1BDDA

Staphylococcus aureus protein a, immunoglobulin-binding b domain, nmr, minimized average structure
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
60
structure length
60
Chain Sequence
TADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCUS AUREUS PROTEIN A
publication title Three-dimensional solution structure of the B domain of staphylococcal protein A: comparisons of the solution and crystal structures.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immunoglobulin-binding protein
total genus 14
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1996-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1bddA00
2SPZA 4EYYQ 1ZXGA 1H0TA 2M5AB 5DJTB 4ZMDA 4ASWA 1EDKA 2QRXA 4GOEA 1OVUA 2M5AA 2P58A 2QVAA 2Q1KA 2B89A 3RGUA 5K5GB 4JBZA 1U7MA 1DEEG 4KJMA 4IOIH 1X0TA 1BDDA 4NPFX 2KUBA 3S1KA 2OTKE 2LXCB 1LP1B 4NPDA 4HKZH 4GODA 2HR3A 5CBNA 1LP1A 3PH0A 4GOFA 3MZWB 2RKLA 4CPGA 2M0BA 2KIKA 2KZIA 2WMMA 1EDIA 5EFWB 3FXEA 1LT1A 4MN4C 4ZNCA 1U7JA 1ZW0A 3QWOC 2LR2A 2KS1B 4BXLA 3MHVA 1FC2C 1OVVA 1S3JA 1Q2NA 2LXBA 4HB1A 1EDJA 1EC5A 2KZJA 5CBOA 2ZAEB 2JWDA 5DJUB 4ASVA 1EDLA 2B88A 1Y47A 1JMBA 2K3RA 2UWJE 3ZDMA 1SS1A 1OVRA 2I8DA 2KI7B 2B87B 1BDCA 1NVOA 1JM0A 4K3AA 2R44A 4NPEA 1MFTA 2B87A 3FXDA 4WWIA 1H0TB 4HJGH 5C39A 4K35A
chains in the Genus database with same CATH superfamily
1LT9C 4EYYQ 2P67A 1NTMJ 2I1JA 1CI6B 3L73J 2BEZF 3S4RA 1NTKE 3A0BH 3CCLP 3AE9C 3HE5B 1FZCC 1PL5A 4YPCA 1KB9D 4HYTB 4A7PA 1KILA 2ZVNB 3PH0A 2R32A 5CCGD 3PTZA 4CPGA 2ZT9B 5AW4B 2J5UA 1AJYA 3D70A 3G6EP 1YJWP 3QWOC 1VQ5P 2LR2A 1S5LX 1SQXD 4I2LC 1S5LE 1WMKA 2XZRA 1HTLC 3AE8C 2O3JA 1BGYE 3CC7P 3M91A 2KZJA 2A06E 5APVA 2JEEA 2HODA 3GHGC 4D6TD 3FGAD 2YMKA 1SS1A 1SQPK 3VOPA 1OW6A 1K05A 3CX5I 3JC22 1N7SB 3L74J 1JY3O 2BCCD 1CZQA 2BEQD 4K3AA 2HPCA 1DX7A 3IN6A 1RF0A 2E76C 1YQ4C 3MUDA 2Z4EA 5L8RJ 1JO5A 3NTNA 3HE4B 2WT7B 1URQB 1HBWA 4RESB 1VL2A 4UB8E 3L73G 1HWTC 1N73C 2R5BA 5AVSB 1ZMEC 1K04A 1DEEG 3O6QA 3FWNA 3CC4P 4HKZH 3H1LE 1R5SA 2WPRA 4KHXA 3NXSA 1JEKA 1KYOI 4H0LB 1JUNA 3B5NB 4U3FD 4EI2A 4ZNCA 2KS1B 2WSEH 2OYHC 1GMJA 2Q3IA 1LT9B 2C9NY 2GA1A 1EZVI 2QJKC 2FYUJ 3CX5D 1ZRTE 3OJAB 3SWFA 1SQQG 3CXHH 1H89A 3H1JJ 1YBKA 2W6BA 1QL2A 2XU6A 3HTKB 3Q1MA 1FZCB 3GLMA 1SQPJ 4PV1B 3V4QA 3HD7C 2AXTE 1LTGC 1VDFA 3H1IE 3H1KJ 1L4AD 4TLFA 1RF1A 1M90Q 5B66E 5GTHE 2J58A 2HYNA 1M1JA 3M06A 3AE4C 1BCCE 1IJDB 3PJSK 3CMEP 4L75A 3RBZA 1HUCA 1P84I 2K1AA 1VQNP 3I55P 1RQVA 3L35A 1VQ4P 2HFED 4PD4E 1T3JA 1KILD 2PGDA 4NPFX 4BRYA 3RK3D 3GHGB 3RL0D 5KLVD 4JYBA 1K8AQ 2RKLA 3C1LA 4DCKA 3AE3C 2O1JA 2H88C 2E76B 1EDIA 3VMXA 4H13B 1N7LA 1K9MQ 3N7NA 1JOCA 3BCCG 1PPJG 2A45I 1RE4A 2KXPB 3H32A 1NTZJ 1FC2C 3RK2D 1BE3G 4OWFA 3WUUA 1EDJA 4OGQD 1T6AA 1A02F 1JY2P 2Q7CA 2FYUG 3A0BE 1N73B 5AW2B 3HUSA 4KT0J 1FZFA 4W80A 3L75D 4JYCA 1RY3A 2W90A 4N78E 3H1KG 2FXMA 3VYIA 1R8EA 4C7NB 2GUVA 3GF3A 1P84D 2PAJA 4OVNF 1NU1G 1AVYA 2BCCJ 2OYHB 1NWQA 1SQBG 3TNUB 1FDOA 1IFJA 1GW4A 4JPZB 2QG4A 2O01N 5AVTB 2GUSA 1Y8AA 1N2DC 3U1AA 2XDJA 3TGUD 2KB7P 3M0DA 2N1TC 2IFNA 2YNYA 3HD7B 5CBNA 1PZQA 4Y28J 3TF5A 5AW5B 2E42A 