2GM4A

An activated, tetrameric gamma-delta resolvase: hin chimaera bound to cleaved dna
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
183
structure length
179
Chain Sequence
MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASDRKGLDLLRMKVKEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDSIDTSSAMGRMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Implications of structures of synaptic tetramers of gamma delta resolvase for the mechanism of recombination.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Recombination, dna
molecule keywords 5'-D(*CP*AP*GP*TP*GP*TP*CP*CP*GP*AP*TP*AP*AP*TP*TP*TP*AP*TP*
total genus 47
structure length 179
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2gm4A03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2gm4A02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gm4A01
2DA6A 3HOVJ 3LSJA 4RBOA 5FKMA 5DTDA 4BKXA 4A3MJ 1NK2P 5IPAA 1FEXA 2JA8J 2IAIA 4A3BJ 4MFDA 1IGNA 2EBIA 2ID6A 1MSFC 3GTOJ 1JKPC 1ETQA 3RKQA 1B72B 3LHFA 3JRDA 4A3JJ 1PUFB 1RPWA 5C4JJ 1MSEC 2ZB9A 2R5ZA 4L5EA 2HYJA 4G12A 2R93J 3GBGA 3ZOBA 1I6HJ 4S0HB 1S7EA 4QIWN 5BNGA 2LR8A 3NARA 5JLXA 2DMNA 3IH2A 2JA7J 2HQ5A 1HF0A 1JT6A 2XSDC 2H8RA 3S16J 2LY9A 1Z77A 5EG0B 3LSRA 3QPSA 4DYRA 2FJ1A 2CQXA 4BY7J 2MHCA 1T56A 1Z0XA 1B8IA 2WB1N 1HCRA 2Y30A 2L7FP 5K7HA 1U8BA 1FIAA 5FLMJ 1XG1A 1AKHA 2LTPA 1ORKA 5IYBJ 4Y7NJ 2Y2ZA 3NAUA 2CRGA 1OJLA 1ZK8A 3W6VA 2LK2A 1JKQC 1FTZA 2DJNA 3TW6A 1D5YA 1U9NA 4B4CA 5F04A 1ZR2A 2LP0A 2AHQA 3Q0WA 2VKVA 2O9LA 1VF9A 4A69C 3D1NI 4X1EA 1JUMA 2Y9YA 2K40A 3BR3A 2DMTA 3ZQIA 3HGGA 3HDDA 4D7NA 2WV1A 4M3DA 4XICA 1BW6A 2LLKA 3LOCA 4MFEA 3Q0VA 3JRFA 3RZDJ 5FJ8J 3Q0UA 2E19A 2ECBA 1H88C 1FTTA 4W97A 1NTCA 2K9NA 2NS7A 2XPVA 3JRBA 1JKOC 1WH7A 1AKHB 3Q3SA 3S2DJ 3HOUJ 5M5YJ 2NVYJ 1TWCJ 1CQTA 2MGQA 3TP3A 3L1PA 5F1JA 5C35A 3HGYA 5M5XJ 2K9SA 2HOTA 3M3YJ 1I50J 2AO9A 1POGA 3OOUA 4BQQA 1TWAJ 5K7FA 2ELKA 2RSLA 2WAQN 3HEFA 3DCFA 2OPTA 1SFOJ 3HOZJ 4C2MJ 3H3VK 2D5VA 2HI3A 1R9TJ 1A6IA 3DEWA 1XS9A 3RZOJ 1VFCA 3JRGA 4M3BA 4A3KJ 5C44J 3HOXJ 1P7IA 1GVDA 4ABZA 3I4MJ 3H0GJ 2Y9ZA 2JK3A 4HNVA 3ZQFA 3BR2A 3O8HA 3M4OJ 3BTCA 2EZLA 2E2JJ 1X2MA 4BXXJ 1HX7A 4DZPA 1HDPA 2EZHA 1LE8A 1IDYA 4DW6A 3G1MA 9ANTA 4IHXA 1FIPA 3G1LA 2M8GX 3IH4A 1Y1WJ 4W1UA 5IP6A 3GTGJ 2M9HA 1TWGJ 2CJJA 1QRYA 3ZQCA 4FTHA 1UHSA 3GTJJ 3TEDA 1K83J 3HKZN 1H89C 4IEJA 2HXOA 2JA5J 1X58A 1A5JA 2E1OA 5IYDJ 4JYKA 1MBHA 2HOSA 1VI0A 2COBA 1G2HA 2DMUA 5EF6A 4UUSA 1MBKA 5M3FJ 1AU7A 2HDDA 5C31A 3TW7A 2VI6A 2R7ZJ 1QVUA 1RESA 4B3AA 4NDLA 5IYCJ 4GFBA 5F0HA 5EZHA 3S1NJ 1JTYA 3BTLA 2DMPA 4I76A 2TCTA 1JJ8C 1ETVA 1T33A 2ID3A 5IOYA 4BBRJ 2R0QC 4FE7A 4M3EA 1ZR4A 2NVTJ 2O7OA 1TWFJ 2VUMJ 3FK7A 4J19A 1AHDP 1IJWC 5C3EJ 1U9OA 3HB9A 2E2HJ 3GTLJ 5FLVA 1Y1VJ 3OSGA 1LFBA 5FKKA 2L7MP 3S1QJ 4MLOA 3VPRA 3S15J 4JX5A 2DMQA 2LVSA 3WHBA 2VPRA 2Y31A 1OFCX 1E3OC 1ETXA 5EGOB 3LHKA 2R5YB 3GUVA 4M6VA 4Y52J 3BR6A 1ZGWA 3S2HJ 4JX4A 2FD5A 3BT9A 3WHCA 4I6ZA 2NOGA 2DA1A 1QVTA 1JJ6C 1YRNB 3HOWJ 5EYRA 3K7AJ 1Q1VA 3K2AA 3S1MJ 3PO3J 2MSYA 1BA5A 1FJLA 2O8KA 2LKXA 1I3QJ 3OIOA 2GM4A 3ZQHA 1O4XA 3A01A 2EZIA 3B6AA 4MIMA 3PKZA 2IBDA 3BTJA 4JX6A 4BY1J 4C3JJ 1IG7A 3UJ3X 3JRIA 5FKLA 3BTIA 3RQIA 3I4NJ 1W0TA 1ENHA 2M2EA 3SJMA 5DS9A 1F43A 2I10A 5E3LA 3CDLA 4A3FJ 3F0CA 1BW5A 3FIWA 1IDZA 4XIDA 2VKEA 1WI3A 5HODA 5J1RA 4UUSB 1IV6A 2G0EA 2R5YA 2NS8A 1GHTA 5EGOA 2RAEA 5C32A 1U78A 1JKRC 4CYCA 2X9DA 4DYQA 2TRTA 1GDTA 2K9QA 5EEAA 3FK6A 4A3IJ 2YU9J 1B72A 1X2NA 2XRLA 1ZQ3P 2PMZN 4D5CA 2DTZA 4EEFG 2NVXJ 1MBGA 4JP0A 4M3GA 4DZJA 3SFIA 4XRSA 1RETA 1JUPA 1RKWA 2L7ZA 1WCMJ 4D5FA 2DA4A 2R92J 2W48A 1JT0A 4X6AJ 3BVPA 1OCTC 2JJ7A 1QPIA 1ZKGA 3CMYA 4M3FA 2DA2A 2B63J 5EZGA 2X48A 2YUSA 1BL0A 3UKGA 4MO7A 2HOAA 5EG0A 1XC5A 1DU6A 2L9RA 3LSPA 3MN2A 2ME6A 2YS9A 2GLOA 4LOCA 2JMWA 3HM5A 2FX0A 2JA6J 1MH3A 2XB0X 4B1RA 2CQQA 2KDZA 1ITYA 2DA7A 5FKNA 3G1OA 3MVPA 1SANA 4IHWA 2R5ZB 1IC8A 5EDNA 4AUXA 2XB5A 3BR5A 1PUFA 1UG2A 2NVQJ 2JWTA 3CQZJ 2MW8A 3HBLA 3PO2J 4D7MA 3G13A 5J3LA 1LFUP 5GPAA 2N8GA 3GTPJ 2XPUA 1TC3C 2CUFA 3ZQGA 1H8AC 2LFBA 4IHVA 1GV5A 2QCOA 2HXIA 2XGEA 1UMQA 4DYCA 3C2BA 3B6CA 2H1KA 3BR1A 4FE4A 3JR9A 3GTKJ 5J1UA 2XGDA 4AYBN 1YRNA 2ECCA 2EQRA 3QPLA 4UUTA 1WGXA 5GPCA 3TP0A 2IEKA 4FCYA 4A93J 3HOYJ 2GM5A 4QTRA 3LNQA 1BJZA 1HDDC 3MKLA 2M34A 2LD5A 1HLVA 2JN6A 3ILXA 4XRSG 4RDUA 5C4XJ 1F36A 2CU7A 5J1YA 4A3EJ 1OCPA 3JREA 2DN0A 3O8GA 1MH4A 4QSHA 5JLWA 1ETOA 4IHYA 3A01B 2E2IJ 4C3HJ 2DA3A 2GBYA 5K7ZA 1LE8B 2KT0A 2QF7A 4V2FA 3S17J 2FQ4A 2XPWA 1ETWA 2XGCA 1B8IB 2L0KA 3SDGA 4C3IJ 3A02A 4BBSJ 1GT0C 3BG9A 2X6OA 3PM1A 4CYCB 4A3GJ 1WH5A 1RR7A 5FKOA 1MBFA 2OF7A 1GV2A 1P7JA 1ETYA 5E3NA 1NK3P 3JRCA 5E3OA 1JGGA 1JTXA 3E7LA 5E3MA 1MNMC 1K61A 3LSGA 1GUUA 3IH3A 1TWHJ 3S1RJ 3BR0A 5M5WJ 3JRAA 5F08A 4V2GA 3BG5A 5GP9A 4AC0A 4XRMA 4XK4A 3BQYA 3FKIJ 5F0FA 1ETKA 2CUEA 3BG3A 2EZKA 4A3CJ 1JUSA 1EF4A 1IRZA 2M0CA 3QQAA 1ZTRA 5IOZA 5M3MJ 2ME0A 3ZQLA 2Y0SN 1W0UA 1MBEA 3S14J 5IP9J 3JRHA 3BQZA 3GTQJ 3A03A 1DU0A 2DA5A 3FISA 1VNDA 3CCYA 5C34B 3GTMJ 1APLC 4FISA 2EH3A 1HOMA 5F0CA 4A3LJ 1IUFA 5IP7J 2P81A 4A3DJ 5F27A 3OSFA 2MG4A 3IV5A 1MBJA 1WPKA 1RKTA
