2ITAA

Solution structure of pufx from rhodobacter sphaeroides
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
70
structure length
70
Chain Sequence
MADKTIFNDHLNTNPKTNLRLWVAFQMMKGAGWAGGVFFGTLLLIGFFRVVGRMLPIQENQAPAPNITGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intrinsic membrane protein pufX
publication title The solution structure of the PufX polypeptide from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Photosynthesis,membrane protein
total genus 13
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2006-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11511 RhodobacterPufX Intrinsic membrane protein PufX
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.920 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces rhodobacter sphaeroides pufx membrane protein 2itaA01
2DW3A 2ITAA 2NRGA
chains in the Genus database with same CATH superfamily
5KAFE 2ZVOB 3G4SP 3TNUB 2ZAEB 2YKOA 4K35A 1LWUC 1CI6A 4JF7A 3B5NB 1YIJP 2W6AA 2HR3A 3I55P 3BVHA 5APVA 2P67A 2FFDA 1FZEA 1K73Q 1KYOI 3CLQA 4XFJA 5AW8B 2P10A 1PPJE 4ASVA 3FXDA 4IL6E 1VQMP 2A45I 3F5HA 1AVYA 1Y47A 2W27A 2QEXP 2HLOA 1AV1A 3M91A 3I56P 1K8AQ 2WPRA 1PP9E 5KLVE 4JPZB 2H88C 2ZT9B 1D7MA 3AEBC 1IK7A 3CPWO 2P1JA 2HPCB 2RMZA 4YPCA 5CCGA 3MHVA 3LIDA 3RK3B 4UB8E 3ITKA 5EFWB 3QWOC 1LP1B 3BATA 1LJ2A 3FXEA 3A0HH 5CCHA 1NTMG 4IFMA 4GKGA 3AECC 2W6BA 2YMKA 1U7JA 2K3RA 3HUSB 2HFED 3L36A 3SWYA 3RK3E 1QEXA 3V2PA 2KSEA 5AVUB 1JMMA 5CCHD 1DX7A 1NAYA 2WSSH 4HKZH 1A02F 2B87B 3HD7A 2PRRA 3WU2H 5KKZC 4HB1A 2IYPA 1YI2P 2K88A 2L91A 1NTKE 3WUUA 1G2CA 1GW4A 1EDKA 1UIIA 4WY4C 1NTZG 2M8RA 3Q5RA 2NRGA 2Y0CA 1SQXK 1IFDA 1GD2E 1R8EA 2XV5A 4I7ZC 2NPSC 2MJZA 2FY8A 2O01H 1HJBA 2Z5HA 2XNXA 4NPFX 2Q5UA 2J58A 1AFOA 1ZRTD 3AE1C 2LXCB 1NTME 2N9YB 1NU1G 3CXHD 4H13B 2H8PD 1LTSC 4PD4I 3P8CE 1FAVA 1YQ3C 2N1TA 5M1BA 3OA7A 1LTTC 3L71J 3L73G 5B66E 1J1EB 2QRXA 1BE3J 1JM0A 4ZMDA 2XZRA 2QIWA 1URQA 1JTHA 1YITP 1EZVI 4DT0A 3CWBE 2N1TD 1SQPJ 2PFXA 1PV3A 2OGUA 2O1JA 1KB9D 2A06D 3IFMA 3WUVA 1NTZE 1OVUA 1URQD 5B5EH 2R44A 2WSCJ 1U57A 3Q3DA 1FZCB 2H7HA 1OFCX 2QJPB 1VQ7P 1M1JC 2Q7CA 3T97B 3BRTB 1FJPA 3H1IG 3CCSP 4NPDA 3CXHH 1NOHA 2AXTE 2FYUJ 2E76D 1Z56A 1OZHA 3IF4A 1BGYJ 3CCJP 3HE5A 5AW9B 1NGMB 1X22A 2K37A 3L73E 3TF5A 3MD0A 1NYHA 4UB6H 3CCEP 3L74J 1CZQA 3WUTA 1QVGO 1N73C 4PV1C 1R5SA 3CMEP 5BVZA 3H1JG 1S2EA 2FYUG 3CX5D 2H43A 3HTKA 3H1KD 2IFNA 1BGYG 4H0LD 3L4FA 3EQ2A 1KILD 1JNMA 2WSFH 3N4XA 5AW0B 3L71D 1EQ7A 1GL2A 3O8ZA 3L70E 1RHZB 3M9QA 4GIFA 2Y9YA 1BE3D 1KN7A 1KTMA 5KKZB 1KFNA 3RGUA 1K9MQ 3S1KA 3P7KA 3C1LA 5AW4B 1S4XA 1M8OB 1Y8AA 5AW6B 1SQPD 1KV4A 5KAIH 1JUNA 1RF1C 1DEEG 3H1IE 4WY4B 2I1KA 2JR8A 2YNYA 1ZMEC 1SS1A 2I8DA 1VQ4P 3L75J 4OGQD 4I7ZB 1NTKK 