2YO3A 2N9BA 1LTJC 5AVZB 3V4WA 3Q2YA 1VPCA 4DJGA 3H6PA 3GF7A 2J59M 1L0NG 1CW5A 3IR9A 1SP4A 1SQXG 3VTPC 5AW9B 2QIWA 2KK7A 1YHQP 3TYYA 1SQVK 2WSCJ 3L4FA 1SQQE 3D6ZA 3A2AA 2Z5HA 1PP9G 3L74D 1MUUA 4WWIA 5BVZA 1AQ5A 1YQ3C 2HG5D 4HJGH 4D6TG 3KQGA 3AEEC 3CCRP 3AEFC 3KXDA 1KZUB 2FYNC 4GOEA 2BCCG 2R3SA 3LW5H 4WB4A 2CK3H 2H7HA 1IFDA 2B89A 2ZYAA 5AVWB 2PP6A 2ZT9D 3CCVP 3CXHE 3S1KA 2OTKE 2IYOA 3L36A 2V7QJ 1AQTA 1YJNP 1RQUA 3T97A 5KAIH 5KLVJ 2W27A 1JCCA 5AVQB 1LWUB 1OZHA 4YXDC 3L72D 3G3ZA 1L0LK 1ZR2A 1ZN5A 1LTBC 3BCCE 1SFCA 1PPJE 4U3FG 4ASVA 3MD0A 1BE3E 2ZXXA 1GU5A 1URQC 3ZDMA 2YKQA 2NPSC 3H1JD 4AUWA 4IFDK 1SQVJ 3L71E 2N1TB 1BDCA 1SQPD 1PIXA 1JMMA 1KQFB 1OW8A 3V2PA 4U7JA 2AEFA 3CWBE 1LTJB 5CMZA 1VQPP 1SLQA 4H0LD 1RE3C 1NU1E 1JCDA 3H1HD 1KV4A 1SQBE 3B5ND 4JBZA 1GL2D 1BDDA 2QJYB 5AVUB 1LP1B 4XFJA 3SFEC 3D6YA 1G1IA 2H8PD 4H44C 3BVHA 5CCHC 3TGUJ 2YXRB 5EFWB 1NO4A 3ITKA 4PV1C 2OYIC 5AVVB 3P8CE 3WUTA 3FX0A 1LGHB 2FYNB 1NTZD 1L0LJ 2JJLA 5KJ7C 1AVOA 2ZAEB 2JWDA 1EXJA 1ZOYC 4UB6H 1Z56A 2WSFJ 2B88A 1Y47A 2YIUB 2K3RA 1LNQA 1L0NE 1P84H 5CCGC 2E5TA 4OH8B 1SQXE 1FAVA 2G8YA 2A06D 3OA7A 2SPZA 2IBZE 4W7ZA 1PP9E 2M5AB 3L75G 2FYZA 3WU2H 1Q86Q 2C0XA 2R3CA 1N8RQ 4IFMA 2XNDH 1JTHA 4D6TE 2DW3A 1M56D 1S9KD 1S1CX 2C0WA 4H13C 3R2PA 3Q3DA 2E76D 2A45H 3CD6P 1X0TA 2QEXP 5H2FH 4NPDA 1YJ9P 4GIFA 3VMAA 2NPSB 1S72P 1NTMG 2Y9ZA 3M0AA 1KMIZ 2KZIA 3LIDA 3W67A 2CPBA 4JQ0D 2KLVA 4BWNA 4WY4C 1PGQA 1GK6A 2B9BA 1QX8A 2AEJA 2BASA 1W5CE 1LTSC 1T2KD 1SFCD 2A45G 4JF7A 1FOSF 2ZYDA 1CSBA 3LIEA 4TT3H 2QSIA 1NTKK 4PD4I 1Q90D 4QMAA 1VF5B 3L72J 2YKPA 4U3FE 1YITP 2YKOA 1NHLA 1NVOA 4H44B 2P7JA 4I7ZC 4L74A 3EFFK 5KAIE 4EDFA 1ZRTD 1H0TA 4DT0A 2OYIB 1EDKA 1L0NK 2M8RA 1JB0J 4GDOA 1LTAC 1RHZB 3L74G 2FFDC 1CI6A 1U7MA 1USDA 1FE6A 3HE5A 1L4AC 2HR3A 4GT1A 3USSA 2HLOA 3H1HJ 1YYCA 2D2CC 1G2CB 2QE7H 1UIIA 2W8ZA 4Z1MH 4MN4C 1KYOD 1ZW0A 2NZ2A 4L73A 5B5EH 5GTIH 2E43A 4HB1A 1USEA 3BATA 1DD4A 1KILE 3G71P 3RK3E 2ZFCA 1KILC 1X8YA 2MKVA 2P2UA 2KSEA 1HF9A 3RK3C 1EZVD 1AFOA 3RL0C 3A7OA 5AW8B 3EWKA 2B87B 3PP5A 3CL3D 1GU4A 2W6JH 1SQVD 2WSSH 3FXDA 5KLIB 1N7SA 2PRRA 2E74D 4PJ0H 3NFQA 2Y0EA 3H1JG 4OGQC 3SWYA 2KSJA 1VQMP 3OW2O 1L2PA 1SQPG 4WY4B 3HE4A 2WT7A 1MZ9A 1BGYJ 3L75E 5K5GB 4UB6E 3UIAA 2KUBA 4N78D 1RF0C 2K9JB 3KHUA 1LWUC 1FU1A 1FZEA 1P84E 1KQLA 1KD1Q 1KB9H 1J1DC 3H1HG 1T8ZA 2KNCB 4RO0A 1FBMA 2E5YA 3AE1C 3VN0A 1N86A 1U7JA 3PLNA 3OAKA 1NTME 1RE3A 5TJHA 3B5NA 3L73E 4I7ZB 1GL2A 3MHVA 4IL6H 3N4XA 2KS1A 1K73Q 2N1TD 5CBOA 4AYCA 1PGOA 1LT9A 2O01J 2FBWC 2OQQA 1L0LD 2FFDB 1VQOP 2JO1A 1MFZA 2POHA 5AW7B 3CXHI 5H2FE 1L4AB 3HTKA 1NTZG 1FZCA 2R44A 3H1LJ 4GKGA 2M3EA 1J1EC 3CC2P 2D2CB 5APTA 2QJYC 4B86A 3AE2C 1OXZA 3CCQP 4XE5B 1M8OB 2KYVA 2P10A 4Y99C 1KILB 1KORA 2A06G 2WPVB 3RK3B 2QM7A 1NOHA 3RL0B 1RF1C 3L74E 3CCJP 5APXA 1IK7A 1M1JC 1EXIA 1OX3A 3GHGA 1JY3P 5AW6B 1FZAA 5AW3B 3H1IJ 2YIUC 2V4HA 1LT1A 1VQ7P 2K37A 4O9BA 3EFGA 3RK2B 1BCCJ 3P7KA 3A3YB 1QVFO 1OVVA 1Q2NA 4OGQB 1LJ2A 3CMAP 2HODB 5KKZC 1VQ6P 3MP7B 5DJUB 5APSA 5KTBA 1HH0A 3CCSP 1JMBA 2WSCH 3CX5H 2HPCB 1N73A 1NTMK 1KQGB 1X22A 2FY8A 3I56P 1IFMA 1N7SD 4N6JA 