2GM4A

An activated, tetrameric gamma-delta resolvase: hin chimaera bound to cleaved dna
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
183
structure length
179
Chain Sequence
MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASDRKGLDLLRMKVKEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDSIDTSSAMGRMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Implications of structures of synaptic tetramers of gamma delta resolvase for the mechanism of recombination.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Recombination, dna
molecule keywords 5'-D(*CP*AP*GP*TP*GP*TP*CP*CP*GP*AP*TP*AP*AP*TP*TP*TP*AP*TP*
total genus 47
structure length 179
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2gm4A03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2gm4A02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gm4A01
5FLVA 2L7ZA 1HLVA 4M3BA 1IG7A 2CJJA 3BQZA 4A3EJ 2DJNA 2YUSA 3K7AJ 2NS7A 3OIOA 5F1JA 3A01B 1ETKA 3HM5A 1ZR4A 2DA2A 4CYCA 2VKVA 1WPKA 4XRSA 2ID6A 1LE8B 1JGGA 1HCRA 2JN6A 1MH4A 2OPTA 1QVTA 3PO3J 1ZTRA 2O7OA 1ZQ3P 2JA6J 3FISA 5IP7J 3BG9A 1LFUP 1BJZA 1MH3A 1Y1VJ 1FIPA 3G1LA 2EZIA 1RESA 3JREA 1ETYA 1IDYA 1PUFA 5BNGA 1JKQC 1P7JA 2O9LA 2VPRA 1PUFB 4EEFG 5IOYA 1RKWA 2O8KA 1WCMJ 4FCYA 4MFDA 3ILXA 3H0GJ 1YRNA 3CCYA 4CYCB 4B4CA 4A93J 1O4XA 5IOZA 1JJ6C 3H3VK 2M8GX 2LLKA 4MIMA 1D5YA 1WH7A 5EDNA 4Y7NJ 1POGA 4NDLA 3HOYJ 3LNQA 4ABZA 1W0TA 2JJ7A 1X58A 3M4OJ 4IHWA 3HOUJ 5FKNA 2EZKA 1OJLA 2NS8A 3GTPJ 2XGCA 2IEKA 5FKOA 2JA8J 2ELKA 3CDLA 4XIDA 4D7MA 1ZGWA 2FX0A 2DA1A 4GFBA 3SJMA 2Y0SN 5EEAA 2LKXA 4RDUA 1NK2P 3VPRA 3GTKJ 4A3FJ 2MW8A 3A03A 1MSEC 1JTXA 1JTYA 3ZQIA 5FKLA 3GTMJ 3IV5A 1NTCA 1QPIA 1Q1VA 3BQYA 1XG1A 2RAEA 2E2IJ 2E19A 5FKMA 3I4MJ 2LR8A 3HGGA 1YRNB 5FKKA 3ZQCA 1TC3C 4BBRJ 2DMTA 3L1PA 1U8BA 4V2FA 3PO2J 3IH2A 4M3EA 4BXXJ 1VI0A 3D1NI 1VNDA 1JUPA 4X6AJ 3I4NJ 1I50J 2Y9YA 3TP3A 3SDGA 2MG4A 4AUXA 3GTGJ 5GP9A 4C2MJ 2CUEA 1FTZA 3BR5A 2HXIA 4BY7J 3BR2A 2NVTJ 1BW5A 4C3IJ 1SFOJ 4W97A 3S16J 4AC0A 2H1KA 3ZQFA 1IGNA 5IYDJ 3JRHA 4DYCA 2JA5J 3FK6A 2L9RA 3JRGA 3CMYA 5F0FA 4IHYA 1T56A 3S15J 2X48A 1AHDP 4B3AA 3TEDA 2I10A 4M3FA 5IPAA 1Z77A 5C3EJ 2IAIA 1ETOA 1ENHA 2JK3A 3B6CA 2EZHA 5M5XJ 5EG0A 4XRMA 3S1QJ 5C4XJ 3JRFA 3RKQA 3UKGA 1P7IA 5J1RA 1FEXA 3ZQLA 3LSPA 1BW6A 3SFIA 4DYQA 4FISA 3GTJJ 4A3LJ 4D5FA 4XRSG 5E3NA 1WGXA 1IRZA 2DA7A 3GTQJ 4G12A 1B8IB 1K83J 1X2MA 5M5YJ 3MKLA 2EH3A 4M3DA 2JA7J 5EF6A 3BTLA 1VFCA 2B63J 2R5YB 1I6HJ 3S1NJ 5E3OA 2EBIA 1WH5A 3A01A 1IV6A 2RSLA 5J1YA 