3VYIA 1L4AD 3CMAP 1FZFA 2HG5D 2M5AA 3EFGA 5APYA 1PIXA 1SQXJ 3OJAB 3AE2C 2NPSA 2FYUD 3CX5H 3CC7P 4N78D 1KYOD 3JSVC 4EOTA 4R4LA 1SQVJ 1RF0C 1VF5C 3AE9C 1SQBK 1T2KC 1BDCA 5TISE 2OQQA 3L74D 4LC1A 1S5LE 2ZT9C 3EFFK 5AVSB 5AW7B 1EDIA 3PP5A 3U1AA 3TGUG 4U3FD 2WVRA 3RK3C 1IK9A 1QLED 2OARA 1L0LK 1T3JA 1HTLC 2WSCH 1ZOYC 1N86A 1SQQE 3KZIE 1JY3N 2Q1KA 3A0BE 3HUSC 1NTZK 1BDDA 2XDJA 1FU1A 1KYOH 1MKMA 1VQ6P 3L75D 1M1JA 4BRYB 1QL2A 2C9NY 3GHGB 1KQFB 1CSBA 4PJ0E 3C8VA 3FWLA 1X79B 1G1IA 4RO0A 1IFPA 2E75B 3H1LJ 3PH0A 1SQXD 2JWDA 4JBZA 1N73B 1KMIZ 2AEJA 4PV1B 2FXPA 4KHXA 3AEGC 3TGUE 2KUBA 2OYOA 2IX7C 2O01J 1USDA 1SQVD 3KXDA 4C7NB 3VP8A 2LR2A 5APXA 1JOCA 1BCCD 1X0TA 1H8AA 5APSA 2KB7P 2JP3A 3G3ZA 2LKMA 5GTHE 1ZR4A 4H13C 2AXCA 2KNCB 3FX0A 2RN0A 3UIAA 1RE3A 1YQ4C 3PJSK 2IZ1A 1RF1B 4OH8B 1S3JA 2FYNC 1J1EC 1J1DC 3SWFA 2JEEA 4DOJA 4PD4D 2OYHA 1L0NJ 1S1CX 2JJLA 2E5TA 3VOPA 3A0HE 1ZR2A 1M1KQ 3AE4C 3TNUA 3FWNA 2FFDB 2D2CD 2WWWA 3VN0A 2BASA 5BU8B 2W83C 2FBWC 2YO2A 3ABVC 1EC5A 1EZVD 2WITA 3B5NA 2SPZA 3USSA 2ZYGA 2P58A 1LTJA 2B9BA 2WPQA 2Q6QA 1PPJD 3RK2C 1XTGB 2O3JA 5E79E 3L35A 1FZCC 1VF5B 2QJPC 4BWNA 2QM8A 1IJDB 2KP8A 1FJKA 2YKPA 1G1JA 1ZV8A 3H1LD 3B5ND 1N7SC 1S72P 3P8MC 1HGZA 3GW6A 1WRGA 4R4MA 3L72J 1SQBJ 2POHA 3K5BA 1UIXA 2V4HA 3CC2P 1VDFA 1GZLA 4PD4H 3VP9A 3TYYA 2XU6A 3V2QA 2HPCA 3AE7C 5KAFH 2ZYDA 4JQ0D 1U7MA 2Q3IA 3BCCJ 1GW3A 3M9HA 5AW1B 4U7JA 2ZJSE 1NKNA 5CCGD 2OYIC 1FE6A 3CC4P 1LP1A 1L0LJ 2WSFJ 3O6QB 2ZFCA 1YJNP 2E74D 3CWBJ 1IFJA 2QA4P 1L0ND 1BSNA 3PLNA 1SQQK 3AEEC 1RQVA 3HUSA 2QVAA 3BCCG 4IL6H 2BCCJ 3KDPB 4H44D 3E7KA 1PGOA 1SFCC 1LNQA 4YXWH 2KLUA 2L5GB 2B87A 1M7LA 1LGHB 3HD7D 3M0AA 1H0TB 1NTKD 5AW3B 3LW5H 2A06G 1AA0A 1L2PA 1RE4C 3GG2A 1FDOA 3A7OA 2IZ0A 1CW5A 3QH9A 5B5EE 1M57D 2FXOA 1OVVA 4C7RA 4XE5B 4KT0J 1USEA 3M0DA 1T8ZA 2WQYC 1LTIC 2YKQA 1ZRTE 2LXBA 1FDIA 1JY2N 3HE4B 3H1KJ 3OW2O 3L72D 1SQBD 1P84I 3HRNA 5AVZB 3S9OA 1MUUA 1HF9A 3G71P 3IAOA 1HUCA 2FYNB 3A2AA 1J1DB 1Q86Q 2BEQD 1KD1Q 2PAJA 1JCCA 1PGQA 2G8YA 3H32B 3I5CA 3BCCD 2IBZD 1URQB 3MIWA 4GT1A 1S9KD 1NKZB 1SP4A 3KYQA 2KLVA 3RL0C 1HWTC 1AQTA 1SLQA 1H89A 3H1KG 3H1HJ 4W7ZA 4C46A 1LWUA 2H89C 1L0LD 1HGVA 3L37A 3CCUP 4D6TJ 3L71G 3CWBD 1KB9E 1FZAA 5APUA 2A06E 2E76B 1BE3G 3RK2B 2VRSA 3Q1MA 1TU3F 1AJYA 3CCRP 2BCCD 5APWA 5AVVB 1SQPG 1KQLA 1N7SB 3JCUE 5KAIE 1NU1E 2YXRB 3GF3A 5GTIE 3VTPC 4D6TG 3T97A 1JY3O 3GHGC 1T6AA 2P2UA 4H0LB 3CD6P 5KLVK 1KILB 2JDIH 3F89A 2E75C 3CI9A 3R4YA 3II6A 2C0WA 2CPBA 5B66H 3BRVB 2WT7B 2AEFA 4WWIA 3LIEA 2K9JB 5KJ7C 2QM7A 2OYIB 3EWKA 1OIPA 2UWJE 1LTBC 4U3FJ 5CBNA 4ASWA 2P7JA 1KILE 3L71E 1YTZT 1FS0E 2WPSA 5K5GB 3CCQP 3M06A 2A45G 5CHXA 1BE3E 3L74G 4YXDC 4OGQB 1LT9C 3L70D 4HJGH 1RH5B 1PZQA 2HODB 1SFCB 1GL2D 1L4AB 2WZ7A 3H1HD 5H2FE 