4N3YB 1J1DB 1IFIA 3AEAC 1M57D 2I1KA 4K35A 2WZ7A 2E75C 4C7NA 1ZXGA 2OYOA 5B5EE 4ZMDA 1URQD 5GTIE 2FYUE 2NPSD 1FZGA 3JCUH 3HUSC 1JY2O 2G3AA 1FOSE 2OYHA 3O6QB 3TNUA 3H1JE 3L71D 1PV3A 3TSIA 5CJ0A 2V7QH 3PHLA 1SQPE 4LC1A 3K5BA 3M9HA 5CHXA 3CPWO 1X79B 3H1KE 1KC8Q 1VQ8P 1KYOH 1YIJP 5BU8B 2WITA 2RH0A 3KYQA 3MZWB 1SQQK 2QJPC 2WWWA 1ZP0C 1FS0E 3HD7A 3CWBD 3IAOA 2WMMA 1J1EB 3L70D 4PJ0E 3MTUE 1VF5C 2IBZI 1NH4A 4RJTA 1GTWA 3CI9A 3B4SA 3EQ2A 1EC5A 1ZR4A 1SVFA 2OGUA 3S9OA 2FKWB 3M0DC 2KP8A 3M9QA 4H44D 4Y99B 2PFXA 2UWJE 1NYHA 1OVRA 1NTKD 5KLVG 1DD3A 1RF1B 4PV1D 2KI7B 1JM0A 1M1JB 4NPEA 3P8CD 1KB9E 1EZVG 2WVRA 3M9BA 5KJ7D 3TK1A 1NTZE 3MIWA 3RBXA 3D71A 4IL6X 5KAFH 3NMDA 4IL6E 1SQVG 2W83C 3VP9A 3GW6A 3VP8A 1L0ND 5KKZB 4BRYB 3RGUA 5APYA 1BGYD 2KLUA 2LXCB 1OWAA 4GODA 3KZIH 2XNXA 1M7LA 4M3LA 5APQA 3A0HH 2IBZD 2FYUK 4C7RA 1PP9D 3H25A 2ZXEB 1SQQJ 1W2EA 3FWLA 3H32B 2BCCE 5APUA 3E1RA 3B71A 4H13D 1NAYA 1OIPA 2OARA 2IZ0A 1S9KE 1U57A 1JNMA 4C46A 2E75B 2LXBA 2JKVA 2WSFH 3CCMP 2ZVOB 3JSVC 2WTYA 1IZNB 2WSEJ 3Q5PA 2O1KA 3HUSB 5KLIC 1LWUA 1BSHA 1FDMA 3BRVB 2C9LY 1NU1K 1QGKB 3TGUG 2XV5A 1SQBK 3KPEA 1OFCX 1MKMA 2OTLP 3IF4A 4WY4D 3MGNA 4IFFA 1MFTA 2ZJSE 2Z5IA 1L0LG 2N1TA 3BRTB 2YO2A 1FJPA 2QJPB 3G4SP 3H1LD 2KOGA 1IFPA 1T2KC 1SFCC 2Q3EA 5E79H 2QRXA 5TISH 4I1LA 1BSNA 2CPSA 1PGJA 1MV8A 2P58A 1LTJA 3AE6C 1T3UA 1GL2B 3P8MC 3U59A 4L76A 4IOIH 1LTTC 3BCCJ 2R5DA 1BE3J 1NTZK 2IDBA 3CX5E 5AVYB 1LP1A 1TU3F 1KQSO 3HD7D 1NAFA 2H89C 3L71J 1SQXK 1UIXA 3CCEP 4LGDE 4YTPC 1KFNA 3H1ID 4DZOA 3E7KA 5BU5A 1FZBA 1YI2P 1S3JA 1FDIA 4AQRD 2IX7C 1BCCD 3Q5SA 3JCUE 3CWBJ 2NRGA 4ZKPA 3L70J 1J2JB 2WQYC 3L37A 2D2CD 4WVZA 1NU1J 2N9YB 2IYPA 1D7MA 1Q81Q 1SQBJ 4R4LA 2I8DA 1NJIQ 5AVXB 1QVGO 4PD4D 1KYOE 1Q7YQ 2GM4A 3IFMA 3KDPB 5KLVE 1QEXA 3AECC 1NTKJ 1KTMA 3SSUA 1EZVE 3CCUP 3II6A 1OVUA 3V2RA 1HGZA 3L72G 2M5AA 2Y9YA 1S2EA 1S4XA 2QA4P 1GK4A 2P1JA 1GDTA 1SQVE 3RK2C 3F89A 1W2BO 2ITAA 1XTGB 1GZLA 1AV1A 1L0NJ 4GOFA 1URQA 3T97B 2E74C 1YTZT 2NPSA 3PRJA 3L71G 1NKZB 2KIKA 1SQXJ 1WRGA 5APWA 3FXEA 2JR8A 3AEGC 1KN7A 2LKMA 1KFMA 3W68A 2M3BA 4BXLA 2AEMA 2Q9IA 3MUDC 3TDKA 1ZLLA 1SFCB 2L5GB 2YXQB 1PP9J 5KAFE 2Y0CA 3HRNA 3CWBG 1A02J 1EDLA 4D6TJ 4LLHA 3L70G 5AW1B 1OW7A 3I5CA 1OMIA 3V6IA 1E5WA 1G1JA 3AEDC 3WMM0 3KZIE 2RMZA 3WU2E 1YTZI 1DH3A 1NTMD 3A0HE 3TGUE 2AXCA 1M1KQ 3L73D 2QM8A 3V5BA 2QJKB 2OTJP 2H43A 3G9RA 5C39A 2FXOA 4I6MC 1NTKG 4W7YA 1S5LH 5CCHA 1L0LE 4ASWA 1HJ0A 3VMYA 3AE5C 1JY2N 2OYIA 2JDIH 3LW5J 4KJMA 5KLVK 4YXWH 1QLED 5KJ7A 1ZV8A 1GW3A 1H8AA 3P32A 2VRSA 4U3FJ 3V2NA 2M0BA 1LTIC 5CCGA 1BGYG 1DEBA 1SQQD 1G2CA 3E1IA 1H88A 3R4YA 1NGMB 1XTCC 2ZYGA 2O01H 4UB8H 5E79E 5TISE 1PFIA 2IBZG 1E79H 3AEBC 1IO4A 1HVVA 3A5TA 2K9YA 3QH9A 1IFNA 1QL1A 3ABVC 3CXHD 4R4MA 2ZT9C 2B87A 4EOTA 2E74B 2RN0A 3CLQA 4DOJA 3GMAA 1FJKA 3V2QA 1HGVA 1JTHB 5DJTB 2XKMA 2L91A 2WPSA 2QVAA 2FXPA 5CJ4A 1IK9A 2Q1KA 4WY4A 1RE4C 3H1LG 3O8ZA 2Q5UA 4XA4A 3RL0g 3L72E 2K88A 1Q82Q 1DIPA 3Q5RA 2AXTH 3SFDC 4RKUJ 1N7SC 3BCCD 1PPJD 3C9IA 2E75D 1NKNA 4HH2A 1BE3D 3SWKA 2K9JA 1X9VA 5B66H 5GTHH 3B8EB 2IZ1A 1KB9I 2MJZA 1VQ9P 2FYUD 2JP3A 3AE7C 1AA0A 1HJBA 2KNCA 4EIJA 3VMZA 2YMYA 1VQLP 1PGPA 3C8VA 2IFMA 1GD2E 3U1CA 1JY3N 2IPPA 5AW0B 3H1KD 2WPQA 2W6AA 4PD4H 4ZKUA 3BASA 3H1IG 1VQKP 2JWAA 3L75J 5AVRB 1WT6A 2FFDA 1NU1D 3H1HE 4WBAA 4H0LC 3WUVA 1SQBD 1Y9BA 1BCCG 1VF5D 3F5HA 3L70E 1R5LA 2Y0DA 5M1BA 1EQ7A 2Q6QA 1IC2A 3B5NC 1GL2C 3GG2A 1L4AA 1H0TB 1RH5B 5CCHD
