2ITAA

Solution structure of pufx from rhodobacter sphaeroides
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
70
structure length
70
Chain Sequence
MADKTIFNDHLNTNPKTNLRLWVAFQMMKGAGWAGGVFFGTLLLIGFFRVVGRMLPIQENQAPAPNITGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the PufX polypeptide from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Photosynthesis,membrane protein
molecule keywords Intrinsic membrane protein pufX
total genus 13
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2006-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11511 RhodobacterPufX Intrinsic membrane protein PufX
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.920 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces rhodobacter sphaeroides pufx membrane protein 2itaA01
2NRGA 2DW3A 2ITAA
chains in the Genus database with same CATH superfamily
1KILD 1URQD 1ZRTD 1N7LA 1EDKA 1NU1E 1LWUA 2D2CD 3H1JD 4LC1A 5APTA 5AW9B 1LTAC 3H1KJ 4KT0J 2WSSH 2YXRB 2ZT9C 2HPCA 1NH4A 3A0BH 1S9KD 1EXJA 1PP9J 2H88C 3VYIA 1R5SA 1KQLA 1L0LJ 2FYUK 2W6AA 1JCDA 2E74D 4LLHA 5AVZB 4GIFA 3AE7C 1IZNB 2XDJA 3RK3B 3USSA 4ASWA 2IFMA 3BVHA 1HH0A 3II6A 2FXOA 3SFEC 4PV1B 2B89A 3HD7C 1SQBK 5CMZA 1IFJA 3PLNA 2KOGA 1VF5D 2QRXA 2ZXXA 1GK4A 4L76A 3TDKA 3S9OA 1ZV8A 1FZBA 1IJDB 2IBZE 3HE4A 3N4XA 1G1JA 5B66H 1NKZB 1L0NG 1Q82Q 1FDIA 1AV1A 1GU4A 1HWTC 1T3JA 2AXTE 2Y0CA 1ZOYC 2D2CC 1NKNA 2JKVA 2M3BA 3BASA 3NFQA 1OW8A 4I7ZB 4PJ0H 5KTBA 2M5AA 2PFXA 2Q1KA 4W7YA 3D71A 4UB6H 1AFOA 3HTKB 1WMKA 3D70A 3SWKA 1KC8Q 2LXBA 3O6QB 3HE5B 1Q7YQ 2N1TB 2YO3A 1BE3J 1NHLA 1SQBD 3BCCJ 3E1RA 3MZWB 1JY2N 5L8RJ 3V2RA 1AJYA 1M1JC 4IFFA 3NXSA 3L75G 3BRVB 2OQQA 2E76B 5CCHD 1KILE 3R2PA 2QA4P 1MV8A 1BCCJ 1PPJE 1SS1A 3AECC 1RE3C 1A02J 3U59A 5KAIH 4EYYQ 1SQBG 4WY4B 3V2NA 1FZGA 2M8RA 2IZ0A 3CWBE 3H1LD 2BEQD 1DD3A 1L0LE 3CLQA 3CXHI 1PFIA 2KSJA 4K3AA 1DX7A 1N7SD 5APXA 1OMIA 3B5NC 5KAIE 2KLUA 1LTJC 2QJKC 1SQVJ 3GHGB 4KHXA 4XFJA 1S2EA 2NRGA 2K3RA 3FGAD 2OTLP 3H1JG 1W5CE 1OW6A 1SQPK 4C7NB 4YTPC 5E79E 1KYOH 2N9YB 4W7ZA 3KXDA 4WBAA 1SQVK 4D6TJ 3VN0A 2IBZG 1ZLLA 2CPSA 3H1IE 1NTZK 4GKGA 2IFNA 3G3ZA 4EI2A 3HUSB 1JY2O 4JYCA 1N8RQ 1SFCB 1SFCA 2IYPA 2JR8A 1S5LH 1VQ4P 2ZJSE 2K1AA 1KILA 1URQA 2W6BA 3AEBC 3IR9A 1LTJA 2YKPA 1BGYG 3BATA 3CI9A 5KAFH 1VQNP 1KTMA 3V6IA 5AVWB 3O8ZA 3M0DC 4JPZB 5AW5B 1L4AA 2Y0DA 1VQPP 2KNCA 2Q9IA 1L0LD 3L74D 3CWBD 4DJGA 3V4QA 3WUTA 1K9MQ 2RMZA 3L70J 3BCCG 2GA1A 3C1LA 3P32A 2QEXP 1KYOI 1JY3P 1LT9C 1VF5B 3AEGC 3G6EP 2FFDA 1Y8AA 3V5BA 1CZQA 1X0TA 3KYQA 1NJIQ 2HLOA 4WY4A 1N73B 2ZT9D 4GDOA 3RK2C 3RL0D 4PD4I 2P1JA 1K8AQ 5TJHA 2YMKA 4I1LA 2Y9YA 1SQXD 3F89A 3OJAB 3BCCD 3CXHE 2E42A 1OIPA 1OWAA 1YTZT 3A0HE 3L71D 4W80A 3RL0g 1OFCX 3CCRP 3U1AA 