2ITAA

Solution structure of pufx from rhodobacter sphaeroides
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
70
structure length
70
Chain Sequence
MADKTIFNDHLNTNPKTNLRLWVAFQMMKGAGWAGGVFFGTLLLIGFFRVVGRMLPIQENQAPAPNITGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis,membrane protein
molecule keywords Intrinsic membrane protein pufX
publication title The solution structure of the PufX polypeptide from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 13
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2006-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11511 RhodobacterPufX Intrinsic membrane protein PufX
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.920 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces rhodobacter sphaeroides pufx membrane protein 2itaA01
2NRGA 2DW3A 2ITAA
chains in the Genus database with same CATH superfamily
1QL1A 2H88C 4K35A 4JF7A 2H8PD 4QMAA 3MP7B 2H89C 4PJ0E 4GDOA 2ZYGA 1J1EB 4TT3H 5CBNA 1LT9C 4ASVA 3I56P 2H43A 2A06D 1IK7A 2AXCA 1OZHA 3LIDA 3HTKA 1URQA 3BASA 3L70D 1QVFO 2HPCA 3S4RA 1L4AB 1KD1Q 1Q86Q 1N7SD 5APUA 4CPGA 4O9BA 3OA7A 4PD4I 3H1JD 2XDJA 2O1KA 3L73E 3H1LJ 2AEJA 4LC1A 2IBZE 3GHGC 4JPZB 1IJDB 2WSCH 1VF5D 2BEQD 2QEXP 3AEDC 3P7KA 1JOCA 4H44B 2O01N 2OTKE 1FBMA 1M8OB 1KN7A 2QSIA 1U7JA 4JYCA 1KILC 5AVQB 1FE6A 2PP6A 3GLMA 2W83C 2M5AA 2QJPC 1SLQA 2A06E 2O1JA 3AE4C 5GTIH 1GD2E 1FZFA 3VTPC 5AVYB 3L70E 2AEMA 1NAFA 1YTZI 2HODB 1N7SB 3V2QA 3E7KA 2K37A 1OX3A 1NU1G 3R4YA 1P84I 3H1HD 3H1LD 1QGKB 2YKPA 1VF5B 1L0NK 4EYYQ 2O01J 1L2PA 2LKMA 4D6TJ 3A0HH 1QL2A 4PJ0H 2E75B 1L0ND 1IFPA 1KB9D 1N7LA 3HTKB 3O6QB 3TSIA 1URQB 2IBZI 3IFMA 3OJAB 1BGYJ 5AVXB 3U1CA 1NO4A 1FZBA 3CWBG 1FZCB 3RK2D 2LXBA 4JQ0D 1GMJA 2I1KA 4WY4D 1JB0J 2QM7A 2FFDB 3NMDA 1NTKJ 3IF4A 1HWTC 3H1HE 1LT1A 2WT7A 4L73A 3L71E 4OH8B 2C0WA 2KYVA 2FXPA 2N9YB 1CSBA 2QJYB 1YJWP 1N2DC 1A02J 2ZAEB 1JY2N 1RQUA 1HVVA 1L0NE 3AE3C 3VP9A 3ZDMA 1KB9E 3JSVC 1G1JA 3EQ2A 1Q7YQ 3B4SA 2KI7B 1NVOA 3WUTA 3H1KG 4IL6X 3RK3C 2QJKC 2Y9ZA 5KJ7C 3RK2B 1DD4A 3RL0B 4WY4B 2I1JA 2WPVB 4IL6E 1GDTA 1ZMEC 1M57D 3HE4B 1SQXJ 1PGJA 3AECC 5KAFE 1KZUB 4I7ZB 3T97A 4KHXA 3FX0A 2ZYDA 1L0LG 3D6ZA 1J1DB 5AW8B 1KQLA 2KS1B 2BCCD 2WSSH 1XTGB 2KSJA 2NZ2A 3KQGA 1NU1K 3RL0g 3C8VA 3KDPB 2C9NY 2M0BA 4R4LA 4DZOA 2FYUJ 1QVGO 1NHLA 1KMIZ 1ZR2A 1R8EA 4H13C 2I8DA 2G8YA 2KIKA 1JNMA 4GT1A 2IYPA 3D6YA 3CCJP 3NTNA 2HYNA 3P8CD 2CPBA 2E76D 2ZYAA 3KZIE 2YO2A 2WSCJ 3E1RA 2WMMA 3L74G 3W67A 3G3ZA 2JR8A 1VQ8P 1KB9H 2BCCE 5KAIE 3AE8C 3GW6A 3FWLA 1USEA 3HRNA 1HGVA 3MZWB 5DJTB 2KK7A 3IAOA 4EIJA 1SQPG 2RMZA 1PP9J 3CWBD 1NTMJ 2GM4A 1ZLLA 3OAKA 1S4XA 4IL6H 3JC22 3SWFA 4DOJA 5CCHD 1NU1E 2JWAA 1YTZT 3A0BE 1BDDA 5B5EE 1BCCJ 1OMIA 1YYCA 