2ITAA

Solution structure of pufx from rhodobacter sphaeroides
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
70
structure length
70
Chain Sequence
MADKTIFNDHLNTNPKTNLRLWVAFQMMKGAGWAGGVFFGTLLLIGFFRVVGRMLPIQENQAPAPNITGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the PufX polypeptide from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Photosynthesis,membrane protein
molecule keywords Intrinsic membrane protein pufX
total genus 13
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2006-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11511 RhodobacterPufX Intrinsic membrane protein PufX
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.920 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces rhodobacter sphaeroides pufx membrane protein 2itaA01
2ITAA 2NRGA 2DW3A
chains in the Genus database with same CATH superfamily
2P1JA 1JMBA 2FYUD 5B5EH 2C9LY 2SPZA 1GDTA 4D6TD 1AQ5A 5KJ7D 3O6QA 5APXA 3H1JJ 3RBXA 1RY3A 1HWTC 2WTYA 1NTKG 4EYYQ 1MUUA 1S1CX 1LTJA 4EIJA 1AFOA 2GUSA 1SQPG 2PP6A 2Y9YA 3HE4B 1SQXE 1Y9BA 4C7NA 3FWLA 2ZYGA 1URQD 3HE5B 3LW5H 3Q5RA 1CW5A 3L73E 1M56D 1S4XA 4HYTB 1IO4A 3CXHI 3T97B 1RF0A 4IFFA 4Y99B 3KZIH 2BCCD 1L0LE 1BCCD 1OVUA 1OW6A 4UB6E 5KLVD 2E75B 2QE7H 1KD1Q 1QVFO 3AE4C 3CCEP 2CPSA 3A3YB 2AXTE 1N8RQ 2JKVA 4UB8H 2OARA 1NH4A 2JEEA 3EWKA 2W27A 3MD0A 1T2KD 3RL0C 4HB1A 4MN4C 3VP9A 3V4QA 5CCHC 1PIXA 2QJKC 5B66H 4Z1MH 3ABVC 4R4MA 1NJIQ 1OMIA 1T8ZA 1H88A 2IPPA 2R5DA 2NPSB 5AW6B 3L71D 2R5BA 1IK7A 1HGVA 1FE6A 1K73Q 1BGYG 1SQQG 2FYZA 3LIEA 1OVVA 2E76D 4GDOA 4PV1C 1KILD 4UB8E 3CWBJ 3PRJA 3H25A 3L73J 2PGDA 1W2EA 3MUDA 1MV8A 1QEXA 1ZOYC 2HR3A 2M3EA 1LT9A 1CI6B 1USEA 2OYOA 2KZIA 2OQQA 3FWNA 3GHGB 1PP9D 3H1KG 3H1LG 3H1HJ 2YXRB 1VF5C 3S9OA 1JTHA 2QJYC 1KFMA 2D2CD 5AW0B 1FZFA 3CC4P 2HG5D 3M0AA 2HPCA 3L74D 3HTKB 1JCDA 1FBMA 1U7MA 3VMXA 3HE4A 5E79E 2A06D 2ZYAA 3H1IG 3GHGC 1SQVG 4U3FJ 1NU1J 4WBAA 2JWAA 2PRRA 3W67A 2KSJA 3CX5E 4H0LC 3L70G 5AW8B 2FYUK 1NU1G 3SSUA 3HRNA 1G1IA 3RL0g 3RK3C 2ZFCA 3L4FA 3WMM0 2IYOA 2KNCA 3H1IJ 1EDIA 3AECC 2KXPB 1KC8Q 1NOHA 2E5YA 3G9RA 1KB9D 2QM8A 3C1LA 1P84E 4JYBA 1L2PA 1HH0A 2JO1A 3WUVA 3RK3E 3H1HG 1GTWA 2KS1A 3H1IE 5CJ4A 3AEAC 1FOSE 3GG2A 2P58A 3CX5H 3M9QA 4PD4E 5AVUB 2XDJA 1X9VA 5CCGC 4U7JA 3BRVB 1JY2P 2P7JA 3CWBG 1VQ5P 5CCGA 1IK9A 1OWAA 3I5CA 4BRYA 4K3AA 1S9KD 1VF5D 2IYPA 1Z56A 2N1TA 2AXTH 1JY3P 1L0LJ 2D2CC 3PHLA 3KPEA 3R4YA 3IR9A 4RKUJ 1VQMP 1N7SC 3D6YA 3RBZA 1KV4A 1URQC 2LXBA 1UIIA 2A45I 3B5ND 3RK2C 3AE1C 4ASWA 4EOTA 2OTLP 3GMAA 4O9BA 3LW5J 3H1KD 3O8ZA 3VYIA 3L72D 3A5TA 3CMEP 5APWA 2YKQA 2D2CB 1PGPA 2HFED 4IOIH 5K5GB 1M1JB 2FXMA 3AEGC 3FX0A 4H13B 3L75D 3I56P 2C9NY 1ZW0A 3F89A 2YMYA 4WY4B 4EI2A 1HTLC 3JSVC 1IFDA 