1SQPE 4U3FG 2Y0EA 4I2LC 3D6YA 4EIJA 1J2JB 4ZNCA 4D6TD 2KS1B 3AEFC 1PGPA 2B89A 2AXTH 5AVRB 4IFFA 2WSEJ 4WY4A 2G3AA 2FFDC 1JEKA 3AE5C 1RE4A 3VMXA 4TLFA 3NFQA 2QJKC 3NMDA 1VQPP 2YO3A 3H1JE 2FYUE 1Q90D 1NHLA 1PGJA 2R5BA 1EXIA 3L75G 4N78E 1BGYE 1RQUA 1QGKB 1BCCJ 1OW8A 2NPSD 1NTMK 2R3CA 1SQXG 1KQGB 2C0XA 5AW2B 1Y9BA 3RL0B 3CCLP 2AEMA 3CCVP 1QX8A 3IR9A 1PFIA 2N9BA 1WT6A 3VMYA 3PTZA 1SQVG 4OWFA 1YHQP 1LTGC 1KB9I 3NXSA 1GK4A 3SWKA 1AQ5A 4I1LA 1MZ9A 5CCHC 1BCCG 1R5LA 3AE8C 4L74A 5AVYB 4WVZA 1VQOP 2XNDH 2CPSA 1AVOA 1HBWA 3V2RA 3W68A 3RL0g 1X8YA 4H44C 2CK3H 4KJMA 1SQQD 5BU5A 4AQRD 1NWQA 3PRJA 1DD3A 3HD7C 2WTYA 4W7YA 1KORA 3SSUA 3L75E 2KZIA 3V4WA 1NH4A 2WMMA 3D6ZA 2KZJA 1YJWP 3N7NA 5AW5B 3IN6A 1GK6A 2YMYA 3G9RA 1NU1K 1VQ5P 1JY3P 1Q2NA 4BRYA 1SQXE 3GHGA 3TDKA 2R3SA 1EZVG 4GOEA 2YXQB 3LW5J 1JMBA 5TISH 4HH2A 1PP9J 2E5YA 5KLVJ 2QJYB 1S5LH 1LT1A 2IFMA 1LTAC 3SFEC 1YYCA 1ZN5A 1GMJA 1PPJG 3CCMP 1N73A 1SQVE 1KFMA 5KJ7A 1X9VA 4DZOA 1VQLP 3H1LG 5AVXB 1LT9B 4O9BA 1FZBA 1NO4A 4WB4A 3RBZA 4C7NA 5AVWB 1IZNB 2WPVB 2IDBA 3MUDC 2N1TC 3ZDMA 4PV1D 3Q2YA 4HYTB 4B86A 2W6JH 3A0BH 4YTPC 2OYHB 1P84D 1CI6B 2KNCA 5AVTB 3WMM0 1Q82Q 1JY2O 3V5BA 4PD4E 1URQC 1KQSO 1NVOA 1RF1A 3Q5SA 2WSEH 2KOGA 1IC2A 3TK1A 4GOFA 3MZWB 5KLIB 1SQPK 5APQA 3B71A 4PJ0H 1A02J 4AYCA 1OXZA 2QJKB 1N7LA 1NTKJ 1W2BO 1EZVE 1LTJB 2E76C 2XKMA 1L0NG 2MKVA 2M0BA 3WU2E 3D70A 3GF7A 4N3YB 4DCKA 1WMKA 2KSJA 5C39A 3H1LE 1GDTA 2FYUK 5KTBA 3AEDC 1NTKG 1RF0A 1PP9D 5KLVD 2RH0A 1M56D 1EDJA 4N6JA 1FDMA 1NTMJ 2BEZF 2HYNA 5CJ4A 5GTHH 1M90Q 5DJTB 1JO5A 1VQNP 4H0LC 3VMZA 1KILC 1P84H 2W8ZA 2E74B 3MTUE 1VF5D 3GLMA 1T2KD 4JYBA 4RKUJ 2YIUC 2ZT9D 2R32A 1W2EA 3L72G 4L76A 1SQBG 4H44B 2RKLA 4ZKUA 1DEBA 1ZW0A 2E43A 4Z1MH 1GL2C 2B88A 3V2NA 2OTJP 2ZVNB 3OAKA 4LLHA 3Q5PA 3HD7B 3V6IA 2OTLP 1L0NE 3PHLA 3RK3D 1NTZJ 4OGQC 3M9BA 2IBZG 2Y9ZA 2V7QJ 1OVRA 1GU4A 3O6QA 1G2CB 3MGNA 1Q81Q 4WBAA 1L4AC 5E79H 1L0LG 1HH0A 4IL6X 3GMAA 3CWBG 2KK7A 1N2DC 1DD4A 2FYZA 1YJ9P 3C9IA 2QSIA 1NU1J 3SFDC 1MFTA 3FGAD 1H0TA 2BCCG 2R5DA 1RY3A 1K05A 3L73J 4UB8H 3AEAC 4TT3H 2NZ2A 3BASA 3CXHE 1KC8Q 2GUSA 2Z5IA 1H88A 5CJ0A 3E1RA 2N1TB 1NTMD 3L72E 1SQBE 1SQVK 4GODA 3CL3D 2JO1A 1QL1A 1XTCC 2QG4A 3P8CD 3HE4A 1ZP0C 3B4SA 3KHUA 4Y99C 1E5WA 4UB6E 1JTHB 4DJGA 3MUDA 3L70J 3BCCE 2JWAA 2IBZE 1S9KE 1LWUB 2C9LY 1IFMA 4H13D 1JY2P 3TSIA 1DIPA 1N8RQ 3H32A 1L0LE 2M3EA 4RJTA 1OX3A 3H1IJ 3H25A 1VL2A 3U1CA 1NTZD 4M3LA 3L70G 3U59A 4IFDK 2Q9IA 1JCDA 2BCCE 3H1HG 1IFIA 1K04A 1FC2C 3VMAA 1FZCA 3HE5B 3RBXA 4ZKPA 4I6MC 1NJIQ 3P32A 5TJHA 1NU1D 3H1JJ 1N7SA 3KQGA 4LGDE 2E42A 3RK2D 4EI2A 2IPPA 3L73D 2KYVA 2IYOA 1VPCA 3HTKB 2YIUB 2QJYC 1KILA 3CX5E 2KIKA 3H1KE 1MFZA 1N7SD 3NTNA 4QMAA 1SVFA 5L8RJ 1GL2B 2WT7A 2K9JA 1Q7YQ 2O01N 2OYIA 4BXLA 