chains in the Genus database with same CATH topology
2SPZA 4EYYQ 1ZXGA 1H0TA 2M5AB 5DJTB 4ZMDA 4ASWA 1EDKA 2QRXA 4GOEA 1OVUA 2M5AA 2P58A 2QVAA 2Q1KA 2B89A 3RGUA 5K5GB 4JBZA 1U7MA 1DEEG 4KJMA 4IOIH 1X0TA 1BDDA 4NPFX 2KUBA 3S1KA 2OTKE 2LXCB 1LP1B 4NPDA 4HKZH 4GODA 2HR3A 5CBNA 1LP1A 3PH0A 4GOFA 3MZWB 2RKLA 4CPGA 2M0BA 2KIKA 2KZIA 2WMMA 1EDIA 5EFWB 3FXEA 1LT1A 4MN4C 4ZNCA 1U7JA 1ZW0A 3QWOC 2LR2A 2KS1B 4BXLA 3MHVA 1FC2C 1OVVA 1S3JA 1Q2NA 2LXBA 4HB1A 1EDJA 1EC5A 2KZJA 5CBOA 2ZAEB 2JWDA 5DJUB 4ASVA 1EDLA 2B88A 1Y47A 1JMBA 2K3RA 2UWJE 3ZDMA 1SS1A 1OVRA 2I8DA 2KI7B 2B87B 1BDCA 1NVOA 1JM0A 4K3AA 2R44A 4NPEA 1MFTA 2B87A 3FXDA 4WWIA 1H0TB 4HJGH 5C39A 4K35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SPZ A;  4EYY Q;  1ZXG A;  1H0T A;  2M5A B;  5DJT B;  4ZMD A;  4ASW A;  1EDK A;  2QRX A;  4GOE A;  1OVU A;  2M5A A;  2P58 A;  2QVA A;  2Q1K A;  2B89 A;  3RGU A;  5K5G B;  4JBZ A;  1U7M A;  1DEE G;  4KJM A;  4IOI H;  1X0T A;  1BDD A;  4NPF X;  2KUB A;  3S1K A;  2OTK E;  2LXC B;  1LP1 B;  4NPD A;  4HKZ H;  4GOD A;  2HR3 A;  5CBN A;  1LP1 A;  3PH0 A;  4GOF A;  3MZW B;  2RKL A;  4CPG A;  2M0B A;  2KIK A;  2KZI A;  2WMM A;  1EDI A;  5EFW B;  3FXE A;  1LT1 A;  4MN4 C;  4ZNC A;  1U7J A;  1ZW0 A;  3QWO C;  2LR2 A;  2KS1 B;  4BXL A;  3MHV A;  1FC2 C;  1OVV A;  1S3J A;  1Q2N A;  2LXB A;  4HB1 A;  1EDJ A;  1EC5 A;  2KZJ A;  5CBO A;  2ZAE B;  2JWD A;  5DJU B;  4ASV A;  1EDL A;  2B88 A;  1Y47 A;  1JMB A;  2K3R A;  2UWJ E;  3ZDM A;  1SS1 A;  1OVR A;  2I8D A;  2KI7 B;  2B87 B;  1BDC A;  1NVO A;  1JM0 A;  4K3A A;  2R44 A;  4NPE A;  1MFT A;  2B87 A;  3FXD A;  4WWI A;  1H0T B;  4HJG H;  5C39 A;  4K35 A; 
#chains in the Genus database with same CATH topology
 1LT9 C;  4EYY Q;  2P67 A;  1NTM J;  2I1J A;  1CI6 B;  3L73 J;  2BEZ F;  3S4R A;  1NTK E;  3A0B H;  3CCL P;  3AE9 C;  3HE5 B;  1FZC C;  1PL5 A;  4YPC A;  1KB9 D;  4HYT B;  4A7P A;  1KIL A;  2ZVN B;  3PH0 A;  2R32 A;  5CCG D;  3PTZ A;  4CPG A;  2ZT9 B;  5AW4 B;  2J5U A;  1AJY A;  3D70 A;  3G6E P;  1YJW P;  3QWO C;  1VQ5 P;  2LR2 A;  1S5L X;  1SQX D;  4I2L C;  1S5L E;  1WMK A;  2XZR A;  1HTL C;  3AE8 C;  2O3J A;  1BGY E;  3CC7 P;  3M91 A;  2KZJ A;  2A06 E;  5APV A;  2JEE A;  2HOD A;  3GHG C;  4D6T D;  3FGA D;  2YMK A;  1SS1 A;  1SQP K;  3VOP A;  1OW6 A;  1K05 A;  3CX5 I;  3JC2 2;  1N7S B;  3L74 J;  1JY3 O;  2BCC D;  1CZQ A;  2BEQ D;  4K3A A;  2HPC A;  1DX7 A;  3IN6 A;  1RF0 A;  2E76 C;  1YQ4 C;  3MUD A;  2Z4E A;  5L8R J;  1JO5 A;  3NTN A;  3HE4 B;  2WT7 B;  1URQ B;  1HBW A;  4RES B;  1VL2 A;  4UB8 E;  3L73 G;  1HWT C;  1N73 C;  2R5B A;  5AVS B;  1ZME C;  1K04 A;  1DEE G;  3O6Q A;  3FWN A;  3CC4 P;  4HKZ H;  3H1L E;  1R5S A;  2WPR A;  4KHX A;  3NXS A;  1JEK A;  1KYO I;  4H0L B;  1JUN