1P84D 5KAIH 3G4SP 3II6A 2YO3A 1BE3J 3A0HH 3A0BE 1OXZA 1ZV8A 3KHUA 3TGUJ 1RHZB 5AVRB 1YHQP 2JJLA 3NXSA 1L0LK 4I7ZB 3H32A 2K9JB 3CCVP 1Q81Q 1JY2O 1RQVA 3M0DA 1LTBC 1PGQA 1K9MQ 3H1JG 2BCCJ 2P10A 1LTJB 5KLVG 3BCCD 1NWQA 2OYHB 1OVRA 4JPZB 2YNYA 2C0XA 4NPEA 4XA4A 3N7NA 2O01J 3CCRP 2V7QH 1GW3A 1DEEG 1IFJA 5AW5B 3WUUA 3U1AA 3AEDC 1LTTC 3GF7A 2GM4A 1JM0A 3D6ZA 1FZGA 1CSBA 1VF5B 1SQVE 4B86A 1IC2A 2E5TA 4OGQC 3CCUP 1X0TA 1OX3A 1NTZD 1SQBD 3HD7A 3R2PA 3NMDA 5TJHA 2WT7B 3G6EP 1MFZA 2ITAA 1G2CA 1T6AA 2K3RA 3H1JE 5AVVB 1H8AA 3TSIA 5AVZB 1NHLA 1S5LH 1FU1A 1LGHB 2ZT9B 3L73D 4PD4H 2FYUE 3CMAP 2W90A 2OYIB 1RQUA 2J5UA 1L0ND 2RKLA 3G3ZA 1PP9J 5AW9B 5AVYB 2ZT9C 1LWUB 5AVWB 1AVOA 1YJWP 3MP7B 4UB6H 2FFDC 2VRSA 3MZWB 2AXCA 1S5LX 1LP1A 2RN0A 2JR8A 3CX5I 1YI2P 1KORA 2FFDA 1FJPA 3L70D 4KJMA 5KJ7C 3PJSK 4IFMA 1HJ0A 3L72G 4I1LA 5CCGD 4L73A 5GTIH 3MIWA 5CHXA 1NTMJ 2RH0A 4W7YA 1KQLA 3HUSC 4NPDA 1PGJA 1SQPE 3TF5A 3M9BA 4XFJA 1VQ7P 2Q1KA 5APYA 2E75C 1SQXD 2WMMA 1FZCC 1N7SD 2W6BA 1IFIA 1LTGC 1Q86Q 2H89C 1JNMA 1FZCA 2E43A 3CX5D 3B5NB 5APQA 2XZRA 3HD7D 3AE7C 3Q3DA 2OYIA 3SWFA 1SLQA 3ITKA 1NVOA 2QJYB 3V2RA 3IAOA 2BEQD 4N6JA 1BGYD 1SQQD 2R32A 3CXHE 4QMAA 3CC2P 3P8CE 3HD7B 2Q3IA 1W5CE 2WZ7A 2Q3EA 1Y8AA 5CCHA 1EZVE 3RL0D 4PD4I 5GTHE 5M1BA 4N78D 2KLVA 1R8EA 4BWNA 2G3AA 2KK7A 1TU3F 2O1JA 1KILA 4ZMDA 1HF9A 2XNXA 2KI7B 3L73G 3L35A 2KOGA 1AJYA 1EXJA 1YBKA 1EXIA 3AE5C 2E76C 2I8DA 4PV1D 1EQ7A 3L72J 2CK3H 1QX8A 3GW6A 1GL2B 4ZKUA 4HH2A 2AEMA 5TISE 1HUCA 3HTKA 3PP5A 5GTHH 3JCUE 3RK2B 3KQGA 4DT0A 3KXDA 1J1DB 2K37A 3CCMP 2OTKE 1M1KQ 3S1KA 3AE9C 3HUSA 2V7QJ 2H8PD 1SQPD 3FXDA 3GHGA 1XTGB 3H1LD 3JC22 4DJGA 2WT7A 3CC7P 3TGUD 1DIPA 1KTMA 2IZ0A 1T3JA 2HLOA 3RGUA 1FJKA 1SQVK 5APSA 2ZJSE 4YPCA 4L76A 1YIJP 4D6TJ 1Y47A 1RF0C 1KB9I 4PJ0E 3VMYA 1J1EC 3BRTB 2FYUG 4D6TG 1NU1K 3CCQP 2QA4P 2QEXP 1H89A 1A02F 3BCCJ 4H0LD 3W68A 4AYCA 3V2PA 1KILB 2Q6QA 3BATA 3E1IA 1JUNA 1Q82Q 2IBZG 2JWDA 1L0NE 2YIUC 2WVRA 3OA7A 4CPGA 2IBZE 4YXDC 4H0LB 3PTZA 1GW4A 1NTMK 3H1HE 2G8YA 1KZUB 3BVHA 1LWUA 3K5BA 4C7RA 1FDMA 1AQTA 2W6JH 3L75G 5E79H 3V2QA 4BRYB 5BVZA 4OH8B 5KLVJ 1YJNP 1JY3O 2O1KA 1NTZJ 1SQBJ 1SS1A 1D7MA 1KYOI 1LTSC 1JCCA 2B87A 2N1TC 2WSEH 3LIDA 4D6TE 2E42A 1IFPA 3A0HE 1KQFB 3CCLP 2BASA 1JY2N 3B5NA 1NU1E 3L37A 2WSSH 4H13D 4OGQB 1WT6A 1LT9C 2QRXA 1GL2A 1DD3A 1GK4A 3B5NC 5AVSB 2IFMA 4LLHA 1JY3N 3C8VA 2FKWB 4EDFA 1OIPA 2A45G 1M1JA 1FS0E 4DZOA 1FZAA 3L71J 2NPSA 1BDDA 2BCCE 2IDBA 4IL6E 4H44D 2WQYC 1SFCB 3L72E 2IBZI 2W6AA 3TGUE 1JEKA 2FY8A 4C46A 3CCSP 4JYCA 2YIUB 3MHVA 1QLED 1NTMD 2KYVA 4H44B 1SFCD 1HBWA 1X22A 5TISH 2HODA 2N9YB 2Y0DA 1FOSF 4W80A 3M0DC 1K8AQ 3A2AA 1L0LG 4A7PA 1NGMB 2W83C 1MFTA 4N3YB 2KSEA 3HUSB 5CBOA 1CI6A 3D70A 4L74A 5KLIC 1LJ2A 1PZQA 