4AYCA 2E76B 2WSEH 1NKZB 5KAFH 3T97B 4GODA 1YHQP 1VPCA 3P8CE 5APQA 4OWFA 1RF0C 3MTUE 2QRXA 2KB7P 1R5LA 2RH0A 2ZT9C 1EXIA 1FS0E 2IFNA 4B86A 1PGOA 1BDCA 1SQBK 3CC4P 1ZV8A 3L75G 1R5SA 2A45I 5APSA 5APWA 3CCMP 4W80A 1NTMD 1J1EC 1CI6A 5KLIB 1H0TB 2P7JA 3CWBE 3WUVA 1Q82Q 1LTGC 1ZP0C 1L0LK 5E79E 1BCCD 1NOHA 1AQTA 2KOGA 1BSNA 2A45H 2E5TA 1BE3G 1L4AC 2AEFA 3L73J 1FOSE 1RE4C 3HE5A 4BRYB 1AFOA 1OVUA 2IYOA 1EZVG 3KZIH 3MGNA 3CCSP 2ZVOB 3MUDA 3CL3D 1RY3A 5CCGA 1JY3P 1X8YA 5KAIH 4H44C 3V2PA 3M9BA 3AEEC 1GL2D 2KNCA 3D71A 1LP1A 1JTHA 3GF7A 4C46A 2ZXXA 1LNQA 1LTJA 5AVWB 2FYNB 2P10A 3H1IG 2HODA 1N7SA 4HH2A 4Y28J 3MD0A 2WWWA 1JUNA 3A0BH 5B5EH 2Q1KA 1N7SC 5AVRB 1USDA 3I5CA 1WRGA 1QEXA 5K5GB 5AVUB 2XNXA 4OGQD 4A7PA 4Y99B 5CJ0A 2C9LY 3P8MC 2Q7CA 2FXMA 1VF5C 1AVOA 1PIXA 4Z1MH 1SQPK 3HUSB 3BCCG 2OTLP 1JM0A 5CCGD 1GL2B 1X9VA 1RH5B 1S5LX 1LWUB 2PGDA 4NPFX 1N86A 3AE1C 2E75C 1CI6B 3O6QA 2NPSD 3SWKA 1SQPD 3USSA 1OW7A 3VN0A 1URQC 2PRRA 1KQGB 4TLFA 5AVSB 3MHVA 1VQ9P 2ZFCA 5KLVG 4OVNF 1FZCA 3L72G 2W6JH 3AE7C 3CC2P 5E79H 3M91A 2PFXA 1BGYG 2FFDA 3SSUA 1MFTA 2YIUB 3BATA 1LJ2A 2WPSA 3TYYA 3H1HJ 4OGQB 3HE5B 2FFDC 5DJUB 3U59A 4I1LA 3L71J 3TK1A 3FGAD 2UWJE 1J2JB 2FKWB 3EFFK 1NTKG 4I6MC 4AUWA 2DW3A 3L74E 1EC5A 3L75D 2QJYC 1AVYA 2KNCB 3L35A 1L0NJ 1LP1B 1JTHB 1OVRA 3GG2A 2NPSB 1EQ7A 1SFCD 2OTJP 2K9YA 1LTJB 2W6BA 2KLVA 2HR3A 1SQPE 1GW4A 1Z56A 2CPSA 2QG4A 1AA0A 3TGUD 4WY4A 3CMAP 2P2UA 2H7HA 2CK3H 3RK2C 1GK4A 2K9JB 2K1AA 3RL0C 1KTMA 1YQ3C 4WY4C 3NXSA 1FDIA 1IK9A 5BVZA 1BE3D 3UIAA 3HE4A 3L71D 2R44A 1RQVA 2JO1A 3E1IA 1EZVD 2WSEJ 3OW2O 2IZ0A 3KHUA 1ZW0A 2E43A 2WITA 1S1CX 1RE3A 1SQQG 4I7ZC 3EFGA 5AW7B 3Q2YA 3CD6P 1RE3C 3L75E 2Y0DA 3F89A 3CCQP 2KS1A 2XKMA 1GTWA 1QX8A 2KSEA 1SFCB 4LLHA 1J1DC 4R4MA 1LTSC 2LXCB 1SP4A 1KILD 4KJMA 2LR2A 2JWDA 2N9BA 3C9IA 4K3AA 3S9OA 2E74D 3H1ID 1X0TA 3A7OA 1K05A 3TGUE 1GU4A 1H8AA 1T3UA 1Q81Q 2Q3EA 4GKGA 4YPCA 1YIJP 1NAYA 3GF3A 1BE3E 1ZXGA 1UIIA 1Q90D 1NTZG 2J58A 4IOIH 1EZVE 2YNYA 3H32B 4NPEA 1FC2C 3CPWO 1VL2A 1A02F 3BCCD 2W90A 5AW5B 2MJZA 1EDIA 5KLVK 4IFFA 1H88A 2BCCJ 3M0AA 2E74B 1KILE 2K3RA 1DEEG 2B87B 2B89A 1Y47A 2B9BA 4HKZH 3V2RA 1SQBG 3H1IE 1LTTC 2WPQA 3AE9C 2KZIA 3L72D 3QWOC 1NTKK 1PPJG 1NU1J 5AW0B 4L75A 2W27A 4EI2A 5M1BA 1AJYA 1NJIQ 5TJHA 1G2CB 3KYQA 5APXA 1PGPA 2E76C 3CI9A 3V6IA 1Y8AA 3BCCE 3FXEA 3VMXA 4WWIA 1Y9BA 5GTHE 3AEAC 1IC2A 4EOTA 4ZKUA 1EZVI 5BU5A 1H0TA 4H0LD 3CWBJ 2JDIH 1NU1D 1VDFA 1RF1A 5CCHA 5KLIC 3L72E 3Q5SA 1FZGA 2W6AA 1KB9I 4HJGH 5KJ7D 1SS1A 4PV1D 4U3FG 5CCHC 5CBOA 1G1IA 1SQQK 1T2KD 2FBWC 2D2CD 4N78D 3WU2E 3TNUB 4BRYA 1FOSF 1YJNP 2W8ZA 1SQQD 1NYHA 3MIWA 3I55P 3L73G 2WZ7A 5AW6B 1JY2O 2IBZG 1JY3O 1JMMA 1M90Q 2AXTE 2JKVA 2OYHB 3KPEA 4AQRD 1N8RQ 3LW5H 4M3LA 1M56D 2YMYA 