A;  3B5N B;  4U3F D;  4EI2 A;  4ZNC A;  2KS1 B;  2WSE H;  2OYH C;  1GMJ A;  2Q3I A;  1LT9 B;  2C9N Y;  2GA1 A;  1EZV I;  2QJK C;  2FYU J;  3CX5 D;  1ZRT E;  3OJA B;  3SWF A;  1SQQ G;  3CXH H;  1H89 A;  3H1J J;  1YBK A;  2W6B A;  1QL2 A;  2XU6 A;  3HTK B;  3Q1M A;  1FZC B;  3GLM A;  1SQP J;  4PV1 B;  3V4Q A;  3HD7 C;  2AXT E;  1LTG C;  1VDF A;  3H1I E;  3H1K J;  1L4A D;  4TLF A;  1RF1 A;  1M90 Q;  5B66 E;  5GTH E;  2J58 A;  2HYN A;  1M1J A;  3M06 A;  3AE4 C;  1BCC E;  1IJD B;  3PJS K;  3CME P;  4L75 A;  3RBZ A;  1HUC A;  1P84 I;  2K1A A;  1VQN P;  3I55 P;  1RQV A;  3L35 A;  1VQ4 P;  2HFE D;  4PD4 E;  1T3J A;  1KIL D;  2PGD A;  4NPF X;  4BRY A;  3RK3 D;  3GHG B;  3RL0 D;  5KLV D;  4JYB A;  1K8A Q;  2RKL A;  3C1L A;  4DCK A;  3AE3 C;  2O1J A;  2H88 C;  2E76 B;  1EDI A;  3VMX A;  4H13 B;  1N7L A;  1K9M Q;  3N7N A;  1JOC A;  3BCC G;  1PPJ G;  2A45 I;  1RE4 A;  2KXP B;  3H32 A;  1NTZ J;  1FC2 C;  3RK2 D;  1BE3 G;  4OWF A;  3WUU A;  1EDJ A;  4OGQ D;  1T6A A;  1A02 F;  1JY2 P;  2Q7C A;  2FYU G;  3A0B E;  1N73 B;  5AW2 B;  3HUS A;  4KT0 J;  1FZF A;  4W80 A;  3L75 D;  4JYC A;  1RY3 A;  2W90 A;  4N78 E;  3H1K G;  2FXM A;  3VYI A;  1R8E A;  4C7N B;  2GUV A;  3GF3 A;  1P84 D;  2PAJ A;  4OVN F;  1NU1 G;  1AVY A;  2BCC J;  2OYH B;  1NWQ A;  1SQB G;  3TNU B;  1FDO A;  1IFJ A;  1GW4 A;  4JPZ B;  2QG4 A;  2O01 N;  5AVT B;  2GUS A;  1Y8A A;  1N2D C;  3U1A A;  2XDJ A;  3TGU D;  2KB7 P;  3M0D A;  2N1T C;  2IFN A;  2YNY A;  3HD7 B;  5CBN A;  1PZQ A;  4Y28 J;  3TF5 A;  5AW5 B;  2E42 A;  2YO3 A;  2N9B A;  1LTJ C;  5AVZ B;  3V4W A;  3Q2Y A;  1VPC A;  4DJG A;  3H6P A;  3GF7 A;  2J59 M;  1L0N G;  1CW5 A;  3IR9 A;  1SP4 A;  1SQX G;  3VTP C;  5AW9 B;  2QIW A;  2KK7 A;  1YHQ P;  3TYY A;  1SQV K;  2WSC J;  3L4F A;  1SQQ E;  3D6Z A;  3A2A A;  2Z5H A;  1PP9 G;  3L74 D;  1MUU A;  4WWI A;  5BVZ A;  1AQ5 A;  1YQ3 C;  2HG5 D;  4HJG H;  4D6T G;  3KQG A;  3AEE C;  3CCR P;  3AEF C;  3KXD A;  1KZU B;  2FYN C;  4GOE A;  2BCC G;  2R3S A;  3LW5 H;  4WB4 A;  2CK3 H;  2H7H A;  1IFD A;  2B89 A;  2ZYA A;  5AVW B;  2PP6 A;  2ZT9 D;  3CCV P;  3CXH E;  3S1K A;  2OTK E;  2IYO A;  3L36 A;  2V7Q J;  1AQT A;  1YJN P;  1RQU A;  3T97 A;  5KAI H;  5KLV J;  2W27 A;  1JCC A;  5AVQ B;  1LWU B;  1OZH A;  4YXD C;  3L72 D;  3G3Z A;  1L0L K;  1ZR2 A;  1ZN5 A;  1LTB C;  3BCC E;  1SFC A;  1PPJ E;  4U3F G;  4ASV A;  3MD0 A;  1BE3 E;  2ZXX A;  1GU5 A;  1URQ C;  3ZDM A;  2YKQ A;  2NPS C;  3H1J D;  4AUW A;  4IFD K;  1SQV J;  3L71 E;  2N1T B;  1BDC A;  1SQP D;  1PIX A;  1JMM A;  1KQF B;  1OW8 A;  3V2P A;  4U7J A;  2AEF A;  3CWB E;  1LTJ B;  5CMZ A;  1VQP P;  1SLQ A;  4H0L D;  1RE3 C;  1NU1 E;  1JCD A;  3H1H D;  1KV4 A;  1SQB E;  3B5N D;  4JBZ A;  1GL2 D;  1BDD A;  2QJY B;  5AVU B;  1LP1 B;  4XFJ A;  3SFE C;  3D6Y A;  1G1I A;  2H8P D;  4H44 C;  3BVH A;  5CCH C;  3TGU J;  2YXR B;  5EFW B;  1NO4 A;  3ITK A;  4PV1 C;  2OYI C;  5AVV B;  3P8C E;  3WUT A;  3FX0 A;  1LGH B;  2FYN B;  1NTZ D;  1L0L J;  2JJL A;  5KJ7 C;  1AVO A;  2ZAE B;  2JWD A;  1EXJ A;  1ZOY C;  4UB6 H;  1Z56 A;  