2O01H 1LWUC 2M5AB 2IZ1A 1GD2E 2HODB 1SQVD 4AUWA 1OW8A 2YKPA 1RF1B 3H6PA 1DX7A 2N1TD 5CMZA 1AV1A 3NTNA 4PJ0H 2M8RA 1UIXA 2WWWA 1HGZA 1PP9E 1SQXG 2YMKA 1PPJD 4YTPC 2WSFJ 1PP9G 1BSHA 1GL2C 1BGYE 1NKNA 1SQQE 2M3BA 1URQA 3CXHD 3GLMA 5GTIE 1GU4A 1R5SA 1MKMA 5AW1B 5KAFE 3C9IA 2GA1A 1J1DC 1KFNA 1NTZE 1SQBE 4RESB 1VQKP 1QVGO 1NAFA 3RK3D 1P84I 3L71G 1RE4A 3Q2YA 3H1KE 1ZXGA 1SVFA 4GIFA 1KQGB 3V2NA 2O01N 3WU2H 2XU6A 1N2DC 4RJTA 2W8ZA 5KJ7A 3OAKA 3L75E 5KAFH 1NYHA 2OTJP 2POHA 1ZRTE 3CXHH 3H1KJ 3H1LJ 2B89A 4WY4A 1HVVA 1KILE 3RK3B 3L70E 2WITA 1DEBA 3SFDC 1NTZG 1SQBG 1U7JA 4TT3H 4GKGA 1L4AC 1LT1A 1BCCG 3AEFC 3L75J 2K88A 4OWFA 1S2EA 1L4AA 1YQ3C 4WVZA 1EDKA 1E5WA 1S5LE 3M06A 4Y28J 3G71P 2E75D 1YJ9P 1N73C 1JO5A 2O3JA 1BE3G 3NFQA 1KYOH 1OFCX 1Q90D 4JBZA 4OVNF 2FXOA 1NTKD 5C39A 1RE3A 1EZVD 1NO4A 2N1TB 3ZDMA 1VQLP 2Z4EA 4I6MC 2E74C 1GU5A 3AE8C 1QL1A 2J59M 3CWBD 4YXWH 5AW4B 3FXEA 1J2JB 5KKZC 1FZCB 1AVYA 2R44A 5KLVE 3Q5SA 1OW7A 4Y99C 4BXLA 1RF1C 3MTUE 3E1RA 3B4SA 1BSNA 4GT1A 1ZN5A 3EQ2A 4M3LA 1KYOE 1YTZT 2XKMA 5APVA 1S72P 3L74J 1KYOD 1L0NK 1RE4C 3GF3A 4RO0A 5AW3B 2ZAEB 2QJPC 3VMAA 4DOJA 1VQ8P 2AEFA 2I1JA 1SFCA 3O6QB 1BDCA 3MUDC 4R4LA 1ZP0C 1N7SB 2XV5A 2Q5UA 2LXCB 4NPFX 3VN0A 5EFWB 5KTBA 5L8RJ 2Q9IA 2FXPA 1NTKK 3CD6P 4LC1A 1IFNA 3FGAD 3V4WA 2PFXA 1EC5A 1SQPK 1LTJC 2KB7P 1L0NJ 5H2FE 2E74B 1JMMA 3T97A 2WPVB 1E79H 2LR2A 2E76B 3IN6A 2WPQA 1PPJE 1X8YA 1WMKA 1M7LA 1GL2D 2B87B 4IL6X 3HE5A 2KIKA 3SWKA 4IFDK 4K35A 2PAJA 5AVQB 1GK6A 1LT9B 2QSIA 3L70J 2NZ2A 4JQ0D 1RE3C 1KQSO 2ZVOB 3B8EB 1KN7A 1PL5A 2HPCB 4L75A 2A06E 2ZXEB 1NAYA 3OJAB 5CJ0A 1VQPP 2IFNA 2KNCB 1T2KC 1EDLA 2MKVA 2Z5HA 1IFMA 3JCUH 1YYCA 3USSA 5CCHD 2ZVNB 3OW2O 2WSCH 1H0TA 2J58A 3KDPB 1VQNP 1S9KE 1NTMG 2R3CA 2WSCJ 2XNDH 2NRGA 2ZT9D 1X79B 2ZYDA 2Z5IA 2IX7C 3M91A 3P8CD 3QWOC 5DJTB 2WPSA 5AW7B 2MJZA 2L5GB 3SWYA 1SQQK 2JP3A 1KILC 3VOPA 2QJKB 2M5AA 1LTAC 2K9JA 1JTHB 2KP8A 3AEBC 2WPRA 1BGYJ 1SQQJ 4XE5B 1L4AD 2Q7CA 4AQRD 1VQOP 1M90Q 1RF1A 2ZXXA 3H1LE 3L71E 1BE3D 1VL2A 5AVXB 1P84H 4PV1B 1SP4A 2N9BA 3L74E 3KYQA 3VMZA 1PV3A 2KS1B 1M1JC 4H13C 4HJGH 4C7NB 3BCCE 2FYUJ 3TYYA 2Y0EA 1N7LA 1K05A 3BCCG 1EDJA 1M8OB 4H44C 3H1JD 2E74D 2M0BA 4GOFA 2C0WA 3IF4A 2YO2A 2OYHA 1G1JA 3VP8A 1OZHA 1BCCE 4ASVA 3L36A 4HKZH 1ZR4A 2FFDB 1ZLLA 3D71A 3TDKA 4N78E 2IBZD 4LGDE 4W7ZA 1S3JA 1BCCJ 1SQPJ 5APTA 5AW2B 2OGUA 2FYNC 3CL3D 2YKOA 5H2FH 1K04A 4WY4D 1NTKJ 2V4HA 4WB4A 2QG4A 5KAIE 5BU5A 1IJDB 2BCCG 4I7ZC 1EZVG 4IL6H 2CPBA 5APUA 4ZKPA 3AE6C 3TGUG 3WU2E 1FC2C 3A0BH 4KHXA 1NTKE 3E7KA 1DH3A 1SQXK 1FDOA 2BEZF 2AEJA 1PPJG 1FAVA 1FZBA 3IFMA 2QM7A 3M9HA 3HD7C 2YXQB 4I2LC 3RK2D 3S4RA 1N7SA 1YITP 1VQ6P 5BU8B 1T3UA 2I1KA 3CLQA 2P67A 2A45H 3P7KA 3VTPC 1FZEA 1HJBA 3CPWO 3TK1A 1QL2A 3AEEC 