5CMZA 1OWAA 1GU5A 2K9YA 2V7QH 3W67A 1KB9H 5CBOA 1RE3C 3S4RA 4AUWA 1SQQJ 2D2CC 3H1HE 2KXPB 2PP6A 1GTWA 1VQ9P 2OYHC 2FXMA 1L0NK 4IOIH 4MN4C 4D6TE 1QVFO 2ITAA 3H1ID 2HODA 3JCUH 1SFCA 1L4AA 1FZGA 1NAFA 1OW7A 5GTIH 2M5AB 5KLIC 3A5TA 2KS1A 2O1KA 2NPSB 2M3BA 2Z4EA 3B5NC 1SQQG 1SFCD 3CXHI 1LTJC 2J5UA 4WY4D 2ZXXA 1FBMA 2JKVA 1KYOE 3AE6C 4L73A 1HVVA 2ZXEB 3B8EB 1MV8A 3H1JD 2PGDA 3TGUJ 1BGYD 4Y99B 1W5CE 3L74E 2IBZI 2OTKE 1YBKA 1EXJA 4NPEA 5CCGC 4U3FE 2QE7H 2I1JA 3D71A 5H2FH 1FOSF 2E74C 1E79H 4A7PA 1FOSE 2ZYAA 4EYYQ 3KPEA 4W80A 2FKWB 4CPGA 5APTA 4GDOA 1T3UA 3RL0D 4EDFA 3G6EP 1EDLA 1M1JB 4OVNF 1PL5A 4XA4A 3R2PA 2Y0DA 1OMIA 1DH3A 2GUVA 1BSHA 2K1AA 4Y28J 3V4QA 1YTZI 4K3AA 1ZXGA 2A45H 3CX5I 1VQ8P 2W90A 1OW6A 1KZUB 1VQKP 5AVQB 3H6PA 2KI7B 3TGUD 1S5LX 2Q3EA 3M0DC 1BCCE 4L75A 2GM4A 2E75D 1ZLLA 4RESB 3MP7B 1PP9G 5KLVG 3JC22 1IO4A 5KJ7D 2D2CB 5DJUB 1JB0J 2DW3A 3KZIH 1LT9A 3AE3C 4JYCA 2GA1A 3E1IA 1HJ0A 3A3YB 1IFNA 2J59M 1P84E
chains in the Genus database with same CATH topology
2DW3A 2ITAA 2NRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DW3 A;  2ITA A;  2NRG A; 
#chains in the Genus database with same CATH topology
 5KAF E;  2ZVO B;  3G4S P;  3TNU B;  2ZAE B;  2YKO A;  4K35 A;  1LWU C;  1CI6 A;  4JF7 A;  3B5N B;  1YIJ P;  2W6A A;  2HR3 A;  3I55 P;  3BVH A;  5APV A;  2P67 A;  2FFD A;  1FZE A;  1K73 Q;  1KYO I;  3CLQ A;  4XFJ A;  5AW8 B;  2P10 A;  1PPJ E;  4ASV A;  3FXD A;  4IL6 E;  1VQM P;  2A45 I;  3F5H A;  1AVY A;  1Y47 A;  2W27 A;  2QEX P;  2HLO A;  1AV1 A;  3M91 A;  3I56 P;  1K8A Q;  2WPR A;  1PP9 E;  5KLV E;  4JPZ B;  2H88 C;  2ZT9 B;  1D7M A;  3AEB C;  1IK7 A;  3CPW O;  2P1J A;  2HPC B;  2RMZ A;  4YPC A;  5CCG A;  3MHV A;  3LID A;  3RK3 B;  4UB8 E;  3ITK A;  5EFW B;  3QWO C;  1LP1 B;  3BAT A;  1LJ2 A;  3FXE A;  3A0H H;  5CCH A;  1NTM G;  4IFM A;  4GKG A;  3AEC C;  2W6B A;  2YMK A;  1U7J A;  2K3R A;  3HUS B;  2HFE D;  3L36 A;  3SWY A;  3RK3 E;  1QEX A;  3V2P A;  2KSE A;  5AVU B;  1JMM A;  5CCH D;  1DX7 A;  1NAY A;  2WSS H;  4HKZ H;  1A02 F;  2B87 B;  3HD7 A;  2PRR A;  3WU2 H;  5KKZ C;  4HB1 A;  2IYP A;  1YI2 P;  2K88 A;  2L91 A;  1NTK E;  3WUU A;  1G2C A;  1GW4 A;  1EDK A;  1UII A;  4WY4 C;  1NTZ G;  2M8R A;  3Q5R A;  2NRG A;  2Y0C A;  1SQX K;  1IFD A;  1GD2 E;  1R8E A;  2XV5 A;  4I7Z C;  2NPS C;  2MJZ A;  2FY8 A;  2O01 H;  1HJB A;  2Z5H A;  2XNX A;  4NPF X;  2Q5U A;  2J58 A;  1AFO A;  1ZRT D;  3AE1 C;  2LXC B;  1NTM E;  2N9Y B;  1NU1 G;  3CXH D;  4H13 B;  2H8P D;  1LTS C;  4PD4 I;  3P8C E;  1FAV A;  1YQ3 C;  2N1T A;  5M1B A;  3OA7 A;  1LTT C;  3L71 J;  3L73 G;  5B66 E;  1J1E B;  2QRX A;  1BE3 J;  1JM0 A;  4ZMD A;  2XZR A;  2QIW A;  1URQ A;  1JTH A;  1YIT P;  1EZV I;  4DT0 