2WSF J;  2B88 A;  1Y47 A;  2YIU B;  2K3R A;  1LNQ A;  1L0N E;  1P84 H;  5CCG C;  2E5T A;  4OH8 B;  1SQX E;  1FAV A;  2G8Y A;  2A06 D;  3OA7 A;  2SPZ A;  2IBZ E;  4W7Z A;  1PP9 E;  2M5A B;  3L75 G;  2FYZ A;  3WU2 H;  1Q86 Q;  2C0X A;  2R3C A;  1N8R Q;  4IFM A;  2XND H;  1JTH A;  4D6T E;  2DW3 A;  1M56 D;  1S9K D;  1S1C X;  2C0W A;  4H13 C;  3R2P A;  3Q3D A;  2E76 D;  2A45 H;  3CD6 P;  1X0T A;  2QEX P;  5H2F H;  4NPD A;  1YJ9 P;  4GIF A;  3VMA A;  2NPS B;  1S72 P;  1NTM G;  2Y9Z A;  3M0A A;  1KMI Z;  2KZI A;  3LID A;  3W67 A;  2CPB A;  4JQ0 D;  2KLV A;  4BWN A;  4WY4 C;  1PGQ A;  1GK6 A;  2B9B A;  1QX8 A;  2AEJ A;  2BAS A;  1W5C E;  1LTS C;  1T2K D;  1SFC D;  2A45 G;  4JF7 A;  1FOS F;  2ZYD A;  1CSB A;  3LIE A;  4TT3 H;  2QSI A;  1NTK K;  4PD4 I;  1Q90 D;  4QMA A;  1VF5 B;  3L72 J;  2YKP A;  4U3F E;  1YIT P;  2YKO A;  1NHL A;  1NVO A;  4H44 B;  2P7J A;  4I7Z C;  4L74 A;  3EFF K;  5KAI E;  4EDF A;  1ZRT D;  1H0T A;  4DT0 A;  2OYI B;  1EDK A;  1L0N K;  2M8R A;  1JB0 J;  4GDO A;  1LTA C;  1RHZ B;  3L74 G;  2FFD C;  1CI6 A;  1U7M A;  1USD A;  1FE6 A;  3HE5 A;  1L4A C;  2HR3 A;  4GT1 A;  3USS A;  2HLO A;  3H1H J;  1YYC A;  2D2C C;  1G2C B;  2QE7 H;  1UII A;  2W8Z A;  4Z1M H;  4MN4 C;  1KYO D;  1ZW0 A;  2NZ2 A;  4L73 A;  5B5E H;  5GTI H;  2E43 A;  4HB1 A;  1USE A;  3BAT A;  1DD4 A;  1KIL E;  3G71 P;  3RK3 E;  2ZFC A;  1KIL C;  1X8Y A;  2MKV A;  2P2U A;  2KSE A;  1HF9 A;  3RK3 C;  1EZV D;  1AFO A;  3RL0 C;  3A7O A;  5AW8 B;  3EWK A;  2B87 B;  3PP5 A;  3CL3 D;  1GU4 A;  2W6J H;  1SQV D;  2WSS H;  3FXD A;  5KLI B;  1N7S A;  2PRR A;  2E74 D;  4PJ0 H;  3NFQ A;  2Y0E A;  3H1J G;  4OGQ C;  3SWY A;  2KSJ A;  1VQM P;  3OW2 O;  1L2P A;  1SQP G;  4WY4 B;  3HE4 A;  2WT7 A;  1MZ9 A;  1BGY J;  3L75 E;  5K5G B;  4UB6 E;  3UIA A;  2KUB A;  4N78 D;  1RF0 C;  2K9J B;  3KHU A;  1LWU C;  1FU1 A;  1FZE A;  1P84 E;  1KQL A;  1KD1 Q;  1KB9 H;  1J1D C;  3H1H G;  1T8Z A;  2KNC B;  4RO0 A;  1FBM A;  2E5Y A;  3AE1 C;  3VN0 A;  1N86 A;  1U7J A;  3PLN A;  3OAK A;  1NTM E;  1RE3 A;  5TJH A;  3B5N A;  3L73 E;  4I7Z B;  1GL2 A;  3MHV A;  4IL6 H;  3N4X A;  2KS1 A;  1K73 Q;  2N1T D;  5CBO A;  4AYC A;  1PGO A;  1LT9 A;  2O01 J;  2FBW C;  2OQQ A;  1L0L D;  2FFD B;  1VQO P;  2JO1 A;  1MFZ A;  2POH A;  5AW7 B;  3CXH I;  5H2F E;  1L4A B;  3HTK A;  1NTZ G;  1FZC A;  2R44 A;  3H1L J;  4GKG A;  2M3E A;  1J1E C;  3CC2 P;  2D2C B;  5APT A;  2QJY C;  4B86 A;  3AE2 C;  1OXZ A;  3CCQ P;  4XE5 B;  1M8O B;  2KYV A;  2P10 A;  4Y99 C;  1KIL B;  1KOR A;  2A06 G;  2WPV B;  3RK3 B;  2QM7 A;  1NOH A;  3RL0 B;  1RF1 C;  3L74 E;  3CCJ P;  5APX A;  1IK7 A;  1M1J C;  1EXI A;  1OX3 A;  3GHG A;  1JY3 P;  5AW6 B;  1FZA A;  5AW3 B;  3H1I J;  2YIU C;  2V4H A;  1LT1 A;  1VQ7 P;  2K37 A;  4O9B A;  3EFG A;  3RK2 B;  1BCC J;  3P7K A;  3A3Y B;  1QVF O;  1OVV A;  1Q2N A;  4OGQ B;  1LJ2 A;  3CMA P;  2HOD B;  5KKZ C;  1VQ6 P;  3MP7 B;  5DJU B;  5APS A;  5KTB A;  1HH0 A;  3CCS P;  1JMB A;  2WSC H;  3CX5 H;  2HPC B;  1N73 A;  1NTM K;  1KQG B;  1X22 A;  2FY8 A;  3I56 P;  1IFM A;  1N7S