3BASA 1LP1B 1QGKB 1XTCC 2NPSC 3EFGA 3EFFK 1LNQA 3A7OA 2H88C 3H1HD 4GOEA 3V6IA 4DCKA 2Y9ZA 1Q2NA 1M57D 3H32B 1JOCA 2FYNB 1SQXJ 1USDA 1YQ4C 3F5HA 1IZNB 1J1EB 2K9YA 3TNUA 3KZIE 3I55P 3RL0B 3AE3C 5KLIB 3TNUB 3Q5PA 1AA0A 2H43A 1GMJA 2B88A 1WRGA 4WY4C 1ZMEC 2H7HA 1EZVI 4U3FD 1YTZI 1NU1D 1RH5B 2R3SA 4WWIA 2LKMA 1GZLA 2WSEJ 3QH9A 1ZRTD 3UIAA 1U57A 1ZR2A 1URQB 1DD4A 1NTZK 1SQBK 2GUVA 5KLVK 3Q1MA 2A06G 3H1ID 1MZ9A 2QJPB 1N73B 3MGNA 5B66E 2UWJE 3L74G 3WUTA 3AE2C 1N73A 1H0TB 2P2UA 3V5BA 1R5LA 3P8MC 5AVTB 4ZNCA 2B9BA 4OGQD 1BE3E 1KB9H 4KT0J 1VPCA 2OYIC 2KLUA 1A02J 1NKZB 1NTME 1VQ9P 5KKZB 3SFEC 1VDFA 2WSFH 2DW3A 1FDIA 3B71A 2Y0CA 3PLNA 5B5EE 3CWBE 1PFIA 4TLFA 1CZQA 3U1CA 1N86A 1PGOA 2K1AA 3U59A 1L0LD 3CCJP 1SQVJ 3PH0A 4U3FG 2NPSD 2L91A 1G2CB 1KMIZ 1JB0J 4GODA 1W2BO 1Q7YQ 4U3FE 5DJUB 1VQ4P 2RMZA 1KB9E 3N4XA 2KUBA 2QIWA 2QVAA 5CBNA 1LTIC 1L0NG 2JDIH 2KZJA 1SFCC 2HYNA 4JF7A 2OYHC 3CI9A 2FBWC 1L4AB 4PD4D 3P32A
chains in the Genus database with same CATH topology
2ITAA 2NRGA 2DW3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ITA A;  2NRG A;  2DW3 A; 
#chains in the Genus database with same CATH topology
 2P1J A;  1JMB A;  2FYU D;  5B5E H;  2C9L Y;  2SPZ A;  1GDT A;  4D6T D;  1AQ5 A;  5KJ7 D;  3O6Q A;  5APX A;  3H1J J;  3RBX A;  1RY3 A;  1HWT C;  2WTY A;  1NTK G;  4EYY Q;  1MUU A;  1S1C X;  1LTJ A;  4EIJ A;  1AFO A;  2GUS A;  1SQP G;  2PP6 A;  2Y9Y A;  3HE4 B;  1SQX E;  1Y9B A;  4C7N A;  3FWL A;  2ZYG A;  1URQ D;  3HE5 B;  3LW5 H;  3Q5R A;  1CW5 A;  3L73 E;  1M56 D;  1S4X A;  4HYT B;  1IO4 A;  3CXH I;  3T97 B;  1RF0 A;  4IFF A;  4Y99 B;  3KZI H;  2BCC D;  1L0L E;  1BCC D;  1OVU A;  1OW6 A;  4UB6 E;  5KLV D;  2E75 B;  2QE7 H;  1KD1 Q;  1QVF O;  3AE4 C;  3CCE P;  2CPS A;  3A3Y B;  2AXT E;  1N8R Q;  2JKV A;  4UB8 H;  2OAR A;  1NH4 A;  2JEE A;  3EWK A;  2W27 A;  3MD0 A;  1T2K D;  3RL0 C;  4HB1 A;  4MN4 C;  3VP9 A;  3V4Q A;  5CCH C;  1PIX A;  2QJK C;  5B66 H;  4Z1M H;  3ABV C;  4R4M A;  1NJI Q;  1OMI A;  1T8Z A;  1H88 A;  2IPP A;  2R5D A;  2NPS B;  5AW6 B;  3L71 D;  2R5B A;  1IK7 A;  1HGV A;  1FE6 A;  1K73 Q;  1BGY G;  1SQQ G;  2FYZ A;  3LIE A;  1OVV A;  2E76 D;  4GDO A;  4PV1 C;  1KIL D;  4UB8 E;  3CWB J;  3PRJ A;  3H25 A;  3L73 J;  2PGD A;  1W2E A;  3MUD A;  1MV8 A;  1QEX A;  1ZOY C;  2HR3 A;  2M3E A;  1LT9 A;  1CI6 B;  1USE A;  2OYO A;  2KZI A;  2OQQ A;  3FWN A;  3GHG B;  1PP9 D;  3H1K G;  3H1L G;  3H1H J;  2YXR B;  1VF5 C;  3S9O A;  1JTH A;  2QJY C;  1KFM A;  2D2C D;  5AW0 B;  1FZF A;  3CC4 P;  2HG5 D;  3M0A A;  2HPC A;  3L74 D;  3HTK B;  1JCD A;  1FBM A;  1U7M A;  3VMX A;  3HE4 A;  5E79 E;  2A06 D;  2ZYA A;  3H1I G;  3GHG C;  1SQV G;  4U3F J;  1NU1 J;  4WBA A;  2JWA A;  2PRR A;  