4XICA 1NK3P 1GV5A 1HOMA 1MBGA 2HOAA 5C35A 4B1RA 2K9SA 2DA5A 5C32A 4M6VA 1CQTA 5EGOA 1ITYA 3RQIA 1B72A 4FE7A 1VF9A 1JUMA 2TRTA 1MBFA 1UMQA 1OFCX 2XGEA 1T33A 1IUFA 2MGQA 4V2GA 1X2NA 2GM5A 5DTDA 3LSGA 4D7NA 4BKXA 2R5YA 1HDDC 5EZGA 4S0HB 3W6VA 5JLXA 5M3FJ 2R92J 1ETWA 1TWGJ 1HDPA 2LVSA 3JRDA 2XSDC 4DZJA 5C44J 4X1EA 5F0HA 1K61A 2XB0X 2HOTA 5IP9J 2DMUA 2AHQA 2HDDA 3HOZJ 5E3MA 2FQ4A 1LE8A 2CU7A 2EQRA 3ZQHA 5FLMJ 1XS9A 2AO9A 3RZOJ 5IYBJ 4RBOA 1B72B 3O8HA 2LK2A 4JX5A 1I3QJ 5C31A 3BG3A 2R0QC 2QF7A 1Z0XA 2W48A 2XPWA 5F27A 5K7HA 2NVQJ 1IDZA 2EZLA 4A3GJ 3PM1A 3JRCA 3FK7A 3TW7A 4DW6A 4UUSB 3E7LA 3LHKA 2CRGA 2CQXA 1IJWC 2R5ZB 3LSJA 1AU7A 3M3YJ 2P81A 3QPLA 1F43A 5EYRA 3WHCA 1JKOC 4IHXA 2MHCA 3Q0VA 2PMZN 2ME6A 3HKZN 5E3LA 2GBYA 2WV1A 2VI6A 1JT0A 2XPVA 5F0CA 1GVDA 5GPCA 1JT6A 5J1UA 1JJ8C 2Y31A 1RETA 1RR7A 4QIWN 2GLOA 2LFBA 1IC8A 2FD5A 3HOXJ 1ZKGA 4C3JJ 1GUUA 1JUSA 3C2BA 2R5ZA 2KT0A 2NOGA 4UUTA 2KDZA 1GDTA 3ZQGA 4JX6A 1TWAJ 2WAQN 3F0CA 2R7ZJ 3K2AA 4MO7A 2E1OA 3Q3SA 1G2HA 3CQZJ 3BVPA 3LHFA 1MBKA 3JR9A 2K9QA 3HDDA 3NAUA 2YU9J 4IHVA 3G1OA 4HNVA 4AYBN 1TWFJ 2M34A 4FE4A 2NVXJ 3QQAA 2LP0A 4MLOA 1Y1WJ 1ETQA 1MNMC 3G1MA 2K40A 4BY1J 3BR0A 1OCPA 2ECCA 3OSGA 3GUVA 2YS9A 2DA3A 3IH3A 1DU6A 3FKIJ 2CUFA 1U78A 3BR6A 1JKPC 2XB5A 1H8AC 1B8IA 2DMQA 4UUSA 2E2JJ 2JMWA 3JRIA 1HX7A 1UHSA 2IBDA 2X9DA 2HOSA 2CQQA 2QCOA 1QRYA 2G0EA 1H89C 3FIWA 2L7FP 3BTCA 2E2HJ 2DMNA 2DA4A 1W0UA 1MBJA 4W1UA 5JLWA 2COBA 4J19A 1ORKA 3GTLJ 3A02A 2ME0A 1UG2A 1SANA 3S1RJ 5GPAA 3OSFA 3HEFA 2M9HA 2HQ5A 2HXOA 3PKZA 1ETVA 1A6IA 4JP0A 2XGDA 1AKHA 3IH4A 2XPUA 3HBLA 4C3HJ 4BBSJ 2JWTA 4A3DJ 3BR1A 4D5CA 1MBEA 2Y2ZA 2DTZA 1GV2A 1ETXA 4MFEA 3WHBA 5IP6A 5FJ8J 4BQQA 2L0KA 1DU0A 1MBHA 2R93J 4DYRA 3O8GA 5M3MJ 1TWCJ 3S14J 2FJ1A 4FTHA 4A3BJ 3HOWJ 2ECBA 3UJ3X 4A3IJ 1GT0C 4JX4A 1R9TJ 2LD5A 2MSYA 4L5EA 1U9NA 4A3CJ 1E3OC 2VKEA 4A3KJ 4JYKA 5M5WJ 3B6AA 3OOUA 5EZHA 3BTIA 5C4JJ 1JKRC 1FIAA 3Q0WA 3JRAA 5K7ZA 4A69C 1FTTA 3S2HJ 1F36A 1APLC 2D5VA 3G13A 2Y30A 2OF7A 2ZB9A 3BR3A 3HGYA 1QVUA 3LOCA 2DN0A 5EGOB 3BTJA 1BL0A 4XK4A 5C34B 2HI3A 2NVYJ 3Q0UA 4DZPA 1ZK8A 2L7MP 2H8RA 4Y52J 3HOVJ 1ZR2A 5J3LA 9ANTA 3S1MJ 1GHTA 2DA6A 1U9OA 2N8GA 5F08A 3RZDJ 4QTRA 3QPSA 3BT9A 1XC5A 2M2EA 3TW6A 1LFBA 4I76A 3MN2A 3MVPA 1H88C 1WI3A 2TCTA 1TWHJ 3JRBA 1BA5A 1MSFC 1FJLA 5F04A 4A3JJ 3S2DJ 4I6ZA 5HODA 3GTOJ 1RKTA 3BG5A 3TP0A 1EF4A 3ZOBA 5DS9A 4LOCA 2HYJA 4QSHA 1AKHB 1OCTC 2GM4A 1A5JA 3NARA 2K9NA 3DEWA 4IEJA 3GBGA 1RPWA 2WB1N 1HF0A 5K7FA 3HB9A 2X6OA 2M0CA 2VUMJ 1S7EA 3LSRA 2XRLA 2ID3A 3S17J 2LTPA 2LY9A 5EG0B 3DCFA 4A3MJ 2Y9ZA 2DMPA 4M3GA 5IYCJ
