1BDDA

Staphylococcus aureus protein a, immunoglobulin-binding b domain, nmr, minimized average structure
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
60
structure length
60
Chain Sequence
TADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin-binding protein
molecule keywords STAPHYLOCOCCUS AUREUS PROTEIN A
publication title Three-dimensional solution structure of the B domain of staphylococcal protein A: comparisons of the solution and crystal structures.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 14
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1996-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1bddA00
2LXCB 1X0TA 2KS1B 2M5AA 5C39A 4HJGH 2HR3A 4GOFA 2B87B 5CBNA 3PH0A 3RGUA 3FXDA 2B88A 3QWOC 1OVVA 2Q1KA 2M0BA 2OTKE 1EC5A 1Y47A 4NPDA 2P58A 5DJUB 1EDKA 4CPGA 4K3AA 1JM0A 1U7MA 4GODA 2I8DA 1EDLA 5EFWB 2B87A 1MFTA 2KIKA 5CBOA 1ZW0A 5DJTB 3FXEA 4KJMA 1DEEG 2LR2A 2B89A 2KZJA 4WWIA 4NPFX 1BDDA 3ZDMA 2KUBA 1OVRA 2R44A 1Q2NA 4EYYQ 2K3RA 3MHVA 4BXLA 2KI7B 2ZAEB 1ZXGA 3S1KA 4MN4C 1BDCA 2KZIA 4K35A 4JBZA 1EDJA 1OVUA 1FC2C 2UWJE 4HB1A 4IOIH 4ZNCA 1U7JA 2JWDA 5K5GB 4NPEA 2M5AB 2WMMA 4GOEA 2QVAA 1NVOA 2QRXA 1S3JA 1LT1A 4ZMDA 2SPZA 2RKLA 1JMBA 1LP1A 1LP1B 3MZWB 1H0TA 4HKZH 1H0TB 4ASWA 2LXBA 1SS1A 4ASVA 1EDIA
chains in the Genus database with same CATH superfamily
2BCCE 1URQD 3H1JD 4N78D 2E74C 1URQC 3F5HA 1EZVE 1PZQA 1N7LA 3CX5E 3BASA 1KB9D 4HJGH 1JY2O 2PGDA 4RKUJ 4WBAA 3L72D 5CBNA 1PGOA 3H1LD 5AW7B 3AEGC 3JCUE 1T6AA 2IBZG 1OVVA 5KKZB 2Q1KA 1IFIA 2R3CA 1BE3D 2KLUA 3L71D 2YXQB 1CSBA 3HTKA 1SQBG 3CCJP 4I7ZC 1U7MA 5E79E 1FDOA 3WMM0 2XNXA 3ABVC 2N1TA 4O9BA 1A02F 1LWUC 1ZOYC 1BDDA 2IX7C 4UB8E 2R44A 2XV5A 1SQVK 2M3BA 2K9JB 2Z5IA 3BVHA 3T97B 5B66E 5AVXB 3H32B 1X22A 1LTAC 2H89C 3VOPA 2CPSA 4H44D 3S4RA 1N8RQ 4H44C 3RK3B 3RL0g 1NTKK 1SQPE 1PP9D 2MJZA 1FZAA 2ZVOB 5AVQB 2QRXA 1HTLC 1AVYA 3KDPB 2FYUE 4H13B 1JUNA 5APSA 1L0LG 2WITA 3QH9A 1KFNA 2A06D 2QJKB 2W90A 1GDTA 4ASWA 2LXBA 1FZGA 3WUVA 2LXCB 1VF5B 1KQGB 1LTSC 2YIUC 2NPSA 1SQXG 4U3FD 3A5TA 3L75D 3L73D 2YKQA 1LTGC 1EC5A 1KORA 3AE4C 3SWFA 5DJUB 1OW7A 1YJWP 3HTKB 1DD4A 1JM0A 1SQQE 1ZRTE 3G9RA 1VQ8P 3Q3DA 1MFTA 1FZFA 1HGZA 1S2EA 3WUUA 1NGMB 1T3UA 3PHLA 1P84I 3CCEP 2MKVA 3AE8C 2ZYAA 2KUBA 1N7SD 1GL2D 1Q2NA 3E7KA 1N7SC 1GL2C 2ZT9B 3S9OA 1USDA 1J1DB 1HJBA 1DEBA 3S1KA 4XE5B 1NU1D 1JO5A 3KZIH 4QMAA 3V2QA 3Q5SA 2IBZD 1E79H 3CD6P 1SFCD 1M7LA 1SFCC 2JWAA 1JY2P 2JWDA 3L74E 1HBWA 3H1KE 5CCHA 1G2CA 3CXHI 1KFMA 2XKMA 2A45G 1GW3A 2QVAA 5H2FH 1QEXA 1LT1A 2I1KA 5GTIE 4JYBA 1T2KD 1T2KC 1LTJA 3KHUA 4PD4E 4LGDE 2NPSB 3O6QB 1RE4C 1HUCA 1JY2N 2O01J 1J1EC 3IN6A 1KC8Q 1FZCC 3B71A 1HJ0A 3NTNA 2I8DA 3II6A 4WY4B 1FS0E 1TU3F 1YQ3C 4GT1A 3L35A 1VL2A 4A7PA 1EZVI 3CX5I 1RQVA 2YMYA 3CC2P 3IFMA 4LC1A 1VDFA 2KI7B 1L0ND 5APUA 4R4MA 3OA7A 1OXZA 3SWKA 4H0LB 1EDJA 1RH5B 2A45H 1EZVD 3CX5D 4IL6X 4I1LA 4L74A 2O01H 2Y0CA 3L72E 1NOHA 1AVOA 3H1LE 4IFDK 1G2CB 2K9YA 2QSIA 5AW2B 3W67A 3GF3A 3L71E 4ZMDA 1QVFO 2ZXXA 4DJGA 1H0TA 3HUSC 1LTJB 2Q3EA 1Q82Q 4DZOA 1BCCE 1N73C 3L74J 3HD7B 3CLQA 1IFDA 