1VQ7P 4N6JA 5H2FE 2Y9YA 4H0LB 4YXDC 1FU1A 2KZJA 3AE6C 1N73B 1SQVG 4ZMDA 1NTZK 4PV1B 1KQSO 1GZLA 3TDKA 1JO5A 3PRJA 4DJGA 1SVFA 2FYNC 5AVZB 3BRTB 3BVHA 1YBKA 2D2CB 3L70G 1UIXA 3Q5RA 1NTZD 3NFQA 3AEGC 4N78E 3TF5A 2XU6A 3GMAA 3AE5C 3BRVB 3H1JG 1SQQE 2XNDH 4Y99C 2R5DA 2YXQB 3HUSA 5KKZB 1GL2A 2KP8A 2Q5UA 2V7QH 5GTHH 3AE2C 3HUSC 3H1KD 1LWUA 1GL2C 1T3JA 1OW6A 3CX5E 1SQBD 1LWUC 4YXWH 1IFDA 1RF1B 4PD4D 2POHA 3PP5A 3L36A 1MZ9A 2WVRA 1NKNA 1T6AA 3WUUA 4YTPC 3WU2H 2YIUC 3CCEP 1WT6A 1NTZE 1HF9A 1L0LD 1M1JA 1HGZA 4OGQC 3VP8A 1VQNP 3H1HG 4W7ZA 3H1LG 1JY2P 2WQYC 2Z5HA 3MUDC 1PFIA 3L74J 5BU8B 2JJLA 2AXTH 5CCGC 3PTZA 3HD7D 3B5ND 2R32A 2YO3A 3H1KE 2P67A 2NPSA 5H2FH 1E5WA 1VQKP 2QE7H 4RJTA 1P84D 2MKVA 4ASWA 1EXJA 2NPSC 3VMZA 1SQPJ 1SQBE 1LGHB 2Q9IA 2OYOA 1LTJC 1MKMA 4PD4E 1PPJE 2QA4P 4U3FD 5AW2B 1DEBA 2K9JA 2R3CA 1VQ6P 5APYA 3M06A 2L91A 1L0LE 1L4AD 2N1TD 3CLQA 4UB6E 4GOEA 3L74D 3PJSK 1SQVK 5AW1B 3B8EB 2HG5D 3HD7B 3B5NB 3L75J 4D6TG 1SFCA 1D7MA 1S5LE 3LIEA 3A0HE 2HLOA 4H44D 3CX5H 1LT9A 3PHLA 1SFCC 1VQPP 2OYIB 1SQVD 1P84E 3L4FA 2KXPB 4GOFA 4RO0A 2VRSA 1PZQA 2WTYA 3TGUJ 3IR9A 4HB1A 3F5HA 2WSFH 1FZCC 4U3FE 2K88A 2IPPA 4RKUJ 1BE3J 5TISE 1M1JB 3N4XA 4W7YA 1GU5A 3VYIA 3L37A 2N1TB 2A45G 3H32A 3GHGA 3A2AA 2RN0A 1S72P 3R2PA 2ZVNB 3G4SP 1VQOP 3A5TA 1TU3F 3PLNA 1KILA 2G3AA 3RBZA 5APTA 4UB8E 3LW5J 1K9MQ 1MUUA 2B87A 3G6EP 2BCCG 1SQVE 2J5UA 1W2BO 2E75D 3K5BA 2BEZF 4PD4H 1W5CE 1CZQA 3H1IJ 2E74C 3CMEP 1URQD 1JMBA 1M1KQ 2IFMA 1S3JA 1IO4A 3AEBC 1KYOD 3W68A 1G2CA 4WB4A 1SQXG 2P58A 1MV8A 4GIFA 4UB6H 5AW4B 1IFIA 3H1JE 1LTBC 1PGQA 2E5YA 1OWAA 1K8AQ 3BCCJ 1HUCA 1VQ5P 1IFMA 3G9RA 2E42A 2ZJSE 2QVAA 1E79H 2V7QJ 5AVVB 3RBXA 1LT9B 1S5LH 4ZKPA 4EDFA 2OQQA 5APVA 2IDBA 4WBAA 2YMKA 1P84H 1KQFB 1GW3A 1FAVA 1H89A 2NRGA 3VMYA 1QLED 5KLVJ 1KFNA 3ITKA 3L72J 2HPCB 2FY8A 2FYUG 1GK6A 5TISH 2FYZA 1VQLP 3Q1MA 3RL0D 5AW3B 1HTLC 1DX7A 2YKOA 1KYOE 4XA4A 3II6A 3TNUA 3GHGB 1M7LA 1ZRTD 2BASA 4BXLA 1K04A 1JEKA 3H1LE 4XFJA 1U57A 3S1KA 1S2EA 2M3BA 4D6TD 1KILB 3SFEC 3KXDA 3WMM0 4JYBA 4UB8H 1X79B 2OYHA 2QJPB 1JY3N 1X22A 4IFMA 2Y0EA 1FDMA 2FXOA 2M5AB 1HH0A 2OYHC 2Q3IA 5EFWB 5KLVD 1N73A 4H0LC 1BGYD 4MN4C 5KJ7A 1N73C 1PP9G 1NTMG 3JCUE 1U7MA 3G71P 4PV1C 1T2KC 1XTCC 2M3EA 1NTKD 4LGDE 2P1JA 3CCRP 3H6PA 4I2LC 2D2CC 5AW9B 1NGMB 1YITP 1BCCG 5B66E 2V4HA 1OVVA 4DT0A 1ZRTE 2O3JA 1SQQJ 1OFCX 1AV1A 1Q2NA 2WPRA 1KFMA 2R3SA 4D6TE 3IN6A 3M9QA 1MFZA 4DCKA 5KKZC 1KYOI 1K73Q 4N3YB 1FDOA 3ABVC 5KTBA 1PL5A 5KLVE 3RK3D 1SQXK 1BGYE 1RF1C 3C1LA 4WVZA 1YI2P 4XE5B 2WSFJ 2SPZA 2GUVA 2QM8A 1FZEA 1KYOH 1SQXD 2YXRB 1NTKE 1NTZJ 2L5GB 3PH0A 2WT7B 4IFDK 1WMKA 2ITAA 1HJBA 1DH3A 3CXHD 2RKLA 1KV4A 3CCVP 1KC8Q 1LTAC 5C39A 3H1KJ 3CX5D 2FYUK 3V2NA 1W2EA 5CJ4A 2PAJA 2JP3A 3RK3B 2QJKB 