A;  3CWB E;  2N1T D;  1SQP J;  2PFX A;  1PV3 A;  2OGU A;  2O1J A;  1KB9 D;  2A06 D;  3IFM A;  3WUV A;  1NTZ E;  1OVU A;  1URQ D;  5B5E H;  2R44 A;  2WSC J;  1U57 A;  3Q3D A;  1FZC B;  2H7H A;  1OFC X;  2QJP B;  1VQ7 P;  1M1J C;  2Q7C A;  3T97 B;  3BRT B;  1FJP A;  3H1I G;  3CCS P;  4NPD A;  3CXH H;  1NOH A;  2AXT E;  2FYU J;  2E76 D;  1Z56 A;  1OZH A;  3IF4 A;  1BGY J;  3CCJ P;  3HE5 A;  5AW9 B;  1NGM B;  1X22 A;  2K37 A;  3L73 E;  3TF5 A;  3MD0 A;  1NYH A;  4UB6 H;  3CCE P;  3L74 J;  1CZQ A;  3WUT A;  1QVG O;  1N73 C;  4PV1 C;  1R5S A;  3CME P;  5BVZ A;  3H1J G;  1S2E A;  2FYU G;  3CX5 D;  2H43 A;  3HTK A;  3H1K D;  2IFN A;  1BGY G;  4H0L D;  3L4F A;  3EQ2 A;  1KIL D;  1JNM A;  2WSF H;  3N4X A;  5AW0 B;  3L71 D;  1EQ7 A;  1GL2 A;  3O8Z A;  3L70 E;  1RHZ B;  3M9Q A;  4GIF A;  2Y9Y A;  1BE3 D;  1KN7 A;  1KTM A;  5KKZ B;  1KFN A;  3RGU A;  1K9M Q;  3S1K A;  3P7K A;  3C1L A;  5AW4 B;  1S4X A;  1M8O B;  1Y8A A;  5AW6 B;  1SQP D;  1KV4 A;  5KAI H;  1JUN A;  1RF1 C;  1DEE G;  3H1I E;  4WY4 B;  2I1K A;  2JR8 A;  2YNY A;  1ZME C;  1SS1 A;  2I8D A;  1VQ4 P;  3L75 J;  4OGQ D;  4I7Z B;  1NTK K;  3VYI A;  1L4A D;  3CMA P;  1FZF A;  2HG5 D;  2M5A A;  3EFG A;  5APY A;  1PIX A;  1SQX J;  3OJA B;  3AE2 C;  2NPS A;  2FYU D;  3CX5 H;  3CC7 P;  4N78 D;  1KYO D;  3JSV C;  4EOT A;  4R4L A;  1SQV J;  1RF0 C;  1VF5 C;  3AE9 C;  1SQB K;  1T2K C;  1BDC A;  5TIS E;  2OQQ A;  3L74 D;  4LC1 A;  1S5L E;  2ZT9 C;  3EFF K;  5AVS B;  5AW7 B;  1EDI A;  3PP5 A;  3U1A A;  3TGU G;  4U3F D;  2WVR A;  3RK3 C;  1IK9 A;  1QLE D;  2OAR A;  1L0L K;  1T3J A;  1HTL C;  2WSC H;  1ZOY C;  1N86 A;  1SQQ E;  3KZI E;  1JY3 N;  2Q1K A;  3A0B E;  3HUS C;  1NTZ K;  1BDD A;  2XDJ A;  1FU1 A;  1KYO H;  1MKM A;  1VQ6 P;  3L75 D;  1M1J A;  4BRY B;  1QL2 A;  2C9N Y;  3GHG B;  1KQF B;  1CSB A;  4PJ0 E;  3C8V A;  3FWL A;  1X79 B;  1G1I A;  4RO0 A;  1IFP A;  2E75 B;  3H1L J;  3PH0 A;  1SQX D;  2JWD A;  4JBZ A;  1N73 B;  1KMI Z;  2AEJ A;  4PV1 B;  2FXP A;  4KHX A;  3AEG C;  3TGU E;  2KUB A;  2OYO A;  2IX7 C;  2O01 J;  1USD A;  1SQV D;  3KXD A;  4C7N B;  3VP8 A;  2LR2 A;  5APX A;  1JOC A;  1BCC D;  1X0T A;  1H8A A;  5APS A;  2KB7 P;  2JP3 A;  3G3Z A;  2LKM A;  5GTH E;  1ZR4 A;  4H13 C;  2AXC A;  2KNC B;  3FX0 A;  2RN0 A;  3UIA A;  1RE3 A;  1YQ4 C;  3PJS K;  2IZ1 A;  1RF1 B;  4OH8 B;  1S3J A;  2FYN C;  1J1E C;  1J1D C;  3SWF A;  2JEE A;  4DOJ A;  4PD4 D;  2OYH A;  1L0N J;  1S1C X;  2JJL A;  2E5T A;  3VOP A;  3A0H E;  1ZR2 A;  1M1K Q;  3AE4 C;  3TNU A;  3FWN A;  2FFD B;  2D2C D;  2WWW A;  3VN0 A;  2BAS A;  5BU8 B;  2W83 C;  2FBW C;  2YO2 A;  3ABV C;  1EC5 A;  1EZV D;  2WIT A;  3B5N A;  2SPZ A;  3USS A;  2ZYG A;  2P58 A;  1LTJ A;  