3H1KJ 2HODA 2CPBA 4I6MC 1FDIA 3R4YA 5CMZA 1HGVA 1NJIQ 4CPGA 3E1IA 3VN0A 3H1IG 2I1JA 1PGQA 1GZLA 1PP9E 2FYNC 2AXCA 2KZJA 2FYUD 3RL0B 1BSHA 3NMDA 2KZIA 3HE4A 1S4XA 4KT0J 4ZNCA 2IYPA 1NTMK 3B5NB 1KYOH 1Z56A 3L75E 3TNUA 1PIXA 5KTBA 2GUVA 2ZYDA 3JSVC 3L73E 4L75A 1GU4A 1G1IA 2FBWC 2RKLA 3TDKA 2Q3IA 1QVGO 1H0TB 4AUWA 1NKNA 4JYCA 3HRNA 3CWBG 1L4AB 1LWUA 4DOJA 1GD2E 5KLIB 3GF7A 3MUDC 5AW3B 3TYYA 3D6ZA 3A0HH 2E75D 2HODB 2E75C 2N9YB 5KLVK 4KHXA 3CWBJ 2OYIC 4W80A 2IBZE 3KXDA 1FZBA 1SLQA 3VMAA 1YIJP 1KZUB 1JOCA 3L74D 1KYOD 3H1KD 3HE5A 2FKWB 3VMZA 1SQBE 4PD4I 3AE6C 1S1CX 3USSA 4RO0A 1LJ2A 4ZKUA 1BCCJ 2PFXA 2E74B 1URQB 3PJSK 3D6YA 2W83C 2WPRA 1CW5A 4JBZA 1OVUA 3L37A 1FC2C 2GUSA 5AVYB 4PD4D 3MTUE 3L4FA 2WTYA 2PRRA 2JJLA 5AVTB 3MIWA 1CI6A 3M06A 1USEA 1K8AQ 2KSJA 2M5AB 1PFIA 3T97A 2NZ2A 3H32A 1FZEA 4I7ZB 2KXPB 1VQ5P 1VQMP 1HWTC 4EIJA 5BU8B 3MZWB 3TGUG 1K05A 5CCGD 5CCGC 1IC2A 1LWUB 1DH3A 3WUTA 1N7SA 1L0LE 1OW8A 1GL2A 1X0TA 3IR9A 4C7RA 2HR3A 1KB9I 3FXDA 3IF4A 5H2FE 4WVZA 1SQXE 4H44B 1SFCA 1LTBC 3OJAB 1RF0C 1NU1K 2WVRA 2W6AA 1IJDB 2KIKA 3FWLA 3HE5B 3FXEA 3BATA 3Q1MA 3TSIA 1FDMA 2W6BA 3CWBD 2WSCJ 1S5LH 2C0XA 2Q5UA 4YPCA 1M90Q 3MHVA 2JEEA 3H6PA 1QL2A 2YIUB 1FJKA 2W27A 4PV1D 2WZ7A 2L91A 4PV1C 2KOGA 2AXTH 1BCCD 1CI6B 3KQGA 3VP8A 1YHQP 1SQBJ 1T3JA 1YBKA 2Y0DA 3G3ZA 5TISE 1LGHB 1NAYA 2IDBA 2WSCH 1SQVG 1N7SB 1GL2B 1KILE 3SFDC 2O1JA 1IFPA 4PJ0H 2B87B 3A3YB 5KAFH 2B88A 2ZYGA 1M1JC 4OH8B 1NTKG 1SVFA 1SFCB 3F89A 4Y99C 1L0NK 2FXMA 3I55P 1SQVJ 1H8AA 5CJ4A 3CPWO 3O6QA 5AW0B 2E43A 3NXSA 3Q5RA 2D2CD 4AQRD 1L0LJ 3V6IA 3FWNA 2D2CC 1OIPA 3ZDMA 1NTKJ 1LT9C 3CCQP 3L70G 3RK2D 2ZAEB 1S72P 3RK2C 2WSFJ 4L76A 2J5UA 1SQXJ 4WY4A 1IK7A 1N73A 1QX8A 5APVA 1EXIA 2IBZI 1J1EB 1CZQA 1FZCB 1X9VA 3L70J 3MP7B 3SWYA 3EFGA 2H43A 1ZP0C 2FFDC 2E76D 2E76C 1YYCA 2KSEA 2CK3H 1KYOE 2JDIH 2R32A 1SQPK 1SQBD 3GHGC 1JTHA 4RJTA 2QM8A 1OW6A 4EI2A 2WSFH 3H1HG 3RGUA 3P32A 1JB0J 3BRTB 1BGYG 3OW2O 4C46A 2P58A 2FYUK 5AW4B 1KN7A 3AE1C 1KD1Q 2JR8A 2PP6A 3H1HJ 4R4LA 3HD7A 3H1IE 1BGYJ 3A0HE 1SQVD 3HUSB 1LTTC 1ZXGA 2JO1A 2Y9ZA 2N9BA 2N1TD 2N1TC 3AEBC 1N73B 1MV8A 3BCCG 2AEFA 1L0LD 3D71A 1KTMA 1SQQK 1NTKD 1Q7YQ 2ZJSE 1U7JA 1JY3O 2K1AA 4NPEA 1KMIZ 1FOSE 1H88A 2OYIA 2WPQA 4YTPC 1SQXD 3JC22 5AW5B 1WRGA 2FYNB 2ZFCA 5AW8B 5TISH 4D6TG 3A0BH 3B5NA 1U57A 4C7NB 5CHXA 1HVVA 1IZNB 1JTHB 2KNCB 1X79B 1KQFB 3CWBE 2H88C 2HPCB 2RN0A 4DT0A 2NRGA 3RBXA 2WPVB 4D6TJ 2O3JA 3PP5A 3CI9A 4EDFA 3VTPC 2HLOA 1L4AA 2AEJA 4IL6E 1Y8AA 1VQ9P 4LLHA 4UB6H 2A45I 1MZ9A 2XZRA 1R8EA 4OWFA 2OARA 1YTZI 2XNDH 3VMXA 5CCGA 5APQA 2IYOA 2W6JH 3L36A 4RESB 1JNMA 2XDJA 1YI2P 2UWJE 2JP3A 3B8EB 1BGYD 1KILD 1KILC 2E75B 4TLFA 2KYVA 3EQ2A 2OYIB 1QGKB 1S5LE 1RF0A 1L2PA 1PPJG 4ZKPA 1URQA 1NTZE 3H1IJ 2FXPA 2Q6QA 4N6JA 3N4XA 2Z4EA 3K5BA 5CCHD 5CCHC 1W5CE 1VQ6P 3SSUA 4W7ZA 3V2RA 2FYZA 2AXTE 3U59A 2K88A 4YXDC 2KS1A 2M5AA 5APWA 3TGUE 2RH0A 1QL1A 3OAKA 1VQ4P 2G3AA 4N3YB 1NTMG 3CMAP 1OZHA 1JMMA 3H1JG 3B4SA 2OQQA 2P1JA 3ITKA 4GODA 1EDLA 1SP4A 2OYHC 1JY3P 1ZLLA 5CBOA 4D6TD 4PJ0E 2DW3A 2BEQD 2LR2A 5KAFE 1KYOI 1RY3A 3M91A 1VQPP 4OGQD 1BE3G 3C8VA 1JCCA 