chains in the Genus database with same CATH superfamily
1H93A 2I8AA 1Z3CA 2GHRA 5A4JA 2BEWA 2QYSA 2XGSA 3A0RB 5EJ2A 2JHAA 4YK7A 5ALLA 4DQXA 1OREA 1PK8A 1F0PA 1Q7GA 4YRVA 1WRGA 2MYSA 2FFJA 1HF0A 5DPMA 2LY9A 4E6KG 3WWPA 1I1OA 2XQJA 1R5GA 1YS4A 1N5LA 3C1TA 2A5GA 1F1ZA 3DD1A 2IHBA 2IGKA 4ER3A 1A97A 1NKZB 2WD7B 2XSJC 3V8QA 2ISZA 5CVIA 2WKPA 5K0JA 1OXUA 1UJ4A 1J1DB 2C8JA 1KC1A 3RROA 2FPRA 4PLPA 1YQAA 1JIIA 4Z4IA 3G0CA 1QQBA 4DR7B 3FXQA 1M1JB 2RBGA 5GONB 5CCGC 1E4EB 1PIWA 4KX5A 2HF2A 3SZUA 4NHEA 1EGAA 5G02A 3EEIA 4L0YB 1VMIA 2EJUA 4FJ0A 1SQPD 4ARUA 1F2DA 4RPIA 3CSDA 5H7XA 4HJGH 3JPYA 3HB7A 1CBUA 2I6XA 1YL6A 2EX1A 4ALMA 4QOEA 4LNUA 3SKVA 3N4XA 3HN7A 2GBLC 3TSOA 1CZLA 2Z2KA 4HX2A 4CF3A 4GMFA 4AJEA 1W73A 5T64A 3RK0A 2F9FA 1MZ9A 1VRVA 3FNRA 4QT0A 4WEOA 3RCBA 2HZDA 1KB9I 1QCCA 4FPXA 4LVCA 2NUAB 2X2PA 4YP7A 2Y6UA 1PP9D 1Z13A 4PWZA 2OYSA 1ZK1A 2V5AA 1D2NA 4XUCA 2H1RA 1H8AA 2R79A 4LCEA 2DUUA 4DDMA 1E7WA 1KJIA 2VJOA 1Z9CA 3SWFA 3F5QA 4JVSB 4TLDA 3V48A 1WZIA 1ESCA 2ZPTX 2CV0A 3JQAB 2M98A 3DLIA 2VCHA 1A6QA 4K3UA 1CP3A 2QHXA 4MIYA 1JDBC 4B87A 4OP1A 3W6NA 1CZQA 1V0JA 1RE4A 3B6AA 2GNAA 3GJSA 4DXAA 2AOTB 2P8TA 1XROA 5AVSA 2IITA 3FRIA 1AKEA 1MT3A 1WWKA 3CC7I 3U9TA 1E0KA 4IQFA 1J2YA 4G1BA 5CCGD 4OXYA 4C76A 2YV2A 4OI2A 2GUGA 5KSYA 2IUTA 1P7YA 1X1AA 1YOVA 1P7PA 4Q4AB 5J63A 1AQ5A 3NIDB 4E6PA 4F52A 1QX8A 4OHMA 4LRYA 3PUVA 1GFZA 3K9GA 1KVSA 2QLBA 4J0FA 4U7WA 1E2EA 1SMTA 4PV1B 1NQOA 2SKDA 1NT4A 3IIMA 2BKLA 3Q6IA 2B63J 1EP3B 5ERYA 2YXEA 2F6CA 2HOAA 2BCGY 4FX4A 4XQ9A 1VYHA 5B36A 1OV4A 4CEHA 3H42B 1DRWA 3ITNA 3FZEA 4QOGA 3MPOA 1QTQA 3BR5A 2VPZA 4JA2A 3L2RA 2QTZA 1KYZA 2WHXA 4FNOA 4XQ0A 1N3LA 5DE3A 4XLZA 3OLZA 1V6CA 3PEUA 2NUBA 1QP8A 4NECA 4GF5A 3FFBA 4FK8A 4Z53A 3RTRA 3UB3A 2CJFA 1GL2C 2WWVD 1JB0J 3MLAA 1ENYA 1DCMA 1MH4A 1E0SA 4B7ZA 3O3CA 5MN6A 4RKUJ 3W8RA 4I50F 2F5EA 3JQCA 2WZDA 2HBYA 3QI7A 5EP2A 4QIHA 2ZWVA 2Y0CA 1SQQJ 3OKPA 1FPQA 2XKBA 5D8DA 1QUEA 2FW6A 3VAYA 1HI9A 2O07A 3IS3A 3KKZA 1R6TA 3QYJA 1O89A 4PO1A 3C6KA 5LHIA 1HE4A 1X0XA 4U0KA 1TZCA 4H0LD 5A02A 3LSGA 1KEWA 5KPDA 2I6GA 4HKZH 4YMIA 1ABFA 3VQTA 4KDFA 3V8EA 1HF9A 4L78A 1OBOA 2PMZA 1FCJA 3FKIJ 4M46A 5A2QK 2EXXA 4HQNA 4J9VA 2FP3A 1P2UA 4Q6BA 3KEQA 4QTTB 5CB4B 4FR5A 1KO1A 2DCUA 5HM8A 1MJGA 3H11A 4HP8A 1R18A 1P4XA 1NUHA 3G6WA 4UNIA 4EA7A 3DUFB 1KVUA 2HXYA 3WKEA 1TKAA 1WXIA 3GXBA 5JVDF 1K66A 5DTDA 4IZOA 2EFPA 1KK2A 2N1TC 2W6JA 3KQKA 3A1SA 3ONNA 1XTCC 2UVQA 1A8IA 1WXQA 4F5DA 2VQDA 3ZE6A 2Q3CA 2XGJA 3K1TA 4G1EB 4X5OA 4XVRA 3TIXB 3PFHA 4IX1A 4DB2A 3T7TA 2PH7A 4FYPA 3ADDA 4NS1A 1S7OA 3RFTA 2QQGA 3VKUA 2P69A 1FZCB 1PDVA 1G60A 3ZPLA 2P8JA 3EQ8A 4DOMA 1E8DA 3H1IE 2GHQA 4I66A 4XLPF 1I6MA 4TROA 4BKUA 1QTNA 4LFBB 4OSEA 5AW6A 3T7KA 5ALDA 2CHVA 2G25A 3W5JA 4IR7A 3DG9A 4Y1GA 5DD8A 2Z8ZA 3P20A 2C2MA 4IH9A 2QTMA 2I2DA 3AF0A 1DPFA 4J0CA 1T91A 2JDIH 4XCXA 2FN7A 3SPXA 1BEEA 2VA9A 2WAAA 4GSYA 5BO5A 2X14A 1ARZA 2Z4TA 1PBTA 2VYND 4I9UA 1RAAA 4B76A 2AXTC 1YNSA 1FBTA 3LKVA 4FEGA 1SFOJ 5APTA 4I5IA 4BBPA 1QDLB 5CA0B 3NWJA 4YUWA 3JSPA 2CC2A 2N47A 2FG5A 1QOQB 4P86A 3DOJA 2JF0A 2VBZA 2JJ1A 1CUGA 1RF0C 3ETJA 1UBUS 2FRXA 1IXRC 1T0UA 5JNLA 5BSTA 4MGZR 4I1RA 4G23A 1JY3N 1JCDA 2VASA 1Z6RA 2AMLA 3MEQA 3RYCB 4BHCA 3DL2A 4BRSA 2HQOA 3N2GA 4CEIA 4NPAA 1BSNA 2BVNA 3T5PA 3BFXA 4GS5A 1FFXA 2P4SA 4RPCA 3RK4A 2FMLA 2NVTJ 2VEOA 5AHRA 4IRIA 3CS3A 2IZZA 2NZUG 2W6MA 4TLBA 2I76A 4OHUA 3B3AA 3VMZA 1ZLLA 3BGVA 3H75A 1LXCA 1M2VA 1ETXA 1P6UA 4ISBA 2PWPA 3ZQ6A 1JJ6C 4CNBA 1R74A 2MOKA 4QWWA 4DT1B 3HD7A 1WY7A 2G88A 3E3OA 2JIMA 4HDCA 3CCLI 2V55B 2Q3HA 2JI8A 1ZI9A 3TCKA 4ESJA 4PG8A 4MULA 3DTVB 4B6RA 4U2GA 4JA0A 4LC1A 3W8EA 2M2EA 4RM2A 2QV0A 3KT8A 2DQLA 5M1BA 1OAKA 4ES6A 1NO4A 5J6XA 1VQOP 3VYSB 4BVHA 2VSXA 3BHMA 2CXPA 1ZZEA 1A98A 2AOXA 3FTCA 1BQ3A 5A1JA 2WUVA 4JK3A 2R8RA 4MOWA 3MWJA 1EYZA 2TRSB 1GRQA 1Y33E 5I51A 4IRXA 4KQJA 4L4XA 2C61A 4KO3S 1JW9B 2K5UA 1KETA 3O38A 2ZUVA 1ZNYA 5C5DA 2KIKA 5AM2A 4MH0R 5DTQA 2HRRA 1UG2A 3VKWA 5IEJA 5D3QA 4P0TA 2IYEA 1CR6A 1CFZA 5DUKA 1UMQA 2QJYB 3HADA 4UE3S 4HX5A 3I6QA 1COWD 2ECCA 4UUTA 2PL1A 3HWWA 4BV2A 3TP0A 2V7FA 1Q0LA 2B5WA 3QXSA 1H1DA 1ZD9A 4PO8A 5CA0A 1C0PA 1CRWG 3VTZA 1OXBB 4RK0A 2XD4A 2PR2A 1T39A 4V19K 1XB4A 4EHFA 5ILQA 3KP7A 2G9VA 3PJEA 3OR2C 4LXYA 4EUKA 3I5UA 4UATA 2Q3EA 3SJCA 3PC7A 3NRBA 4C4TA 2X1HA 3E7LA 5BUSA 1KTVA 1TDJA 4V0LA 2K02A 1NPTO 3DS8A 1M34A 2KZGA 1RI3A 3OQPA 3UK1A 2XMBA 1D5CA 5F2NA 1U0HC 4Z9AA 1JUSA 5FGMA 2QGZA 4EX6A 2V8BA 2V1NA 4CKEB 3S2ZA 3L7KA 2VSFA 1C4XA 4CIAA 2X4HA 1LTBC 3UAZA 1HTTA 4GODA 4MYSA 1W9HA 3BPVA 1B4DA 4XWAA 3QUBA 2IV7A 1FSZA 1KH1A 3NHBA 3GHGA 4Q4JB 3W6JB 4ABTA 4A3MJ 2Q2OA 2EZ4A 5TJ9A 3IMFA 1QP0A 5LXTB 1KONA 4J3JA 1JIQA 3AUJB 3FOFC 3UGJA 3CC4I 1GSAA 3BZUA 5LQCA 1LBQA 3MJEA 2JA1A 4EPRA 2I3GA 1WQ4A 3Q0EA 1RUNA 1Y3BE 1RACA 1OW7A 2ZVOB 2VOJA 3IBCA 2MCFA 2WSCJ 2PXAA 3K2ZA 4NPFX 3JD1A 1CDOA 3K6KA 1KGDA 4KFUA 2LXNA 4E2XA 4FYKA 3TQHA 5C53B 3EA0A 4G07A 2HFHA 4MITA 3WV5A 4D7NA 2GZWA 2WV1A 1PJZA 2A59A 2JK0A 1LF0A 2QN1A 1DAFA 2BJWA 1I7PA 4O9BA 4HDSB 1SQFA 3G9UA 1KB9D 1L4YA 5KWIA 3BZKA 3ZOKA 4IXDA 4ZTBA 3MT9A 3VOAA 1B6SA 1SMKA 1QBGA 1EQ2A 2HI3A 3H5VA 1A6IA 3RVMA 1H4SA 1HFWA 4BVEA 5DO9A 4HZUA 621PA 1UMCB 3KPWA 1DPUA 4ZYHA 4ZOLF 4I1LA 3CNNA 3LBYA 4UVIA 1QR2A 1IM5A 3OY9A 5GM2A 1F4PA 1KQ8A 2F8MA 1JVBA 1ZJZA 1OY1A 1H9AA 2EV9A 2PUHA 5AVRB 2ZQZA 4W1UA 5HF9A 1YDMA 4QBTA 3I12A 2FHSA 3H1KD 2VP9A 3GG9A 1K83J 2FPGA 3KAPA 2Z9BA 1FDTA 2XXJA 3DNPA 1O9BA 3N7TA 4LBZA 2LY2A 4POAA 3J80K 3EAGA 4XGRA 6Q21A 1ZH2A 2IXDA 3QTTA 3HB5X 4MJ3A 3W2FA 2XQFA 4Q5SF 3AV0B 2C5BA 2PQ8A 3O4GA 4ZKPA 3A27A 1GA6A 4B3TB 4R8RA 4IQGA 4R1LA 1DKUA 2VKHA 2VP4A 1Y1VJ 3ZWNA 1I2ZA 1ZUWA 3ZWAA 2OYRA 2NNWB 3H4TA 4YUZA 3OESA 2G1AA 4WOPA 2FF5A 4AF6A 4YWHA 1PL7A 1LQ1A 2OHJA 1EBFA 1KZ6A 2LKXA 4XVQA 1E5VA 2ZOSA 5A5EA 3KIOA 1ZEMA 1NTRA 2HQ1A 1LD3A 1QHHD 4GL4A 1HQYE 2C88A 2Z9OA 5TB5A 3TG8A 3O8LA 2OXEA 1DJQA 1NQVA 3QOFA 2P6NA 1PZEA 4JV5B 2GXAA 3KFLA 3TXYA 5KLVD 3QX9A 3R3YA 1DBQA 2HT1A 3EG9B 1BHO1 3L4BA 1E8MA 1Y3IA 2R8OA 5ABPA 3ZE2B 2FSGA 8AT1A 4HF1A 3A6FA 3VB2A 4ZQIA 3LWFA 3AU8A 3UEOA 4BASA 3ABVC 5KNCD 1FLAA 4UD6A 2WYOA 3I9KA 4XRGA 2IC5A 4HTFA 1GEEA 1JBQA 4ENNA 1E7MA 3DUWA 2RK3A 4GFDA 1RKBA 1EBBA 4IWYA 2R5FA 1LFUP 2YNMD 1CRLA 1SBNE 1JR3A 2XCSB 3DF7A 5LZ7A 3HFGA 3N7NA 2O0MA 3GJ8A 3E03A 1FL9A 4EATA 2FUG2 5CUQA 1EESA 2C95A 4RBNA 1FDWA 2Q5EA 2DN0A 3WYCA 3EHEA 4IPTA 5L3SB 4BO2A 2E4VA 1Q7TA 2GO1A 4RMJA 1MZPA 4AIIA 4JBLA 3GVCA 1AQJA 3L75D 3NMUF 1JXSA 3LDHA 3BXGA 4BE0A 1YZLA 5AIBA 4CEJA 3A2KA 1EB8A 1T98A 4G86A 3NRCA 4PRYA 1YK0A 2Y1WA 3QUCA 2BE7A 2EWMA 4ITUA 2VJMA 1Z0FA 5JXJA 3UK7A 5DTJA 3FTNA 3OOYA 2QD2A 2ZSFA 1SK8A 3KRTA 1P8JA 3ZTYA 3WA7A 4CQLA 2IH4A 2NX2A 3O8BA 2IDKA 4W5QA 4IZ6A 1MJFA 3ZGOA 3HUSB 4OGQB 2R2GA 5SYNA 1DCFA 2JFUA 1SQPE 4GYIA 4RJ2A 3G0OA 2Q3IA 1FLVA 2C5GA 3PUBA 1BR4A 2YZMA 1BGYD 5GVRA 3G9RA 1QG6A 1QHFA 3QKWA 1G59A 4EL0A 2GN0A 4HLYA 4LW8A 1KMQA 1PNTA 2RKOA 1TGYA 4KXXA 4XLLA 1TJNA 1ESDA 3K09C 3KZIC 5IP7J 5F51A 2QZ9A 5ER6A 3PA6A 2XCRB 3BN3A 3HN6A 3V1YA 2JJ8A 2BMEA 4G94A 3GF4A 2IYAA 5BT9A 1D1CA 4ZOEA 1E1YA 5KYWA 1DNPA 5GINE 2C4WA 1ZPDA 5ALYA 1WJ5A 2EG9A 1IY8A 1Y34E 2AL7A 2CYBA 3PXBA 2OWDA 4GP9A 1VQNP 5DYMA 2FW1A 3E0XA 1QBKC 4LSWA 5LC1A 1CRPA 2GAIA 4P9FA 5ISMA 3CPHA 1OKKD 4YQZA 1VJGA 3JVVA 1UQTA 2CXUA 5IYBJ 2CW7A 5A4KA 2LVBA 4AMYA 1L6IA 3EZ7A 4M3NA 4MWOA 3R7FA 4L8FA 3DEUA 4XPIB 3AY3A 4V38A 4BQSA 4PYMA 1JXMA 4EM1A 2CEAA 4PYNA 4I50B 4DGSA 3EVEA 3HLKA 4PSCA 2ZZKA 4JLUA 1NY5A 5IYZF 3A3PA 5H6RA 1XUOA 2NNYA 4DV3B 1DT3A 3Q9LA 4ENRA 3B5IA 3LYUA 2RHWA 1U2SA 1CT9A 3I8XA 5KOHB 3OPXA 3C3JA 3MJHA 1P62B 2HB6A 5DK6A 5K8TA 3IMEA 1AZSC 4A0ZA 4F93B 4UTXA 1OXZA 1U2ZA 3BSFA 1SC7A 3UTDA 3WQQA 3BR2A 5LGTA 5FYDA 2XNCA 2L0XA 4Y2TA 1NRWA 3D43A 2VP5A 1J5EB 3CEJA 3KJQA 3H13A 5BOXA 2FJPA 5GTHH 4YC7A 4B7XA 4UM5A 1NGMB 2RHLA 3DEZA 2IYLD 5G0UA 2X9VA 1G2HA 1RPZA 5ANRB 3VO1A 5JS1A 4DLUA 1MH9A 4FR2A 1WUJS 4A8PA 4MYCA 1N3BA 4KIUA 4FHEA 2WWFA 4Y0AA 1BMDA 1HSTA 3TEMA 3JAWA 4DLKA 2IHYA 4KHPB 4AL4A 2GK6A 4PYOA 4MI9A 1XRNA 5F3DA 1KPIA 4J7AA 3MS4A 1S89A 2DF8A 3I9MA 5DTRA 2L7MP 1PTJC 2H59A 2GCGA 2HPAA 3AE7C 1H6AA 3CONA 1E5XA 3VV3A 1A96A 3AYZB 4LB5A 3LHKA 5AW6B 3JAKA 1JKMA 2Q5LA 3ZE8A 2W6PA 3LP5A 5ADWA 1BA5A 3KLOA 3L2WA 6NULA 2XR1A 1NOHA 2HMTA 1IATA 4QPNA 3RS5A 3BA1A 2RDPA 2B30A 4BZPA 4D56A 3OFND 3P5JA 1YB6A 2IYWA 1LW6E 2ZT9D 4BV9A 4LVUA 5A5GA 4XQGA 1NN0A 1X3ZB 1VQ1A 1JS1X 2YXPX 3FFXA 3ZCSA 3GLGE 1PFYA 3CH4B 3H1TA 1KGSA 5CDUA 1X77A 2I3DA 2P62A 3PHJA 1SU4A 2R8XA 3ICOA 4RGVA 1YZVA 2PUFA 2WNSA 2QRJA 4XM1A 1DDIA 3JR7A 1JT0A 4JPZB 2QUZA 3M4JA 3TL4X 3RHFA 4EUHA 1E0DA 1RPTA 3BFVA 5DLQC 3BZ6A 2WIDA 4C05A 2VS1A 3B3QA 2G0TA 1FX0A 1OYVA 1QF9A 1TVCA 2VF7A 3OPYB 1EVYA 1LGHB 4G5HA 4MR9A 4GOEA 3DD5A 1M5TA 4KKXB 1SZPA 2R1UA 2XGEA 1DDNA 4RTPA 2OA0A 2H0QA 4QRIA 5L51A 4BKRA 3BWBA 1II8B 5CURA 4WOJA 3N7UA 3BB3A 4INPA 7ADHA 3UK0A 3ZW8A 4H17A 4A0RA 4JYMA 1UEXC 4YR9A 1IUPA 2FRHA 1QXSA 2MYNA 1TUIA 3A01B 2WINI 2XMRA 3SKXA 3DH0A 3A31A 4PV7A 1S3SA 2X8AA 3G7UA 5FF9A 4KKVA 1P7ZA 3VPGA 1T8RA 4COOA 3O8OA 1H8EA 4YELA 1OLOA 4NV3A 4AZSA 4ARBA 4TWIA 3ACDA 4LK0F 3PUYA 2C29D 2NO6A 4RZQA 4BCDA 4FU0A 3UAYA 5JY6A 4P7FA 5BNZA 2J9RA 2PX3A 3PL5A 1GUUA 3SYTA 2R00C 2FV8A 2ICWG 1IMJA 1RLIA 1UKAA 1HKUA 2VAXA 3HP4A 4OEHA 1ZVMA 1EHIA 1Z2PX 2P6UA 3RIXA 1WI9A 4LGVA 2SBTA 2QQFA 3R3HA 2LBPA 4MSUA 4BE4A 3OFJA 1PIXA 4TSFD 2BJHA 3BHIA 3TWOA 4OQLA 2IEAA 4IDAA 4E03A 4AS2A 2QL5A 3JQBC 1ZXBA 2ID6A 5SYMA 4AO8A 1FUKA 2JGRA 2QVYX 3IBYA 2Z2XA 2Q3FA 3E7PA 1FFSA 1DWUA 2A3NA 2XCOA 3ZPXA 4S0HB 3NX4A 3WFIA 5BN3B 2GHIA 4IEIA 5F7ZA 2H2AA 1XNRB 5GZ3A 2JR8A 4TM8A 1WO8A 4WNAA 3AZQA 1KKMA 3WR5A 5C52B 1Z5OA 2KOGA 1T8UA 4D96A 5J8FA 3T1OA 4NATA 1WCIB 3G3ZA 1VMEA 2UYCA 5KU7A 5JLAA 4B46A 4Y7NJ 1LK0A 3LA3A 4ZQFA 3M2PA 4BYMA 1Z39A 3THWB 4Y6RA 1I01A 3KOOA 3TW6A 4HDKA 4N03A 4F1KA 4CA0A 2YJZA 3GHGC 4XBFA 4RFVA 4ESOA 1FYEA 3KD2A 2YZ2A 5EL0A 3RLIA 3VR6D 2AI2A 3WMWA 3F8MA 3FCYA 2NVYJ 4G6QA 4LCBA 3S8MA 5LZ9A 4IQ8A 3BJMA 2YC4C 3DYBA 1X1CA 2B78A 2XF7A 4DMHA 1GPAA 4QUHA 2UYOA 4TS9A 1OLSB 5AKKA 4IL6H 4FQGA 3G2JA 3C4VA 3RIHA 2DW4A 4L4RA 4GMGA 3LW5H 1P84H 2O52A 3VNVA 1YRWA 2V7WA 1QV6A 4M60A 1KH2A 4FX5A 5C1BA 4JEHA 4J3NA 4X20B 2DMUA 4KK3A 3L2UA 3HZHA 2FEPA 3PNSA 