chains in the Genus database with same CATH superfamily
5CFNA 5HXAA 1ZK0A 3L75G 1VKZA 3MQ4A 3L8GA 3C74A 1RZ3A 2HJRA 1OFUA 4WXHA 4X91A 4B6PA 5JOQA 2O06A 3K1YA 2X51A 1UFMA 2V4JC 1KILD 1Z56A 1XZIA 2SHKA 5B58T 4WVLA 4NBTA 3L1UA 3UT5B 1V8FA 3W04A 1CQXA 3U37A 1KIAA 4TTRA 1IG3A 3I5AA 2I66A 1J8FA 4B8XA 4JXXA 1E9AA 1TK2A 3HJRA 2KLHA 1R0CA 2IW3A 1YCGA 1P1BA 5DUIA 3P0HA 4PQFA 3UICA 1X58A 4HF7A 4YT5A 2KHZA 3HWRA 1QWOA 3DBHA 3HUFA 2JF0A 1TLFA 5D8KB 2XE4A 1MJFA 3IUSA 5LSAA 4XA8A 5B3JC 3A03A 4OIQF 4MYTA 3OTWA 4AYXA 3OSZA 3C8DA 3OE7A 1I1QB 2H52A 1MJ5A 2D0OB 1R0LA 2WIJA 1JUPA 2C07A 4LJKA 5DGDA 3QE3A 1TA4A 2W6CX 4YHBA 4D3DA 3QRWA 4HQFA 4CLXA 5EE0A 5FA8A 1ICIA 4GE3A 1QHYA 3OJCA 4OX9Y 4D82A 4RA6B 3M3PA 1UIIA 1C7IA 4M7OA 2V7QJ 2YR2A 4L74A 2GD1O 2XMSA 3IP6A 5D5PA 2AGVA 1KFKB 3UENA 3FBIB 4KDPA 4H6VA 2FU5C 3RL0D 3RTAA 2H4JA 5LDHA 3WGOA 2NG1A 1YDWA 2ANCA 4JT9A 4FS8A 3S44A 1HEUA 1CUSA 3L2OB 3RWBA 2CUNA 2MR5A 5C8YF 3MCVA 4J8PA 4RSRA 4P54A 2IVZA 3CXHE 1FK8A 1P81A 4PNZA 3EVDA 2WIDA 1FZCA 3C7KA 4TT8A 5KLIB 1Y1TA 4D6YA 1V7QA 2ZSUA 1WBJB 1AA9A 1ZS9A 2LVSA 4B48A 2Y67A 4XDGA 4MR9A 1PR6A 4X6LA 3C5CA 3WDLA 3BDVA 3WO1A 2B9SA 4JX5A 3KSAC 2QF7A 1Z0XA 4LGWA 2OQIA 3EFHA 4ER6A 1V7PC 3CEAA 5E38A 3IMKA 4RS4A 1PSZA 1EXVA 3SY8A 4G1EB 1ECGA 3U3XA 2B92A 4E33A 2Z83A 3WYBA 4EOTA 2CXQA 4J4TA 1W49A 2ADUA 5AVKA 5JVTA 2P2NA 3V7NA 3KXLA 2H0AA 3C70A 5GZ1A 3G85A 3WLKX 2OBNA 1VSUA 3KZIE 1HETA 5ALVA 5K51A 4ND5A 3U7EB 4WNIA 4RZHA 1TD9A 2FE3A 1M1UA 2O57A 2H4HA 2WWVD 3TW8B 3AZQA 1QPGA 3Q1MA 1ATIA 3L2VA 4BVBA 3WTVC 1PJLA 3DFGA 1XTJA 3K9GA 2C4VA 4HX4A 5APSA 5KTRA 2ERCA 2P79A 1QH0A 2K4BA 5SYNA 4PLFA 2MSNA 2JI8A 4LDZA 5SZIA 3E03A 4KR2A 3N8NA 1R8QA 1Q86Q 1CZUA 2G7MC 2HWYA 2VL8A 4CM6A 1QL2A 4BVGA 4LXGA 5K03A 4RS8A 5APVA 3H0DA 4BB5A 3UQZA 1SANA 1LTGC 2N1MA 3CKLA 4MDFA 1AA6A 4NPEA 4Y1GA 2QAGC 4FIZA 2B98A 3T5GA 1BRTA 1Z0JA 4OGFA 3PRHA 2P6NA 4NWIA 2I1LA 3C45A 1HRKA 4RC9A 3AHFA 5EXPA 2VB6A 2BIFA 1IN1A 1FX0B 2TECE 4N0PA 4LA4A 4QTYA 2XVYA 2QT9A 2ECFA 4XUEA 4L0ZB 3FXAA 1E6LA 2DFTA 2YWCA 5J9FA 1RP1A 1SXIA 1ZVVA 4YIFA 2HPAA 4GPEA 2NPIA 5AW3A 3RTBA 3W7BA 3N2ZB 2GFIA 4I1PA 2H88C 1WKBA 2I1QA 2VDOB 2Y71A 3T3MB 3GDHA 5LP6F 1YJQA 4AUKA 1OAAA 1SNYA 1WVRA 1URPA 1SB9A 3DPLC 5E3HA 4LJSA 3EISA 1QP0A 2YC2C 2XGMA 4F0JA 3HWX1 4M3GA 4ER7A 3CC2P 5IXJA 4BV8A 1VJTA 5I4KA 1T2KA 1ZVMA 3RHTA 3MBOA 2PT9A 5FTKA 3ZGZA 4X3OA 3KKKA 1BU8A 2NADA 4WKGA 1JLMA 2NU7B 5JAOA 1YOBA 2QPAA 3QUBA 2BW0A 2VJBA 5T6MA 3J80A 