1SQBJ 2A06G 1T8ZA 1ZOYC 2J59M 3RK3E 2Z4EA 4U7JA 2GUSA 1PV3A 2OARA 2FYUD 4L76A 1NWQA 3JCUH 1OXZA 2IX7C 3U1AA 2HFED 4H13D 1FZAA 3Q5PA 4C7NA 1KORA 3CCUP 3V5BA 1SQXE 5B66H 1L0LJ 3CXHE 1RF0A 1NH4A 4L74A 2O01H 2KUBA 1YQ4C 3SWYA 5L8RJ 3HD7A 3B5NA 1ZN5A 5CMZA 1NTMK 3HD7C 3B5NC 1EDLA 3N7NA 1EDJA 1FJPA 2OYIA 4BWNA 1HJ0A 1JCDA 1VQMP 3FXDA 3P32A 1PPJD 3O8ZA 2OYIC 1IZNB 1PP9D 3AEFC 2Y0CA 2FYUE 3FWNA 1DD3A 3B71A 4H13B 3Q3DA 4U3FJ 2Q6QA 2M8RA 3EWKA 1IFNA 2R5BA 3TGUG 1L4AA 2N1TA 2JEEA 3D70A 2XZRA 4HYTB 1RE4A 1M1JC 1S9KD 1FJKA 2N1TC 3L71G 2GA1A 4KT0J 3M9HA 2C0XA 2ZT9D 3SFDC 3V4QA 2XV5A 1YJ9P 1HBWA 2Z5IA 1RHZB 4C7RA 1OW8A 3VOPA 1L0NG 3M0DA 3CCLP 3H25A 1OIPA 3V4WA 1SQVJ 3CXHI 3VMAA 3M0DC 4NPDA 2QIWA 5GTIE 3A3YB 4ZNCA 1PP9E 2B88A 4RESB 1NTME 4JBZA 2KLUA 1EDKA 1ZR4A 3QH9A 3L70J 4C7NB 1DIPA 3RGUA 1IFJA 3CX5I 1VQ4P 2YKQA 1AQ5A 5CHXA 2ZXEB 1CW5A 1BCCE 2OGUA 3L73D 3CXHH 1LTIC 2IZ1A 1BSHA 5AVTB 2IBZD 1S9KE 3H1JJ 3CC7P 2ZT9B 1JCCA
chains in the Genus database with same CATH topology
2NRGA 2DW3A 2ITAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NRG A;  2DW3 A;  2ITA A; 
#chains in the Genus database with same CATH topology
 1QL1 A;  2H88 C;  4K35 A;  4JF7 A;  2H8P D;  4QMA A;  3MP7 B;  2H89 C;  4PJ0 E;  4GDO A;  2ZYG A;  1J1E B;  4TT3 H;  5CBN A;  1LT9 C;  4ASV A;  3I56 P;  2H43 A;  2A06 D;  1IK7 A;  2AXC A;  1OZH A;  3LID A;  3HTK A;  1URQ A;  3BAS A;  3L70 D;  1QVF O;  2HPC A;  3S4R A;  1L4A B;  1KD1 Q;  1Q86 Q;  1N7S D;  5APU A;  4CPG A;  4O9B A;  3OA7 A;  4PD4 I;  3H1J D;  2XDJ A;  2O1K A;  3L73 E;  3H1L J;  2AEJ A;  4LC1 A;  2IBZ E;  3GHG C;  4JPZ B;  1IJD B;  2WSC H;  1VF5 D;  2BEQ D;  2QEX P;  3AED C;  3P7K A;  1JOC A;  4H44 B;  2O01 N;  2OTK E;  1FBM A;  1M8O B;  1KN7 A;  2QSI A;  1U7J A;  4JYC A;  1KIL C;  5AVQ B;  1FE6 A;  2PP6 A;  3GLM A;  2W83 C;  2M5A A;  2QJP C;  1SLQ A;  2A06 E;  2O1J A;  3AE4 C;  5GTI H;  1GD2 E;  1FZF A;  3VTP C;  5AVY B;  3L70 E;  2AEM A;  1NAF A;  1YTZ I;  2HOD B;  1N7S B;  3V2Q A;  3E7K A;  2K37 A;  1OX3 A;  1NU1 G;  3R4Y A;  1P84 I;  3H1H D;  3H1L D;  1QGK B;  2YKP A;  1VF5 B;  1L0N K;  4EYY Q;  2O01 J;  1L2P A;  2LKM A;  4D6T J;  3A0H H;  1QL2 A;  4PJ0 H;  2E75 B;  1L0N D;  1IFP A;  1KB9 D;  1N7L A;  3HTK B;  3O6Q B;  3TSI A;  1URQ B;  2IBZ I;  3IFM A;  3OJA B;  1BGY J;  5AVX B;  3U1C A;  1NO4 A;  1FZB A;  3CWB G;  1FZC B;  3RK2 D;  2LXB A;  4JQ0 D;  1GMJ A;  2I1K A;  4WY4 D;  1JB0 J;  2QM7 A;  2FFD B;  3NMD A;  1NTK J;  3IF4 A;  1HWT C;  3H1H E;  1LT1 A;  2WT7 A;  4L73 A;  3L71 E;  4OH8 B;  2C0W A;  2KYV A;  2FXP A;  2N9Y B;  1CSB A;  2QJY B;  1YJW P;  1N2D C;  1A02 J;  2ZAE B;  1JY2 N;  1RQU A;  1HVV A;  1L0N E;  3AE3 C;  3VP9 A;  3ZDM A;  1KB9 E;  