4PBSA 1UOPA 4DYVA 1QRUA 3RI3A 4J9UE 3LY8A 4DC9A 3O4RA 3OSUA 1T2DA 3ZX4A 1I4LD 3RRFA 1G20A 1XXLA 4ZJZA 2DFDA 3O8DA 4BFWA 2REXB 1NJ6A 4YCSA 4R2XA 3FYSA 3KZNA 3AF6A 3TDKA 1QTRA 2XDVA 4FMCF 1E2IA 3RL0B 4C08A 5E79H 2ZAGA 3R6LA 4JENA 5KEIA 3AFIA 1OR7A 2PZGA 3GW8A 3AE6C 1SQXK 2INGX 4LN1A 2Z4SA 5CFLA 1GCAA 3N5KA 2WJIA 2QGNA 4OMCA 1BXZA 2QKMB 1EQ7A 3TTVA 3EC2A 1WCV1 3FK6A 4LA4A 4QXOA 5FPKA 3F9CA 4BVLA 3QIVA 5AVRA 4XYBA 1DC8A 2DYKA 1KJ9A 3K5PA 4KNYA 4K81B 4EJUA 2AN4A 3PF9A 1O6GA 5JR3A 4ZQCB 4PLHA 2QJPC 1ZA2A 3HCRA 3NHJA 4II3A 2OUKA 1N2OA 2Q28A 2ZJZA 2RH0A 2BONA 4I2NA 2XE4A 5F1RA 1T9BA 1TJ3A 1FFEA 2HDNB 2F7SA 2QTHA 2QZZA 3IGFA 5L3VA 3D3WB 1ZCFA 5K1YA 1RI7A 1NM5C 4Q9IA 4O33A 3L1KA 4OGLA 2JJ2D 3VP9A 4TM7A 3H1AA 1DQRA 3BZCA 1JDTA 4N7RA 5FTNA 3OOSA 3L4BC 4IWXA 1RRCA 2AOUA 3KHKA 2A5WA 2M1ZA 4OMUA 3L05A 3N07A 2UUZA 1Z4OA 3O47A 2GD1O 3NHPA 4R1SA 1L7EA 1XGMA 3KC2A 2L0KA 2JCVA 1W7PB 3D2CA 3AUXA 4N5MA 3MWEB 3OUZA 2YHSA 4H1TA 1T5HX 1SVFA 1YSCA 5LRSA 5AKGA 2M7BA 1T2FA 2PK3A 4BNKA 2IH2A 3LK6A 1XALA 3N0WA 3PWSA 5D1HA 3JWJA 3CZPA 1KR2A 2ABWA 3IIJA 4R7TA 2PZ8A 2VT7A 4WZAB 4JI2B 1E2PA 4A9AA 2TDXA 2KZVA 4W1QA 3FDIA 4MI1A 3G71P 4KJXA 2I2BA 2F5FA 2P78A 1J1EB 3T3EA 3CZQA 3STVA 3W2HA 3PS9A 3U5TA 3LAWA 1JWLA 2XQKA 3ZV3A 1YCFA 3GVHA 1KS9A 1KI4A 4HF0A 2FFDA 2ZT6A 4GVPA 1UPCA 3I73A 3KZXA 1KBQA 1YTZI 2UZ3A 4WXPA 1LQ2A 2CW5A 2VF2A 2NXCA 5J2TB 1FTYA 3LG2A 4H13C 5BN4A 1IGNA 2XT9A 1KIAA 3NKLA 2Z58A 5CLQA 5H3CA 2STWA 3B6ZA 1Q0PA 5FBLB 3VJRA 4RK7A 1UQRA 3LMKA 4R8SA 3W2VA 1HLDA 4I2LC 4DVGA 4O08A 3F78A 3RBXA 1AGRA 2GETA 4IXNA 2BH2A 5IJ9A 3GP5A 4G97A 1SB8A 1D2EA 1NWQA 2ZIFA 1XDGA 1QLED 5I9SA 4PE5B 1ZVQA 4HCJA 1JTEA 1U3DA 4H3SA 1F2UA 1K8QA 4DSOA 2R7KA 1XAJA 3IUQA 4U88A 3VSKA 2P67A 4OY3A 1FMWA 3FBGA 3CH5A 3IQZA 2F1JA 3K09A 2WDZA 1I6KA 4HZGA 4EGQA 1KF0A 1O96A 1NLYA 2UZIR 4BRYB 5APYA 1ORRA 5FOSA 1TQPA 5FJ8J 4L4ZA 3VU8A 3R8FA 5AVWA 3HKEB 3PQCA 3V7FA 3DZJA 3CRRA 3DMYA 1CRQA 1FYWA 5TQ2A 5BMZA 2KHZA 4XLFA 1KO7A 1SC9A 3RKXA 3L7BA 3MP7B 4ZVUA 3RU7A 2OR3A 4UDOA 1JHVA 2Q4EA 4RKWA 3TUZC 4Z49A 2XVAA 4GZ5A 4WCFC 1KVTA 4O4IA 4PNZA 1IFDA 3GQBA 5C1PA 2RD2A 1E9FA 4MW7A 2Q0OA 1EFVB 3O8NA 3DB1A 5FQNA 2VA8A 2P35A 1KYIA 1XJ5A 5K0SA 5BUZA 1VI0A 5DW3A 3TFOA 4W8OA 1FTGA 1A1VA 3RS9A 1KN7A 2ZR7A 1G3TA 3V2HA 1Z83A 3FOCA 3RU2A 1J8DA 1RJ9B 4KAFA 2W98A 4JBXA 4AJKA 3QXGA 4EP1A 3EN0A 1CCWA 1US8A 3WLHA 1PJ3A 3JRNA 4HAXA 1GK6A 1PFVA 1THGA 2CK3A 3I3OA 4E21A 5IH3A 4NUBA 2ENUA 5CPRB 3NHYA 4AZTA 2G40A 2LIVA 3A1UA 1LI5A 3VH2A 3BT9A 3I6MA 1KI9A 2DA1A 3PT5A 1WETA 5DLDA 3EAQA 2HZBA 2X0DA 1OCZH 1RYNA 4HLUC 1DUSA 1YAHA 4HGPA 4NOLA 2ESRA 1B15A 1UUFA 3GJ7A 5B1SA 5FLKA 2UUPA 3BMOB 3CWBG 2H1FA 1A3CA 1QHYA 3IV6A 2GOYA 1O8BA 1C7ZA 4O2BB 2YR0A 4OKNA 2V9KA 3A1TA 1GIAA 3JQ9A 1EFLA 4G1CA 4X1YA 5JXWA 3HBJA 3WNZA 3VRHA 5KTOA 2FGKA 4GNRA 4CM7A 1DLIA 3IMGA 1VYUA 3R5FA 4D41A 3F7OA 3LPLA 1NVBA 3NYRA 1ZLKA 1DC5A 2YOHA 4OUDB 3PL1A 2B4TO 3WV4A 2ZUDA 3LCVB 3AG2H 5JY1A 3KKNA 5EIWA 1FRNA 2YS9A 5HFNA 1U8RA 2LW7A 3IEXA 4LDQA 4LWPA 2M5AA 4MQBA 5JIBA 1ZN7A 1HYHA 2P9HA 3I5AA 1W29A 1VL2A 3ZTWA 1M33A 3UMJA 1JEQA 1KILA 2C59A 2HHJA 3L7IA 4KO8A 2JT1A 1HDRA 3PUWA 2RC4A 5FUQA 3U1AA 1GYQA 1EUZA 1IBSA 4I0WB 5C8ZA 3OZFA 2OHFA 2C9LY 2NU6B 2M0BA 2OY0A 3M3PA 4ZGBA 4MRMA 3I6YA 1JHUA 4N7JA 5DLPA 1X1TA 5JADA 3JREA 4G5SA 1Z34A 6PFKA 3FHZA 1TL8A 1PJAA 2XUFA 3RVDA 1ECGA 3MCTA 5ILSA 1N5OX 1XZIA 2X6OA 3ZWBA 5KPJA 2EP8A 4WNCA 1ODDA 1G5FA 2VQCA 2IHKA 3LFHA 4UE6A 1W0CA 2ATXA 4I46A 2M5WA 2J46A 1USWA 2DCMA 4M1YA 4NCXA 3L7MA 3FVWA 1EJ2A 3CJRB 3QHQA 2ZBDA 4HSGA 3WMEA 4UHKA 3AVWA 2OK7A 3KSAC 3IWFA 1Q19A 2Q07A 1W8DA 4NKRA 4L9WA 2IT0A 2YKQA 4K9SA 4ZNCA 5CT6A 3R3VA 4Q7JB 3W9UA 4FISA 4RVDA 4GE3A 2VT6A 3DL7A 1SQPJ 1SHLA 4N3GA 3ZDBA 2W82A 2ZAEB 1E63A 4N40A 5KAPA 1J7KA 2AZTA 1EH7A 1JKPC 4RWEA 4JLNA 3P45A 1P0CA 1RHQA 2R5ZA 4FETA 4C6TB 3HTUA 3KCCA 5AM4A 3RVQA 2QXUA 4OFXA 2DMNA 2R00A 4KR7A 1NJ8A 1UPBA 3H92A 2HRQA 3L8DA 4D5EA 3EFHA 2ST1A 2FX3A 2DTDA 3VC7A 3QOYA 2A0KA 4QMAA 2LF8A 1ABEA 5I9NA 1TBXA 1XXHE 3SCZA 2G67A 2J0SA 2QLMA 1RTTA 3L75J 4MUXA 3RK3E 2WJVA 2R3CA 1IC6A 3D54D 2IW1A 3F2VA 1OIVA 3JYNA 1LBIA 2RMKA 2XPVA 5HR5A 4HN2A 1Q1QA 5E1BA 5J3JA 2ODAA 1KQ0A 2AO9A 5AICA 3ZHSA 3Q7TA 2WAQN 2V98A 2VTVA 4WBXC 1K4YA 3HPQA 4WZAE 4TRMA 5AI4A 2R7QA 2D2IA 4GNKA 5TF4A 3U48A 4LXIA 4MS4A 3IPRA 5G53C 3GPBA 3PC4A 5KQMA 3GEPA 2WV7A 4AIRA 1WBDA 3CBQA 4CQLB 4JVLA 2ZT8A 2SNIE 1BR1A 5FP0A 1VXOA 3B89A 4AVYA 1S9KE 4UM8B 1PG5A 1B8UA 1XEWY 1B3BA 2WA1A 2JP3A 1FE8A 2B4YA 2KIQA 1TZ2A 3OZEA 3SEZA 2Q8PA 4P33A 4JC5A 3P9IA 3KEYA 3ZCVA 4E5MA 2FH5B 1NW6A 2G8LA 3DAPA 2DWPA 2M5AB 1BNCA 4R98A 2QGFA 5KB3A 3L6RA 2IOHA 1M67A 4LYYA 1RZRD 3M4ZA 5H0IA 1N3IA 5JHFA 3HBNA 1KVQA 3BXPA 3F6OA 1YXMA 3O8CA 4UFOA 3HOWJ 2XKPA 4PBTA 4BP3A 2K7FA 4NZPA 4Z0HO 1PDNC 1XNQB 1ZHFA 1HH4A 1XCPA 2ONCA 4H6WA 2MFZA 1KDZA 4CTOA 1EH6A 3WRXC 5M5BA 2O8DB 5B4VA 4DF3A 4YAFA 5SYAA 1MJHA 5IVPA 4MJLA 3KEGA 5LNK6 4OQDA 4HFNA 3DTEA 2WU8A 1IUNA 1T9DA 1SZJG 3VYIA 2ODPA 4DMCA 2NU7B 5FTJA 2F5VA 4Q7MB 4DBQA 3QMMA 1X7DA 1D04A 2DWUA 5LWQA 4G2TA 1E2XA 3ANLA 2PHZA 3MIIA 2XODA 3NT4A 1R15A 1AKVA 1ULAA 