2B9B A;  2WPQ A;  2Q6Q A;  1PPJ D;  3RK2 C;  1XTG B;  2O3J A;  5E79 E;  3L35 A;  1FZC C;  1VF5 B;  2QJP C;  4BWN A;  2QM8 A;  1IJD B;  2KP8 A;  1FJK A;  2YKP A;  1G1J A;  1ZV8 A;  3H1L D;  3B5N D;  1N7S C;  1S72 P;  3P8M C;  1HGZ A;  3GW6 A;  1WRG A;  4R4M A;  3L72 J;  1SQB J;  2POH A;  3K5B A;  1UIX A;  2V4H A;  3CC2 P;  1VDF A;  1GZL A;  4PD4 H;  3VP9 A;  3TYY A;  2XU6 A;  3V2Q A;  2HPC A;  3AE7 C;  5KAF H;  2ZYD A;  4JQ0 D;  1U7M A;  2Q3I A;  3BCC J;  1GW3 A;  3M9H A;  5AW1 B;  4U7J A;  2ZJS E;  1NKN A;  5CCG D;  2OYI C;  1FE6 A;  3CC4 P;  1LP1 A;  1L0L J;  2WSF J;  3O6Q B;  2ZFC A;  1YJN P;  2E74 D;  3CWB J;  1IFJ A;  2QA4 P;  1L0N D;  1BSN A;  3PLN A;  1SQQ K;  3AEE C;  1RQV A;  3HUS A;  2QVA A;  3BCC G;  4IL6 H;  2BCC J;  3KDP B;  4H44 D;  3E7K A;  1PGO A;  1SFC C;  1LNQ A;  4YXW H;  2KLU A;  2L5G B;  2B87 A;  1M7L A;  1LGH B;  3HD7 D;  3M0A A;  1H0T B;  1NTK D;  5AW3 B;  3LW5 H;  2A06 G;  1AA0 A;  1L2P A;  1RE4 C;  3GG2 A;  1FDO A;  3A7O A;  2IZ0 A;  1CW5 A;  3QH9 A;  5B5E E;  1M57 D;  2FXO A;  1OVV A;  4C7R A;  4XE5 B;  4KT0 J;  1USE A;  3M0D A;  1T8Z A;  2WQY C;  1LTI C;  2YKQ A;  1ZRT E;  2LXB A;  1FDI A;  1JY2 N;  3HE4 B;  3H1K J;  3OW2 O;  3L72 D;  1SQB D;  1P84 I;  3HRN A;  5AVZ B;  3S9O A;  1MUU A;  1HF9 A;  3G71 P;  3IAO A;  1HUC A;  2FYN B;  3A2A A;  1J1D B;  1Q86 Q;  2BEQ D;  1KD1 Q;  2PAJ A;  1JCC A;  1PGQ A;  2G8Y A;  3H32 B;  3I5C A;  3BCC D;  2IBZ D;  1URQ B;  3MIW A;  4GT1 A;  1S9K D;  1NKZ B;  1SP4 A;  3KYQ A;  2KLV A;  3RL0 C;  1HWT C;  1AQT A;  1SLQ A;  1H89 A;  3H1K G;  3H1H J;  4W7Z A;  4C46 A;  1LWU A;  2H89 C;  1L0L D;  1HGV A;  3L37 A;  3CCU P;  4D6T J;  3L71 G;  3CWB D;  1KB9 E;  1FZA A;  5APU A;  2A06 E;  2E76 B;  1BE3 G;  3RK2 B;  2VRS A;  3Q1M A;  1TU3 F;  1AJY A;  3CCR P;  2BCC D;  5APW A;  5AVV B;  1SQP G;  1KQL A;  1N7S B;  3JCU E;  5KAI E;  1NU1 E;  2YXR B;  3GF3 A;  5GTI E;  3VTP C;  4D6T G;  3T97 A;  1JY3 O;  3GHG C;  1T6A A;  2P2U A;  4H0L B;  3CD6 P;  5KLV K;  1KIL B;  2JDI H;  3F89 A;  2E75 C;  3CI9 A;  3R4Y A;  3II6 A;  2C0W A;  2CPB A;  5B66 H;  3BRV B;  2WT7 B;  2AEF A;  4WWI A;  3LIE A;  2K9J B;  5KJ7 C;  2QM7 A;  2OYI B;  3EWK A;  1OIP A;  2UWJ E;  1LTB C;  4U3F J;  5CBN A;  4ASW A;  2P7J A;  1KIL E;  3L71 E;  1YTZ T;  1FS0 E;  2WPS A;  5K5G B;  3CCQ P;  3M06 A;  2A45 G;  5CHX A;  1BE3 E;  3L74 G;  4YXD C;  4OGQ B;  1LT9 C;  3L70 D;  4HJG H;  1RH5 B;  1PZQ A;  2HOD B;  1SFC B;  1GL2 D;  1L4A B;  2WZ7 A;  3H1H D;  5H2F E;  1SQP E;  4U3F G;  2Y0E A;  4I2L C;  3D6Y A;  4EIJ A;  1J2J B;  4ZNC A;  4D6T D;  2KS1 B;  3AEF C;  1PGP A;  2B89 A;  2AXT H;  5AVR B;  4IFF A;  2WSE J;  4WY4 A;  2G3A A;  2FFD C;  1JEK A;  3AE5 C;  1RE4 