3JSV C;  1G1J A;  3EQ2 A;  1Q7Y Q;  3B4S A;  2KI7 B;  1NVO A;  3WUT A;  3H1K G;  4IL6 X;  3RK3 C;  2QJK C;  2Y9Z A;  5KJ7 C;  3RK2 B;  1DD4 A;  3RL0 B;  4WY4 B;  2I1J A;  2WPV B;  4IL6 E;  1GDT A;  1ZME C;  1M57 D;  3HE4 B;  1SQX J;  1PGJ A;  3AEC C;  5KAF E;  1KZU B;  4I7Z B;  3T97 A;  4KHX A;  3FX0 A;  2ZYD A;  1L0L G;  3D6Z A;  1J1D B;  5AW8 B;  1KQL A;  2KS1 B;  2BCC D;  2WSS H;  1XTG B;  2KSJ A;  2NZ2 A;  3KQG A;  1NU1 K;  3RL0 g;  3C8V A;  3KDP B;  2C9N Y;  2M0B A;  4R4L A;  4DZO A;  2FYU J;  1QVG O;  1NHL A;  1KMI Z;  1ZR2 A;  1R8E A;  4H13 C;  2I8D A;  2G8Y A;  2KIK A;  1JNM A;  4GT1 A;  2IYP A;  3D6Y A;  3CCJ P;  3NTN A;  2HYN A;  3P8C D;  2CPB A;  2E76 D;  2ZYA A;  3KZI E;  2YO2 A;  2WSC J;  3E1R A;  2WMM A;  3L74 G;  3W67 A;  3G3Z A;  2JR8 A;  1VQ8 P;  1KB9 H;  2BCC E;  5KAI E;  3AE8 C;  3GW6 A;  3FWL A;  1USE A;  3HRN A;  1HGV A;  3MZW B;  5DJT B;  2KK7 A;  3IAO A;  4EIJ A;  1SQP G;  2RMZ A;  1PP9 J;  3CWB D;  1NTM J;  2GM4 A;  1ZLL A;  3OAK A;  1S4X A;  4IL6 H;  3JC2 2;  3SWF A;  4DOJ A;  5CCH D;  1NU1 E;  2JWA A;  1YTZ T;  3A0B E;  1BDD A;  5B5E E;  1BCC J;  1OMI A;  1YYC A;  4AYC A;  2E76 B;  2WSE H;  1NKZ B;  5KAF H;  3T97 B;  4GOD A;  1YHQ P;  1VPC A;  3P8C E;  5APQ A;  4OWF A;  1RF0 C;  3MTU E;  2QRX A;  2KB7 P;  1R5L A;  2RH0 A;  2ZT9 C;  1EXI A;  1FS0 E;  2IFN A;  4B86 A;  1PGO A;  1BDC A;  1SQB K;  3CC4 P;  1ZV8 A;  3L75 G;  1R5S A;  2A45 I;  5APS A;  5APW A;  3CCM P;  4W80 A;  1NTM D;  1J1E C;  1CI6 A;  5KLI B;  1H0T B;  2P7J A;  3CWB E;  3WUV A;  1Q82 Q;  1LTG C;  1ZP0 C;  1L0L K;  5E79 E;  1BCC D;  1NOH A;  1AQT A;  2KOG A;  1BSN A;  2A45 H;  2E5T A;  1BE3 G;  1L4A C;  2AEF A;  3L73 J;  1FOS E;  1RE4 C;  3HE5 A;  4BRY B;  1AFO A;  1OVU A;  2IYO A;  1EZV G;  3KZI H;  3MGN A;  3CCS P;  2ZVO B;  3MUD A;  3CL3 D;  1RY3 A;  5CCG A;  1JY3 P;  1X8Y A;  5KAI H;  4H44 C;  3V2P A;  3M9B A;  3AEE C;  1GL2 D;  2KNC A;  3D71 A;  1LP1 A;  1JTH A;  3GF7 A;  4C46 A;  2ZXX A;  1LNQ A;  1LTJ A;  5AVW B;  2FYN B;  2P10 A;  3H1I G;  2HOD A;  1N7S A;  4HH2 A;  4Y28 J;  3MD0 A;  2WWW A;  1JUN A;  3A0B H;  5B5E H;  2Q1K A;  1N7S C;  5AVR B;  1USD A;  3I5C A;  1WRG A;  1QEX A;  5K5G B;  5AVU B;  2XNX A;  4OGQ D;  4A7P A;  4Y99 B;  5CJ0 A;  2C9L Y;  3P8M C;  2Q7C A;  2FXM A;  1VF5 C;  1AVO A;  1PIX A;  4Z1M H;  1SQP K;  3HUS B;  3BCC G;  2OTL P;  1JM0 A;  5CCG D;  1GL2 B;  1X9V A;  1RH5 B;  1S5L X;  1LWU B;  2PGD A;  4NPF X;  1N86 A;  3AE1 C;  2E75 C;  1CI6 B;  3O6Q A;  2NPS D;  3SWK A;  1SQP D;  3USS A;  1OW7 A;  3VN0 A;  1URQ C;  2PRR A;  1KQG B;  4TLF A;  5AVS B;  3MHV A;  1VQ9 P;  2ZFC A;  5KLV G;  4OVN F;  1FZC A;  3L72 G;  2W6J H;  3AE7 C;  3CC2 P;  5E79 H;  3M91 