2IWHA 1T0PA 1JZQA 5CIYA 4NPDA 3RTGA 2V7PA 2QMUA 1DQPA 3D5QA 1J00A 5BNIA 2QD3A 2PZAA 5FOWA 2ZT9B 4WERA 3K4MA 2I6UA 1JY2N 2HDHA 1QPMA 4P4UA 3SQDA 1LNSA 4L2IA 3F73A 2V1DA 2EQRA 2IPLA 2QM8A 1ILWA 1A31A 2KPOA 3J7AY 3RK3C 1RWBA 4BFUA 2LXBA 3FDZB 4ER0A 3DEFA 3WE2A 1XZPA 3ENZA 3RYRA 3F8WA 4K9DA 3ODGA 3R61A 2H43A 5HDNA 3MRSA 1BDDA 1WH5A 2RHGB 2GJ9A 3ECCA 5FKOA 3WAGA 1SVKA 3OQJA 4Z4HA 3UWMA 3JSXA 4UARA 4U6NA 2GPTA 4JP8A 2VUHB 4DLSA 1XL0A 2X8BA 1XF1A 1CF7B 1V35A 5HWSA 1IEWA 5FX2A 1W8IA 3Q3CA 2WB1A 2NP7A 1DEBA 5AESA 3GHHA 3NTOA 3L74G 2OBXA 1UMCA 3GZNB 2DJ5A 2WFLB 1EGHA 4IIJB 3T52A 2PZFA 3NXKA 4G1MB 3ZI4A 4P84A 1Y3CE 1ZIOA 3HUGB 2D2XA 1CJSA 2DG2A 3WTXC 2P2NA 1UZLA 1I7DA 1MENA 4ERNA 3AY0A 2PJRB 1XX6A 2O8EA 2MU1A 5CXQA 3OSFA 4J0IA 1AKMA 2EX0A 2JI6A 1VA5A 5T6MA 1SQVK 2HAEA 4NTZA 4X1YB 4QVGA 2XUDA 3GVPA 2F00A 3PNLA 3OL4A 3GJXC 1VIMA 3AVXA 3ZOBA 1ZHOA 2DFHA 1B14A 1D2RA 5CNMA 1I3NA 1DZ3A 3BC1A 1VCHA 3AIOA 2XBMA 1SCQA 4KBYA 3VTKA 2PT7A 1Z5PA 1UR5A 3SEAA 2YN2A 3AHGA 4LK1F 5KYXA 2KM1A 4BJ6A 3VZRA 1GDDA 1D5YA 2GLUA 3VR2A 5HKAA 3M70A 3Q15C 2UUBB 3PSAA 4AX8A 3KPVA 1CW5A 2UXCB 1C2YA 2ZXFA 3RYIA 1UKBA 1TEXA 4U3FG 2YTZA 1F1BA 4GYYA 2KS1A 4YPOA 4US2R 3SAJA 4CR8A 1XPUA 4BDSA 3I9V2 3TL6A 1SQQG 2PAJA 5E95A 2HLDA 2DUJA 3R5HA 5LQNA 4ZZ2A 2XOEA 4ZT7A 3EFEA 3RYIB 2PJZA 3UFXA 4GIFA 1P4HA 4FUQA 4ZYZA 2FX5A 1NQWA 3SQWA 4N6OA 2IK8A 4MDHA 5CYFA 1GU5A 1RLMA 2PGNA 5EI5A 1K97A 5KHOC 2PFKA 3KJXA 3ZWCA 2ZULA 4IHXA 2J8ZA 4MQFB 2IXAA 2XMZA 2ZXHA 1R23A 2HTJA 3AIKA 4OHOA 4FTHA 4R4MA 1CUAA 3BHJA 5DT9A 3INYA 1BDMA 5F3RA 2W7NA 1LVGA 3BXZA 3LWNA 5DGHA 5J2TF 3UYKA 4Q37A 1MB0A 3VDQA 1B76A 2VP2A 3TW7A 3VYTB 5JV5A 2ZWAA 4ZO7A 1B0AA 2EILH 1A76A 4AY6A 1JVNA 3ZK9A 1N6HA 1VIAA 2HDWA 1POXA 2OCYC 1DRKA 4YT5A 3JYLA 1XRPA 2AQ8A 4WCFA 1V9SA 2O1WA 4JNKA 4AJIA 2PD4A 3WAKA 4KMFA 1KL7A 4AY4A 4BB0A 2NU8A 4WY4B 5IT5A 5GV8A 4BV3A 4IIJA 5ICSA 1S5LC 2C3OA 3A9WA 3LCMA 4R79A 5IAEA 1QH8B 3U7QB 3K2AA 1KC3A 5CX1A 1VCMA 4UAGA 3RW9A 1YMVA 3BTJA 5K01A 3M7GA 2C5FA 1T10A 4AJPA 2JLUA 4N41A 3Q9UA 4FBLA 4ZO6A 3H9BA 1BX3A 3F6EX 2COKA 4AMBA 2AR9A 1WUIS 3L02A 2J0UA 1U57A 4G4SO 1JG6A 1LZLA 2HREA 4DA4A 1RWNA 4TTIA 3KP1A 5L6LB 1G8HA 2MINB 1Y6IA 1E62A 3IT1A 4GI5A 5EZ6B 3WODF 4G37A 4UBLA 1Z0ZA 1BQEA 3IAHA 1E3MA 2IF2A 4AY2A 1E6UA 1FLNA 1JKJA 2J0QA 1C7FA 2IX3A 1MX9A 3FSGA 4QBGB 3WIUA 4ASNA 1ZHHA 4RAZA 2KL4A 4H6VA 3GA0A 1DOHA 1KIFA 1SQPK 1P81A 2HC9A 5HKLA 1B6GA 4E13A 2ANBA 2QT1A 4ARIA 3QOPA 2ZTUA 3AP1A 2JRLA 4KACA 1ZK2A 4KK4A 1QRDA 4PG6A 3U3OA 2C20A 4KLAA 3JQ9C 1MB3A 3W5BA 3WI7A 4FUTA 3PQ5A 1T9CA 3H1HE 3EIOA 3WHPA 3CWBD 1QMGA 1T8SA 1ODCA 3IQHX 1GG8A 1S4QA 3TJRA 2KJBA 3KEFA 3IPXA 3K9HA 3B48A 3HY3A 3MJRA 5I7WA 4ZVTA 5B6PA 3U40A 2B2CA 1NW4A 4GC9A 2X0KA 1J42A 1U0NA 2HL6A 3RUCA 1N5RA 2V1XA 4RTLA 1PP9J 1K6IA 2VJAA 3Q85A 3ABZA 4N0QA 3TINA 5F4BA 4EYEA 4OMYA 1BC7C 1HYQA 1I7QB 3NEPX 3L2VA 5D7BA 3NH9A 4E1VA 1KILC 2E74B 1PZGA 3EH1A 4TKUB 1QGED 4OK3A 4YDRA 2J9ZB 4PZJA 3LXUX 1F6BA 4QTZA 1T2EA 3FZGA 3LT0A 4F9GA 3OAKA 3AQ4A 4LHXA 5JNTA 2WF5A 1DGQA 5FI3A 2PJRA 5FWXA 4RDIA 1TQDA 4JDPA 1NUPA 4RCZA 4EG4A 3T7CA 4I6GA 3QPCA 3PTAA 3U3JA 2XZOA 4X92A 3WLAA 1BZYA 3RYHB 1MUUA 3AEKA 3E27A 2NTVA 1K92A 2DY0A 3T4EA 1KJZA 4K7JA 2WJAA 1SQBJ 2OG2A 1V54H 1KFNA 2HYJA 3H18A 2UZ1A 3E6DA 2XTZA 2ZPUA 1BGVA 3NP7A 4US1R 5JLXA 1RRMA 1IRGA 3IH2A 4K6MA 2H57A 1ZK3A 2I54A 3L92A 4S1OA 1JAHA 3LT2A 1KWGA 1XGKA 3ELBA 4FFBA 2WITA 4ZQEA 1I27A 1YZKA 4BFYA 4LFUA 1UMDB 1KYYA 2LK2A 1DIBA 1GOTA 5JD4A 4FT8A 2FW7A 4I4LA 4OXKA 3LPNA 4N78D 2BKUA 3K8ZA 1SFUA 4PICA 3HXOA 3KVYA 5IT9Z 1QZUA 2ZE8A 4TV9A 4MV9A 1XPJA 2PLWA 1UJCA 2YXLA 1M7GA 1J2JA 2Y27A 1GZDA 2V8OA 2FMIA 4C87A 5C5CA 4MUYA 4TTTS 4YBZA 3ML6A 3E0JB 3GCXA 3QLEA 4P81A 4RD4A 4LGWA 3OYIA 2Y0SA 1XU7A 1BWPA 1FVFA 4OQ4A 4GWKA 3AEAC 3I05A 5TT1A 3AVVA 1IDYA 1RPNA 2EATA 1FIPA 3KPYA 2F3QA 1F4LA 1TWGJ 3Q1KA 3T3MB 3R7WA 4GSKA 3CRQA 5FFNA 2HW8A 4X0EA 5LWHA 1WDWB 1U99A 3LXMA 3ZE1B 4RJJA 1FTNA 4HLXA 4Y7CA 4EMUA 4QQRA 4E7PA 3LMMA 3EMVA 3I1FA 1F3LA 1KFMA 1SU8A 2LE0A 4YIRX 1YJNI 2FZLA 4KN7X 3SR3A 3DBHB 4MQ9F 3OLWA 1GKLA 1TZJA 3U16A 3S15J 4Q4ZF 3WHBA 1OFCX 1FOSF 4YRCA 5CVVA 4TKVA 4YT8A 3CCQP 5IZ4A 2FNPA 4OXQA 4A2WA 2JVHA 3ZEAA 1WBJB 1KQ3A 1E2QA 5DXFA 3OZVA 3CG0A 4GW3A 4OH7A 3Q0TA 1M2GA 5IXYA 2F5DA 3LBHA 2YRWA 3HUUA 2JRTA 1T3LA 2ZCVA 1IG7A 2QN8A 2FTKE 4R69A 1R0XA 3A9TA 4RFLA 2J9XB 3F6VA 1GTG1 2JVGA 2L19A 2C0PA 2JJMA 1XB2A 5LCXA 4WNAB 4IHJA 3DMGA 2YIUB 2AUMA 1RS0A 1B9MA 2UVPA 2BYTA 4TKZA 1P0MA 2Y77A 2EFQA 4MUEA 1GHTA 1XTTA 3UB2A 2HRBA 5JYDA 2I2CA 5BWNA 3W2AA 2K3RA 3ZMVA 2LCFA 1FLDA 3HFSA 2O5EA 3O0DA 4ZVRA 2VOPA 2I4NA 3T9DA 3VOSA 4MS4B 4A5NA 2HSDA 2WHYA 1ISSA 5LDHA 4IIFA 4UVAA 4TGLA 5JNSA 2UZ4A 1DU6A 4Q4LA 1NKTA 4KODA 1XGNA 2VJBA 3PEEA 3QVXA 3GLIE 3TSAA 2EERA 4YRGA 3QP9A 3T3OA 3R75A 1E0JA 3KXPA 2BFBB 4NB5A 2Q7CA 5KYTA 3TAUA 1GO2A 2XTJA 3O9VA 1RXYA 3QK7A 3OWHA 1BH6A 3A14A 2OCGA 4QU8A 4H1UA 2H1KA 4TQGA 3PR1A 1FFWA 3BWDD 4RX1A 2VRNA 1CS0B 4NZOA 2AMJA 2IEKA 3MTBA 1GUZA 5DOZA 4J1NA 5P8WA 3I6ZA 1F36A 1YH3A 3ROFA 1J9ZA 4D98A 2D0IA 2NLOA 5AVXB 4H0CA 5A2GA 1JV2B 4MWTA 3TSZA 1K6MA 3LI2A 4FZVA 