D;  4N6J A;  4N3Y B;  1J1D B;  1IFI A;  3AEA C;  1M57 D;  2I1K A;  4K35 A;  2WZ7 A;  2E75 C;  4C7N A;  1ZXG A;  2OYO A;  5B5E E;  4ZMD A;  1URQ D;  5GTI E;  2FYU E;  2NPS D;  1FZG A;  3JCU H;  3HUS C;  1JY2 O;  2G3A A;  1FOS E;  2OYH A;  3O6Q B;  3TNU A;  3H1J E;  3L71 D;  1PV3 A;  3TSI A;  5CJ0 A;  2V7Q H;  3PHL A;  1SQP E;  4LC1 A;  3K5B A;  3M9H A;  5CHX A;  3CPW O;  1X79 B;  3H1K E;  1KC8 Q;  1VQ8 P;  1KYO H;  1YIJ P;  5BU8 B;  2WIT A;  2RH0 A;  3KYQ A;  3MZW B;  1SQQ K;  2QJP C;  2WWW A;  1ZP0 C;  1FS0 E;  3HD7 A;  3CWB D;  3IAO A;  2WMM A;  1J1E B;  3L70 D;  4PJ0 E;  3MTU E;  1VF5 C;  2IBZ I;  1NH4 A;  4RJT A;  1GTW A;  3CI9 A;  3B4S A;  3EQ2 A;  1EC5 A;  1ZR4 A;  1SVF A;  2OGU A;  3S9O A;  2FKW B;  3M0D C;  2KP8 A;  3M9Q A;  4H44 D;  4Y99 B;  2PFX A;  2UWJ E;  1NYH A;  1OVR A;  1NTK D;  5KLV G;  1DD3 A;  1RF1 B;  4PV1 D;  2KI7 B;  1JM0 A;  1M1J B;  4NPE A;  3P8C D;  1KB9 E;  1EZV G;  2WVR A;  3M9B A;  5KJ7 D;  3TK1 A;  1NTZ E;  3MIW A;  3RBX A;  3D71 A;  4IL6 X;  5KAF H;  3NMD A;  4IL6 E;  1SQV G;  2W83 C;  3VP9 A;  3GW6 A;  3VP8 A;  1L0N D;  5KKZ B;  4BRY B;  3RGU A;  5APY A;  1BGY D;  2KLU A;  2LXC B;  1OWA A;  4GOD A;  3KZI H;  2XNX A;  1M7L A;  4M3L A;  5APQ A;  3A0H H;  2IBZ D;  2FYU K;  4C7R A;  1PP9 D;  3H25 A;  2ZXE B;  1SQQ J;  1W2E A;  3FWL A;  3H32 B;  2BCC E;  5APU A;  3E1R A;  3B71 A;  4H13 D;  1NAY A;  1OIP A;  2OAR A;  2IZ0 A;  1S9K E;  1U57 A;  1JNM A;  4C46 A;  2E75 B;  2LXB A;  2JKV A;  2WSF H;  3CCM P;  2ZVO B;  3JSV C;  2WTY A;  1IZN B;  2WSE J;  3Q5P A;  2O1K A;  3HUS B;  5KLI C;  1LWU A;  1BSH A;  1FDM A;  3BRV B;  2C9L Y;  1NU1 K;  1QGK B;  3TGU G;  2XV5 A;  1SQB K;  3KPE A;  1OFC X;  1MKM A;  2OTL P;  3IF4 A;  4WY4 D;  3MGN A;  4IFF A;  1MFT A;  2ZJS E;  2Z5I A;  1L0L G;  2N1T A;  3BRT B;  2YO2 A;  1FJP A;  2QJP B;  3G4S P;  3H1L D;  2KOG A;  1IFP A;  1T2K C;  1SFC C;  2Q3E A;  5E79 H;  2QRX A;  5TIS H;  4I1L A;  1BSN A;  2CPS A;  1PGJ A;  1MV8 A;  2P58 A;  1LTJ A;  3AE6 C;  1T3U A;  1GL2 B;  3P8M C;  3U59 A;  4L76 A;  4IOI H;  1LTT C;  3BCC J;  2R5D A;  1BE3 J;  1NTZ K;  2IDB A;  3CX5 E;  5AVY B;  1LP1 A;  1TU3 F;  1KQS O;  3HD7 D;  1NAF A;  2H89 C;  3L71 J;  1SQX K;  1UIX A;  3CCE P;  4LGD E;  4YTP C;  1KFN A;  3H1I D;  4DZO A;  3E7K A;  5BU5 A;  1FZB A;  1YI2 P;  1S3J A;  1FDI A;  4AQR D;  2IX7 C;  1BCC D;  3Q5S A;  3JCU E;  3CWB J;  2NRG A;  4ZKP A;  3L70 J;  1J2J B;  2WQY C;  3L37 A;  2D2C D;  4WVZ A;  1NU1 J;  2N9Y B;  2IYP A;  1D7M A;  1Q81 Q;  1SQB J;  4R4L A;  2I8D A;  1NJI Q;  5AVX B;  1QVG O;  4PD4 D;  1KYO E;  1Q7Y Q;  2GM4 A;  3IFM A;  3KDP B;  5KLV E;  1QEX A;  3AEC C;  1NTK J;  1KTM A;  3SSU A;  1EZV E;  3CCU P;  3II6 A;  1OVU A;  3V2R A;  1HGZ A;  3L72 G;  2M5A A;  2Y9Y A;  1S2E A;  1S4X A;  2QA4 P;  1GK4 A;  2P1J A;  1GDT A;  1SQV E;  3RK2 C;  3F89 A;  1W2B O;  2ITA A;  1XTG B;  1GZL A;  1AV1 A;  1L0N J;  4GOF A;  1URQ A;  3T97 B;  2E74 C;  1YTZ T;  2NPS A;  3PRJ A;  3L71 G;  1NKZ B;  2KIK A;  1SQX J;  1WRG A;  5APW A;  3FXE A;  2JR8 A;  3AEG C;  1KN7 A;  