2NPSA 1L4AD 4Y99B 1NAYA 2B87B 2OTJP 2B87A 4H13D 4WWIA 3AE2C 3ZDMA 1CW5A 4U3FE 1SQVE 4OGQC 3HUSA 1ZW0A 5AVSB 2HODB 4EIJA 1AVYA 3VP9A 5AW7B 3GLMA 3LIDA 2H8PD 1VQ8P 5GTHE 3B5NA 1KILB 1URQB 1GK6A 2Q5UA 2I1KA 3JSVC 3L71G 3VP8A 3WMM0 1NTKG 4BXLA 4C7RA 1S3JA 2OYHA 1X79B 3H1HG 3L36A 1K73Q 1JO5A 3P8CE 1G2CB 2P10A 2V7QJ 5AW4B 2W8ZA 2FFDB 2J59M 3FWNA 1M90Q 1BCCE 2I8DA 3M0AA 3A7OA 4Y28J 5APYA 3CCMP 2WWWA 2WQYC 4H13B 1N7SA 1BDDA 1N7SB 2NPSD 4NPDA 2OYIC 5APVA 5TISH 1QX8A 2Q3EA 2Y9ZA 2KK7A 2POHA 1U7MA 4UB6E 2FBWC 1HTLC 1KORA 2C0XA 2HFED 3MUDA 1CI6B 4A7PA 1FZCB 1U57A 4PD4E 1BGYD 1PPJG 3A5TA 2QSIA 2XNDH 2JO1A 2WSFH 2KS1B 1SQBE 2Z5IA 1N2DC 3A0HH 4N3YB 2Q7CA 3P8MC 2RH0A 1IFNA 2R5BA 2QJPB 3AEEC 1YJ9P 1T3UA 4BRYB 2QG4A 2K88A 2IYOA 2KYVA 1BSNA 2IPPA 3PRJA 2J58A 4U3FG 5DJTB 1JTHB 1GL2A 1BCCD 1GW3A 4L74A 5AVUB 3VTPC 1NTMK 1NU1G 3Q1MA 4AUWA 3HD7A 3RL0C 1KYOD 1E79H 4OWFA 1IC2A 3CPWO 2KP8A 2GM4A 3MTUE 2NPSC 1RH5B 1NVOA 4RKUJ 1PV3A 1KD1Q 1J1DC 3TF5A 2KI7B 2XNXA 1T2KC 3OAKA 1QVGO 1LP1B 1SQQK 4GODA 5GTHH 1BGYE 1H88A 1VQ6P 1Y47A 2O3JA 1P84D 2KB7P 5E79H 1SQQE 3L75D 4OGQD 3WUVA 5KJ7A 1OVUA 2L91A 2YXQB 2FYUD 2P58A 3H1KE 5APQA 2OYOA 4YPCA 4D6TD 1PGPA 4PV1C 3MGNA 1EZVE 3EFFK 3IFMA 3TK1A 2FYUE 4RO0A 5APSA 3L72J 1UIIA 2OGUA 4XE5B 4N78E 1L0NE 5AW0B 3OW2O 2E74B 1RE4C 2P67A 4PD4D 1GU5A 4AYCA 2JJLA 3PTZA 2PGDA 3RBZA 2C9NY 5AVXB 3S4RA 2XV5A 1NU1K 2O1JA 4IFMA 2E75C 1L0ND 4H0LD 1S1CX 1SQPE 1X22A 3AEAC 1SP4A 1J1EB 1FJKA 2AXCA 1OVRA 1OZHA 3L72G 1EQ7A 4ZKUA 4H44C 5APWA 2R3SA 3GMAA 4CPGA 4WVZA 4O9BA 1BGYJ 1NTZG 4D6TG 1S5LX 3WU2E 2A45G 1L0LK 1RY3A 1SQVG 2LKMA 2BASA 3H1KD 3MIWA 3PH0A 2AEJA 1SQQD 3L75E 2WVRA 3PP5A 4NPFX 2N1TC 4R4MA 3W67A 1PIXA 2R44A 1M1KQ 3L4FA 1M1JB 5BU5A 2WMMA 3TNUA 1OXZA 2C0WA 2E76C 3R4YA 2HR3A 1AA0A 4AQRD 2YKQA 2WT7A 2ZT9B 2VRSA 3CCUP 1LNQA 3A2AA 5AVTB 2IDBA 1HJBA 3QWOC 1EDLA 2SPZA 2G8YA 1QVFO 5CBNA 1KB9H 1NU1D 2KXPB 3NTNA 3BRTB 2W83C 5AW8B 1FZEA 3VMYA 1RF1A 3VMAA 5CCGA 1RF1B 2W90A 3M9BA 3B8EB 3JC22 1BE3D 1SQBJ 3C8VA 1NTMJ 4R4LA 3SSUA 3B71A 2M5AB 2YIUC 3CXHD 3H1LG 5KLVG 3CMEP 1S72P 1LTGC 1PGQA 1NTKK 1T6AA 1KQFB 2O01H 3V2QA 3TGUD 1DH3A 1PL5A 4L73A 2R5DA 1YIJP 1JM0A 2NZ2A 3HE5A 3QH9A 1DEEG 4PD4H 5CHXA 1DD4A 1ZR2A 3HUSC 1U7JA 1H0TB 5CCHC 1A02F 1FS0E 2OYHB 1SFCC 1TU3F 3H32A 3H1LJ 5B5EE 2AEFA 5CBOA 1GD2E 1Z56A 3CX5I 4IOIH 4TT3H 1H89A 3VMXA 1NTZE 3I55P 2M3EA 1LJ2A 3BCCE 2KIKA 3V2PA 2QJYB 2GUVA 3PJSK 5CCGD 2K9JA 3Q5SA 2KSEA 3FXDA 4C46A 1GL2C 1FC2C 2WT7B 1JEKA 1IK9A 3L73J 4N6JA 1NTME 4N78D 4U3FJ 1JUNA 2E75D 3H6PA 2XKMA 4H0LC 4HH2A 1NTKD 1X8YA 3CMAP 1N73C 1CI6A 1FZCA 2FXMA 3CWBG 4GT1A 4B86A 1KMIZ 1KQGB 1L0LG 4JYBA 2E5TA 1L4AC 2BEZF 1JB0J 3L73G 1SQQG 5CCHA 3GF3A 3O6QA 1JCCA 2FYNC 2UWJE 3H1KG 2K9YA 3MUDC 