5C1IA 1CQZA 1IAVA 4Y9DA 3BJIC 3ISVA 1XDUA 2HU2A 2C2YA 3D4IA 3O03A 5AWFC 2A45I 1P75A 4UE2A 4RPLA 4IUDS 2IE8A 3OH8A 3A1DA 3FMVA 3IUBA 5EINA 3OBIA 4US0R 3T94A 4I2VA 2WICA 1ZI6A 5EGSA 4UD2A 2CQ7A 1QLHA 3L6DA 3RKSA 1Y1RA 1XFDA 4AYTA 5F0FA 2VBYA 2HKXA 1ULYA 3QQAA 4D57A 4XSHA 4O29A 2XYGA 2G06A 3L0YA 5C51B 1Z08A 1U1IA 2B8JA 5KYKA 2O57A 4ZYDA 4JS0A 4UFPA 2P81A 3P0RA 1O6ZA 3I42A 4B17A 3AJDA 4IJAA 4XJXA 2D8MA 3BH6A 1OV6A 4HXGA 2R751 1B72B 1FRVA 4HMOA 1YI2P 2X9GA 2JH9A 4MWGA 3V8KA 4XCQA 1NX9A 2YZNA 3A11A 3EIWA 1I2DA 4ONEA 4AJ9A 3B1JA 2O6GE 4G63A 1BGWA 4G8CA 2AJLI 1KYOD 3EQ9A 1ZELA 2JD2A 1AHHA 1FIAA 2WNIA 2JSCA 4DJTA 3WIOA 1U5TA 4KDCA 5I8ZA 1MO3A 3MZWB 1G6KA 3G6EP 5F04A 4OX9B 1DMSA 2B8NA 5JROA 3FJYA 4XVUA 2OFOA 3TAHA 5D5WB 4WW0A 4L18B 3GLFE 1U3CA 1HJ0A 3TDZC 1EM8A 4PC6A 1FRZA 4UMDA 1CQTA 3ASYA 3LA8A 3HCAA 4QAJA 5K5EA 1YJ5A 4UMVA 5JAQA 3DOIA 5M29A 4E7SA 5JCXA 3HOZJ 1TYEB 4CGYA 1ZKMA 1ZOIA 4IM7A 5C44J 2P6OA 3U6KA 3A6DA 4JBYA 3LDUA 1R66A 4INJA 2V74B 1NXOA 3QLTA 5DMHA 1HX7A 4DZPA 1UK8A 1XR3A 1E7SA 1SQ5A 1TB4A 3WMRA 3O92A 4E4HA 1QRYA 4TKUA 3ME5A 1K5GA 3C7JA 1SCUA 5FL7A 5FTWA 2R7MA 1U7TA 4JL5A 4TUYB 1IRIA 1H6BA 4KFSA 2OPBA 4S24A 1OCEA 1VLVA 2F9MA 3UA3A 2XNDA 4LZNA 5IYCJ 4DCNA 1XNGA 4MW4A 5H3HA 3W5SA 1VM6A 2YWJA 4KV9A 4A8JA 5J9FA 1RBQA 2ZJ8A 1N1MA 3IEIA 5EMKA 3ICVA 1RWWA 1A9QA 3ZLUA 1N0UA 2C7QA 2LKDA 3G8CA 3TCXB 3Q10A 3GMAA 1XEAA 2EGHA 2F8SA 4ZC1A 5LIRA 3TMYA 3RS4A 1FFYA 1UXKA 4EFLA 2OGUA 2ATCA 3EAFA 4WDQA 1BC5A 1JDSA 2QTGA 3HKZA 2Z2JA 4OAPA 1UBGA 2XE6A 1QM5A 4GRAA 2KS1B 4C7BA 3D6UA 3IOBA 2CKMA 2J85A 4IIEA 3AK4A 4E3WA 4GI3A 4UKDA 1NNSA 2BUCA 1URPA 5CJ2A 1SCJA 3KQHA 1L0BA 4UV9A 3CZAA 1LH0A 3UKJA 3CVOA 6ABPA 1B26A 2TRTA 2GBGA 4MIOA 1W94A 2E76C 1SCDA 2VYCA 3TKYA 4EGFA 4B74A 4A8JB 5FOQA 2ZE5A 1RXIA 3PFFA 1FZPB 4JUIA 1SXJA 2R6ZA 3HCBA 1CYEA 4G9EA 3T0YA 3IJEB 1XC5A 2AJDA 2O8BA 2WV9A 2CHUA 4J4TA 1ZSYA 2K2QB 1F4VA 4RAQA 3M07A 4P82A 3ORQA 2F3RA 3JQFA 2H8WA 2ECFA 2ODBA 3MFYA 4H0LB 4DLXA 4UM9B 2B99A 5IJAA 5IHPA 4ZVMA 4MPJA 1D8JA 3CW2A 3WAJA 1TMGE 1L0NK 4Q4AA 3IIIA 1B42A 1VOTA 2X1MA 5JQGA 1QYVA 2VHEA 2V7UA 2DU9A 3W7VA 1FTWA 4BUCA 4LI3X 4NCBA 5EZSA 3QKTA 3UB4A 3QBTA 1EUDA 2ERXA 3L37A 4KE7A 2J5PA 1Q91A 4AN1A 4H2DA 1QP4A 2W6CX 3I55P 3QYPA 1M76A 2ZB4A 1TLHB 1E1QA 1Z62A 1Z18A 2BGUA 2DHQA 3A06A 4NBRA 5ETJA 3LW5J 2PMEA 2RDMA 5JI6A 3H2JA 3K9NA 3UKOA 2K9YA 3R5SA 4D8WA 1A4UA 1PJRA 5TPWB 2PL3A 3DBOB 2EBUA 5B64A 2VNJA 4YRMA 5CVUA 3EVAA 2XDAA 1L2PA 5ARCA 2RNJA 5DUIA 4MRVA 2EAUA 1YONA 2QSYA 2XUHA 3C70A 2TYSB 1RE0A 2PUCA 3ZCPA 3AM1A 3QWOC 3G4SI 5EVCA 2IFTA 3KJNA 5AQ1A 3OYBA 3AF4A 3C24A 3E5MA 1GJRA 4M9CA 1LDGA 1SCNE 3LIPA 1P1KA 2E1CA 2FXMA 2DODA 4ND5A 4ZANA 1IQPA 4X61A 1T15A 1GAEO 2XKMA 4GX2A 4ENVA 1LP1A 3RH0A 3PXXA 1TZLA 3FLBA 2Z83A 2YWEA 2ZM5A 4F6RB 1RWMA 2ID4A 4B6SA 1XYGA 4PSWA 2IHZA 1TYDE 4HWSA 1IFPA 5DBGA 1MOSA 5GONA 1J99A 1L7OA 4CDRA 3AI1A 3H9EO 3A1YA 1FTZA 4FOSA 1L5RA 1VQ9I 3GFSA 3WQSB 4GECA 2C04A 3H1LJ 1DL5A 1IZ9A 4J94A 3RK3B 2EF0A 2OORA 4MRSA 4F6CA 3I6IA 1U6KA 3JRFA 1FMJA 1WXFA 1RYMA 3WLSA 4JI4B 2QMYA 2J3EA 2EEZA 1J59A 4REOA 3RVSA 1M8KA 2YKPA 2IPQX 1P17A 1D4OA 1HDYA 1QFMA 3CBGA 5CM2Z 1L6RA 3C6BA 2P1ZA 5IKPA 4KQ2A 4QJ5A 3Q87B 3PJGA 4IL6X 1ZMOA 3UXHA 3WYBA 2P5YA 4ZVLA 3RHTA 4PLCA 5F23A 5IDWA 3KJEA 3QHAA 4MWCA 3TOBA 1XNHA 1Z2OX 4A27A 4XSVA 3ZS9A 1H94A 2Z3WA 3VPBA 3ABKH 1Q6YA 3C6YA 3MLEA 5J40A 4HG2A 1V3FA 3T97B 4HDRA 2XZDA 2OAP1 3CCJP 4QYSA 5B2ZA 4JC4A 1CF7A 3T3NA 4UDXX 2VQEB 4NRDA 1EZZA 1NOIA 3P32A 5IUNC 5KSPA 3TR6A 1IULA 3KQQA 1HKSA 3EA4A 1I39A 1JIKA 1KKUA 1DWOA 1ZH4A 3PIRA 3ZHCA 3LAPA 1NJ1A 2OTLI 2I4MA 2NT4A 5CX4A 1WY5A 1X22A 4BHPA 3F98A 1YTYA 2NO4A 1V5WA 3PXDA 3H1JE 4HDSA 2Z30A 1RJEA 3CJNA 3MF4A 3ORYA 1XN7A 1AHDP 4EO7A 5BR7A 4FGKA 5LU8A 2WSFJ 5L3EA 4RJLA 1QDUA 5EJ7A 3EJWA 5K3EA 5CYVA 1EDOA 2V45A 3MOIA 4CV0A 3WDSA 4DL9A 1PP7U 3RWMB 2VYVA 2NXJA 4OKIA 2CUNA 3H2IA 3K7AJ 1CQIA 1PJ4A 3A05A 4O3MA 1G8SA 1ZLJA 2CHFA 4ANJA 1XTZA 1E89A 4BMZA 2E7ZA 1TQ8A 1IVYA 4UEQA 4ZDLA 3QQ5A 3DE0X 1VHTA 1COWA 2DT8A 5GTIH 1QK4A 2GKSA 5DHRA 4HNQA 1SXJD 4C4AA 5KYYA 1WVGA 5IBCA 2X0LA 4Y6GB 1NLUA 2J6IA 1TQMA 4XKWA 2QN9A 4TMWA 2BFEB 2WQZA 2RQQA 4D9BA 5K1ZA 4DBVO 2O8FA 2VJKA 1SKUA 2C4MA 4LB6B 1YB1A 1HC8A 1C7EA 2ZS8A 4XB6B 4LOCA 1K4SA 3JC22 1P1IA 1FZEA 1DG3A 3F3YA 1PI3A 2Y48A 1EVIA 1GU7A 4BMYA 3SFTA 4BGEA 5I3ZA 4W5NA 4QM7A 2KMLA 3SK0A 4DBRA 2NU9A 4YRTA 3IQIX 4F85A 4DIQA 3EK2A 4Q34A 3SM3A 3U6BA 3V6MA 3EDPA 4QC2A 3C6XA 3R3XA 5E4FA 1ESMA 1N57A 2EKBA 4GXQA 4HVTA 1GFWA 2VHTA 3BRSA 1RZRA 4CYMA 1JAZA 4CLRA 3FDFA 3R5JA 4TN1A 4WOBA 1ZQ1A 3C1UA 5CB0A 3QOXA 1QB7A 3CTPA 3P9QA 2W6JH 1PO7A 1Z4NA 3A02A 2X15A 1J2JB 4ZO9A 3X43A 1A9XA 1IEVA 2B61A 1SM4A 5G3ZA 4TV9B 4W7HA 4HV4A 3V00A 4LYAA 4A03A 1CY7A 1J8FA 4ASUD 2WUDA 4HNHA 4RADA 3OQ6A 2EFNA 5AJUA 1X15A 3VO2A 1R2QA 4GEKA 9GPBA 1CUHA 1WABA 1U0OC 2CZCA 4GR9A 1U5BB 3DVLA 1DGWY 2VI5A 5F5LA 4DQ0A 5C80A 2H94A 4LXUA 4V2GA 1Y5RA 3R4YA 1YFZA 3KP2A 3PEFA 5DYWA 5ECDA 2VTDA 4MHSA 4UUOA 4PRLA 3VTPC 1IM2A 3IRUA 2G4CA 3F6CA 1B2LA 1ZM4A 2PVSA 3CMAI 4Y2SA 3CLRC 1WXWA 1LBHA 2Y0SN 2QVAA 2AUNA 5H59A 5JOQA 2GZDA 2WPDD 