3W67 A;  2KSJ A;  3CX5 E;  4H0L C;  3L70 G;  5AW8 B;  2FYU K;  1NU1 G;  3SSU A;  3HRN A;  1G1I A;  3RL0 g;  3RK3 C;  2ZFC A;  3L4F A;  3WMM 0;  2IYO A;  2KNC A;  3H1I J;  1EDI A;  3AEC C;  2KXP B;  1KC8 Q;  1NOH A;  2E5Y A;  3G9R A;  1KB9 D;  2QM8 A;  3C1L A;  1P84 E;  4JYB A;  1L2P A;  1HH0 A;  2JO1 A;  3WUV A;  3RK3 E;  3H1H G;  1GTW A;  2KS1 A;  3H1I E;  5CJ4 A;  3AEA C;  1FOS E;  3GG2 A;  2P58 A;  3CX5 H;  3M9Q A;  4PD4 E;  5AVU B;  2XDJ A;  1X9V A;  5CCG C;  4U7J A;  3BRV B;  1JY2 P;  2P7J A;  3CWB G;  1VQ5 P;  5CCG A;  1IK9 A;  1OWA A;  3I5C A;  4BRY A;  4K3A A;  1S9K D;  1VF5 D;  2IYP A;  1Z56 A;  2N1T A;  2AXT H;  1JY3 P;  1L0L J;  2D2C C;  3PHL A;  3KPE A;  3R4Y A;  3IR9 A;  4RKU J;  1VQM P;  1N7S C;  3D6Y A;  3RBZ A;  1KV4 A;  1URQ C;  2LXB A;  1UII A;  2A45 I;  3B5N D;  3RK2 C;  3AE1 C;  4ASW A;  4EOT A;  2OTL P;  3GMA A;  4O9B A;  3LW5 J;  3H1K D;  3O8Z A;  3VYI A;  3L72 D;  3A5T A;  3CME P;  5APW A;  2YKQ A;  2D2C B;  1PGP A;  2HFE D;  4IOI H;  5K5G B;  1M1J B;  2FXM A;  3AEG C;  3FX0 A;  4H13 B;  3L75 D;  3I56 P;  2C9N Y;  1ZW0 A;  3F89 A;  2YMY A;  4WY4 B;  4EI2 A;  1HTL C;  3JSV C;  1IFD A;  1P84 D;  5KAI H;  3G4S P;  3II6 A;  2YO3 A;  1BE3 J;  3A0H H;  3A0B E;  1OXZ A;  1ZV8 A;  3KHU A;  3TGU J;  1RHZ B;  5AVR B;  1YHQ P;  2JJL A;  3NXS A;  1L0L K;  4I7Z B;  3H32 A;  2K9J B;  3CCV P;  1Q81 Q;  1JY2 O;  1RQV A;  3M0D A;  1LTB C;  1PGQ A;  1K9M Q;  3H1J G;  2BCC J;  2P10 A;  1LTJ B;  5KLV G;  3BCC D;  1NWQ A;  2OYH B;  1OVR A;  4JPZ B;  2YNY A;  2C0X A;  4NPE A;  4XA4 A;  3N7N A;  2O01 J;  3CCR P;  2V7Q H;  1GW3 A;  1DEE G;  1IFJ A;  5AW5 B;  3WUU A;  3U1A A;  3AED C;  1LTT C;  3GF7 A;  2GM4 A;  1JM0 A;  3D6Z A;  1FZG A;  1CSB A;  1VF5 B;  1SQV E;  4B86 A;  1IC2 A;  2E5T A;  4OGQ C;  3CCU P;  1X0T A;  1OX3 A;  1NTZ D;  1SQB D;  3HD7 A;  3R2P A;  3NMD A;  5TJH A;  2WT7 B;  3G6E P;  1MFZ A;  2ITA A;  1G2C A;  1T6A A;  2K3R A;  3H1J E;  5AVV B;  1H8A A;  3TSI A;  5AVZ B;  1NHL A;  1S5L H;  1FU1 A;  1LGH B;  2ZT9 B;  3L73 D;  4PD4 H;  2FYU E;  3CMA P;  2W90 A;  2OYI B;  1RQU A;  2J5U A;  1L0N D;  2RKL A;  3G3Z A;  1PP9 J;  5AW9 B;  5AVY B;  2ZT9 C;  1LWU B;  5AVW B;  1AVO A;  1YJW P;  3MP7 B;  4UB6 H;  2FFD C;  2VRS A;  3MZW B;  2AXC A;  1S5L X;  1LP1 A;  2RN0 A;  2JR8 A;  3CX5 I;  1YI2 P;  1KOR A;  2FFD A;  1FJP A;  3L70 D;  4KJM A;  5KJ7 C;  3PJS K;  4IFM A;  1HJ0 A;  3L72 G;  4I1L A;  5CCG D;  4L73 A;  5GTI H;  3MIW A;  5CHX A;  1NTM J;  2RH0 A;  4W7Y A;  1KQL A;  3HUS C;  4NPD A;  1PGJ A;  1SQP E;  3TF5 A;  3M9B A;  4XFJ A;  1VQ7 P;  2Q1K A;  5APY A;  2E75 C;  1SQX D;  2WMM A;  1FZC C;  1N7S D;  2W6B A;  1IFI A;  1LTG C;  1Q86 Q;  2H89 C;  1JNM A;  1FZC