1FZFA 3G71P 2PAJA 1JOCA 3B5NB 3P7KA 3E1IA 1GMJA 1LTJB 3GHGC 3AE1C 1LWUB 1MKMA 2E76D 3CXHH 1LGHB 3EFGA 3H32B 4L75A 3H1IG 1OX3A 3U1CA 1YJWP 1H0TA 4U7JA 5BU8B 5KLIB 5H2FH 3L71J 3IF4A 2ZYDA 1K05A 3MD0A 3L75J 1QL1A 1R5LA 3M9HA 3TGUG 2W27A 1KB9I 4EDFA 4Z1MH 3CC4P 1QGKB 1BCCG 5APUA 3UIAA 3CX5E 1LT1A 3GG2A 2J5UA 3AE9C 1NYHA 2WITA 3AE3C 3AE6C 5BVZA 5K5GB 1KQSO 3H1ID 1UIXA 2JWDA 2BCCG 3G9RA 1FOSF 2OARA 3L37A 3FX0A 3CL3D 3CC7P 4H13C 3JCUH 2HYNA 2O1KA 2XU6A 1OVVA 1RE4A 1X9VA 5KKZB 2G3AA 4GOFA 3RK3C 2WSEJ 1P84E 3AEDC 5C39A 2HG5D 3JCUE 5AW6B 1KZUB 2I1JA 1Q2NA 3IN6A 1MFTA 1K04A 3K5BA 1AQ5A 2YMYA 1EZVD 1JTHA 1HUCA 3W68A 2WPQA 3L73E 3KZIE 1M7LA 3HRNA 3RK2D 4PJ0E 1NTZJ 1YJNP 2H7HA 3AE5C 2N1TA 1KB9D 3KQGA 3SWFA 1CSBA 2W6JH 2B88A 2ZFCA 3S1KA 5H2FE 1Q86Q 1FDMA 4DCKA 1KV4A 3CCQP 3LW5J 2IX7C 5AVRB 2IBZI 2D2CB 3C9IA 4RJTA 5CJ4A 2FKWB 5KLVE 4I7ZC 2JP3A 2OTKE 1LP1A 2KZJA 3L71E 3RL0B 2O01N 1VDFA 1SLQA 1NGMB 1G1IA 2QE7H 1USEA 4WY4D 3D6ZA 5AW3B 1J1DB 1SQVD 1KFNA 2KLVA 3LW5H 3V4WA 2KS1A 1VQMP 1NWQA 1FAVA 3I5CA 1NTKJ 1ZMEC 3H1HJ 1M57D 2N9BA 4PV1D 1XTCC 1RF0A 3N7NA 3CX5H 3AEFC 2WTYA 1PZQA 1HF9A 3RGUA 1HVVA 3B5ND 1VPCA 2A06E 3M9QA 1GL2D 2O01J 1QL2A 1KB9E 5KJ7C 4IL6E 4DT0A 1IFDA 2H89C 1Y9BA 5B66E 3A3YB 2QM8A 3HTKA 1RQUA 1YITP 1GW4A 1PP9D 1SQPG 3HD7B 4M3LA 2C9LY 1T2KD 2RN0A 3KHUA 3LIEA 3CCJP 3EWKA 2PRRA 3CX5D 2Z4EA 1ZP0C 1VQLP 5CJ0A 5DJUB 1J1EC 2WZ7A 5KAFE 1IFIA 3RK3E 3L73D 3GW6A 2IZ1A 4HKZH 4KJMA 3D6YA 1M1JA 1IFMA 1JMBA 4ZMDA 4TLFA 2K37A 5KLVD 3GHGA 3L72D 3KDPB 1W2EA 3CCSP 2E5YA 2KZIA 1SQPJ 1MUUA 1NU1J 1M56D 1BDCA 3EQ2A 5B5EH 2B9BA 1WT6A 1XTGB 4IL6X 2Q3IA 1RE3A 4K35A 3WU2H 3CD6P 2FYUJ 1HJ0A 2FXPA 2KUBA 2R3CA 2ZVOB 3GF7A 4DZOA 4C7NA 1ZXGA 1IFPA 1JY2P 3Q3DA 3KPEA 2MJZA 1PGJA 2BCCE 1H8AA 2HPCB 3TGUJ 2CK3H 2V7QH 1FU1A 2MKVA 1LTSC 1Q90D 2PP6A 2LR2A 2A06G 3IAOA 2FYUG 3RBXA 1GTWA 3L70D 4IFDK 1P84I 4WY4C 3FWLA 2AXTH 2YIUB 3H1JJ 1LT9A 1FJPA 4I6MC 1S5LE 1RF0C 1J2JB 1ZRTE 1SFCD 2JDIH 2QJKB 2V4HA 3L70E 4OVNF 4QMAA 4Y99C 1GZLA 2WPVB 3KZIH 4HB1A 3TSIA 1N73A 2QVAA 1BE3G 1FZAA 2IBZD 4ZNCA 1PP9E 5GTIH 1S9KE 2OYHC 1SVFA 2QIWA 4GOEA 3L74E 4XA4A 2H43A 1KILC 1URQC 3FXEA 3ITKA 1L0NK 4H44B 4NPEA 4HYTB 1NOHA 1YYCA 4U3FD 5KJ7D 3WUUA 2BCCJ 2QJYC 2WPRA 2YNYA 2FFDC 3MHVA 1EDJA 2AEMA 3E7KA 1L0NJ 3CC2P 2YKOA 5AVVB 3H1HE 5M1BA 1W2BO 1VQ9P 2QM7A 3TYYA 3A0BE 2E43A 1T8ZA 1SQXE 1RQVA 2FYZA 3NMDA 4H0LB 4JF7A 4MN4C 1N86A 4WB4A 1YQ3C 1PPJD 2N1TD 1VQ5P 2LXCB 1SQXK 3HD7D 4RESB 1NAFA 3PHLA 2DW3A 1JY3N 1LT9B 1SQQJ 1VF5C 2A45H 2R32A 2ZVNB 4ASVA 1L4AB 4DOJA 1Q81Q 2KNCB 2BCCD 1LTTC 1PGOA 4HJGH 1G2CA 3RK2B 4JBZA 1LTBC 2FYNB 2Z5HA 3H1LE 3CWBJ 3SFDC 1KFMA 1D7MA 2WSCJ 5CCGC 4YXWH 2OYIA 1RF1C 1FOSE 1IO4A 2WSEH 1HGZA 3Q5PA 1DEBA 1L2PA 2ZXEB 3G4SP 