A;  1L4A C;  3S1K A;  2BAS A;  3D6Z A;  2JEE A;  3UIA A;  3L70 D;  4Y99 B;  3TYY A;  3G9R A;  2KOG A;  1T2K D;  1GK6 A;  4UB6 E;  3CWB E;  2OYI B;  1PV3 A;  3N4X A;  2B87 A;  4EI2 A;  2CK3 H;  3A0H H;  2WSS H;  2FYU D;  4WWI A;  5B66 E;  1NAF A;  2E74 B;  3S4R A;  3SFE C;  2E75 B;  3RL0 D;  1OZH A;  3HE4 B;  1JMB A;  1SQX J;  2WZ7 A;  2O01 J;  3H1K E;  1KIL B;  1EZV D;  3T97 B;  2WQY C;  3LID A;  5APY A;  1L2P A;  2M3B A;  3L72 D;  1FZC C;  2K37 A;  3Q1M A;  3JCU H;  2ZXE B;  3GHG C;  3M9H A;  4LLH A;  3HUS C;  4RKU J;  1M1K Q;  1L4A D;  2YKO A;  3GG2 A;  2R5B A;  2KYV A;  1VQL P;  3H32 A;  1SQX K;  2FFD C;  5AVR B;  2QM7 A;  5CBN A;  3BCC D;  3P8C E;  3R2P A;  2XV5 A;  1PZQ A;  4ZNC A;  2P67 A;  3IFM A;  1JY2 O;  1M1J C;  2IYP A;  5CCG C;  2QIW A;  2A45 H;  2H43 A;  1GL2 A;  4IL6 X;  3CXH I;  5CCH A;  2IDB A;  3SFD C;  3Q3D A;  1PIX A;  1NTM J;  3A0B E;  3H1J G;  2V4H A;  4ZKU A;  3C9I A;  5EFW B;  3VTP C;  1KB9 I;  4TT3 H;  2G8Y A;  4GIF A;  4L76 A;  2VRS A;  1LTJ A;  3B8E B;  3CWB D;  1N86 A;  1IJD B;  1SQX E;  2M8R A;  4I7Z B;  3HE5 B;  3CD6 P;  1Y47 A;  4WBA A;  3IF4 A;  3MTU E;  1PPJ G;  3D71 A;  3H1K D;  4OGQ C;  2M0B A;  5H2F H;  2QJP C;  2NPS B;  2SPZ A;  4W80 A;  2YMK A;  1MFT A;  2WVR A;  2BCC J;  1G2C B;  5CCG D;  1JY2 P;  3ABV C;  1X8Y A;  1KYO I;  3M91 A;  2R3C A;  1L0N J;  3TSI A;  5KLV G;  1Q81 Q;  1LGH B;  3C1L A;  3E1I A;  2P7J A;  1AQT A;  2OYH A;  1W5C E;  3P8C D;  4B86 A;  3HD7 A;  2RKL A;  2I1J A;  4TLF A;  5B5E E;  5AVX B;  1ZR4 A;  1QX8 A;  2IZ1 A;  2KIK A;  4WY4 C;  1X22 A;  4K35 A;  1OX3 A;  1VQP P;  2ZYD A;  3KQG A;  2IPP A;  1HUC A;  1L0N K;  3CL3 D;  2QG4 A;  1JTH B;  1LNQ A;  4IFF A;  1HBW A;  1HJB A;  4H13 B;  4OGQ D;  3PRJ A;  4JF7 A;  2Q6Q A;  5BVZ A;  1FDO A;  1ZN5 A;  1SQX D;  3AE6 C;  2IFN A;  1ZP0 C;  1N73 B;  3H1L G;  3TF5 A;  3AEF C;  4AYC A;  2FY8 A;  3MUD C;  5KAI E;  1VQ4 P;  3TGU G;  1PP9 J;  1JY2 N;  3L75 G;  1NKN A;  1BCC G;  1LP1 A;  1NTK J;  4WY4 D;  1L0L G;  1L0N E;  5KLI B;  3I5C A;  1SQB J;  2ZT9 C;  1AVY A;  2B87 B;  1DD3 A;  1DEB A;  2H88 C;  3GF3 A;  5CMZ A;  1J1E B;  2Z5H A;  5GTI H;  1ZRT E;  2QJY C;  4C46 A;  2YIU B;  2O01 N;  2IBZ I;  3PP5 A;  3U1A A;  1OVR A;  2KI7 B;  2O1K A;  1NTK K;  1KN7 A;  2BEQ D;  4PV1 B;  1S1C X;  1FOS F;  2LKM A;  3NXS A;  1RE4 C;  5APX A;  4GOD A;  5CJ0 A;  2WPS A;  2HPC A;  1NWQ A;  1FZG A;  1JY3 P;  2UWJ E;  1SP4 A;  1SQP K;  1NTZ J;  1FZB A;  3H32 B;  2K9J B;  5AW8 B;  1NHL A;  3CI9 A;  3F5H A;  3RK2 B;  2MKV A;  3CX5 H;  3FWL A;  2ZT9 D;  3E1R A;  1OVU A;  1YYC A;  1CW5 A;  2NRG A;  3BAS A;  1FJK A;  3SWF A;  1GL2 B;  1RF1 B;  1NTZ K;  3L70 G;  1PP9 E;  1NTK E;  2W6A A;  4UB8 E;  1VL2 A;  3L70 J;  1OW8 A;  3BAT A;  1HWT C;  5KKZ C;  1R5S A;  1L0N D;  1HGZ A;  2FYU G;  3V2P A;  5CCH C;  