A;  2E43 A;  3CX5 D;  3B5N B;  5APQ A;  2XZR A;  3HD7 D;  3AE7 C;  3Q3D A;  2OYI A;  3SWF A;  1SLQ A;  3ITK A;  1NVO A;  2QJY B;  3V2R A;  3IAO A;  2BEQ D;  4N6J A;  1BGY D;  1SQQ D;  2R32 A;  3CXH E;  4QMA A;  3CC2 P;  3P8C E;  3HD7 B;  2Q3I A;  1W5C E;  2WZ7 A;  2Q3E A;  1Y8A A;  5CCH A;  1EZV E;  3RL0 D;  4PD4 I;  5GTH E;  5M1B A;  4N78 D;  2KLV A;  1R8E A;  4BWN A;  2G3A A;  2KK7 A;  1TU3 F;  2O1J A;  1KIL A;  4ZMD A;  1HF9 A;  2XNX A;  2KI7 B;  3L73 G;  3L35 A;  2KOG A;  1AJY A;  1EXJ A;  1YBK A;  1EXI A;  3AE5 C;  2E76 C;  2I8D A;  4PV1 D;  1EQ7 A;  3L72 J;  2CK3 H;  1QX8 A;  3GW6 A;  1GL2 B;  4ZKU A;  4HH2 A;  2AEM A;  5TIS E;  1HUC A;  3HTK A;  3PP5 A;  5GTH H;  3JCU E;  3RK2 B;  3KQG A;  4DT0 A;  3KXD A;  1J1D B;  2K37 A;  3CCM P;  2OTK E;  1M1K Q;  3S1K A;  3AE9 C;  3HUS A;  2V7Q J;  2H8P D;  1SQP D;  3FXD A;  3GHG A;  1XTG B;  3H1L D;  3JC2 2;  4DJG A;  2WT7 A;  3CC7 P;  3TGU D;  1DIP A;  1KTM A;  2IZ0 A;  1T3J A;  2HLO A;  3RGU A;  1FJK A;  1SQV K;  5APS A;  2ZJS E;  4YPC A;  4L76 A;  1YIJ P;  4D6T J;  1Y47 A;  1RF0 C;  1KB9 I;  4PJ0 E;  3VMY A;  1J1E C;  3BRT B;  2FYU G;  4D6T G;  1NU1 K;  3CCQ P;  2QA4 P;  2QEX P;  1H89 A;  1A02 F;  3BCC J;  4H0L D;  3W68 A;  4AYC A;  3V2P A;  1KIL B;  2Q6Q A;  3BAT A;  3E1I A;  1JUN A;  1Q82 Q;  2IBZ G;  2JWD A;  1L0N E;  2YIU C;  2WVR A;  3OA7 A;  4CPG A;  2IBZ E;  4YXD C;  4H0L B;  3PTZ A;  1GW4 A;  1NTM K;  3H1H E;  2G8Y A;  1KZU B;  3BVH A;  1LWU A;  3K5B A;  4C7R A;  1FDM A;  1AQT A;  2W6J H;  3L75 G;  5E79 H;  3V2Q A;  4BRY B;  5BVZ A;  4OH8 B;  5KLV J;  1YJN P;  1JY3 O;  2O1K A;  1NTZ J;  1SQB J;  1SS1 A;  1D7M A;  1KYO I;  1LTS C;  1JCC A;  2B87 A;  2N1T C;  2WSE H;  3LID A;  4D6T E;  2E42 A;  1IFP A;  3A0H E;  1KQF B;  3CCL P;  2BAS A;  1JY2 N;  3B5N A;  1NU1 E;  3L37 A;  2WSS H;  4H13 D;  4OGQ B;  1WT6 A;  1LT9 C;  2QRX A;  1GL2 A;  1DD3 A;  1GK4 A;  3B5N C;  5AVS B;  2IFM A;  4LLH A;  1JY3 N;  3C8V A;  2FKW B;  4EDF A;  1OIP A;  2A45 G;  1M1J A;  1FS0 E;  4DZO A;  1FZA A;  3L71 J;  2NPS A;  1BDD A;  2BCC E;  2IDB A;  4IL6 E;  4H44 D;  2WQY C;  1SFC B;  3L72 E;  2IBZ I;  2W6A A;  3TGU E;  1JEK A;  2FY8 A;  4C46 A;  3CCS P;  4JYC A;  2YIU B;  3MHV A;  1QLE D;  1NTM D;  2KYV A;  4H44 B;  1SFC D;  1HBW A;  1X22 A;  5TIS H;  2HOD A;  2N9Y B;  2Y0D A;  1FOS F;  4W80 A;  3M0D C;  1K8A Q;  3A2A A;  1L0L G;  4A7P A;  1NGM B;  2W83 C;  1MFT A;  4N3Y B;  2KSE A;  3HUS B;  5CBO A;  1CI6 A;  3D70 A;  4L74 A;  5KLI C;  1LJ2 A;  1PZQ A;  2O01 H;  1LWU C;  2M5A B;  2IZ1 A;  1GD2 E;  2HOD B;  1SQV D;  4AUW A;  1OW8 A;  2YKP A;  1RF1 B;  3H6P A;  1DX7 A;  2N1T D;  5CMZ A;  1AV1 A;  3NTN A;  4PJ0 H;  2M8R A;  1UIX A;  2WWW