3M0DA 4YXDC 1DIPA 2Y0EA 2XZRA 2WSFJ 3M91A 5KLIC 1AQTA 1YI2P 1BSHA 3T97B 3H1HD 1QLED 3P8CD 3T97A 1VQOP 3M06A 1VQ7P 2WSCH 1SQXJ 1BE3E 3H25A 5EFWB 4OGQB 2WPSA 5AW1B 3VMZA 3L74G 2ZYGA 3L35A 1YQ4C 1FDOA 2A45I 2FY8A 2JEEA 3F5HA 4BWNA 3VOPA 2NPSB 2YO2A 5AVYB 2ITAA 1MFZA 1OW7A 2GUSA 2HODA 4EOTA 5KKZC 1NTMG 1NTKE 3L74J 1M8OB 1GL2B 2JWAA 1KN7A 2RKLA 1JY3O 1SQXG 2M0BA 4BRYA 3B4SA 1N7SC 1FBMA 3ABVC 5GTIE 2OYIB 5AW2B 1RHZB 1WRGA 3OA7A 1JMMA 3MP7B 4JQ0D 1YHQP 1R8EA 3H1JE 1IK7A 5KLVJ 1FZCC 1EZVG 2E74C 3AE8C 2K9JB 1JNMA 1VL2A 1E5WA 1EZVI 1AVOA 1S4XA 3AE4C 4LGDE 4ZKPA 1NTMD 2L5GB 3CCVP 1GDTA 4IL6H 1VQKP 1KYOE 2Q6QA 4H44D 2E75B 4UB8H 3Q2YA 1LWUC 3TNUB 2P7JA 1EC5A 1MZ9A 1USDA 1ZN5A 3HE4B 3CCEP 1P84H 1FE6A 2QJPC 1EXIA 4OH8B 3RK3D 1LTIC 3L70G 1EDIA 3TGUE 1ZR4A 1NTZD 2ZYAA 2A06D 2CPBA 1QEXA 3H1IJ 4UB8E 3I56P 3L72E 5TISE 1YTZI 4I2LC 1HGVA 1PP9G 1NO4A 1SQPD 1HBWA 2P2UA 1YBKA 2ZAEB 3SWYA 4D6TE 5KLVK 3CCLP 5AVQB 3Q5RA
chains in the Genus database with same CATH topology
2NRGA 2DW3A 2ITAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NRG A;  2DW3 A;  2ITA A; 
#chains in the Genus database with same CATH topology
 1KIL D;  1URQ D;  1ZRT D;  1N7L A;  1EDK A;  1NU1 E;  1LWU A;  2D2C D;  3H1J D;  4LC1 A;  5APT A;  5AW9 B;  1LTA C;  3H1K J;  4KT0 J;  2WSS H;  2YXR B;  2ZT9 C;  2HPC A;  1NH4 A;  3A0B H;  1S9K D;  1EXJ A;  1PP9 J;  2H88 C;  3VYI A;  1R5S A;  1KQL A;  1L0L J;  2FYU K;  2W6A A;  1JCD A;  2E74 D;  4LLH A;  5AVZ B;  4GIF A;  3AE7 C;  1IZN B;  2XDJ A;  3RK3 B;  3USS A;  4ASW A;  2IFM A;  3BVH A;  1HH0 A;  3II6 A;  2FXO A;  3SFE C;  4PV1 B;  2B89 A;  3HD7 C;  1SQB K;  5CMZ A;  1IFJ A;  3PLN A;  2KOG A;  1VF5 D;  2QRX A;  2ZXX A;  1GK4 A;  4L76 A;  3TDK A;  3S9O A;  1ZV8 A;  1FZB A;  1IJD B;  2IBZ E;  3HE4 A;  3N4X A;  1G1J A;  5B66 H;  1NKZ B;  1L0N G;  1Q82 Q;  1FDI A;  1AV1 A;  1GU4 A;  1HWT C;  1T3J A;  2AXT E;  2Y0C A;  1ZOY C;  2D2C C;  1NKN A;  2JKV A;  2M3B A;  3BAS A;  3NFQ A;  1OW8 A;  4I7Z B;  4PJ0 H;  5KTB A;  2M5A A;  2PFX A;  2Q1K A;  4W7Y A;  3D71 A;  4UB6 H;  1AFO A;  3HTK B;  1WMK A;  3D70 A;  3SWK A;  1KC8 Q;  2LXB A;  3O6Q B;  3HE5 B;  1Q7Y Q;  2N1T B;  2YO3 A;  1BE3 J;  1NHL A;  1SQB D;  3BCC J;  3E1R A;  3MZW B;  1JY2 N;  5L8R J;  3V2R A;  1AJY A;  1M1J C;  4IFF A;  3NXS A;  3L75 G;  3BRV B;  2OQQ A;  2E76 B;  5CCH D;  1KIL E;  3R2P A;  2QA4 P;  1MV8 A;  1BCC J;  1PPJ E;  1SS1 A;  3AEC C;  1RE3 C;  1A02 J;  3U59 A;  5KAI H;  4EYY Q;  1SQB G;  4WY4 B;  3V2N A;  1FZG A;  2M8R A;  2IZ0 A;  3CWB E;  3H1L D;  2BEQ D;  1DD3 A;  1L0L E;  3CLQ A;  3CXH I;  1PFI A;  2KSJ A;  4K3A A;  1DX7 A;  1N7S D;  5APX A;  1OMI A;  3B5N C;  5KAI E;  2KLU A;  1LTJ C;  2QJK C;  1SQV J;  