4OGQC 1OVRA 1NTMJ 3RK3E 2QM7A 1IFMA 1NYHA 4JPZB 5AW6B 2P2UA 1RF1B 3P8CD 1G1JA 2YKOA 1M8OB 5APTA 1M56D 2OGUA 3LW5H 1M1JA 2KK7A 2OYOA 5GTHH 3RBZA 5K5GB 5KLVG 2QJPC 1AFOA 3CCLP 3CC7P 1X8YA 1AJYA 1FU1A 1NTZG 2B9BA 2ZVNB 5L8RJ 4AYCA 1LT9A 2BEZF 5KLVJ 2KS1B 3H1ID 2HYNA 3E1RA 3CXHE 3D70A 1SQVE 3EFFK 2A06G 4IL6H 1NTZJ 4PV1B 1Q86Q 1IO4A 1RE3C 1K9MQ 2V7QJ 3VP9A 5TJHA 2WSSH 1Q81Q 3M0DC 4U3FG 1NTKE 1RF1C 2BASA 4Z1MH 2B87A 1T8ZA 3UIAA 1ZW0A 3V4WA 1K73Q 3M0AA 1OMIA 2FFDA 4NPFX 3TGUJ 4EYYQ 1NHLA 1YTZT 3CCMP 4MN4C 2Q9IA 3GHGA 4U3FJ 2Y9YA 2JKVA 1ZR4A 3L70E 4W7YA 1ZR2A 2IPPA 4HB1A 4IOIH 3VYIA 3V2NA 1NTMD 2QIWA 1M1JB 2M3EA 1SQBK 4Y99B 2V7QH 1NU1G 2P10A 1RE4A 1A02J 5KJ7D 1XTCC 2QJYC 1LP1A 5KJ7C 1AQTA 3AEAC 1GK4A 2D2CB 2HFED 3PRJA 2XU6A 2V4HA 1LT9B 1DX7A 3GMAA 2OTLP 1FZCA 3PLNA 3P7KA 3RK2B 3EWKA 1NU1J 1Q90D 1AA0A 1M1KQ 4XA4A 2OTKE 3PTZA 4NPDA 4BRYA 3O8ZA 3V2PA 3A0BE 2E42A 5KLVD 3H1HE 1ZMEC 2K37A 4DCKA 1BGYE 1RQUA 1E5WA 4L73A 2YNYA 1L0LK 1IK9A 3WU2H 3BRVB 4KJMA 5AVVB 2FFDB 1WT6A 1NTZD 4WWIA 2E76B 3V4QA 4BXLA 1SQXK 5BVZA 1KQSO 3W68A 1BDCA 3GHGB 1IFNA 5KKZC 2J58A 1RHZB 3G4SP 1YJ9P 3MD0A 4UB6E 4U7JA 3TGUD 1P84H 2YKPA 3P8MC 2H8PD 3BCCE 1OFCX 3G71P 3HUSA 1L0NG 2POHA 2QA4P 5AVSB 1JCDA 1WMKA 2BCCG 2SPZA 1NWQA 1EZVG 1LP1B 1MKMA 1VQOP 3M9QA 1GU5A 4XFJA 1VPCA 2QEXP 4D6TE 3IAOA 1L0NJ 3AECC 3CXHH 5AVZB 2W8ZA 3RK3D 3RK3C 2BCCJ 2N1TB 2PAJA 1DD3A 4BRYB 3G6EP 1KILA 4C7NA 3P8CE 1EDKA 3VMYA 5CJ0A 2YO3A 2KNCA 2HG5D 4H13D 5EFWB 4H13C 2QJKC 2HPCA 1P84D 1DEEG 5AW1B 1VF5D 1VF5C 1LTIC 1SQPG 3GG2A 3AEDC 4I2LC 1AV1A 5KAIH 1NKZB 1KQLA 1UIIA 1JEKA 1FAVA 1MFZA 3CX5H 3CXHD 4WB4A 2AEMA 3AE7C 2FYUG 5APYA 2QG4A 1ZN5A 3JCUH 1SQPJ 3FGAD 3C9IA 1NAFA 1NVOA 2E5YA 2OYHA 3MUDA 1PPJE 4HKZH 2ZT9D 4GKGA 2ZT9C 4ASVA 1J1DC 2FYUJ 5AVUB 5E79H 5GTHE 5AVWB 5C39A 1PV3A 3N7NA 3CCVP 2C9NY 3PH0A 2J59M 3AE2C 1VQNP 4UB8H 2P7JA 3BCCJ 1QLED 1SQQG 2Q7CA 1KILB 1W2EA 5B66H 2WT7A 1VQKP 3L70D 2WWWA 2O1KA 1S9KD 3NFQA 5B5EE 1NTME 2BCCD 1GTWA 3H1JE 4N78E 1KB9E 2OTJP 1SQQJ 1HH0A 2K3RA 2NPSD 4JF7A 2NPSC 1K04A 1HF9A 1BE3E 3R2PA 3L74G 1PGPA 2P67A 2Z5HA 3H1KG 2Y0EA 2M8RA 3AEEC 3U1AA 2ZXEB 3KPEA 1RE3A 2C0WA 4WY4D 1ZV8A 4GDOA 4WY4C 3M0DA 3CCRP 1RF1A 1S3JA 2VRSA 3H1HD 2IZ1A 5KLVE 2OYHB 3A7OA 3KYQA 1VQ7P 5APXA 1S5LX 2KP8A 3U1CA 3TK1A 2R5DA 4OGQB 5M1BA 3AE5C 4H0LD 1SQPD 4H0LC 4EOTA 3Q2YA 1W2BO 5AVRB 3AE9C 2H7HA 3QWOC 1H89A 1R5LA 1D7MA 5AW9B 3TF5A 4JQ0D 2GA1A 2M0BA 1Y47A 3AE3C 1PL5A 1N86A 2L5GB 2WT7B 2A06E 4K3AA 2QJPB 4M3LA 3GLMA 1NH4A 3BCCD 3LW5J 4U3FE 2B89A 5KJ7A 1LTJC 2KB7P 2FXOA 3CC4P 3AEFC 1R5SA 3H25A 1FJPA 3FX0A 1KV4A 3HD7D 3V5BA 5GTIH 1YJNP 2WSEJ 3HD7C 3L72G 2RMZA 3H1LG 1ZRTD 1SQQD 3I56P 1FBMA 4PD4H 3WU2E 1FOSF 3M9BA 3L71G 2ITAA 2R3SA 3H1JJ 1MUUA 2QE7H 4B86A 3MGNA 4IFFA 2WPSA 1VQLP 1BSNA 2KLVA 3L72J 4IFMA 1GMJA 1LNQA 1FE6A 2FY8A 3H1LJ 3C1LA 4YXWH 1NU1E 1OX3A 3RL0D 1EDIA 1BCCG 1BE3J 3RL0C 3L71J 1P84E 2R5BA 3SFEC 4GIFA 1JY3N 1YITP 2IFMA 4GOFA 2O01N 4Y28J 2LKMA 3CCSP 1AQ5A 3B5ND 4OVNF 3Q5PA 2WSEH 1GK6A 3B5NC 1NTZK 1PP9G 3M9HA 1Y9BA 1OWAA 1J2JB 2C9LY 5B5EH 2WQYC 4BWNA 3HE4B 2YMKA 1N2DC 1KB9H 2IZ0A 3A2AA 5DJTB 1L4AD 1L4AC 2QJYB 1IFJA 1PGJA 1PP9J 3TNUB 1M57D 2K9JA 5KLIC 4HYTB 1XTGB 1PPJD 3LIEA 1YQ4C 4K35A 1GW4A 3L75G 3CL3D 4TT3H 3KZIE 5BU5A 1DIPA 2GM4A 3CCUP 3L73G 1UIXA 1EXJA 1NO4A 2IFNA 2YO2A 2E5TA 3LIDA 2WMMA 3CMEP 4GOEA 4HH2A 3GW6A 3I5CA 3L75J 2YXRB 1L0NE 1JMBA 1EQ7A 1S9KE 3L73J 5KAIE 2G8YA 1SS1A 2E74D