1D4ZA 3I73A 1EQUA 4ZU6X 3MHPA 4EKIA 4GBGA 2OG1A 2NXJA 2BF7A 4M1KA 3FJ1A 3AVOA 2A0XA 4TV8A 2OBMA 1LTAC 1CF7A 2IA0A 1YZYA 4LI3X 1C30A 1JT9A 1R8JA 4PC2A 3VPSA 4IHWA 2GBLC 3O2NA 1OT3A 3LF2A 3B38A 1ZISA 1RYFA 3QFRA 5B1IA 1VFPA 3T1VA 5KAFE 2UYQA 5CFPA 1RHUA 3DKIA 5B1SA 2HO4A 4FDTA 3A0BE 2FOXA 4HSGA 2YX4A 3U1VA 4QMAA 5AVUB 4JXKA 5J40A 4Q82A 1FYLA 1VE7A 1P5FA 3IH2A 3JQCA 1AN9A 2XNDH 1MW9X 1OHHA 1I0LA 2Q0HA 2B34A 4EJMA 1ZA2A 3PX7A 2V55B 4KN8A 3LCCA 1LJ8A 1JSXA 2X13A 1LVKA 4JD5A 4ENTA 3GCGA 821PA 4JKIA 5DP1A 3ZWAA 1YF3A 5TISE 2BFNA 5IPAA 1WSDA 2WSMA 3Q0TA 5IBQA 4NMXB 1IAWA 2WUDA 2JJQA 5E1BA 3R7WB 3KZZA 1FZFA 2LXBA 2QTRA 3VHRA 1P7YA 1WZUA 1ZQ9A 4EG6A 3HY3A 5LMZA 5IS2A 3IAS2 1BHJA 1G7SA 1CW2B 4FHEA 4BO7A 2QUFA 4IIDA 4YRKA 2R4GA 1N7HA 3GRPA 3MT0A 4YRFA 2YTZA 1ZC4A 4TV7A 1G41A 1FUIA 2DTDA 5FOXA 1EK1A 1ZUHA 1IEQA 1ZRCA 1O96B 1I6MA 4NENB 2K9SA 3RUFA 3PEWA 4P7GA 1VLMA 2Q9BA 2F55A 2YMLA 1EXNA 4HWKA 4U9IS 1S01A 1OFCX 2IYAA 3F6SA 1Z12A 4ZGBA 4ZJYA 5B1HA 1XLTC 4CM1A 5AOCA 5E4FA 3SXUB 3MQFA 3WYAA 1MEOA 1JEOA 2I1JA 2Y0BA 2JP3A 4RK4A 1L4HA 4YUYA 2JPBA 4DR1B 3O90A 1XS9A 2BFFB 5CBKA 4FOOA 2AQFA 2K1AA 3LCUA 4OQEA 4F91B 3JWGA 2OFWA 1YQTA 5AW7A 3ESQA 4DNPA 1N2IA 4M0DA 4OPMA 1KMHA 3TTSA 2QRVB 2QEQA 5AONA 3QPLA 1FXWA 2O01J 1J2XA 4IHXA 2VHTA 1ZNXA 3FLEA 2F00A 3WLNA 2YCLA 5AVXA 4IZIA 1RXSA 3ZV6A 1B1AA 2R7ZJ 4E1BA 2V7VA 1RU3A 3N2NA 3OA7A 4ZTJA 4BQSA 5JANA 3NAUA 1ZGCA 1D09A 1Y39A 1RABA 5A2GA 5AM4A 3AEKB 2B78A 5CM9C 1SMKA 1LWUB 3KUKA 4QGGA 1SXJC 5EIBD 1BI1A 2PX9A 3OAAD 4N4AA 5JH7F 5CXXA 4LYJA 5HKKD 1R5GA 1GGFA 1YRHA 2ZQ5A 1GSIA 3JWPA 5HIKA 1H94A 2DHCA 1C5KA 3HHPA 3GGOA 4DARA 3CUUA 1RWXA 3OIWA 5JDCA 5HDQA 5HIIA 3GRAA 3JQ8B 3FUWA 1M8GA 3LSHA 1YK0A 1UWLA 1U9NA 1TQDA 1IQ0A 2Z6UA 5B37A 1ZH2A 1YIDA 4HAIA 4LB6B 1J09A 1OWMA 4NE2A 1RM3A 1FSGA 1XHEA 2J0UA 3VPDA 1CNMA 4K5QA 1LNWA 3P8MC 1QKKA 1Y8ZA 4PSVA 4UAVA 3N2GA 3EA0A 3L8FA 1FFEA 1MIHA 3UJCA 1OH8A 3M33A 2QN1A 2R7SA 3CCEP 1H3FA 3VPCA 5D84A 1DXYA 5BSWA 2CW8A 3IEVA 3QKSB 1URQC 1GPH1 1GTJ1 3DBLB 1QLWA 3MRVA 1FNDA 1UP6A 1KY4A 2BI4A 1CY0A 5K0NA 4NNPA 1WUIS 3LKDA 4YXWA 1WXHA 1CI6A 3H1AA 2B83A 1R0SA 3UNGC 4DA9A 1I6KA 1R4NB 3QX7A 1M2JA 2XJ4A 3ZQQA 4X41A 1U3TA 3GFMA 4NJOA 3I5XA 2GEDA 3UJ6A 4ZOLB 5KHAA 1H4VB 5A4MS 4GC5A 4RJJA 4IKPA 3AU9A 3TN7A 4DZTA 3WB2A 3TRDA 5A03A 5K0ZA 5U4XA 2YUTA 5IU6A 2JUGA 1UBNA 4QVGA 2VRCA 2VJYA 2V1XA 4H6XA 1FYKA 1M2FA 1BN7A 1UZLA 4FILA 3VR5H 3MXTA 1NJ2A 5JUWA 1E2GA 4HJRA 4LDQA 5CCDA 1AO0A 3EEOA 2P7VB 2HDHA 1E3MA 2EKDA 7MHTA 1S9KE 2FZEA 2P5KA 