3GHG B;  4KHX A;  4XFJ A;  1S2E A;  2NRG A;  2K3R A;  3FGA D;  2OTL P;  3H1J G;  1W5C E;  1OW6 A;  1SQP K;  4C7N B;  4YTP C;  5E79 E;  1KYO H;  2N9Y B;  4W7Z A;  3KXD A;  4WBA A;  1SQV K;  4D6T J;  3VN0 A;  2IBZ G;  1ZLL A;  2CPS A;  3H1I E;  1NTZ K;  4GKG A;  2IFN A;  3G3Z A;  4EI2 A;  3HUS B;  1JY2 O;  4JYC A;  1N8R Q;  1SFC B;  1SFC A;  2IYP A;  2JR8 A;  1S5L H;  1VQ4 P;  2ZJS E;  2K1A A;  1KIL A;  1URQ A;  2W6B A;  3AEB C;  3IR9 A;  1LTJ A;  2YKP A;  1BGY G;  3BAT A;  3CI9 A;  5KAF H;  1VQN P;  1KTM A;  3V6I A;  5AVW B;  3O8Z A;  3M0D C;  4JPZ B;  5AW5 B;  1L4A A;  2Y0D A;  1VQP P;  2KNC A;  2Q9I A;  1L0L D;  3L74 D;  3CWB D;  4DJG A;  3V4Q A;  3WUT A;  1K9M Q;  2RMZ A;  3L70 J;  3BCC G;  2GA1 A;  3C1L A;  3P32 A;  2QEX P;  1KYO I;  1JY3 P;  1LT9 C;  1VF5 B;  3AEG C;  3G6E P;  2FFD A;  1Y8A A;  3V5B A;  1CZQ A;  1X0T A;  3KYQ A;  1NJI Q;  2HLO A;  4WY4 A;  1N73 B;  2ZT9 D;  4GDO A;  3RK2 C;  3RL0 D;  4PD4 I;  2P1J A;  1K8A Q;  5TJH A;  2YMK A;  4I1L A;  2Y9Y A;  1SQX D;  3F89 A;  3OJA B;  3BCC D;  3CXH E;  2E42 A;  1OIP A;  1OWA A;  1YTZ T;  3A0H E;  3L71 D;  4W80 A;  3RL0 g;  1OFC X;  3CCR P;  3U1A A;  2NPS A;  1L4A D;  4Y99 B;  1NAY A;  2B87 B;  2OTJ P;  2B87 A;  4H13 D;  4WWI A;  3AE2 C;  3ZDM A;  1CW5 A;  4U3F E;  1SQV E;  4OGQ C;  3HUS A;  1ZW0 A;  5AVS B;  2HOD B;  4EIJ A;  1AVY A;  3VP9 A;  5AW7 B;  3GLM A;  3LID A;  2H8P D;  1VQ8 P;  5GTH E;  3B5N A;  1KIL B;  1URQ B;  1GK6 A;  2Q5U A;  2I1K A;  3JSV C;  3L71 G;  3VP8 A;  3WMM 0;  1NTK G;  4BXL A;  4C7R A;  1S3J A;  2OYH A;  1X79 B;  3H1H G;  3L36 A;  1K73 Q;  1JO5 A;  3P8C E;  1G2C B;  2P10 A;  2V7Q J;  5AW4 B;  2W8Z A;  2FFD B;  2J59 M;  3FWN A;  1M90 Q;  1BCC E;  2I8D A;  3M0A A;  3A7O A;  4Y28 J;  5APY A;  3CCM P;  2WWW A;  2WQY C;  4H13 B;  1N7S A;  1BDD A;  1N7S B;  2NPS D;  4NPD A;  2OYI C;  5APV A;  5TIS H;  1QX8 A;  2Q3E A;  2Y9Z A;  2KK7 A;  2POH A;  1U7M A;  4UB6 E;  2FBW C;  1HTL C;  1KOR A;  2C0X A;  2HFE D;  3MUD A;  1CI6 B;  4A7P A;  1FZC B;  1U57 A;  4PD4 E;  1BGY D;  1PPJ G;  3A5T A;  2QSI A;  2XND H;  2JO1 A;  2WSF H;  2KS1 B;  1SQB E;  2Z5I A;  1N2D C;  3A0H H;  4N3Y B;  2Q7C A;  3P8M C;  2RH0 A;  1IFN A;  2R5B A;  2QJP B;  3AEE C;  1YJ9 P;  1T3U A;  4BRY B;  2QG4 A;  2K88 A;  2IYO A;  2KYV A;  1BSN A;  2IPP A;  3PRJ A;  2J58 A;  4U3F G;  5DJT B;  1JTH B;  1GL2 A;  1BCC D;  1GW3 A;  4L74 A;  5AVU B;  3VTP C;  1NTM K;  1NU1 G;  3Q1M A;  4AUW A;  3HD7 A;  3RL0 C;  1KYO D;  1E79 H;  4OWF A;  1IC2 A;  3CPW O;  2KP8 A;  2GM4 A;  3MTU E;  2NPS C;  1RH5 B;  1NVO A;  4RKU J;  1PV3 A;  1KD1 Q;  1J1D C;  3TF5 A;  2KI7 B;  2XNX A;  1T2K C;  3OAK A;  1QVG O;  1LP1 B;  1SQQ K;  4GOD A;  5GTH H;  1BGY