A;  3VMX A;  4TLF A;  3NFQ A;  2QJK C;  3NMD A;  1VQP P;  2YO3 A;  3H1J E;  2FYU E;  1Q90 D;  1NHL A;  1PGJ A;  2R5B A;  1EXI A;  3L75 G;  4N78 E;  1BGY E;  1RQU A;  1QGK B;  1BCC J;  1OW8 A;  2NPS D;  1NTM K;  2R3C A;  1SQX G;  1KQG B;  2C0X A;  5AW2 B;  1Y9B A;  3RL0 B;  3CCL P;  2AEM A;  3CCV P;  1QX8 A;  3IR9 A;  1PFI A;  2N9B A;  1WT6 A;  3VMY A;  3PTZ A;  1SQV G;  4OWF A;  1YHQ P;  1LTG C;  1KB9 I;  3NXS A;  1GK4 A;  3SWK A;  1AQ5 A;  4I1L A;  1MZ9 A;  5CCH C;  1BCC G;  1R5L A;  3AE8 C;  4L74 A;  5AVY B;  4WVZ A;  1VQO P;  2XND H;  2CPS A;  1AVO A;  1HBW A;  3V2R A;  3W68 A;  3RL0 g;  1X8Y A;  4H44 C;  2CK3 H;  4KJM A;  1SQQ D;  5BU5 A;  4AQR D;  1NWQ A;  3PRJ A;  1DD3 A;  3HD7 C;  2WTY A;  4W7Y A;  1KOR A;  3SSU A;  3L75 E;  2KZI A;  3V4W A;  1NH4 A;  2WMM A;  3D6Z A;  2KZJ A;  1YJW P;  3N7N A;  5AW5 B;  3IN6 A;  1GK6 A;  2YMY A;  3G9R A;  1NU1 K;  1VQ5 P;  1JY3 P;  1Q2N A;  4BRY A;  1SQX E;  3GHG A;  3TDK A;  2R3S A;  1EZV G;  4GOE A;  2YXQ B;  3LW5 J;  1JMB A;  5TIS H;  4HH2 A;  1PP9 J;  2E5Y A;  5KLV J;  2QJY B;  1S5L H;  1LT1 A;  2IFM A;  1LTA C;  3SFE C;  1YYC A;  1ZN5 A;  1GMJ A;  1PPJ G;  3CCM P;  1N73 A;  1SQV E;  1KFM A;  5KJ7 A;  1X9V A;  4DZO A;  1VQL P;  3H1L G;  5AVX B;  1LT9 B;  4O9B A;  1FZB A;  1NO4 A;  4WB4 A;  3RBZ A;  4C7N A;  5AVW B;  1IZN B;  2WPV B;  2IDB A;  3MUD C;  2N1T C;  3ZDM A;  4PV1 D;  3Q2Y A;  4HYT B;  4B86 A;  2W6J H;  3A0B H;  4YTP C;  2OYH B;  1P84 D;  1CI6 B;  2KNC A;  5AVT B;  3WMM 0;  1Q82 Q;  1JY2 O;  3V5B A;  4PD4 E;  1URQ C;  1KQS O;  1NVO A;  1RF1 A;  3Q5S A;  2WSE H;  2KOG A;  1IC2 A;  3TK1 A;  4GOF A;  3MZW B;  5KLI B;  1SQP K;  5APQ A;  3B71 A;  4PJ0 H;  1A02 J;  4AYC A;  1OXZ A;  2QJK B;  1N7L A;  1NTK J;  1W2B O;  1EZV E;  1LTJ B;  2E76 C;  2XKM A;  1L0N G;  2MKV A;  2M0B A;  3WU2 E;  3D70 A;  3GF7 A;  4N3Y B;  4DCK A;  1WMK A;  2KSJ A;  5C39 A;  3H1L E;  1GDT A;  2FYU K;  5KTB A;  3AED C;  1NTK G;  1RF0 A;  1PP9 D;  5KLV D;  2RH0 A;  1M56 D;  1EDJ A;  4N6J A;  1FDM A;  1NTM J;  2BEZ F;  2HYN A;  5CJ4 A;  5GTH H;  1M90 Q;  5DJT B;  1JO5 A;  1VQN P;  4H0L C;  3VMZ A;  1KIL C;  1P84 H;  2W8Z A;  2E74 B;  3MTU E;  1VF5 D;  3GLM A;  1T2K D;  4JYB A;  4RKU J;  2YIU C;  2ZT9 D;  2R32 A;  1W2E A;  3L72 G;  4L76 A;  1SQB G;  4H44 B;  2RKL A;  4ZKU A;  1DEB A;  1ZW0 A;  2E43 A;  4Z1M H;  1GL2 C;  2B88 A;  3V2N A;  2OTJ P;  2ZVN B;  3OAK A;  4LLH A;  3Q5P A;  3HD7 B;  3V6I A;  2OTL P;  1L0N E;  3PHL A;  3RK3 D;  1NTZ J;  4OGQ C;  3M9B A;  2IBZ G;  2Y9Z A;  2V7Q J;  1OVR A;  1GU4 A;  3O6Q A;  1G2C B;  3MGN A;  1Q81 Q;  4WBA A;  1L4A C;  5E79 H;  1L0L G;  1HH0 A;  4IL6 X;  3GMA A;  3CWB G;  2KK7 A;  1N2D C;  1DD4 A;  2FYZ A;  