chains in the Genus database with same CATH topology
2LXCB 1X0TA 2KS1B 2M5AA 5C39A 4HJGH 2HR3A 4GOFA 2B87B 5CBNA 3PH0A 3RGUA 3FXDA 2B88A 3QWOC 1OVVA 2Q1KA 2M0BA 2OTKE 1EC5A 1Y47A 4NPDA 2P58A 5DJUB 1EDKA 4CPGA 4K3AA 1JM0A 1U7MA 4GODA 2I8DA 1EDLA 5EFWB 2B87A 1MFTA 2KIKA 5CBOA 1ZW0A 5DJTB 3FXEA 4KJMA 1DEEG 2LR2A 2B89A 2KZJA 4WWIA 4NPFX 1BDDA 3ZDMA 2KUBA 1OVRA 2R44A 1Q2NA 4EYYQ 2K3RA 3MHVA 4BXLA 2KI7B 2ZAEB 1ZXGA 3S1KA 4MN4C 1BDCA 2KZIA 4K35A 4JBZA 1EDJA 1OVUA 1FC2C 2UWJE 4HB1A 4IOIH 4ZNCA 1U7JA 2JWDA 5K5GB 4NPEA 2M5AB 2WMMA 4GOEA 2QVAA 1NVOA 2QRXA 1S3JA 1LT1A 4ZMDA 2SPZA 2RKLA 1JMBA 1LP1A 1LP1B 3MZWB 1H0TA 4HKZH 1H0TB 4ASWA 2LXBA 1SS1A 4ASVA 1EDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXC B;  1X0T A;  2KS1 B;  2M5A A;  5C39 A;  4HJG H;  2HR3 A;  4GOF A;  2B87 B;  5CBN A;  3PH0 A;  3RGU A;  3FXD A;  2B88 A;  3QWO C;  1OVV A;  2Q1K A;  2M0B A;  2OTK E;  1EC5 A;  1Y47 A;  4NPD A;  2P58 A;  5DJU B;  1EDK A;  4CPG A;  4K3A A;  1JM0 A;  1U7M A;  4GOD A;  2I8D A;  1EDL A;  5EFW B;  2B87 A;  1MFT A;  2KIK A;  5CBO A;  1ZW0 A;  5DJT B;  3FXE A;  4KJM A;  1DEE G;  2LR2 A;  2B89 A;  2KZJ A;  4WWI A;  4NPF X;  1BDD A;  3ZDM A;  2KUB A;  1OVR A;  2R44 A;  1Q2N A;  4EYY Q;  2K3R A;  3MHV A;  4BXL A;  2KI7 B;  2ZAE B;  1ZXG A;  3S1K A;  4MN4 C;  1BDC A;  2KZI A;  4K35 A;  4JBZ A;  1EDJ A;  1OVU A;  1FC2 C;  2UWJ E;  4HB1 A;  4IOI H;  4ZNC A;  1U7J A;  2JWD A;  5K5G B;  4NPE A;  2M5A B;  2WMM A;  4GOE A;  2QVA A;  1NVO A;  2QRX A;  1S3J A;  1LT1 A;  4ZMD A;  2SPZ A;  2RKL A;  1JMB A;  1LP1 A;  1LP1 B;  3MZW B;  1H0T A;  4HKZ H;  1H0T B;  4ASW A;  2LXB A;  1SS1 A;  4ASV A;  1EDI A; 
#chains in the Genus database with same CATH topology
 2BCC E;  1URQ D;  3H1J D;  4N78 D;  2E74 C;  1URQ C;  3F5H A;  1EZV E;  1PZQ A;  1N7L A;  3CX5 E;  3BAS A;  1KB9 D;  4HJG H;  1JY2 O;  2PGD A;  4RKU J;  4WBA A;  3L72 D;  5CBN A;  1PGO A;  3H1L D;  5AW7 B;  3AEG C;  3JCU E;  1T6A A;  2IBZ G;  1OVV A;  5KKZ B;  2Q1K A;  1IFI A;  2R3C A;  1BE3 D;  2KLU A;  3L71 D;  2YXQ B;  1CSB A;  3HTK A;  1SQB G;  3CCJ P;  4I7Z C;  1U7M A;  5E79 E;  1FDO A;  3WMM 0;  2XNX A;  3ABV C;  2N1T A;  4O9B A;  1A02 F;  1LWU C;  1ZOY C;  1BDD A;  2IX7 C;  4UB8 E;  2R44 A;  2XV5 A;  1SQV K;  2M3B A;  2K9J B;  2Z5I A;  3BVH A;  3T97 B;  5B66 E;  5AVX B;  3H32 B;  1X22 A;  1LTA C;  2H89 C;  3VOP A;  2CPS A;  4H44 D;  3S4R A;  1N8R Q;  4H44 C;  3RK3 B;  3RL0 g;  1NTK K;  1SQP E;  1PP9 D;  2MJZ A;  1FZA A;  2ZVO B;  5AVQ B;  2QRX A;  1HTL C;  1AVY A;  3KDP B;  2FYU E;  4H13 B;  1JUN A;  5APS A;  1L0L G;  2WIT A;  3QH9 A;  1KFN A;  2A06 D;  2QJK B;  2W90 A;  1GDT A;  4ASW A;  2LXB A;  1FZG A;  3WUV A;  2LXC B;  1VF5 B;  1KQG B;  1LTS C;  2YIU C;  2NPS A;  