1TEZA 2DTEA 4TKVA 3BCRA 2RHBA 4K3VA 2KUBA 6REQB 3IVCA 3MS4A 3OPYI 1KYOE 1QKIA 3CBQA 2IY8A 2WT8A 3FZVA 4NC7A 5SZJA 1Y8QB 1SURA 3BR2A 2IFTA 3W5BA 3C41J 4BKPA 4QUBA 2ZRKA 4KXVA 2BELA 2VLAA 2QRNA 5B2EA 4KMRA 3W5SA 3WSVA 1HLPA 2X4DA 3LX5A 1BD4A 3UMSA 1G6Q1 2QTGA 1NUPA 1YACA 4P5EA 3CUSA 1JHXA 3C3AA 2WABA 3NO4A 1KGDA 5CA1A 5JBIA 4J2HA 1I6XA 2I29A 4YX9A 4YRMA 2XMDA 4MHSA 4EGFA 5K05A 3I09A 3HJFA 2ALJA 1E1DA 4WAUA 3K53A 3ZNOA 1UUFA 4UM9B 1GA1A 4RPHA 4DSOA 3A9CA 3E97A 4UJ5A 3FTEA 4O2AA 4F11A 4LY9A 4FUTA 4QE3A 2W6AA 5L3SA 1ZI9A 3I2GA 1C7ZA 3D6NB 1QIMA 4YY3B 5EIWA 4CHTA 5D3MB 5HE8A 1O7JA 4P9UA 4ZKUA 5BUQA 1HDPA 4F4DA 1QXSA 3L84A 3QMWA 1U0TA 5HCNA 1SXQA 4DLZA 3KWLA 1JDJA 1IJEA 1ZW1A 3EXAA 4CMIA 2GD0A 1S89A 1PPJD 2RDPA 2P6MA 3TNYA 4LXQA 2W82A 1VQ4P 3EBPA 5JC8A 5F3RA 4HGRA 1XRNA 2AVDA 4QSMA 1QMPA 2PH7A 4Q24A 3OYBA 5F9MA 4D46A 3ZGKA 4J3NA 4L15A 2QLLA 3QUQA 3IELA 1YBHA 4R9UC 4G63A 4BU2A 3PQEA 3NETA 5ALFA 5K0TA 3UGTA 1QPBA 5F21A 3R7WA 5EE3A 2HZ7A 4MGZR 2ILVA 8ADHA 3AR4A 4X84A 2ANBA 3AR3A 2YOHA 1XRLA 3U6BA 4DIBA 1Q92A 4WXEA 3PSFA 5AIPA 3MQ0A 4U7FA 2NACA 3OJXA 3JRIA 3N0WA 4OP3A 5GAHJ 1YQQA 1S3GA 2DY0A 2OWEA 4MYHA 1T2CA 4MQFA 3VX3A 2ZWOA 5BVHA 1UT8A 2C78A 3FNHA 3WLEA 3T1QA 2A57A 3Q72A 1WU8A 2PMCA 3OSFA 5DRTA 4XIGS 1P0QA 2Z16A 4JMLA 2YRFA 1NF9A 1E6CA 3BR1A 2CNWD 4JJ4A 4D6PA 1CZLA 1A9XA 2JJMA 2QZSA 4A3IJ 3JW8A 2C7OA 3RSCA 1V6SA 2R00A 2C20A 1HLFA 1APLC 3WE3A 1ONOA 4Z9XA 4IRHA 4IFDK 5JAQA 2CHEA 4JBYA 2IX3A 1JUDA 1T0BA 1Y1PA 3O92A 3DTVD 4BE7B 2XOKD 2Q2VA 4Q1CA 3LT2A 2W2VA 3TEJA 2YIUC 3OCYA 1T0HB 4LK1F 5KQGA 1XD9A 1NYLA 4QSHA 5ESDA 4UBLA 4YMVA 4PCLA 5KX5F 1Z83A 4QJBA 1B74A 1L7VC 3WLJA 2DEUA 1HXDA 1ENOA 2Q6TA 4JP8A 4YBZA 3VNBA 2KW5A 3KELA 3JRWA 3BZUA 2AFIB 2ZQZA 4YMTA 4LJ7A 1ST2A 2QDKA 3D6ZA 3RKYA 1M5UA 3Q41A 1SC7A 3V9AA 1PFUA 1OXVA 2GETA 3I9NA 2RK3A 3RBZA 1BR4A 2EZIA 4RQBA 2NVOA 2RGVA 3RHSA 1JILA 2WAFA 3I8SA 5K6AA 2YY7A 1BMTA 1NVBA 5D85A 3U3OA 3SQOA 2D5LA 4JQZA 2CLFB 2JCSA 1HT1E 2Q2EB 4D9JA 1UKEA 3AY3A 4Z7OB 1P0FA 3L8ZA 5LLSA 4DLPA 4GRDA 4U7PB 4R9VA 2WHEA 1Z29A 2PVSA 3OPNA 4NYIR 3ND8A 3TPZA 4XWAA 4L8GA 2R6ZA 4ZCLA 4MUKA 2WWRA 1ODLA 2ZRFA 1NY6A 4L8YA 5SYAA 2IHJA 3LSKA 4P84A 4PNPA 5IFLA 3EF3A 1YHZA 2QT1A 5AM5A 5JS2A 2GEBA 2GXSA 3DSRA 4BHCA 1SUSA 2RDMA 3C1DA 2WICA 5A6SA 3UMBA 5LIPA 5H3LA 3P4XA 3HUEA 4ND6A 4U5XA 4R9NA 3ZHYA 3HA3A 4YRPA 3OZ7A 1SFOJ 4Q4JA 1N0WA 4ZT4A 2OP1A 5BSFA 3JQPA 3T5MA 1KO5A 2Q2NA 1I2ZA 1S7CA 1P0CA 621PA 5I3CA 1CD5A 1Y4AE 5A2QA 2H07A 1V8ZA 3HABA 4BTEA 2DHQA 4Q4CA 1TM1E 5CK5A 