E;  1H88 A;  1VQ6 P;  1Y47 A;  2O3J A;  1P84 D;  2KB7 P;  5E79 H;  1SQQ E;  3L75 D;  4OGQ D;  3WUV A;  5KJ7 A;  1OVU A;  2L91 A;  2YXQ B;  2FYU D;  2P58 A;  3H1K E;  5APQ A;  2OYO A;  4YPC A;  4D6T D;  1PGP A;  4PV1 C;  3MGN A;  1EZV E;  3EFF K;  3IFM A;  3TK1 A;  2FYU E;  4RO0 A;  5APS A;  3L72 J;  1UII A;  2OGU A;  4XE5 B;  4N78 E;  1L0N E;  5AW0 B;  3OW2 O;  2E74 B;  1RE4 C;  2P67 A;  4PD4 D;  1GU5 A;  4AYC A;  2JJL A;  3PTZ A;  2PGD A;  3RBZ A;  2C9N Y;  5AVX B;  3S4R A;  2XV5 A;  1NU1 K;  2O1J A;  4IFM A;  2E75 C;  1L0N D;  4H0L D;  1S1C X;  1SQP E;  1X22 A;  3AEA C;  1SP4 A;  1J1E B;  1FJK A;  2AXC A;  1OVR A;  1OZH A;  3L72 G;  1EQ7 A;  4ZKU A;  4H44 C;  5APW A;  2R3S A;  3GMA A;  4CPG A;  4WVZ A;  4O9B A;  1BGY J;  1NTZ G;  4D6T G;  1S5L X;  3WU2 E;  2A45 G;  1L0L K;  1RY3 A;  1SQV G;  2LKM A;  2BAS A;  3H1K D;  3MIW A;  3PH0 A;  2AEJ A;  1SQQ D;  3L75 E;  2WVR A;  3PP5 A;  4NPF X;  2N1T C;  4R4M A;  3W67 A;  1PIX A;  2R44 A;  1M1K Q;  3L4F A;  1M1J B;  5BU5 A;  2WMM A;  3TNU A;  1OXZ A;  2C0W A;  2E76 C;  3R4Y A;  2HR3 A;  1AA0 A;  4AQR D;  2YKQ A;  2WT7 A;  2ZT9 B;  2VRS A;  3CCU P;  1LNQ A;  3A2A A;  5AVT B;  2IDB A;  1HJB A;  3QWO C;  1EDL A;  2SPZ A;  2G8Y A;  1QVF O;  5CBN A;  1KB9 H;  1NU1 D;  2KXP B;  3NTN A;  3BRT B;  2W83 C;  5AW8 B;  1FZE A;  3VMY A;  1RF1 A;  3VMA A;  5CCG A;  1RF1 B;  2W90 A;  3M9B A;  3B8E B;  3JC2 2;  1BE3 D;  1SQB J;  3C8V A;  1NTM J;  4R4L A;  3SSU A;  3B71 A;  2M5A B;  2YIU C;  3CXH D;  3H1L G;  5KLV G;  3CME P;  1S72 P;  1LTG C;  1PGQ A;  1NTK K;  1T6A A;  1KQF B;  2O01 H;  3V2Q A;  3TGU D;  1DH3 A;  1PL5 A;  4L73 A;  2R5D A;  1YIJ P;  1JM0 A;  2NZ2 A;  3HE5 A;  3QH9 A;  1DEE G;  4PD4 H;  5CHX A;  1DD4 A;  1ZR2 A;  3HUS C;  1U7J A;  1H0T B;  5CCH C;  1A02 F;  1FS0 E;  2OYH B;  1SFC C;  1TU3 F;  3H32 A;  3H1L J;  5B5E E;  2AEF A;  5CBO A;  1GD2 E;  1Z56 A;  3CX5 I;  4IOI H;  4TT3 H;  1H89 A;  3VMX A;  1NTZ E;  3I55 P;  2M3E A;  1LJ2 A;  3BCC E;  2KIK A;  3V2P A;  2QJY B;  2GUV A;  3PJS K;  5CCG D;  2K9J A;  3Q5S A;  2KSE A;  3FXD A;  4C46 A;  1GL2 C;  1FC2 C;  2WT7 B;  1JEK A;  1IK9 A;  3L73 J;  4N6J A;  1NTM E;  4N78 D;  4U3F J;  1JUN A;  2E75 D;  3H6P A;  2XKM A;  4H0L C;  4HH2 A;  1NTK D;  1X8Y A;  3CMA P;  1N73 C;  1CI6 A;  1FZC A;  2FXM A;  3CWB G;  4GT1 A;  4B86 A;  1KMI Z;  1KQG B;  1L0L G;  4JYB A;  2E5T A;  1L4A C;  2BEZ F;  1JB0 J;  3L73 G;  1SQQ G;  5CCH A;  3GF3 A;  3O6Q A;  1JCC A;  2FYN C;  2UWJ E;  3H1K G;  2K9Y A;  3MUD C;  1FZF A;  3G71 P;  2PAJ A;  1JOC A;  3B5N B;  3P7K A;  3E1I A;  1GMJ A;  1LTJ B;  3GHG C;  3AE1 C;  1LWU B;  1MKM A;  2E76 D;  3CXH H;  1LGH B;  3EFG A;  3H32 B;  4L75 A;  3H1I G;  1OX3 