1SQX G;  4U3F D;  3A5T A;  3L75 D;  3L73 D;  2YKQ A;  1LTG C;  1EC5 A;  1KOR A;  3AE4 C;  3SWF A;  5DJU B;  1OW7 A;  1YJW P;  3HTK B;  1DD4 A;  1JM0 A;  1SQQ E;  1ZRT E;  3G9R A;  1VQ8 P;  3Q3D A;  1MFT A;  1FZF A;  1HGZ A;  1S2E A;  3WUU A;  1NGM B;  1T3U A;  3PHL A;  1P84 I;  3CCE P;  2MKV A;  3AE8 C;  2ZYA A;  2KUB A;  1N7S D;  1GL2 D;  1Q2N A;  3E7K A;  1N7S C;  1GL2 C;  2ZT9 B;  3S9O A;  1USD A;  1J1D B;  1HJB A;  1DEB A;  3S1K A;  4XE5 B;  1NU1 D;  1JO5 A;  3KZI H;  4QMA A;  3V2Q A;  3Q5S A;  2IBZ D;  1E79 H;  3CD6 P;  1SFC D;  1M7L A;  1SFC C;  2JWA A;  1JY2 P;  2JWD A;  3L74 E;  1HBW A;  3H1K E;  5CCH A;  1G2C A;  3CXH I;  1KFM A;  2XKM A;  2A45 G;  1GW3 A;  2QVA A;  5H2F H;  1QEX A;  1LT1 A;  2I1K A;  5GTI E;  4JYB A;  1T2K D;  1T2K C;  1LTJ A;  3KHU A;  4PD4 E;  4LGD E;  2NPS B;  3O6Q B;  1RE4 C;  1HUC A;  1JY2 N;  2O01 J;  1J1E C;  3IN6 A;  1KC8 Q;  1FZC C;  3B71 A;  1HJ0 A;  3NTN A;  2I8D A;  3II6 A;  4WY4 B;  1FS0 E;  1TU3 F;  1YQ3 C;  4GT1 A;  3L35 A;  1VL2 A;  4A7P A;  1EZV I;  3CX5 I;  1RQV A;  2YMY A;  3CC2 P;  3IFM A;  4LC1 A;  1VDF A;  2KI7 B;  1L0N D;  5APU A;  4R4M A;  3OA7 A;  1OXZ A;  3SWK A;  4H0L B;  1EDJ A;  1RH5 B;  2A45 H;  1EZV D;  3CX5 D;  4IL6 X;  4I1L A;  4L74 A;  2O01 H;  2Y0C A;  3L72 E;  1NOH A;  1AVO A;  3H1L E;  4IFD K;  1G2C B;  2K9Y A;  2QSI A;  5AW2 B;  3W67 A;  3GF3 A;  3L71 E;  4ZMD A;  1QVF O;  2ZXX A;  4DJG A;  1H0T A;  3HUS C;  1LTJ B;  2Q3E A;  1Q82 Q;  4DZO A;  1BCC E;  1N73 C;  3L74 J;  3HD7 B;  3CLQ A;  1IFD A;  3H1K J;  2HOD A;  2CPB A;  4I6M C;  1FDI A;  3R4Y A;  5CMZ A;  1HGV A;  1NJI Q;  4CPG A;  3E1I A;  3VN0 A;  3H1I G;  2I1J A;  1PGQ A;  1GZL A;  1PP9 E;  2FYN C;  2AXC A;  2KZJ A;  2FYU D;  3RL0 B;  1BSH A;  3NMD A;  2KZI A;  3HE4 A;  1S4X A;  4KT0 J;  4ZNC A;  2IYP A;  1NTM K;  3B5N B;  1KYO H;  1Z56 A;  3L75 E;  3TNU A;  1PIX A;  5KTB A;  2GUV A;  2ZYD A;  3JSV C;  3L73 E;  4L75 A;  1GU4 A;  1G1I A;  2FBW C;  2RKL A;  3TDK A;  2Q3I A;  1QVG O;  1H0T B;  4AUW A;  1NKN A;  4JYC A;  3HRN A;  3CWB G;  1L4A B;  1LWU A;  4DOJ A;  1GD2 E;  5KLI B;  3GF7 A;  3MUD C;  5AW3 B;  3TYY A;  3D6Z A;  3A0H H;  2E75 D;  2HOD B;  2E75 C;  2N9Y B;  5KLV K;  4KHX A;  3CWB J;  2OYI C;  4W80 A;  2IBZ E;  3KXD A;  1FZB A;  1SLQ A;  3VMA A;  1YIJ P;  1KZU B;  1JOC A;  3L74 D;  1KYO D;  3H1K D;  3HE5 A;  2FKW B;  3VMZ A;  1SQB E;  4PD4 I;  3AE6 C;  1S1C X;  3USS A;  4RO0 A;  1LJ2 A;  4ZKU A;  1BCC J;  2PFX A;  2E74 B;  1URQ B;  3PJS K;  3D6Y A;  2W83 C;  2WPR A;  1CW5 A;  4JBZ A;  1OVU A;  3L37 A;  1FC2 C;  2GUS A;  5AVY B;  4PD4 D;  3MTU E;  3L4F A;  2WTY A;  2PRR A;  2JJL A;  5AVT B;  3MIW A;  1CI6 A;  3M06 A;  1USE A;  1K8A Q;  2KSJ A;  2M5A B;  1PFI A;  3T97 A;  2NZ2 A;  3H32 A;  1FZE A;  4I7Z B;  2KXP B;  1VQ5 P;  1VQM P;  1HWT C;  4EIJ A;  5BU8 B;  3MZW B;  3TGU G;  1K05 A;  5CCG D;  5CCG C;  1IC2 A;  1LWU B;  1DH3 A;  3WUT A;  1N7S A;  1L0L E;  1OW8 A;  1GL2 A;  1X0T A;  3IR9 A;  4C7R A;  2HR3 A;  1KB9 I;  3FXD A;  3IF4 A;  5H2F E;  4WVZ A;  1SQX E;  4H44 B;  1SFC