2QROA 4HGOA 3CMEI 3EEQA 3HKCA 1PKXA 4OFZA 3IRRA 1EXMA 5ARBA 3K71B 4FMCF 3CCFA 1VF5B 5BQ3A 1EKEA 3NHJA 4QXOA 3BXXA 4HXFB 4CV0A 5C32A 2K6GA 4P38A 1KU7A 1IWBB 2EZTA 5DCLA 1W88A 2WMOB 1QB8A 5T64A 1EH5A 7REQB 1Z3YA 1G5TA 2C7GA 2DECA 1VIVA 1WRJA 1YONA 2RI0A 3OAAA 3KPEA 1SUCA 1SC4A 4EVSA 2KP6A 1Z37A 1R5ID 1T25A 6AT1A 4KGVA 3QW2A 1RZUA 2I87A 3A0RB 4M9CA 4L02A 2VXBA 3BTVA 3BL5A 3GY0A 4NH4A 1DC7A 3F5MA 4M22A 1BOAA 4E07A 2P81A 5LLQA 3QPBA 4F2WA 2RC6A 2HXSA 1NQXA 5EOVA 5DYMA 4WK4B 1QJCA 5APQA 1D6SA 1M5RA 4ESHA 3HP7A 3KYLA 1FB5A 4LMPA 1XVTA 3OEYA 4XQ0A 3FHCB 2VH1A 4RTPA 1BCCG 2F43A 3AF1A 2DFVA 4AYBN 4LGYA 1TWFJ 4CW7A 4P32A 3CWBD 3CPJB 2A9KA 4AYWA 4OAYA 2IYYA 4NCHA 2QSJA 4Y6SA 3QUAA 5E0KB 4KMOA 2WBMA 3H1KD 1GZSA 3KV3O 4ZVVA 1UH5A 1WO8A 3OI7A 3Q2KA 2O19A 1EJ0A 2KQRA 1PS9A 4V39A 3B53X 4FLFA 2WJVA 4MCHA 1N7GA 4ER5A 3D4IA 2CY0A 5L3ZA 1K97A 3FFXA 5KVVA 5BOXA 5EZYA 4AO8A 3M81A 4XJXA 1W6UA 3LT4A 4ZYTA 4FNOA 1J8VA 1QWSA 3BERA 3JZAA 5CLIA 1TECE 3L8EA 1NYRA 1KYIA 2EFPA 3PYXA 2JI9A 2M2EA 3AG2H 2OILA 1K8AQ 2H2DA 2ZDHA 1GKYA 2B69A 5F04A 2FPPA 1AC5A 5AJUA 4PYQA 4UNRA 4BMYA 1KEEA 2EWNA 3NR2A 2RB5A 1U0OC 3OMLA 3T7RA 1M6YA 3P4YA 5JADA 2ZXEA 2E42A 2PGOA 1SOMA 4DV6B 5HX7A 4WV3A 3WGVA 1L8QA 2CJJA 1MMDA 2I2AA 3GRFA 4KFUA 1RJ9A 2IU0A 5LXTF 4EHIA 2HWUA 1M83A 4GOOD 1WM1A 3ZDQA 1D8JA 4QBKA 2PZKA 2HKOA 2XZRA 1NBAA 2I6QA 3W1WA 1JY2N 5K6AC 5GGYA 4EK9A 4B87A 2XIGA 5GM1A 1JKJB 1W4AA 1Q20A 2YXBA 2J3QA 2CB9A 1IRXA 3K8ZA 2QR2A 2LF8A 1JJ6C 1Q22A 2FCRA 2J59M 4ZAWA 2F9MA 3LOPA 3J7AO 5J8CA 2V5VA 5E79E 1RZRD 1R50A 1IWOA 4BAGA 3GLTA 2YXPX 3EUHC 1M90Q 1H05A 3NHAA 3QTLA 1ZVQA 4PAGA 2PAJA 3OX1A 1ZL2A 2G07A 4M6XA 2MOKA 4RK6A 2CXHA 4A8PA 2BZTA 3NOXA 1NQ5A 2XASA 1CLUA 3CYFA 4B5LA 2N9UA 3FROA 4W63A 3OR1C 3OYIA 2SKEA 3G9QA 3TP3A 4AZ0A 2WU3A 1ESNA 4F4HA 2HF9A 2AXLA 1HJ0A 3EWSA 5CKTA 4Y3OA 3UZUA 3CJRA 2ZCWA 1TU3A 2VN8A 1X74A 1NLYA 5T8KA 2IA1A 3KKLA 4CYMA 2O1WA 3LBIA 4C4XA 4L9JA 2LY1A 4CCAA 3N8HA 5DBHX 4MHGA 2YR0A 3M8KA 2W6MA 5DGHA 2BMVA 3VFDA 3WIBA 3N75A 3RIHA 1QANA 3TOZA 2F4MB 2GQQA 3BUSA 5JD6A 4HH4A 4HDUA 1SUDA 2E82A 5KAIC 1C2YA 5DM70 4AMYA 4ZAXA 3SKYA 4DA8A 4ZCQA 2XAUA 1T8IA 5B57C 5KS2A 2V6JA 4LXHA 1BHSA 1OW3B 2OKGA 2AI1A 4TMKA 3RQIA 4IS3A 1VGVA 4ARBA 3MT7A 4GBJA 5L3VA 1V1MA 4TRNA 1LPAB 2G9UA 4CMIB 3W5VA 3T8RA 3EPRA 4L73A 2NNYA 5CLFA 3EULA 2XVXA 5DCYA 4AJEA 4X1EA 2H1FA 3AC0A 3EYAA 3HKEA 2D2IA 3FX0A 3KJGA 1XZFA 1YS7A 5JI6A 3SHTA 2W48A 3L8HA 4JKOA 1FLDA 4WASA 4CFZA 3KP7A 3R9IA 3JQ9A 1NVEA 3OQVA 4UARA 3WQBA 3H13A 1FT9A 3WTUC 