A;  1HGZ A;  1PP9 E;  1SQX G;  2YMK A;  1PPJ D;  4YTP C;  2WSF J;  1PP9 G;  1BSH A;  1GL2 C;  1BGY E;  1NKN A;  1SQQ E;  2M3B A;  1URQ A;  3CXH D;  3GLM A;  5GTI E;  1GU4 A;  1R5S A;  1MKM A;  5AW1 B;  5KAF E;  3C9I A;  2GA1 A;  1J1D C;  1KFN A;  1NTZ E;  1SQB E;  4RES B;  1VQK P;  1QVG O;  1NAF A;  3RK3 D;  1P84 I;  3L71 G;  1RE4 A;  3Q2Y A;  3H1K E;  1ZXG A;  1SVF A;  4GIF A;  1KQG B;  3V2N A;  2O01 N;  3WU2 H;  2XU6 A;  1N2D C;  4RJT A;  2W8Z A;  5KJ7 A;  3OAK A;  3L75 E;  5KAF H;  1NYH A;  2OTJ P;  2POH A;  1ZRT E;  3CXH H;  3H1K J;  3H1L J;  2B89 A;  4WY4 A;  1HVV A;  1KIL E;  3RK3 B;  3L70 E;  2WIT A;  1DEB A;  3SFD C;  1NTZ G;  1SQB G;  1U7J A;  4TT3 H;  4GKG A;  1L4A C;  1LT1 A;  1BCC G;  3AEF C;  3L75 J;  2K88 A;  4OWF A;  1S2E A;  1L4A A;  1YQ3 C;  4WVZ A;  1EDK A;  1E5W A;  1S5L E;  3M06 A;  4Y28 J;  3G71 P;  2E75 D;  1YJ9 P;  1N73 C;  1JO5 A;  2O3J A;  1BE3 G;  3NFQ A;  1KYO H;  1OFC X;  1Q90 D;  4JBZ A;  4OVN F;  2FXO A;  1NTK D;  5C39 A;  1RE3 A;  1EZV D;  1NO4 A;  2N1T B;  3ZDM A;  1VQL P;  2Z4E A;  4I6M C;  2E74 C;  1GU5 A;  3AE8 C;  1QL1 A;  2J59 M;  3CWB D;  4YXW H;  5AW4 B;  3FXE A;  1J2J B;  5KKZ C;  1FZC B;  1AVY A;  2R44 A;  5KLV E;  3Q5S A;  1OW7 A;  4Y99 C;  4BXL A;  1RF1 C;  3MTU E;  3E1R A;  3B4S A;  1BSN A;  4GT1 A;  1ZN5 A;  3EQ2 A;  4M3L A;  1KYO E;  1YTZ T;  2XKM A;  5APV A;  1S72 P;  3L74 J;  1KYO D;  1L0N K;  1RE4 C;  3GF3 A;  4RO0 A;  5AW3 B;  2ZAE B;  2QJP C;  3VMA A;  4DOJ A;  1VQ8 P;  2AEF A;  2I1J A;  1SFC A;  3O6Q B;  1BDC A;  3MUD C;  4R4L A;  1ZP0 C;  1N7S B;  2XV5 A;  2Q5U A;  2LXC B;  4NPF X;  3VN0 A;  5EFW B;  5KTB A;  5L8R J;  2Q9I A;  2FXP A;  1NTK K;  3CD6 P;  4LC1 A;  1IFN A;  3FGA D;  3V4W A;  2PFX A;  1EC5 A;  1SQP K;  1LTJ C;  2KB7 P;  1L0N J;  5H2F E;  2E74 B;  1JMM A;  3T97 A;  2WPV B;  1E79 H;  2LR2 A;  2E76 B;  3IN6 A;  2WPQ A;  1PPJ E;  1X8Y A;  1WMK A;  1M7L A;  1GL2 D;  2B87 B;  4IL6 X;  3HE5 A;  2KIK A;  3SWK A;  4IFD K;  4K35 A;  2PAJ A;  5AVQ B;  1GK6 A;  1LT9 B;  2QSI A;  3L70 J;  2NZ2 A;  4JQ0 D;  1RE3 C;  1KQS O;  2ZVO B;  3B8E B;  1KN7 A;  1PL5 A;  2HPC B;  4L75 A;  2A06 E;  2ZXE B;  1NAY A;  3OJA B;  5CJ0 A;  1VQP P;  2IFN A;  2KNC B;  1T2K C;  1EDL A;  2MKV A;  2Z5H A;  1IFM A;  3JCU H;  1YYC A;  3USS A;  5CCH D;  2ZVN B;  3OW2 O;  2WSC H;  1H0T A;  2J58 A;  3KDP B;  1VQN P;  1S9K E;  1NTM G;  2R3C A;  2WSC J;  2XND H;  2NRG A;  2ZT9 D;  1X79 B;  2ZYD A;  2Z5I A;  2IX7 C;  3M91 A;  3P8C D;  3QWO C;  5DJT B;  2WPS A;  5AW7 B;  2MJZ A;  2L5G B;  3SWY A;  1SQQ K;  2JP3 A;  1KIL C;  3VOP A;  2QJK B;  2M5A A;  1LTA C;  2K9J A;  1JTH B;  2KP8 A;  3AEB C;  2WPR A;  1BGY J;  1SQQ J;  4XE5 B;  1L4A D;  2Q7C