A;  3U1C A;  1YJW P;  1H0T A;  4U7J A;  5BU8 B;  5KLI B;  5H2F H;  3L71 J;  3IF4 A;  2ZYD A;  1K05 A;  3MD0 A;  3L75 J;  1QL1 A;  1R5L A;  3M9H A;  3TGU G;  2W27 A;  1KB9 I;  4EDF A;  4Z1M H;  3CC4 P;  1QGK B;  1BCC G;  5APU A;  3UIA A;  3CX5 E;  1LT1 A;  3GG2 A;  2J5U A;  3AE9 C;  1NYH A;  2WIT A;  3AE3 C;  3AE6 C;  5BVZ A;  5K5G B;  1KQS O;  3H1I D;  1UIX A;  2JWD A;  2BCC G;  3G9R A;  1FOS F;  2OAR A;  3L37 A;  3FX0 A;  3CL3 D;  3CC7 P;  4H13 C;  3JCU H;  2HYN A;  2O1K A;  2XU6 A;  1OVV A;  1RE4 A;  1X9V A;  5KKZ B;  2G3A A;  4GOF A;  3RK3 C;  2WSE J;  1P84 E;  3AED C;  5C39 A;  2HG5 D;  3JCU E;  5AW6 B;  1KZU B;  2I1J A;  1Q2N A;  3IN6 A;  1MFT A;  1K04 A;  3K5B A;  1AQ5 A;  2YMY A;  1EZV D;  1JTH A;  1HUC A;  3W68 A;  2WPQ A;  3L73 E;  3KZI E;  1M7L A;  3HRN A;  3RK2 D;  4PJ0 E;  1NTZ J;  1YJN P;  2H7H A;  3AE5 C;  2N1T A;  1KB9 D;  3KQG A;  3SWF A;  1CSB A;  2W6J H;  2B88 A;  2ZFC A;  3S1K A;  5H2F E;  1Q86 Q;  1FDM A;  4DCK A;  1KV4 A;  3CCQ P;  3LW5 J;  2IX7 C;  5AVR B;  2IBZ I;  2D2C B;  3C9I A;  4RJT A;  5CJ4 A;  2FKW B;  5KLV E;  4I7Z C;  2JP3 A;  2OTK E;  1LP1 A;  2KZJ A;  3L71 E;  3RL0 B;  2O01 N;  1VDF A;  1SLQ A;  1NGM B;  1G1I A;  2QE7 H;  1USE A;  4WY4 D;  3D6Z A;  5AW3 B;  1J1D B;  1SQV D;  1KFN A;  2KLV A;  3LW5 H;  3V4W A;  2KS1 A;  1VQM P;  1NWQ A;  1FAV A;  3I5C A;  1NTK J;  1ZME C;  3H1H J;  1M57 D;  2N9B A;  4PV1 D;  1XTC C;  1RF0 A;  3N7N A;  3CX5 H;  3AEF C;  2WTY A;  1PZQ A;  1HF9 A;  3RGU A;  1HVV A;  3B5N D;  1VPC A;  2A06 E;  3M9Q A;  1GL2 D;  2O01 J;  1QL2 A;  1KB9 E;  5KJ7 C;  4IL6 E;  4DT0 A;  1IFD A;  2H89 C;  1Y9B A;  5B66 E;  3A3Y B;  2QM8 A;  3HTK A;  1RQU A;  1YIT P;  1GW4 A;  1PP9 D;  1SQP G;  3HD7 B;  4M3L A;  2C9L Y;  1T2K D;  2RN0 A;  3KHU A;  3LIE A;  3CCJ P;  3EWK A;  2PRR A;  3CX5 D;  2Z4E A;  1ZP0 C;  1VQL P;  5CJ0 A;  5DJU B;  1J1E C;  2WZ7 A;  5KAF E;  1IFI A;  3RK3 E;  3L73 D;  3GW6 A;  2IZ1 A;  4HKZ H;  4KJM A;  3D6Y A;  1M1J A;  1IFM A;  1JMB A;  4ZMD A;  4TLF A;  2K37 A;  5KLV D;  3GHG A;  3L72 D;  3KDP B;  1W2E A;  3CCS P;  2E5Y A;  2KZI A;  1SQP J;  1MUU A;  1NU1 J;  1M56 D;  1BDC A;  3EQ2 A;  5B5E H;  2B9B A;  1WT6 A;  1XTG B;  4IL6 X;  2Q3I A;  1RE3 A;  4K35 A;  3WU2 H;  3CD6 P;  2FYU J;  1HJ0 A;  2FXP A;  2KUB A;  2R3C A;  2ZVO B;  3GF7 A;  4DZO A;  4C7N A;  1ZXG A;  1IFP A;  1JY2 P;  3Q3D A;  3KPE A;  2MJZ A;  1PGJ A;  2BCC E;  1H8A A;  2HPC B;  3TGU J;  2CK3 H;  2V7Q H;  1FU1 A;  2MKV A;  1LTS C;  1Q90 D;  2PP6 A;  2LR2 A;  2A06 G;  3IAO A;  2FYU G;  3RBX A;  1GTW A;  3L70 D;  4IFD K;  1P84 I;  4WY4 C;  3FWL A;  2AXT H;  2YIU B;  3H1J J;  1LT9 A;  1FJP A;  4I6M C;  1S5L E;  1RF0 C;  1J2J B;  1ZRT E;  1SFC