1T8PA 3P5JA 1XTQA 4QKQA 2HGSA 3BXGA 3TZCA 1VJ0A 2QG9A 1TT0A 4EUKA 2EV5A 3LBNA 1ZNQO 1X3SA 2XUJA 1SC6A 3L5OA 3PEFA 1UHMA 2CFRA 1MOZA 4HDMB 2FFBA 1LU9A 2NOGA 3Q7PA 1XSXA 2I4TA 2LSOA 5A62A 1X7WA 4EEKA 3EFBA 1SZPA 2DQYA 4B4KA 4BP9A 4YPCA 2B21A 3TAXA 2IRWA 2Q1SA 2VKTA 4OVNF 2HGZA 2NPFA 3WTTC 4GX5A 5FUWA 1FFSA 2HHCA 4DJTA 3ROTA 1YZKA 2VFAA 2MSDB 2PT6A 5CP8A 4NFYA 1LW7A 3P2KA 2OC6A 5J1TB 2GA9A 3I6ZA 4H7IA 3WLFA 3SIWA 5LPNA 1Z4JA 2DFEA 5E1ZB 2Q6OA 1VJGA 3S5UA 1Y6IA 1RTKA 4F6CA 3RKSA 5CVCA 1IZ7A 1E9SA 3WLIA 5KHOC 1FU8A 2PGJA 3E53A 4R69A 2BVLA 2COMA 4FW8A 4CODB 3L6OO 5C5IA 4EY7A 4UHJA 2FXMA 4MKIA 3IPAA 4FE3A 3BA6A 3QWFA 2C0XA 3Q2IA 3PXGA 2DPMA 3A32A 5FROA 1KDZA 3R7SA 3NWOA 2L4AA 4KI7A 4C7KA 1V2GA 5H82A 4DRXB 1D4AA 1OFGA 1EF4A 3I12A 1NXTA 3TVYA 1V48A 4YCJA 1O1YA 5DASA 3ONEA 3AI7A 1M1NA 2QSFX 4G9YA 1CE8B 1HZJA 1ZIXA 1SQPG 1B6GA 1L7XA 3IUQA 3JR3A 5AKLA 3OIGA 5K6TA 3OE7D 1ADYA 2YNYA 3EDCA 3HL0A 4MR8A 1UCFA 3INRA 1QMGA 4J00A 1CIVA 2UU9B 3PNBA 3AFHA 3B5NB 5ERIA 4RV4A 4XLNF 4FETA 4ZO6A 3JSOA 1ZD4A 2IA2A 5DM6F 3TJZA 3G3EA 2CV1A 4YB8A 4UDNA 4UQPA 3ZK7A 1JKQC 5AVJA 4DGQA 2V8BA 2QWWA 1BHO1 4GYJA 4RPCA 4EZEA 2FLWA 4RJTA 5J63A 3AHCA 1EFLA 5EXDA 4BRYA 1NI4A 5J4LA 3R9XA 4BNHA 1AIPA 4Q9IA 1V9SA 2NO7A 4OP2A 4KXQA 2EV9A 4L5YA 3O3KA 3BB3A 4K6GA 4KVAA 4E13A 2OAQ1 3J7YJ 3DV9A 3HCRA 2Q2WA 1LSUA 3QKRB 2V1UA 3UC5A 4PSXA 4U2CA 4G9BA 5DBEX 4CKWA 1U2WA 1ZH5A 4DCVA 3DXJF 4B75A 5ULLA 4RV9A 3UXEA 1XDGA 3A9VA 1E2IA 5J2TB 4QRIA 1AQUA 2WUFA 2FWPA 1FP2A 3GLQA 2V4MA 1V3TA 2HXIA 5B3JA 4LVNA 4I2VA 1MU0A 3TE6A 4NAVA 2H5IA 3CN9A 3ASUA 3BASA 4A73A 1ZCBA 3VZPA 3VMXA 2AR0A 2ESHA 1EBBA 1V7ZA 4FKBA 4FX2A 1PJ8A 1OFVA 2WG0A 1A7AA 1TFRA 1TUBA 3NIBA 3EAGA 1Q0ZA 4OHRA 2J5XA 2HSGA 4WOBA 4B6JA 3R5XA 3AKZA 4LTMA 1Z0ZA 1WGXA 2JGIA 5HLTA 2C7RA 3GB9A 4IUCS 2J30A 3NJ8A 4II7A 3L72J 3KLPX 2CNKA 3IXQA 4XSGA 1XQ6A 3VV2A 2P6SA 1FP1D 4D1YA 5JWOA 3MS7A 2PZAA 2P10A 5DP2A 4ZV9A 4AI6A 3AGQA 3P1JA 2HWWA 1BHQ1 1YFZA 5JZBA 2ROQA 2Q1YA 4IHQA 5EXTA 4YLYA 3BMOB 2ZIVB 2H4FA 2ZS9A 2QRZA 3LSGA 3I5MA 2R5YA 5LXTA 4L95C 3FDYA 1HW2A 3KYCB 5M3FJ 4HNTA 3ZY6A 2ZR0A 2PP6A 3AKDA 2XB0X 5A2QK 4ER0A 1SCQA 1XN7A 1M2OA 3RZOJ 1O57A 1KETA 1AF4A 2I55A 4U3FD 4G5RA 2RH9B 4N01A 4RHXA 2XPWA 1P4XA 1G98A 4RTSA 1CVLA 1THGA 2UZKA 5JPCA 1CJTC 2B4RO 3OL4A 3RAJA 3K70B 4RAFA 3OEHA 1X6VA 4GOLD 2WW8A 2V6CA 2LDXA 5BUCA 2VI6A 3QBVA 3NT4A 1JAYA 5LBTA 3R41A 4DVGA 3SPXA 1D6JA 4C3JJ 1U2RA 3CI9A 3FF1A 3S2GA 1I10A 3L70E 2BOLA 4Q34A 4MO7A 1NOKA 2M98A 3LRXA 2GNOA 4MTEA 3L1HA 2JJYA 3KOMA 2FXAA 