3JZDA 2NU6A 2A9VA 2JFPA 4A23A 1YO6A 1VQ5P 3GLTA 1HZZC 3DQQA 1D1BA 1OFHA 2JAHA 1HDXA 3Q3EA 2EBIA 4BBAA 4EF6A 3TPZA 2NAZA 2ERYA 2FSHA 4L08A 3N6VA 4XJTA 2OTJI 5LUAA 1WHTA 5G0TA 3ZLVA 3C6MA 3KYQA 3ABMH 3WGMA 2VF4X 3OQOA 4BZQA 1M8GA 1JDUA 1Z28A 1U8YA 4MPRA 4J7XA 1NG9A 2X86A 1L0NJ 5CA0F 3WE3A 1CY1A 5EG5A 1S1CA 3AU9A 2CHQA 4S1WA 3LC0A 5JYBA 2B87A 9LDBA 3K5IA 1OZGA 5JQGF 1H8HA 3KFWX 3CSUA 4WASA 4C01A 1NTKD 4HUQA 1SOUA 3ODPA 2BEVA 4U3FD 3ZNQA 3GWZA 4AZ3A 3KP3A 3ZQIA 1I4WA 3OIDA 1LDDA 1OH5A 4ZA2A 3PVZA 4ER7A 4MNTA 3PCRB 4ACBA 1FFXB 2P79A 4UVBA 4RXUA 3N2IA 1TEHA 3MB5A 3R3JA 4Y6QA 3U49A 3W1VA 1Z38A 4XIIA 3EWNA 3LFKA 5ALMA 2B1QA 1XMXA 2N9YB 3PLNA 4Z4QA 4QPJC 4E12A 2OD9A 4ZRDA 3OP4A 2CXOA 3LPMA 4NJMA 1ELOA 2CJJA 2H9AA 4TL9A 1KILD 2WC1A 3DAYA 3EZNA 4Q4HB 5CK4A 5ADVA 3N53A 5BV8A 3CUKA 1U3GA 2FOWA 3ESDA 1O5OA 3JZFA 2PM8A 4IGKA 4B32A 1GFSA 3RNLA 4IUYA 3M3DA 3CMCO 2VOOA 3MVEA 3CCEP 2EW2A 2E42A 3S1NJ 4BQOA 3I71A 1C50A 4QXRA 4FE7A 2RGCA 4IV0A 3TLXA 2I3ZA 3JALA 3UTCA 4X65B 2RONA 4KISA 4MLOA 1C7RA 3Q5EA 5BWCA 1BEZA 2WR8A 4MKIA 5JW6A 3P7KA 3ITDA 2FMUA 4XGQA 2XNXA 5CFZA 1BDHA 2BFWA 1FYXA 3PXAA 4JX6A 1JEQB 2AUTA 2XXBA 3VNAA 1MO6A 4KXYA 4O4HB 5G41A 3VR4D 2Q4DA 3HRIA 2EF1A 3IMCA 1J8MF 4Y30A 4PHCA 4WECA 1S9DA 2KIFA 4Q9DA 5HYVA 4Y1RA 2WU1A 5C3MA 3K0EA 2O7QA 2GR9A 3P4YA 4EG6A 1N0VC 3FNIA 2IOYA 5JBIA 3FZQA 5ICEA 1IOVA 3WTYC 3BRWA 2H8KA 4RUKA 3D6AA 1KRWA 5EC8A 4W82A 2R7SA 2AXPA 3UFBA 3RAEC 3PX7A 2FF7A 1YCGA 1WTAA 4WXYB 2D59A 1U7XA 2PUWA 4BRZA 3LZCA 1DQZA 1TYBE 3EEFA 4PX9A 2JEEA 2RGEA 2VYFA 2QVXX 4CT4B 4CL2A 2NVQJ 1RYYA 4Q6WA 4YA6A 5JH7A 7ABPA 4Q02A 2YY6A 3A0BH 4WXEA 4BZZA 1DAKA 1BSVA 2JEYA 1OWAA 1SFRA 3AZPA 1IO4A 1P7CA 3BMCB 4MEAA 1RHRA 1XA4A 3RJPA 5EJEA 4RGSA 4QO7A 1GNSA 5JZMA 1ULUA 5CT4A 2JPBA 1ODIA 5AKIA 3VZCA 1T4CA 4JKOA 2AWOA 4BQRA 2J31A 3CEPB 4L4SA 3WGZA 2VDKB 4KIWA 3I59B 1N2JA 1XKLA 1L9XA 1VA4A 4G5YA 4NBKA 4LF4B 2PTHA 1FUYB 2FYNB 4RL6A 1A35A 5BV7A 2JLBA 2MSDB 3NVAA 5LLTA 3AR6A 1AB5A 3PL8A 4RWZA 2VHYA 4YP6A 1DQYA 2CNWD 3R0XA 5BMVB 5KYXB 2OV2A 1CQIB 5HRCA 3TRIA 4QKQA 1B6TA 3T5AA 3ZBUA 1YHQP 5JUWA 5ICGA 4R5HA 4OOEA 2WM2A 3CNBA 1IN6A 2I3BA 1T35A 1E7RA 3PEVA 4D02A 3IERA 5FEMA 1YS1X 2AI1A 4N78E 3H8JA 1K9VF 5G1PA 1CUYA 3ADKA 1VBMA 4I3GA 1XMSA 2QGUA 3I9JA 5TQ2B 3BD9A 1IHYA 3I32A 4UHJA 3E9ZA 4QYXA 2V3CC 4H27A 1HDZA 5DBHX 3O1JC 1SBZA 1VTNC 3V1KA 2H16A 1N7LA 1ZXLA 3R8XA 4BU1A 1Q0QA 1V5IA 3D6MA 3LJKA 2UZ1B 2ODTX 3AEEC 2IPNA 4DYHA 1N73B 3RL0D 2AOTA 1ZD4A 4I1IA 2HA7A 5BNTA 2X8JA 4X8OA 5ALIA 3Q5GA 2DWQA 1XRJA 1VF9A 2WT7B 3VP8A 1JIVA 3SJZA 4HVAA 3U3KA 3LF1A 2DLLA 3T7RA 4N5NA 3OHSX 3REQB 2CNKA 3BAZA 4YY3B 4M8KA 5DGCA 4K9MA 1NVOA 4JB2A 5IAJA 1BXGB 4GDMA 4RJTA 2Z57A 2BDUA 5EWLB 1B59A 1QIFA 2OCXA 5I9MA 3RF7A 3O1LA 5LP1A 3RYFB 4ZVNA 2Y0BA 1E2BA 1WQ2A 3GLHB 5COAA 3SLRA 2QJPB 3NTQA 2DPMA 4Y99B 3R7BA 4WZAA 1A9OA 1K0FA 1GM5A 4IH1A 4ZGWA 2P27A 3BERA 1YJQA 4RO0A 2O8VA 5IYDJ 5GGXA 3RRNA 1HGVA 3DW3X 1XP8A 4NCAA 2DFFA 3FPKA 1EX1A 4DMKA 2ILTA 3MWEA 3BICA 4JP2A 3PX3A 2HR3A 4ZEOA 3SJ7A 4F3RA 3TMKA 2KP6A 3DF9A 3QBEA 1H2HA 4MWZA 4M0KA 2NZYA 2RH4A 1XRQA 4Z0PA 5CTJA 4W6QA 2GPNA 3EVNA 1NLFA 1QB8A 1M54A 2XMGA 1T1IA 4MKXA 1FP4A 3N86A 3FW1A 3OZRA 3WTVC 1G8GA 4LYEA 2QRXA 3UWDA 2AZMA 4EEZA 2R47A 3ESRA 5DWDA 4MUGA 5TX7A 3HBMA 5E2IA 3HEAA 3VYVA 5LL6P 3L7WA 3F6BX 4P3KA 1ZJ5A 2QRUA 3CUEF 2YMKA 1CLEA 4LIPD 3OCCA 1MEOA 4JQSA 5E9AA 3ITKA 3FSGD 2GZ3A 2BEUA 3EZGA 2JG3A 1IK4A 3R2JA 2IHJA 2CNWA 5AFSA 1OTXA 4YQYA 3M6VA 3SFIA 3AGPA 2EQAA 2FBKA 5F1YA 2F3UA 4B3BA 4HAOA 3LSKA 1Z0JA 1WEKA 1J90A 2JAPA 2PY6A 2YS7A 2PLFA 5A7GA 3SKYA 1Y5IA 3VNQA 2DI3A 1NNLA 2ZFWA 2I99A 2JS7A 3KCQA 3L73G 1Y7TA 2XXAA 2V96A 4UUQA 1SU6A 3EMBA 2YOFA 3WLIA 1I3KA 5AIQA 3ENNA 1OX6A 3FF1A 4PFPA 421PA 1R0ZA 2I6TA 3E8MA 4B3GA 4RB1A 4BNJA 2PQ0A 2EKQA 1E99A 3KSRA 2N8GA 1VGVA 1MB9A 3WK6A 3IP9A 5K6TA 5B58T 2NSDA 1J0DA 1WSBA 3I76A 3D7RA 3HYTA 4XOPA 3G0DA 2WJHA 1XA0A 3TGLA 3NHMA 3RFCA 3HS3A 3UOGA 5HVQC 5KQGA 1RWVA 3QPVA 3RT1A 3CRZA 4CU2A 3PNTA 1E1LA 4L4YA 2FVXA 4A2QA 2WPNA 1YT5A 3ZZUA 2G1JA 4H0FA 2C5EA 4PZEA 2LV8A 1TUEA 1EDIA 1U5AA 3UBTA 3SXYA 1SUCA 1QFZA 2QJOA 3KQNA 5C1OA 4LJ9A 3K30A 5GQSA 1LU9A 4C7JA 2H4FA 2E5YA 3HD7C 2OCBA 2M3AA 1G4UR 5D5VB 1SQVD 4QXAA 4NNPA 3CUYA 2B83A 5FBQB 3U0VA 2CFIA 2Q2VA 3STTA 3X1DA 3A5TA 1RUOA 5HW0A 2HGZA 3KTAB 3BIOA 4I7EA 3BK2A 4F4FA 4H08A 2BI7A 4A2PA 2GXGA 2VONA 4XYGA 5ALZA 3EQZA 5M7EA 1WD5A 5DM1A 2HK6A 3GFJA 1RQVA 2GD0A 4ZC3A 1LI7A 3R0AA 5IT0A 2XZPA 5EFWB 3QKRB 5KHLB 1HBWA 5IYZB 1SQXE 3FJOA 4DIBA 2K88A 1QVWA 3M5WA 1KI7A 1LT1A 1KYOE 1ETHA 2W9XA 1Y4UA 2V0CA 5C5EA 2N0SA 3CPWO 3OOWA 4F8JA 1R10A 1GKKA 1BD3A 3NBUA 2GCOB 4LOAA 3EPKA 3NFRA 4OBXA 5FLYA 3FPHA 3VVLA 6AT1A 5DW0A 5C5IA 4H16A 4QGAA 3FYTA 4OGGA 2F17A 5J23A 1SU7A 1X9GA 5FJJA 3C3EA 3L4FA 3NWPA 5LD2C 1JSXA 5LMZA 4XKJA 4OQMA 5C8YA 4GOLD 2E19A 1MT0A 3OYFA 5IJZA 3TVDA 4FFDA 2XOXA 3AVOA 3D5EA 4LZJA 3WL5A 1E64A 4RC9A 5A6VA 3C3AA 1BN5A 2Q1XA 3WNBA 3RSNA 2Q7DA 3HGYA 3JSAA 1CZNA 1L4MA 2HX1A 3ONWA 4HX4A 2JUCA 1YASA 2NO1A 1E32A 4XIYA 4RH1A 1NQ5A 4AVPA 5DM70 2M45A 1URQA 2GILA 3KT6A 1MAUA 2ZS9A 5HLGA 5GM1A 3KZIH 