A;  1LTB C;  3OJA B;  1RF0 C;  1NU1 K;  2WVR A;  2W6A A;  1IJD B;  2KIK A;  3FWL A;  3HE5 B;  3FXE A;  3BAT A;  3Q1M A;  3TSI A;  1FDM A;  2W6B A;  3CWB D;  2WSC J;  1S5L H;  2C0X A;  2Q5U A;  4YPC A;  1M90 Q;  3MHV A;  2JEE A;  3H6P A;  1QL2 A;  2YIU B;  1FJK A;  2W27 A;  4PV1 D;  2WZ7 A;  2L91 A;  4PV1 C;  2KOG A;  2AXT H;  1BCC D;  1CI6 B;  3KQG A;  3VP8 A;  1YHQ P;  1SQB J;  1T3J A;  1YBK A;  2Y0D A;  3G3Z A;  5TIS E;  1LGH B;  1NAY A;  2IDB A;  2WSC H;  1SQV G;  1N7S B;  1GL2 B;  1KIL E;  3SFD C;  2O1J A;  1IFP A;  4PJ0 H;  2B87 B;  3A3Y B;  5KAF H;  2B88 A;  2ZYG A;  1M1J C;  4OH8 B;  1NTK G;  1SVF A;  1SFC B;  3F89 A;  4Y99 C;  1L0N K;  2FXM A;  3I55 P;  1SQV J;  1H8A A;  5CJ4 A;  3CPW O;  3O6Q A;  5AW0 B;  2E43 A;  3NXS A;  3Q5R A;  2D2C D;  4AQR D;  1L0L J;  3V6I A;  3FWN A;  2D2C C;  1OIP A;  3ZDM A;  1NTK J;  1LT9 C;  3CCQ P;  3L70 G;  3RK2 D;  2ZAE B;  1S72 P;  3RK2 C;  2WSF J;  4L76 A;  2J5U A;  1SQX J;  4WY4 A;  1IK7 A;  1N73 A;  1QX8 A;  5APV A;  1EXI A;  2IBZ I;  1J1E B;  1CZQ A;  1FZC B;  1X9V A;  3L70 J;  3MP7 B;  3SWY A;  3EFG A;  2H43 A;  1ZP0 C;  2FFD C;  2E76 D;  2E76 C;  1YYC A;  2KSE A;  2CK3 H;  1KYO E;  2JDI H;  2R32 A;  1SQP K;  1SQB D;  3GHG C;  1JTH A;  4RJT A;  2QM8 A;  1OW6 A;  4EI2 A;  2WSF H;  3H1H G;  3RGU A;  3P32 A;  1JB0 J;  3BRT B;  1BGY G;  3OW2 O;  4C46 A;  2P58 A;  2FYU K;  5AW4 B;  1KN7 A;  3AE1 C;  1KD1 Q;  2JR8 A;  2PP6 A;  3H1H J;  4R4L A;  3HD7 A;  3H1I E;  1BGY J;  3A0H E;  1SQV D;  3HUS B;  1LTT C;  1ZXG A;  2JO1 A;  2Y9Z A;  2N9B A;  2N1T D;  2N1T C;  3AEB C;  1N73 B;  1MV8 A;  3BCC G;  2AEF A;  1L0L D;  3D71 A;  1KTM A;  1SQQ K;  1NTK D;  1Q7Y Q;  2ZJS E;  1U7J A;  1JY3 O;  2K1A A;  4NPE A;  1KMI Z;  1FOS E;  1H88 A;  2OYI A;  2WPQ A;  4YTP C;  1SQX D;  3JC2 2;  5AW5 B;  1WRG A;  2FYN B;  2ZFC A;  5AW8 B;  5TIS H;  4D6T G;  3A0B H;  3B5N A;  1U57 A;  4C7N B;  5CHX A;  1HVV A;  1IZN B;  1JTH B;  2KNC B;  1X79 B;  1KQF B;  3CWB E;  2H88 C;  2HPC B;  2RN0 A;  4DT0 A;  2NRG A;  3RBX A;  2WPV B;  4D6T J;  2O3J A;  3PP5 A;  3CI9 A;  4EDF A;  3VTP C;  2HLO A;  1L4A A;  2AEJ A;  4IL6 E;  1Y8A A;  1VQ9 P;  4LLH A;  4UB6 H;  2A45 I;  1MZ9 A;  2XZR A;  1R8E A;  4OWF A;  2OAR A;  1YTZ I;  2XND H;  3VMX A;  5CCG A;  5APQ A;  2IYO A;  2W6J H;  3L36 A;  4RES B;  1JNM A;  2XDJ A;  1YI2 P;  2UWJ E;  2JP3 A;  3B8E B;  1BGY D;  1KIL D;  1KIL C;  2E75 B;  4TLF A;  2KYV A;  3EQ2 A;  2OYI B;  1QGK B;  1S5L E;  1RF0 A;  1L2P A;  1PPJ G;  4ZKP A;  1URQ A;  1NTZ E;  3H1I J;  2FXP A;  2Q6Q A;  4N6J A;  3N4X A;  2Z4E A;  3K5B A;  5CCH D;  5CCH C;  1W5C E;  1VQ6 P;  3SSU A;  4W7Z A;  3V2R A;  2FYZ A;  2AXT E;  3U59 A;  2K88 A;  4YXD C;  2KS1 A;  2M5A A;  5APW A;  3TGU E;  2RH0 A;  1QL1 A;  3OAK A;  1VQ4 P;  2G3A A;  4N3Y B;  1NTM G;  3CMA P;  1OZH A;  1JMM A;  3H1J G;  3B4S A;  2OQQ A;  2P1J A;  3ITK A;  4GOD A;  1EDL A;  1SP4 A;  2OYH C;  1JY3 P;  1ZLL A;  5CBO A;  4D6T D;  4PJ0 E;  2DW3 A;  2BEQ D;  2LR2 A;  5KAF E;  1KYO I;  1RY3 A;  3M91 A;  1VQP P;  4OGQ D;  1BE3 G;  3C8V A;  1JCC