D;  2JDI H;  2QJK B;  2V4H A;  3L70 E;  4OVN F;  4QMA A;  4Y99 C;  1GZL A;  2WPV B;  3KZI H;  4HB1 A;  3TSI A;  1N73 A;  2QVA A;  1BE3 G;  1FZA A;  2IBZ D;  4ZNC A;  1PP9 E;  5GTI H;  1S9K E;  2OYH C;  1SVF A;  2QIW A;  4GOE A;  3L74 E;  4XA4 A;  2H43 A;  1KIL C;  1URQ C;  3FXE A;  3ITK A;  1L0N K;  4H44 B;  4NPE A;  4HYT B;  1NOH A;  1YYC A;  4U3F D;  5KJ7 D;  3WUU A;  2BCC J;  2QJY C;  2WPR A;  2YNY A;  2FFD C;  3MHV A;  1EDJ A;  2AEM A;  3E7K A;  1L0N J;  3CC2 P;  2YKO A;  5AVV B;  3H1H E;  5M1B A;  1W2B O;  1VQ9 P;  2QM7 A;  3TYY A;  3A0B E;  2E43 A;  1T8Z A;  1SQX E;  1RQV A;  2FYZ A;  3NMD A;  4H0L B;  4JF7 A;  4MN4 C;  1N86 A;  4WB4 A;  1YQ3 C;  1PPJ D;  2N1T D;  1VQ5 P;  2LXC B;  1SQX K;  3HD7 D;  4RES B;  1NAF A;  3PHL A;  2DW3 A;  1JY3 N;  1LT9 B;  1SQQ J;  1VF5 C;  2A45 H;  2R32 A;  2ZVN B;  4ASV A;  1L4A B;  4DOJ A;  1Q81 Q;  2KNC B;  2BCC D;  1LTT C;  1PGO A;  4HJG H;  1G2C A;  3RK2 B;  4JBZ A;  1LTB C;  2FYN B;  2Z5H A;  3H1L E;  3CWB J;  3SFD C;  1KFM A;  1D7M A;  2WSC J;  5CCG C;  4YXW H;  2OYI A;  1RF1 C;  1FOS E;  1IO4 A;  2WSE H;  1HGZ A;  3Q5P A;  1DEB A;  1L2P A;  2ZXE B;  3G4S P;  3M0D A;  4YXD C;  1DIP A;  2Y0E A;  2XZR A;  2WSF J;  3M91 A;  5KLI C;  1AQT A;  1YI2 P;  1BSH A;  3T97 B;  3H1H D;  1QLE D;  3P8C D;  3T97 A;  1VQO P;  3M06 A;  1VQ7 P;  2WSC H;  1SQX J;  1BE3 E;  3H25 A;  5EFW B;  4OGQ B;  2WPS A;  5AW1 B;  3VMZ A;  3L74 G;  2ZYG A;  3L35 A;  1YQ4 C;  1FDO A;  2A45 I;  2FY8 A;  2JEE A;  3F5H A;  4BWN A;  3VOP A;  2NPS B;  2YO2 A;  5AVY B;  2ITA A;  1MFZ A;  1OW7 A;  2GUS A;  2HOD A;  4EOT A;  5KKZ C;  1NTM G;  1NTK E;  3L74 J;  1M8O B;  1GL2 B;  2JWA A;  1KN7 A;  2RKL A;  1JY3 O;  1SQX G;  2M0B A;  4BRY A;  3B4S A;  1N7S C;  1FBM A;  3ABV C;  5GTI E;  2OYI B;  5AW2 B;  1RHZ B;  1WRG A;  3OA7 A;  1JMM A;  3MP7 B;  4JQ0 D;  1YHQ P;  1R8E A;  3H1J E;  1IK7 A;  5KLV J;  1FZC C;  1EZV G;  2E74 C;  3AE8 C;  2K9J B;  1JNM A;  1VL2 A;  1E5W A;  1EZV I;  1AVO A;  1S4X A;  3AE4 C;  4LGD E;  4ZKP A;  1NTM D;  2L5G B;  3CCV P;  1GDT A;  4IL6 H;  1VQK P;  1KYO E;  2Q6Q A;  4H44 D;  2E75 B;  4UB8 H;  3Q2Y A;  1LWU C;  3TNU B;  2P7J A;  1EC5 A;  1MZ9 A;  1USD A;  1ZN5 A;  3HE4 B;  3CCE P;  1P84 H;  1FE6 A;  2QJP C;  1EXI A;  4OH8 B;  3RK3 D;  1LTI C;  3L70 G;  1EDI A;  3TGU E;  1ZR4 A;  1NTZ D;  2ZYA A;  2A06 D;  2CPB A;  1QEX A;  3H1I J;  4UB8 E;  3I56 P;  3L72 E;  5TIS E;  1YTZ I;  4I2L C;  1HGV A;  1PP9 G;  1NO4 A;  1SQP D;  1HBW A;  2P2U A;  1YBK A;  2ZAE B;  3SWY A;  4D6T E;  5KLV K;  3CCL P;  5AVQ B;  3Q5R A; 
#chains in the Genus database with same CATH homology
 2NRG A;  2DW3 A;  2ITA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...