2LKM A;  1KFM A;  3W68 A;  2M3B A;  4BXL A;  2AEM A;  2Q9I A;  3MUD C;  3TDK A;  1ZLL A;  1SFC B;  2L5G B;  2YXQ B;  1PP9 J;  5KAF E;  2Y0C A;  3HRN A;  3CWB G;  1A02 J;  1EDL A;  4D6T J;  4LLH A;  3L70 G;  5AW1 B;  1OW7 A;  3I5C A;  1OMI A;  3V6I A;  1E5W A;  1G1J A;  3AED C;  3WMM 0;  3KZI E;  2RMZ A;  3WU2 E;  1YTZ I;  1DH3 A;  1NTM D;  3A0H E;  3TGU E;  2AXC A;  1M1K Q;  3L73 D;  2QM8 A;  3V5B A;  2QJK B;  2OTJ P;  2H43 A;  3G9R A;  5C39 A;  2FXO A;  4I6M C;  1NTK G;  4W7Y A;  1S5L H;  5CCH A;  1L0L E;  4ASW A;  1HJ0 A;  3VMY A;  3AE5 C;  1JY2 N;  2OYI A;  2JDI H;  3LW5 J;  4KJM A;  5KLV K;  4YXW H;  1QLE D;  5KJ7 A;  1ZV8 A;  1GW3 A;  1H8A A;  3P32 A;  2VRS A;  4U3F J;  3V2N A;  2M0B A;  1LTI C;  5CCG A;  1BGY G;  1DEB A;  1SQQ D;  1G2C A;  3E1I A;  1H88 A;  3R4Y A;  1NGM B;  1XTC C;  2ZYG A;  2O01 H;  4UB8 H;  5E79 E;  5TIS E;  1PFI A;  2IBZ G;  1E79 H;  3AEB C;  1IO4 A;  1HVV A;  3A5T A;  2K9Y A;  3QH9 A;  1IFN A;  1QL1 A;  3ABV C;  3CXH D;  4R4M A;  2ZT9 C;  2B87 A;  4EOT A;  2E74 B;  2RN0 A;  3CLQ A;  4DOJ A;  3GMA A;  1FJK A;  3V2Q A;  1HGV A;  1JTH B;  5DJT B;  2XKM A;  2L91 A;  2WPS A;  2QVA A;  2FXP A;  5CJ4 A;  1IK9 A;  2Q1K A;  4WY4 A;  1RE4 C;  3H1L G;  3O8Z A;  2Q5U A;  4XA4 A;  3RL0 g;  3L72 E;  2K88 A;  1Q82 Q;  1DIP A;  3Q5R A;  2AXT H;  3SFD C;  4RKU J;  1N7S C;  3BCC D;  1PPJ D;  3C9I A;  2E75 D;  1NKN A;  4HH2 A;  1BE3 D;  3SWK A;  2K9J A;  1X9V A;  5B66 H;  5GTH H;  3B8E B;  2IZ1 A;  1KB9 I;  2MJZ A;  1VQ9 P;  2FYU D;  2JP3 A;  3AE7 C;  1AA0 A;  1HJB A;  2KNC A;  4EIJ A;  3VMZ A;  2YMY A;  1VQL P;  1PGP A;  3C8V A;  2IFM A;  1GD2 E;  3U1C A;  1JY3 N;  2IPP A;  5AW0 B;  3H1K D;  2WPQ A;  2W6A A;  4PD4 H;  4ZKU A;  3BAS A;  3H1I G;  1VQK P;  2JWA A;  3L75 J;  5AVR B;  1WT6 A;  2FFD A;  1NU1 D;  3H1H E;  4WBA A;  4H0L C;  3WUV A;  1SQB D;  1Y9B A;  1BCC G;  1VF5 D;  3F5H A;  3L70 E;  1R5L A;  2Y0D A;  5M1B A;  1EQ7 A;  2Q6Q A;  1IC2 A;  3B5N C;  1GL2 C;  3GG2 A;  1L4A A;  1H0T B;  1RH5 B;  5CCH D; 
#chains in the Genus database with same CATH homology
 2SPZ A;  4EYY Q;  1ZXG A;  1H0T A;  2M5A B;  5DJT B;  4ZMD A;  4ASW A;  1EDK A;  2QRX A;  4GOE A;  1OVU A;  2M5A A;  2P58 A;  2QVA A;  2Q1K A;  2B89 A;  3RGU A;  5K5G B;  4JBZ A;  1U7M A;  1DEE G;  4KJM A;  4IOI H;  1X0T A;  1BDD A;  4NPF X;  2KUB A;  3S1K A;  2OTK E;  2LXC B;  1LP1 B;  4NPD A;  4HKZ H;  4GOD A;  2HR3 A;  5CBN A;  1LP1 A;  3PH0 A;  4GOF A;  3MZW B;  2RKL A;  4CPG A;  2M0B A;  2KIK A;  2KZI A;  2WMM A;  1EDI A;  5EFW B;  3FXE A;  1LT1 A;  4MN4 C;  4ZNC A;  1U7J A;  1ZW0 A;  3QWO C;  2LR2 A;  2KS1 B;  4BXL A;  3MHV A;  1FC2 C;  1OVV A;  1S3J A;  1Q2N A;  2LXB A;  4HB1 A;  1EDJ A;  1EC5 A;  2KZJ A;  5CBO A;  2ZAE B;  2JWD A;  5DJU B;  4ASV A;  1EDL A;  2B88 A;  1Y47 A;  1JMB A;  2K3R A;  2UWJ E;  3ZDM A;  1SS1 A;  1OVR A;  2I8D A;  2KI7 B;  2B87 B;  1BDC A;  1NVO A;  1JM0 A;  4K3A A;  2R44 A;  4NPE A;  1MFT A;  2B87 A;  3FXD A;  4WWI A;  1H0T B;  4HJG H;  5C39 A;  4K35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...