A;  4AQR D;  1VQO P;  1M90 Q;  1RF1 A;  2ZXX A;  3H1L E;  3L71 E;  1BE3 D;  1VL2 A;  5AVX B;  1P84 H;  4PV1 B;  1SP4 A;  2N9B A;  3L74 E;  3KYQ A;  3VMZ A;  1PV3 A;  2KS1 B;  1M1J C;  4H13 C;  4HJG H;  4C7N B;  3BCC E;  2FYU J;  3TYY A;  2Y0E A;  1N7L A;  1K05 A;  3BCC G;  1EDJ A;  1M8O B;  4H44 C;  3H1J D;  2E74 D;  2M0B A;  4GOF A;  2C0W A;  3IF4 A;  2YO2 A;  2OYH A;  1G1J A;  3VP8 A;  1OZH A;  1BCC E;  4ASV A;  3L36 A;  4HKZ H;  1ZR4 A;  2FFD B;  1ZLL A;  3D71 A;  3TDK A;  4N78 E;  2IBZ D;  4LGD E;  4W7Z A;  1S3J A;  1BCC J;  1SQP J;  5APT A;  5AW2 B;  2OGU A;  2FYN C;  3CL3 D;  2YKO A;  5H2F H;  1K04 A;  4WY4 D;  1NTK J;  2V4H A;  4WB4 A;  2QG4 A;  5KAI E;  5BU5 A;  1IJD B;  2BCC G;  4I7Z C;  1EZV G;  4IL6 H;  2CPB A;  5APU A;  4ZKP A;  3AE6 C;  3TGU G;  3WU2 E;  1FC2 C;  3A0B H;  4KHX A;  1NTK E;  3E7K A;  1DH3 A;  1SQX K;  1FDO A;  2BEZ F;  2AEJ A;  1PPJ G;  1FAV A;  1FZB A;  3IFM A;  2QM7 A;  3M9H A;  3HD7 C;  2YXQ B;  4I2L C;  3RK2 D;  3S4R A;  1N7S A;  1YIT P;  1VQ6 P;  5BU8 B;  1T3U A;  2I1K A;  3CLQ A;  2P67 A;  2A45 H;  3P7K A;  3VTP C;  1FZE A;  1HJB A;  3CPW O;  3TK1 A;  1QL2 A;  3AEE C;  3BAS A;  1LP1 B;  1QGK B;  1XTC C;  2NPS C;  3EFG A;  3EFF K;  1LNQ A;  3A7O A;  2H88 C;  3H1H D;  4GOE A;  3V6I A;  4DCK A;  2Y9Z A;  1Q2N A;  1M57 D;  3H32 B;  1JOC A;  2FYN B;  1SQX J;  1USD A;  1YQ4 C;  3F5H A;  1IZN B;  1J1E B;  2K9Y A;  3TNU A;  3KZI E;  3I55 P;  3RL0 B;  3AE3 C;  5KLI B;  3TNU B;  3Q5P A;  1AA0 A;  2H43 A;  1GMJ A;  2B88 A;  1WRG A;  4WY4 C;  1ZME C;  2H7H A;  1EZV I;  4U3F D;  1YTZ I;  1NU1 D;  1RH5 B;  2R3S A;  4WWI A;  2LKM A;  1GZL A;  2WSE J;  3QH9 A;  1ZRT D;  3UIA A;  1U57 A;  1ZR2 A;  1URQ B;  1DD4 A;  1NTZ K;  1SQB K;  2GUV A;  5KLV K;  3Q1M A;  2A06 G;  3H1I D;  1MZ9 A;  2QJP B;  1N73 B;  3MGN A;  5B66 E;  2UWJ E;  3L74 G;  3WUT A;  3AE2 C;  1N73 A;  1H0T B;  2P2U A;  3V5B A;  1R5L A;  3P8M C;  5AVT B;  4ZNC A;  2B9B A;  4OGQ D;  1BE3 E;  1KB9 H;  4KT0 J;  1VPC A;  2OYI C;  2KLU A;  1A02 J;  1NKZ B;  1NTM E;  1VQ9 P;  5KKZ B;  3SFE C;  1VDF A;  2WSF H;  2DW3 A;  1FDI A;  3B71 A;  2Y0C A;  3PLN A;  5B5E E;  3CWB E;  1PFI A;  4TLF A;  1CZQ A;  3U1C A;  1N86 A;  1PGO A;  2K1A A;  3U59 A;  1L0L D;  3CCJ P;  1SQV J;  3PH0 A;  4U3F G;  2NPS D;  2L91 A;  1G2C B;  1KMI Z;  1JB0 J;  4GOD A;  1W2B O;  1Q7Y Q;  4U3F E;  5DJU B;  1VQ4 P;  2RMZ A;  1KB9 E;  3N4X A;  2KUB A;  2QIW A;  2QVA A;  5CBN A;  1LTI C;  1L0N G;  2JDI H;  2KZJ A;  1SFC C;  2HYN A;  4JF7 A;  2OYH C;  3CI9 A;  2FBW C;  1L4A B;  4PD4 D;  3P32 A; 
#chains in the Genus database with same CATH homology
 2ITA A;  2NRG A;  2DW3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...