5HRAA 3RRZA 3U7FB 3QJGA 4UBKA 1JR6A 1BMQA 4JQ0D 3EBOA 4B43A 2BCCJ 5ESWA 3GFQA 2JA5J 3MFKA 2VDRB 1QOPB 2PG3A 3DMTC 1YR8A 1AU9A 2UVDA 2HLHA 2QLFA 1N2HA 5BW4A 1AMUA 2HF7A 3KTAA 5FORA 3SGLA 5CLHA 4PJJA 2C3YA 5HF8A 4HF2A 3TUIC 5JPCA 5I3CA 4GKJB 4QGFA 5EEGA 1SQQD 4LHWA 5CD1A 3THRA 2FWJA 4JLWA 2QIPA 4D0NA 2VZEA 1K3FA 3R4KA 5DCLA 4DA6A 4IHAA 1SQPG 4I1YA 4Z9YA 1DPRA 1II8A 2G72A 4MHOA 3OCXA 1KA8A 3A2AA 4I2OA 1LS1A 2QJKB 4LVNA 1JFFA 3F72A 1F8YA 2H6CA 4M6WA 4RNCA 3BG7A 3MGKA 3SDSA 4DTCA 3RTEA 1V4RA 5DV5A 3TZLA 3QE9Y 3U1BA 2JFOA 3H6PA 4GVXA 3IP7A 1N8SA 2ZWPA 2V6CA 3IEUA 1WX1A 1P44A 4RJKA 1JQJC 2Q1WA 1U2WA 2XMPA 4J6FA 3E5NA 2OXCA 2ZUSA 4IJQA 2IZ7A 4RKFA 1OYWA 4H9GA 2ZJFA 2L7ZA 4RCYA 5H2FH 1OPRA 3MD9A 1T2UA 5ALUA 1TQHA 4FFPA 2A05A 5ICCA 4UNSA 3X1KA 1LRLA 5IAKA 2QZSA 2P11A 3N0RA 3SDBA 2IXTA 3K9TA 2YN4A 2CBZA 5A05A 5CMLA 2I55A 2PN6A 3ZBPA 2X5NA 3P0IA 3TGUG 3F8TA 1TZBA 4IDDA 4ZAVA 1GKIA 4DYCA 4CPDA 3P26A 1SVWA 4Z4EA 2EBHX 3WP0A 2M34A 2C98A 3BD8A 2KUBA 1VHQA 4TVKA 3ND7A 3FHLA 2HBRA 3RUAA 4FW8A 2W2PA 4BMNA 3KKOA 3MUFA 1ECPA 4K28A 2GBYA 3Q6MA 1YZTA 1EIWA 1L0LG 1GD1O 2E1MB 4BQNA 1R5NA 4MTEA 2ZVQX 3FLAA 4X84A 4YFNF 1JHDA 4O4JB 1SAUA 3IR6A 1IY0A 1MOPA 3QY9A 2KYRA 5FPQA 4XMYA 4YPVA 1ZGGA 4YXFA 3BRQA 3GWGA 1O54A 1MOQA 2HWUA 4IGIA 4HI0E 5JNWA 4Z3OA 2PGXA 4M0DA 1JY2O 1A2QA 4X7RA 2QWWA 1HMYA 5L3SA 3RIGA 2P68A 3JRHA 3G9TA 4IS3A 1O7JA 5AHOA 2P4QA 4L5CA 3FKSA 5L9AA 4MN4C 1B1BA 1L4AC 2IU4A 3AE8C 1NTZK 3FMRA 2GTHA 4F4HA 5I7FA 2BM1A 2J0VA 3DDSA 1VBNA 5I7RA 4DOZA 1IWPB 1LV7A 4OA8A 3E7WA 3LSJA 2QNIA 3WTUC 4ZGGA 3A4IA 1CY8A 3RSQA 1O97D 3T61A 2IBTA 2GM9A 3RLFA 2WFZA 2VXYA 2L9VA 1G21E 2X0RA 1AIPA 2WK1A 3TLBA 2QJWA 4BLUA 1ZRTD 4UVGA 2BVLA 4PAWA 1LB2A 1TVMA 4RLHA 2QN2A 1GGEA 4GOOD 2J5UA 2OSVA 1XTJA 1R0KA 5E1DA 2QG9A 4QDOA 4UPVA 3T3PB 2HXGA 2BFEA 1NNI1 2Q3BA 1C5KA 1Y0UA 5TC4A 1M6NA 2OV6A 5SY6A 5KNCH 5ES3A 4EELA 4M71A 1WJCA 3RK2C 4A26A 3L9FA 4MDEA 1WZUA 2H7YA 5IZCC 3W5VA 1E92A 2C84A 2SKEA 2Q5OA 4WI1A 4BJ6C 4PINA 2NQTA 5IM5A 1AGXA 4HGZA 1YZ3A 3E4DA 2JO1A 5ERXA 2QP3A 4FEYA 3M3YJ 3HYRA 4AMUA 3ZU5A 4GM0A 4R1QA 5K7FA 3HE5A 5ALGA 4MJXA 5LKRA 3B7PA 3H5TA 4LOHA 4YMSA 3WTCA 4JHXA 1LK5A 1Q7CA 2IODA 2FSIA 4CGZA 3I83A 5M34A 1GLGA 2H51A 3SHQA 2P5LC 4DDUA 4JVOA 4PQYA 3QWAA 1EQUA 3B71A 1YB2A 4H77A 4QUKA 3DKWA 5GIOE 5HTOA 3SXUA 1RI1A 3FSRA 3UJDA 2IIBA 4WIAA 4MRMB 2QRHA 4IEJA 1GPH1 5FBVB 4X60A 4V02A 3P19A 1FSHA 4PBRA 4HS4A 3CZCA 2R7VA 5ENZA 1PKEA 5BSHA 2WSSA 5BOSB 4BVJA 2VH2A 3L74E 4RXMA 1FZBA 3TGNA 1U9IC 1JBKA 3NAGA 1WV1A 3BCHA 3I3LA 4L0MA 1L7XA 3NYIA 4DWOA 1A8HA 1NJ5A 2F1IA 2JRMA 2RBEA 5ADHA 5JTTA 4ZDWA 2K7LA 4W8HA 4CFZA 1K6JA 1RZUA 3LQYA 2GPWA 1E2LA 3B70A 3GFGA 2WWXA 3W79A 1YCDA 2QIOA 3SWWA 1C30B 1LTSC 4J01A 1IJFA 4NSNA 1MJGM 4N8SA 2D1YA 1QX4A 1BCRB 4QUGA 5KJ7C 3L00A 1L5LA 3V4PB 4HQMA 4ZV9A 3JRWA 1T34A 5H2FE 2NTEA 1OVVA 2SECE 1HNWB 5I9BA 3DVQX 4HQOA 1L4AD 5EZYF 4BNFA 2IZ0A 3ENVA 2ACWA 3PCTA 1P8AA 1AS3A 4ZDPA 1W0KA 4BJ3A 1EV7A 1FC3A 1UINA 1FOWA 4D6TJ 3RTCA 3HC7A 3D1JA 1D1TA 5JI3E 2P2CA 2K4JA 3DP7A 4AO7A 2B0JA 1QH1A 1US8B 1WEHA 4C0LA 3ENQA 3WFZA 2RN0A 2Z8XA 4WBAA 5IWCA 5C7YA 2E74C 8GPBA 1UL1X 3W4IA 5PNTA 2AE2A 3JXEA 4RD6A 2GZRA 5JASA 2N9UA 3ZD8A 2GM5A 4EJ0A 2OA4A 1HEUA 1NBMD 1V7ZA 3VKFA 4EA9A 1ESEA 1RQRA 1BN7A 3M1CA 2JGDB 1M0SA 1MQ8B 3LCJA 5KREA 3KJHA 3S17J 1Z8DA 1T1SA 4FQ8A 2X19A 1SG9A 1YIJP 5ITZB 4TL8A 4C7MA 1R37A 4OHWA 1RJWA 4M0EA 4ZMSA 2I03A 3GJZA 5AHKA 1E4OA 2FWNA 4FI3F 3BROA 5EMJA 3SZOA 1JEEA 4EA6A 1BVYF 3DCIA 4K86A 4YRRA 2CJPA 3UMSA 3ZDYB 3OZBA 4LWZA 3HKEA 3ZJTA 5AVWB 4IKEA 3MGBA 1B73A 2OM2A 3M5PA 4OIFA 4XGNA 4KCGA 1G18A 3L82B 3G6EI 1Z7BA 4RV9A 3R0QA 1H2RS 2BLNA 4RSMA 4FASD 4LIVA 1PNOA 4RKYA 5CA1B 4MLDA 4DSTA 1YS7A 5BSFA 5HJ7A 3LFTA 1O58A 1AO3A 4TMVA 1NYQA 3DVAA 1ULSA 4XWGA 3PNOA 3LX5A 3IRVA 4ZH4F 1GP2A 5A2QA 1YVDA 5A3VA 2A1TS 1MW8X 1I7LA 2ECKA 1NLZA 3K0HA 1DXYA 3UH1A 2OO3A 3PGLA 3QPSA 1HBJA 2J58A 1UMKA 2ZKZA 2ESNA 1MAAA 1XPRA 3BWYA 4ETNA 2CNLA 3CP2A 1AOYA 4Y9TA 2KNCB 2GK3A 2KW5A 2HR1A 3AETA 2XAQA 1BS1A 2FX2A 3ZQUA 2BMDA 5KI6A 5E1WA 1MTZA 1K89A 4D9KA 4I7ZC 3EJ6A 3QRWA 4IYRA 3GFMA 3K4CA 4CO8A 3AB8A 2ECBA 3PDWA 4XI9A 4HGOA 1CI6B 3VHLB 3PUKA 3FLMA 4GYKA 3D7LA 1NVDA 1GTMA 2FBWC 3PUHA 3M0AA 1WG8A 1T2KA 2HLNA 2OV8A 3UM9A 3IQXA 2RSLA 3LS2A 2HPCA 4QHYA 3L6BA 4BBJA 5AUOB 5LHHA 4TXMA 1D7OA 4CKEA 4NCKA 1J9IA 4QQ8A 1NUQA 1FVHA 1W9MA 1H8HD 4NBNA 1RMTA 2L01A 4HEQA 3W8FA 3L8ZA 4CLDA 1DUXC 4I0BA 2H4HA 3ZKWB 4TWRA 1E5TA 2HCJB 3OPYI 3GLKA 2G80A 2ZYUX 4BP1A 1CR4A 2NUPA 5SZIA 2IKQA 2Y1LA 2B89A 5E8JA 5CW1A 1AHPA 3M1YA 2GPAA 4N3AA 3ONQA 3GRKA 5AXAA 3DSRA 2OZPA 3W4KA 3RREA 4PZDA 2ATEA 4IUBS 1SUPA 1VYVA 1LWOA 2Y69H 4MCHA 3W90A 1G38A 2XOKD 3QQPA 2FEZA 5LQKA 2G1KA 5L95A 5CPBA 2ZVPX 1WT6A 5HNFA 1KHTA 2YWCA 4Y67A 4UM9D 4NNOA 4C9YA 5TE9A 1MEJA 5CXUA 4TQAA 1PS0A 4TKMA 1EPUA 2N46A 1RZ3A 4W1PA 3LRTA 3U9SA 3WU2C 3PENA 2P40A 4QUBA 5CBPA 3N6XA 1Q20A 3M9BA 1B8OA 3EH2A 3HACA 4G3XA 2L2OA 3WA6A 3C3MA 2XVCA 4MVJA 1S3GA 2O3RA 1QKKA 2W6ID 1S2OA 1Z22A 4R0NA 3U59A 4AZ0B 2XASA 2G9ZA 3CLVA 3RK2D 1YE5A 5JXIA 4PHHA 1QO0D 3ZKWA 3EUHA 1RETA 3ORHA 3MGNA 1JILA