A;  4OGQ C;  1OVR A;  1NTM J;  3RK3 E;  2QM7 A;  1IFM A;  1NYH A;  4JPZ B;  5AW6 B;  2P2U A;  1RF1 B;  3P8C D;  1G1J A;  2YKO A;  1M8O B;  5APT A;  1M56 D;  2OGU A;  3LW5 H;  1M1J A;  2KK7 A;  2OYO A;  5GTH H;  3RBZ A;  5K5G B;  5KLV G;  2QJP C;  1AFO A;  3CCL P;  3CC7 P;  1X8Y A;  1AJY A;  1FU1 A;  1NTZ G;  2B9B A;  2ZVN B;  5L8R J;  4AYC A;  1LT9 A;  2BEZ F;  5KLV J;  2KS1 B;  3H1I D;  2HYN A;  3E1R A;  3CXH E;  3D70 A;  1SQV E;  3EFF K;  2A06 G;  4IL6 H;  1NTZ J;  4PV1 B;  1Q86 Q;  1IO4 A;  1RE3 C;  1K9M Q;  2V7Q J;  3VP9 A;  5TJH A;  2WSS H;  1Q81 Q;  3M0D C;  4U3F G;  1NTK E;  1RF1 C;  2BAS A;  4Z1M H;  2B87 A;  1T8Z A;  3UIA A;  1ZW0 A;  3V4W A;  1K73 Q;  3M0A A;  1OMI A;  2FFD A;  4NPF X;  3TGU J;  4EYY Q;  1NHL A;  1YTZ T;  3CCM P;  4MN4 C;  2Q9I A;  3GHG A;  4U3F J;  2Y9Y A;  2JKV A;  1ZR4 A;  3L70 E;  4W7Y A;  1ZR2 A;  2IPP A;  4HB1 A;  4IOI H;  3VYI A;  3V2N A;  1NTM D;  2QIW A;  1M1J B;  2M3E A;  1SQB K;  4Y99 B;  2V7Q H;  1NU1 G;  2P10 A;  1RE4 A;  1A02 J;  5KJ7 D;  1XTC C;  2QJY C;  1LP1 A;  5KJ7 C;  1AQT A;  3AEA C;  1GK4 A;  2D2C B;  2HFE D;  3PRJ A;  2XU6 A;  2V4H A;  1LT9 B;  1DX7 A;  3GMA A;  2OTL P;  1FZC A;  3PLN A;  3P7K A;  3RK2 B;  3EWK A;  1NU1 J;  1Q90 D;  1AA0 A;  1M1K Q;  4XA4 A;  2OTK E;  3PTZ A;  4NPD A;  4BRY A;  3O8Z A;  3V2P A;  3A0B E;  2E42 A;  5KLV D;  3H1H E;  1ZME C;  2K37 A;  4DCK A;  1BGY E;  1RQU A;  1E5W A;  4L73 A;  2YNY A;  1L0L K;  1IK9 A;  3WU2 H;  3BRV B;  4KJM A;  5AVV B;  2FFD B;  1WT6 A;  1NTZ D;  4WWI A;  2E76 B;  3V4Q A;  4BXL A;  1SQX K;  5BVZ A;  1KQS O;  3W68 A;  1BDC A;  3GHG B;  1IFN A;  5KKZ C;  2J58 A;  1RHZ B;  3G4S P;  1YJ9 P;  3MD0 A;  4UB6 E;  4U7J A;  3TGU D;  1P84 H;  2YKP A;  3P8M C;  2H8P D;  3BCC E;  1OFC X;  3G71 P;  3HUS A;  1L0N G;  2POH A;  2QA4 P;  5AVS B;  1JCD A;  1WMK A;  2BCC G;  2SPZ A;  1NWQ A;  1EZV G;  1LP1 B;  1MKM A;  1VQO P;  3M9Q A;  1GU5 A;  4XFJ A;  1VPC A;  2QEX P;  4D6T E;  3IAO A;  1L0N J;  3AEC C;  3CXH H;  5AVZ B;  2W8Z A;  3RK3 D;  3RK3 C;  2BCC J;  2N1T B;  2PAJ A;  1DD3 A;  4BRY B;  3G6E P;  1KIL A;  4C7N A;  3P8C E;  1EDK A;  3VMY A;  5CJ0 A;  2YO3 A;  2KNC A;  2HG5 D;  4H13 D;  5EFW B;  4H13 C;  2QJK C;  2HPC A;  1P84 D;  1DEE G;  5AW1 B;  1VF5 D;  1VF5 C;  1LTI C;  1SQP G;  3GG2 A;  3AED C;  4I2L C;  1AV1 A;  5KAI H;  1NKZ B;  1KQL A;  1UII A;  1JEK A;  1FAV A;  1MFZ A;  3CX5 H;  3CXH D;  4WB4 A;  2AEM A;  3AE7 C;  2FYU G;  5APY A;  2QG4 A;  1ZN5 A;  3JCU H;  1SQP J;  3FGA D;  3C9I A;  1NAF A;  1NVO A;  2E5Y A;  2OYH A;  3MUD A;  1PPJ E;  4HKZ H;  2ZT9 D;  4GKG A;  2ZT9 C;  4ASV A;  1J1D C;  2FYU J;  5AVU B;  5E79 H;  5GTH E;  5AVW B;  5C39 A;  1PV3 A;  3N7N A;  3CCV P;  2C9N Y;  3PH0 A;  2J59 M;  3AE2 C;  1VQN P;  4UB8 H;  2P7J A;  3BCC J;  1QLE D;  1SQQ G;  2Q7C A;  1KIL B;  1W2E A;  5B66 H;  2WT7 A;  1VQK P;  3L70 D;  2WWW A;  2O1K A;  1S9K D;  3NFQ A;  5B5E E;  1NTM E;  2BCC D;  1GTW A;  3H1J E;  4N78 E;  1KB9 E;  2OTJ P;  1SQQ J;  1HH0 A;  2K3R A;  2NPS D;  4JF7 A;  2NPS C;  1K04 A;  1HF9 A;  1BE3 E;  