A;  2PFX A;  1BGY G;  2FFD A;  3SSU A;  1MFT A;  2YIU B;  3BAT A;  1LJ2 A;  2WPS A;  3TYY A;  3H1H J;  4OGQ B;  3HE5 B;  2FFD C;  5DJU B;  3U59 A;  4I1L A;  3L71 J;  3TK1 A;  3FGA D;  2UWJ E;  1J2J B;  2FKW B;  3EFF K;  1NTK G;  4I6M C;  4AUW A;  2DW3 A;  3L74 E;  1EC5 A;  3L75 D;  2QJY C;  1AVY A;  2KNC B;  3L35 A;  1L0N J;  1LP1 B;  1JTH B;  1OVR A;  3GG2 A;  2NPS B;  1EQ7 A;  1SFC D;  2OTJ P;  2K9Y A;  1LTJ B;  2W6B A;  2KLV A;  2HR3 A;  1SQP E;  1GW4 A;  1Z56 A;  2CPS A;  2QG4 A;  1AA0 A;  3TGU D;  4WY4 A;  3CMA P;  2P2U A;  2H7H A;  2CK3 H;  3RK2 C;  1GK4 A;  2K9J B;  2K1A A;  3RL0 C;  1KTM A;  1YQ3 C;  4WY4 C;  3NXS A;  1FDI A;  1IK9 A;  5BVZ A;  1BE3 D;  3UIA A;  3HE4 A;  3L71 D;  2R44 A;  1RQV A;  2JO1 A;  3E1I A;  1EZV D;  2WSE J;  3OW2 O;  2IZ0 A;  3KHU A;  1ZW0 A;  2E43 A;  2WIT A;  1S1C X;  1RE3 A;  1SQQ G;  4I7Z C;  3EFG A;  5AW7 B;  3Q2Y A;  3CD6 P;  1RE3 C;  3L75 E;  2Y0D A;  3F89 A;  3CCQ P;  2KS1 A;  2XKM A;  1GTW A;  1QX8 A;  2KSE A;  1SFC B;  4LLH A;  1J1D C;  4R4M A;  1LTS C;  2LXC B;  1SP4 A;  1KIL D;  4KJM A;  2LR2 A;  2JWD A;  2N9B A;  3C9I A;  4K3A A;  3S9O A;  2E74 D;  3H1I D;  1X0T A;  3A7O A;  1K05 A;  3TGU E;  1GU4 A;  1H8A A;  1T3U A;  1Q81 Q;  2Q3E A;  4GKG A;  4YPC A;  1YIJ P;  1NAY A;  3GF3 A;  1BE3 E;  1ZXG A;  1UII A;  1Q90 D;  1NTZ G;  2J58 A;  4IOI H;  1EZV E;  2YNY A;  3H32 B;  4NPE A;  1FC2 C;  3CPW O;  1VL2 A;  1A02 F;  3BCC D;  2W90 A;  5AW5 B;  2MJZ A;  1EDI A;  5KLV K;  4IFF A;  1H88 A;  2BCC J;  3M0A A;  2E74 B;  1KIL E;  2K3R A;  1DEE G;  2B87 B;  2B89 A;  1Y47 A;  2B9B A;  4HKZ H;  3V2R A;  1SQB G;  3H1I E;  1LTT C;  2WPQ A;  3AE9 C;  2KZI A;  3L72 D;  3QWO C;  1NTK K;  1PPJ G;  1NU1 J;  5AW0 B;  4L75 A;  2W27 A;  4EI2 A;  5M1B A;  1AJY A;  1NJI Q;  5TJH A;  1G2C B;  3KYQ A;  5APX A;  1PGP A;  2E76 C;  3CI9 A;  3V6I A;  1Y8A A;  3BCC E;  3FXE A;  3VMX A;  4WWI A;  1Y9B A;  5GTH E;  3AEA C;  1IC2 A;  4EOT A;  4ZKU A;  1EZV I;  5BU5 A;  1H0T A;  4H0L D;  3CWB J;  2JDI H;  1NU1 D;  1VDF A;  1RF1 A;  5CCH A;  5KLI C;  3L72 E;  3Q5S A;  1FZG A;  2W6A A;  1KB9 I;  4HJG H;  5KJ7 D;  1SS1 A;  4PV1 D;  4U3F G;  5CCH C;  5CBO A;  1G1I A;  1SQQ K;  1T2K D;  2FBW C;  2D2C D;  4N78 D;  3WU2 E;  3TNU B;  4BRY A;  1FOS F;  1YJN P;  2W8Z A;  1SQQ D;  1NYH A;  3MIW A;  3I55 P;  3L73 G;  2WZ7 A;  5AW6 B;  1JY2 O;  2IBZ G;  1JY3 O;  1JMM A;  1M90 Q;  2AXT E;  2JKV A;  2OYH B;  3KPE A;  4AQR D;  1N8R Q;  3LW5 H;  4M3L A;  1M56 D;  2YMY A;  1VQ7 P;  4N6J A;  5H2F E;  2Y9Y A;  4H0L B;  4YXD C;  1FU1 A;  2KZJ A;  3AE6 C;  1N73 B;  1SQV G;  4ZMD A;  1NTZ K;  4PV1 B;  1KQS O;  1GZL A;  3TDK A;  1JO5 A;  3PRJ A;  4DJG A;  1SVF A;  2FYN C;  5AVZ B;  