1YJ9 P;  3C9I A;  2QSI A;  1NU1 J;  3SFD C;  1MFT A;  3FGA D;  1H0T A;  2BCC G;  2R5D A;  1RY3 A;  1K05 A;  3L73 J;  4UB8 H;  3AEA C;  4TT3 H;  2NZ2 A;  3BAS A;  3CXH E;  1KC8 Q;  2GUS A;  2Z5I A;  1H88 A;  5CJ0 A;  3E1R A;  2N1T B;  1NTM D;  3L72 E;  1SQB E;  1SQV K;  4GOD A;  3CL3 D;  2JO1 A;  1QL1 A;  1XTC C;  2QG4 A;  3P8C D;  3HE4 A;  1ZP0 C;  3B4S A;  3KHU A;  4Y99 C;  1E5W A;  4UB6 E;  1JTH B;  4DJG A;  3MUD A;  3L70 J;  3BCC E;  2JWA A;  2IBZ E;  1S9K E;  1LWU B;  2C9L Y;  1IFM A;  4H13 D;  1JY2 P;  3TSI A;  1DIP A;  1N8R Q;  3H32 A;  1L0L E;  2M3E A;  4RJT A;  1OX3 A;  3H1I J;  3H25 A;  1VL2 A;  3U1C A;  1NTZ D;  4M3L A;  3L70 G;  3U59 A;  4IFD K;  2Q9I A;  1JCD A;  2BCC E;  3H1H G;  1IFI A;  1K04 A;  1FC2 C;  3VMA A;  1FZC A;  3HE5 B;  3RBX A;  4ZKP A;  4I6M C;  1NJI Q;  3P32 A;  5TJH A;  1NU1 D;  3H1J J;  1N7S A;  3KQG A;  4LGD E;  2E42 A;  3RK2 D;  4EI2 A;  2IPP A;  3L73 D;  2KYV A;  2IYO A;  1VPC A;  3HTK B;  2YIU B;  2QJY C;  1KIL A;  3CX5 E;  2KIK A;  3H1K E;  1MFZ A;  1N7S D;  3NTN A;  4QMA A;  1SVF A;  5L8R J;  1GL2 B;  2WT7 A;  2K9J A;  1Q7Y Q;  2O01 N;  2OYI A;  4BXL A;  5CMZ A;  1OWA A;  1GU5 A;  2K9Y A;  2V7Q H;  3W67 A;  1KB9 H;  5CBO A;  1RE3 C;  3S4R A;  4AUW A;  1SQQ J;  2D2C C;  3H1H E;  2KXP B;  2PP6 A;  1GTW A;  1VQ9 P;  2OYH C;  2FXM A;  1L0N K;  4IOI H;  4MN4 C;  4D6T E;  1QVF O;  2ITA A;  3H1I D;  2HOD A;  3JCU H;  1SFC A;  1L4A A;  1FZG A;  1NAF A;  1OW7 A;  5GTI H;  2M5A B;  5KLI C;  3A5T A;  2KS1 A;  2O1K A;  2NPS B;  2M3B A;  2Z4E A;  3B5N C;  1SQQ G;  1SFC D;  3CXH I;  1LTJ C;  2J5U A;  4WY4 D;  2ZXX A;  1FBM A;  2JKV A;  1KYO E;  3AE6 C;  4L73 A;  1HVV A;  2ZXE B;  3B8E B;  1MV8 A;  3H1J D;  2PGD A;  3TGU J;  1BGY D;  4Y99 B;  1W5C E;  3L74 E;  2IBZ I;  2OTK E;  1YBK A;  1EXJ A;  4NPE A;  5CCG C;  4U3F E;  2QE7 H;  2I1J A;  3D71 A;  5H2F H;  1FOS F;  2E74 C;  1E79 H;  4A7P A;  1FOS E;  2ZYA A;  4EYY Q;  3KPE A;  4W80 A;  2FKW B;  4CPG A;  5APT A;  4GDO A;  1T3U A;  3RL0 D;  4EDF A;  3G6E P;  1EDL A;  1M1J B;  4OVN F;  1PL5 A;  4XA4 A;  3R2P A;  2Y0D A;  1OMI A;  1DH3 A;  2GUV A;  1BSH A;  2K1A A;  4Y28 J;  3V4Q A;  1YTZ I;  4K3A A;  1ZXG A;  2A45 H;  3CX5 I;  1VQ8 P;  2W90 A;  1OW6 A;  1KZU B;  1VQK P;  5AVQ B;  3H6P A;  2KI7 B;  3TGU D;  1S5L X;  2Q3E A;  3M0D C;  1BCC E;  4L75 A;  2GM4 A;  2E75 D;  1ZLL A;  4RES B;  3MP7 B;  1PP9 G;  5KLV G;  3JC2 2;  1IO4 A;  5KJ7 D;  2D2C B;  5DJU B;  1JB0 J;  2DW3 A;  3KZI H;  1LT9 A;  3AE3 C;  4JYC A;  2GA1 A;  3E1I A;  1HJ0 A;  3A3Y B;  1IFN A;  2J59 M;  1P84 E; 
#chains in the Genus database with same CATH homology
 2DW3 A;  2ITA A;  2NRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...