3R2P A;  3L74 G;  1PGP A;  2P67 A;  2Z5H A;  3H1K G;  2Y0E A;  2M8R A;  3AEE C;  3U1A A;  2ZXE B;  3KPE A;  1RE3 A;  2C0W A;  4WY4 D;  1ZV8 A;  4GDO A;  4WY4 C;  3M0D A;  3CCR P;  1RF1 A;  1S3J A;  2VRS A;  3H1H D;  2IZ1 A;  5KLV E;  2OYH B;  3A7O A;  3KYQ A;  1VQ7 P;  5APX A;  1S5L X;  2KP8 A;  3U1C A;  3TK1 A;  2R5D A;  4OGQ B;  5M1B A;  3AE5 C;  4H0L D;  1SQP D;  4H0L C;  4EOT A;  3Q2Y A;  1W2B O;  5AVR B;  3AE9 C;  2H7H A;  3QWO C;  1H89 A;  1R5L A;  1D7M A;  5AW9 B;  3TF5 A;  4JQ0 D;  2GA1 A;  2M0B A;  1Y47 A;  3AE3 C;  1PL5 A;  1N86 A;  2L5G B;  2WT7 B;  2A06 E;  4K3A A;  2QJP B;  4M3L A;  3GLM A;  1NH4 A;  3BCC D;  3LW5 J;  4U3F E;  2B89 A;  5KJ7 A;  1LTJ C;  2KB7 P;  2FXO A;  3CC4 P;  3AEF C;  1R5S A;  3H25 A;  1FJP A;  3FX0 A;  1KV4 A;  3HD7 D;  3V5B A;  5GTI H;  1YJN P;  2WSE J;  3HD7 C;  3L72 G;  2RMZ A;  3H1L G;  1ZRT D;  1SQQ D;  3I56 P;  1FBM A;  4PD4 H;  3WU2 E;  1FOS F;  3M9B A;  3L71 G;  2ITA A;  2R3S A;  3H1J J;  1MUU A;  2QE7 H;  4B86 A;  3MGN A;  4IFF A;  2WPS A;  1VQL P;  1BSN A;  2KLV A;  3L72 J;  4IFM A;  1GMJ A;  1LNQ A;  1FE6 A;  2FY8 A;  3H1L J;  3C1L A;  4YXW H;  1NU1 E;  1OX3 A;  3RL0 D;  1EDI A;  1BCC G;  1BE3 J;  3RL0 C;  3L71 J;  1P84 E;  2R5B A;  3SFE C;  4GIF A;  1JY3 N;  1YIT P;  2IFM A;  4GOF A;  2O01 N;  4Y28 J;  2LKM A;  3CCS P;  1AQ5 A;  3B5N D;  4OVN F;  3Q5P A;  2WSE H;  1GK6 A;  3B5N C;  1NTZ K;  1PP9 G;  3M9H A;  1Y9B A;  1OWA A;  1J2J B;  2C9L Y;  5B5E H;  2WQY C;  4BWN A;  3HE4 B;  2YMK A;  1N2D C;  1KB9 H;  2IZ0 A;  3A2A A;  5DJT B;  1L4A D;  1L4A C;  2QJY B;  1IFJ A;  1PGJ A;  1PP9 J;  3TNU B;  1M57 D;  2K9J A;  5KLI C;  4HYT B;  1XTG B;  1PPJ D;  3LIE A;  1YQ4 C;  4K35 A;  1GW4 A;  3L75 G;  3CL3 D;  4TT3 H;  3KZI E;  5BU5 A;  1DIP A;  2GM4 A;  3CCU P;  3L73 G;  1UIX A;  1EXJ A;  1NO4 A;  2IFN A;  2YO2 A;  2E5T A;  3LID A;  2WMM A;  3CME P;  4GOE A;  4HH2 A;  3GW6 A;  3I5C A;  3L75 J;  2YXR B;  1L0N E;  1JMB A;  1EQ7 A;  1S9K E;  3L73 J;  5KAI E;  2G8Y A;  1SS1 A;  2E74 D; 
#chains in the Genus database with same CATH homology
 2LXC B;  1X0T A;  2KS1 B;  2M5A A;  5C39 A;  4HJG H;  2HR3 A;  4GOF A;  2B87 B;  5CBN A;  3PH0 A;  3RGU A;  3FXD A;  2B88 A;  3QWO C;  1OVV A;  2Q1K A;  2M0B A;  2OTK E;  1EC5 A;  1Y47 A;  4NPD A;  2P58 A;  5DJU B;  1EDK A;  4CPG A;  4K3A A;  1JM0 A;  1U7M A;  4GOD A;  2I8D A;  1EDL A;  5EFW B;  2B87 A;  1MFT A;  2KIK A;  5CBO A;  1ZW0 A;  5DJT B;  3FXE A;  4KJM A;  1DEE G;  2LR2 A;  2B89 A;  2KZJ A;  4WWI A;  4NPF X;  1BDD A;  3ZDM A;  2KUB A;  1OVR A;  2R44 A;  1Q2N A;  4EYY Q;  2K3R A;  3MHV A;  4BXL A;  2KI7 B;  2ZAE B;  1ZXG A;  3S1K A;  4MN4 C;  1BDC A;  2KZI A;  4K35 A;  4JBZ A;  1EDJ A;  1OVU A;  1FC2 C;  2UWJ E;  4HB1 A;  4IOI H;  4ZNC A;  1U7J A;  2JWD A;  5K5G B;  4NPE A;  2M5A B;  2WMM A;  4GOE A;  2QVA A;  1NVO A;  2QRX A;  1S3J A;  1LT1 A;  4ZMD A;  2SPZ A;  2RKL A;  1JMB A;  1LP1 A;  1LP1 B;  3MZW B;  1H0T A;  4HKZ H;  1H0T B;  4ASW A;  2LXB A;  1SS1 A;  4ASV A;  1EDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...