3BRT B;  3BVH A;  1YBK A;  2D2C B;  3L70 G;  1UIX A;  3Q5R A;  1NTZ D;  3NFQ A;  3AEG C;  4N78 E;  3TF5 A;  2XU6 A;  3GMA A;  3AE5 C;  3BRV B;  3H1J G;  1SQQ E;  2XND H;  4Y99 C;  2R5D A;  2YXQ B;  3HUS A;  5KKZ B;  1GL2 A;  2KP8 A;  2Q5U A;  2V7Q H;  5GTH H;  3AE2 C;  3HUS C;  3H1K D;  1LWU A;  1GL2 C;  1T3J A;  1OW6 A;  3CX5 E;  1SQB D;  1LWU C;  4YXW H;  1IFD A;  1RF1 B;  4PD4 D;  2POH A;  3PP5 A;  3L36 A;  1MZ9 A;  2WVR A;  1NKN A;  1T6A A;  3WUU A;  4YTP C;  3WU2 H;  2YIU C;  3CCE P;  1WT6 A;  1NTZ E;  1HF9 A;  1L0L D;  1M1J A;  1HGZ A;  4OGQ C;  3VP8 A;  1VQN P;  3H1H G;  4W7Z A;  3H1L G;  1JY2 P;  2WQY C;  2Z5H A;  3MUD C;  1PFI A;  3L74 J;  5BU8 B;  2JJL A;  2AXT H;  5CCG C;  3PTZ A;  3HD7 D;  3B5N D;  2R32 A;  2YO3 A;  3H1K E;  2P67 A;  2NPS A;  5H2F H;  1E5W A;  1VQK P;  2QE7 H;  4RJT A;  1P84 D;  2MKV A;  4ASW A;  1EXJ A;  2NPS C;  3VMZ A;  1SQP J;  1SQB E;  1LGH B;  2Q9I A;  2OYO A;  1LTJ C;  1MKM A;  4PD4 E;  1PPJ E;  2QA4 P;  4U3F D;  5AW2 B;  1DEB A;  2K9J A;  2R3C A;  1VQ6 P;  5APY A;  3M06 A;  2L91 A;  1L0L E;  1L4A D;  2N1T D;  3CLQ A;  4UB6 E;  4GOE A;  3L74 D;  3PJS K;  1SQV K;  5AW1 B;  3B8E B;  2HG5 D;  3HD7 B;  3B5N B;  3L75 J;  4D6T G;  1SFC A;  1D7M A;  1S5L E;  3LIE A;  3A0H E;  2HLO A;  4H44 D;  3CX5 H;  1LT9 A;  3PHL A;  1SFC C;  1VQP P;  2OYI B;  1SQV D;  1P84 E;  3L4F A;  2KXP B;  4GOF A;  4RO0 A;  2VRS A;  1PZQ A;  2WTY A;  3TGU J;  3IR9 A;  4HB1 A;  3F5H A;  2WSF H;  1FZC C;  4U3F E;  2K88 A;  2IPP A;  4RKU J;  1BE3 J;  5TIS E;  1M1J B;  3N4X A;  4W7Y A;  1GU5 A;  3VYI A;  3L37 A;  2N1T B;  2A45 G;  3H32 A;  3GHG A;  3A2A A;  2RN0 A;  1S72 P;  3R2P A;  2ZVN B;  3G4S P;  1VQO P;  3A5T A;  1TU3 F;  3PLN A;  1KIL A;  2G3A A;  3RBZ A;  5APT A;  4UB8 E;  3LW5 J;  1K9M Q;  1MUU A;  2B87 A;  3G6E P;  2BCC G;  1SQV E;  2J5U A;  1W2B O;  2E75 D;  3K5B A;  2BEZ F;  4PD4 H;  1W5C E;  1CZQ A;  3H1I J;  2E74 C;  3CME P;  1URQ D;  1JMB A;  1M1K Q;  2IFM A;  1S3J A;  1IO4 A;  3AEB C;  1KYO D;  3W68 A;  1G2C A;  4WB4 A;  1SQX G;  2P58 A;  1MV8 A;  4GIF A;  4UB6 H;  5AW4 B;  1IFI A;  3H1J E;  1LTB C;  1PGQ A;  2E5Y A;  1OWA A;  1K8A Q;  3BCC J;  1HUC A;  1VQ5 P;  1IFM A;  3G9R A;  2E42 A;  2ZJS E;  2QVA A;  1E79 H;  2V7Q J;  5AVV B;  3RBX A;  1LT9 B;  1S5L H;  4ZKP A;  4EDF A;  2OQQ A;  5APV A;  2IDB A;  4WBA A;  2YMK A;  1P84 H;  1KQF B;  1GW3 A;  1FAV A;  1H89 A;  2NRG A;  3VMY A;  1QLE D;  5KLV J;  1KFN A;  3ITK A;  3L72 J;  2HPC B;  2FY8 A;  2FYU G;  1GK6 A;  5TIS H;  2FYZ A;  1VQL P;  3Q1M A;  3RL0 D;  5AW3 B;  1HTL C;  1DX7 A;  2YKO A;  1KYO E;  4XA4 A;  3II6 A;  3TNU A;  3GHG B;  1M7L A;  1ZRT D;  2BAS A;  4BXL A;  1K04 A;  1JEK A;  3H1L E;  4XFJ A;  1U57 A;  3S1K A;  1S2E A;  2M3B A;  4D6T D;  1KIL B;  3SFE C;  3KXD A;  3WMM 0;  4JYB A;  4UB8 H;  1X79 B;  2OYH A;  2QJP B;  1JY3 N;  1X22 A;  4IFM A;  2Y0E A;  1FDM A;  2FXO A;  2M5A B;  1HH0 A;  2OYH C;  2Q3I A;  5EFW B;  5KLV D;  1N73 A;  4H0L C;  1BGY D;  4MN4 C;  5KJ7 A;  1N73 C;  1PP9 G;  1NTM G;  3JCU E;  1U7M A;  3G71 P;  4PV1 C;  1T2K C;  1XTC C;  2M3E A;  1NTK D;  4LGD E;  2P1J A;  3CCR P;  3H6P A;  4I2L C;  2D2C C;  5AW9 B;  1NGM B;  1YIT P;  1BCC G;  5B66 E;  2V4H A;  1OVV A;  4DT0 A;  1ZRT E;  2O3J A;  1SQQ J;  1OFC X;  1AV1 A;  1Q2N A;  2WPR A;  1KFM A;  2R3S A;  4D6T E;  3IN6 A;  3M9Q A;  1MFZ A;  4DCK A;  5KKZ C;  1KYO I;  1K73 Q;  4N3Y B;  1FDO A;  3ABV C;  5KTB A;  1PL5 A;  5KLV E;  3RK3 D;  1SQX K;  1BGY E;  1RF1 C;  3C1L A;  4WVZ A;  1YI2 P;  4XE5 B;  2WSF J;  2SPZ A;  2GUV A;  2QM8 A;  1FZE A;  1KYO H;  1SQX D;  2YXR B;  1NTK E;  1NTZ J;  2L5G B;  3PH0 A;  2WT7 B;  4IFD K;  1WMK A;  2ITA A;  1HJB A;  1DH3 A;  3CXH D;  2RKL A;  1KV4 A;  3CCV P;  1KC8 Q;  1LTA C;  5C39 A;  3H1K J;  3CX5 D;  2FYU K;  3V2N A;  1W2E A;  5CJ4 A;  2PAJ A;  2JP3 A;  3RK3 B;  2QJK B;  1SQB J;  2A06 G;  1T8Z A;  1ZOY C;  2J59 M;  3RK3 E;  2Z4E A;  4U7J A;  2GUS A;  1PV3 A;  2OAR A;  2FYU D;  4L76 A;  1NWQ A;  3JCU H;  1OXZ A;  2IX7 C;  3U1A A;  2HFE D;  4H13 D;  1FZA A;  3Q5P A;  4C7N A;  1KOR A;  3CCU P;  3V5B A;  1SQX E;  5B66 H;  1L0L J;  3CXH E;  1RF0 A;  1NH4 A;  4L74 A;  2O01 H;  2KUB A;  1YQ4 C;  3SWY A;  5L8R J;  3HD7 A;  3B5N A;  1ZN5 A;  5CMZ A;  1NTM K;  3HD7 C;  3B5N C;  1EDL A;  3N7N A;  1EDJ A;  1FJP A;  2OYI A;  4BWN A;  1HJ0 A;  1JCD A;  1VQM P;  3FXD A;  3P32 A;  1PPJ D;  3O8Z A;  2OYI C;  1IZN B;  1PP9 D;  3AEF C;  2Y0C A;  2FYU E;  3FWN A;  1DD3 A;  3B71 A;  4H13 B;  3Q3D A;  4U3F J;  2Q6Q A;  2M8R A;  3EWK A;  1IFN A;  2R5B A;  3TGU G;  1L4A A;  2N1T A;  2JEE A;  3D70 A;  2XZR A;  4HYT B;  1RE4 A;  1M1J C;  1S9K D;  1FJK A;  2N1T C;  3L71 G;  2GA1 A;  4KT0 J;  3M9H A;  2C0X A;  2ZT9 D;  3SFD C;  3V4Q A;  2XV5 A;  1YJ9 P;  1HBW A;  2Z5I A;  1RHZ B;  4C7R A;  1OW8 A;  3VOP A;  1L0N G;  3M0D A;  3CCL P;  3H25 A;  1OIP A;  3V4W A;  1SQV J;  3CXH I;  3VMA A;  3M0D C;  4NPD A;  2QIW A;  5GTI E;  3A3Y B;  4ZNC A;  1PP9 E;  2B88 A;  4RES B;  1NTM E;  4JBZ A;  2KLU A;  1EDK A;  1ZR4 A;  3QH9 A;  3L70 J;  4C7N B;  1DIP A;  3RGU A;  1IFJ A;  3CX5 I;  1VQ4 P;  2YKQ A;  1AQ5 A;  5CHX A;  2ZXE B;  1CW5 A;  1BCC E;  2OGU A;  3L73 D;  3CXH H;  1LTI C;  2IZ1 A;  1BSH A;  5AVT B;  2IBZ D;  1S9K E;  3H1J J;  3CC7 P;  2ZT9 B;  1JCC A; 
#chains in the Genus database with same CATH homology
 2NRG A;  2DW3 A;  2ITA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...