2H89 C;  3M0D C;  3E7K A;  1S72 P;  1ZRT D;  1SQQ J;  1DIP A;  1SQV J;  1ZOY C;  1PFI A;  4H0L B;  1EZV G;  3N7N A;  2QRX A;  3M06 A;  3L72 G;  3V2R A;  1BE3 J;  4MN4 C;  3TDK A;  2Q7C A;  2N1T C;  3F89 A;  1NTZ E;  1DEE G;  4BWN A;  3V4Q A;  2KB7 P;  1OFC X;  5E79 H;  1SQQ K;  2V7Q J;  3FGA D;  4KJM A;  1SQV K;  3KZI E;  3BCC G;  3LW5 H;  3CXH H;  2E5T A;  5C39 A;  3A3Y B;  2OYH B;  4RO0 A;  3I55 P;  3WMM 0;  4WB4 A;  3HD7 B;  5KAF H;  1AV1 A;  1FDI A;  3HE5 A;  4ASW A;  2JR8 A;  5CCH D;  3MD0 A;  1NO4 A;  1QL2 A;  1Q82 Q;  5AW3 B;  1PP9 D;  3M9B A;  2K9Y A;  1LT9 C;  1URQ B;  1AQ5 A;  2Z5I A;  1NTK D;  3ZDM A;  2Q3E A;  5AVS B;  1JEK A;  3L73 J;  1FAV A;  1AA0 A;  2AEM A;  1CI6 B;  3EFG A;  1KQF B;  1VF5 C;  3CWB G;  4N3Y B;  3V2N A;  2FBW C;  4JBZ A;  1SQQ E;  3MP7 B;  1SQV E;  2L91 A;  1R8E A;  2YMY A;  4GKG A;  1OW6 A;  4U7J A;  3H1K G;  1BE3 E;  2KLV A;  1DX7 A;  2C0X A;  4Z1M H;  5AVT B;  2FYZ A;  2Y0D A;  4LGD E;  1G1I A;  1WT6 A;  1NTZ D;  3MGN A;  1H88 A;  1P84 E;  2RH0 A;  1JTH A;  1EQ7 A;  1KV4 A;  3AE7 C;  3RL0 C;  2OAR A;  2LR2 A;  2O3J A;  4IL6 H;  3IAO A;  3RBX A;  3NFQ A;  4EOT A;  2WSC J;  1PGQ A;  2YNY A;  3SSU A;  4C7N A;  1VF5 D;  3Q5R A;  1L4A B;  1LJ2 A;  3Q5P A;  1IK9 A;  1GMJ A;  2FYN C;  3O6Q B;  3L37 A;  1EC5 A;  2QJK B;  2C9L Y;  3L73 E;  1NU1 K;  1CZQ A;  2QA4 P;  2HPC B;  2KS1 B;  3CX5 I;  1AVO A;  1FU1 A;  1KOR A;  1K05 A;  3EWK A;  2WSE J;  1N7S A;  1RH5 B;  4HB1 A;  2E43 A;  2HG5 D;  3W68 A;  1SFC A;  4Y99 C;  1SQQ D;  4JYC A;  1SQV D;  1SQX G;  1S5L E;  2MJZ A;  1KIL E;  3A7O A;  3L36 A;  3RBZ A;  4U3F J;  2A06 E;  3AEA C;  1BE3 D;  3H1I J;  2OYI C;  1QVG O;  1KD1 Q;  5L8R J;  3HUS B;  3OW2 O;  1LTS C;  1OMI A;  2E74 C;  1EDK A;  3P32 A;  3KHU A;  1QGK B;  3CLQ A;  1K73 Q;  4RES B;  2E75 C;  5AW4 B;  1NU1 E;  1P84 D;  3GW6 A;  1KIL C;  1AFO A;  4R4M A;  2RN0 A;  2K9J A;  3L71 E;  1VQ5 P;  2Y9Y A;  4UB6 H;  1NH4 A;  4D6T J;  5AVQ B;  4LC1 A;  3P8M C;  1S3J A;  5B66 H;  3L35 A;  1KFN A;  2DW3 A;  4HYT B;  3RK3 B;  3AEE C;  2B89 A;  4ZMD A;  2Q9I A;  1NTM G;  3FXE A;  1RF1 A;  2BEZ F;  5BU8 B;  1NJI Q;  2Z4E A;  3L73 D;  3L74 E;  4BXL A;  1T3U A;  1RF0 C;  2D2C C;  3B4S A;  1ZW0 A;  3GMA A;  3A2A A;  1MZ9 A;  2KSJ A;  1A02 J;  4HKZ H;  1HVV A;  4C7R A;  2E74 D;  4U3F E;  3USS A;  2E75 D;  1KIL D;  3H1I E;  5AW9 B;  4YXD C;  1GW3 A;  2OGU A;  3GF7 A;  2HR3 A;  1J1D C;  2A06 D;  2KP8 A;  1YIT P;  2BCC G;  3G3Z A;  3FXD A;  3Q2Y A;  2RMZ A;  3TNU A;  4I7Z C;  1BGY J;  5TIS E;  1L0N G;  3CCS P;  2K88 A;  3A0B H;  3H1H J;  5KJ7 C;  4W7Y A;  4D6T E;  1NU1 D;  2NPS C;  3M9Q A;  3L71 D;  1FS0 E;  1JMM A;  2D2C D;  2HOD B; 
#chains in the Genus database with same CATH homology
 2ITA A;  2DW3 A;  2NRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...