4QODA 4LFUA 5D5VB 3MSCA 4I4CA 3TRJA 3OFNA 4ND7A 2ECCA 1D04A 3L06A 3VGPA 3PJSK 3CINA 3I83A 3U44B 1B8IA 2XC7A 3LGAA 4Z6YA 2JGAA 1P7PA 2ZI5A 4ITRC 2QQ8A 2V58A 4N65A 1AQ5A 4V0LA 4EATA 5IVDA 2P1DA 2JIPA 2Z57A 4AF8A 4A1FA 3OTIA 3CG0A 1KZ6A 3HEFA 2WKQA 3K1NA 3C3YA 1RWNA 3RSOA 3ZXSA 5TPWB 4DWWA 1QVAA 3K5HA 1ZGBA 2R7DA 1SKUA 5KX5B 5JPIA 3OKAA 4AJIA 1XMQB 1RJGA 1D0IA 1M34A 2Q3EA 2AFHA 3B2NA 2IHZA 3QH4A 1DOAA 1AGNA 3G13A 2ZRLA 3MD9A 3ORYA 3G1TA 4GPTA 3LOCA 3BTJA 3FPSA 4BMOB 3V2IA 5ADUS 4GM1A 4UMFA 4UVGA 2EOAA 1W8DA 1SQBE 4D0LB 2QQEA 4RMIA 2PJRB 4XA4A 4NQRA 1IB0A 4TKUA 4E7LA 5HJEA 5K9ZA 4CLRB 3L2WA 5LNK1 3VZDA 2XDWA 3NM6B 2WYWA 1QLED 3GGJA 3RVKA 2VA9A 3GTOJ 3F6RA 4OL9A 1C9KA 2VK4A 5B7NA 3GDFA 1K4TA 3CLKA 3K2QA 4GDFA 3CR7A 3GA0A 1RPNA 1WJGA 1Z45A 2GERA 2O9JA 1ZLYA 2IGNA 1N6PA 3FWPA 1YI8A 3MAGA 4OM8A 4GECA 2VDVE 2OG2A 2QMOA 4ONEA 2Y1LA 1V1RB 1A77A 4E31A 5IDQA 2ZVQX 3ZZ1A 3H2SA 4WHMA 5AJXA 2R7FA 3RF6A 3RFCA 4POAA 1Z0UA 4YK7A 1H66A 1T4BA 3ED1A 2Y48A 2CK3D 5E95A 4DWVA 1CI6B 3A25A 4BFLA 3D59A 3RCBA 5CYFA 4KIUA 5DT9A 4R7GA 3B6IA 4AIRA 1WR8A 3GMTA 4AS2A 1XRSB 5AW9B 1NASA 3H3VK 5TGTA 1BX3A 5DWQA 2YV3A 3ZPXA 1P84D 3ROQA 4GSKA 4KOAA 2E21A 3CCQP 2WMDA 2EATA 2VZEA 1J2EA 1NQAO 4ZRMA 3TKLA 1CR6A 4YJDA 4YFVA 3ZWMA 3C1TA 3PDCA 4D8VA 3KXPA 3R4VA 4UEWA 3DOIA 5KEIA 4HS4A 1OX5A 2O2JA 1Z4MA 3ZQIA 4HF1A 1SUBA 2WTBA 1SQXJ 2DQLA 3PQ6A 4OQXA 5JNRA 4DNFA 3WK8A 3ZQCA 3E9RA 3NDIA 3IURA 3C6QA 4X6AJ 4U3FG 4G5HA 2GCEA 3C3WA 2MG4A 3AEFC 5CNJA 5GP9A 5H3HA 2XBMA 3JQFC 2ON6A 1O5IA 3O3CA 4BY7J 2MLKA 1T5DX 4UPDA 2EFQA 3X1KA 4W97A 1ZRFA 2Q99A 1RI3A 3AO0B 3BRTB 2N1TB 1IFDA 3UAXA 3CO6C 4ZIRB 4LVOA 3UVEA 3CKMA 3H1JD 1T6NA 1MAUA 5HZGA 4X5OA 2F8TA 5LCXA 4IUBS 3GO5A 1JHVA 2AOWA 1J70A 3TYXA 3NUQA 4JBXA 3KP2A 4ZC8A 4Q3KA 3EBLA 5CFRA 1UBCA 2BF4A 1U99A 3CMMA 3IKVA 1K9MQ 1R5BA 1FW6A 1WXDA 4WA8A 1MF7A 3HP1A 2G1UA 3AF6A 4KUHA 1MJGM 2KLUA 5KOHA 2R7MA 4MR9B 1G5FA 4TV9A 3KDPB 4XD7A 1NTZJ 5FUVA 1S4MA 2B9EA 1FOWA 1RC9A 1JGTA 1ZMOA 2OPBA 5DTDA 4HV4A 1JS1X 2JEYA 1BGYD 2H2FA 1R6TA 5D6NA 2ZVPX 2C5FA 1JKMA 3ABLH 4GOXA 3VYWA 1G8FA 1XTRA 4CG0A 4RBOA 1V9LA 4IG4A 2IU3A 3SJBA 5KX5A 2N75A 5B1EA 3MWEB 3CX5E 2BGLA 3JAMA 3FB4A 4MUNA 1MDBA 2YWGA 2I4MA 3F96A 3IDSA 5IF9A 4E5NA 5FWXB 2PH3A 4DTCA 2X0JA 5M34A 4OXKA 5D2CA 2A94A 5FBVB 2KM1A 3HKZN 4N7MA 3LUJA 3LAPA 1NXOA 8ATCA 3F8WA 4CHGA 5IDWA 3HV0A 2JSPA 2O1EA 1JUSA 1YIOA 3USCS 4X54A 1EWRA 4OIOF 1K5PA 2GF2A 1GFIA 1W5FA 1PZXA 1ZVJA 2DHDA 2F9LA 1TVMA 3H1ID 4Z51A 2BR5A 4YJ3A 2IBDA 1GT91 3KG2A 2DAPA 1K7XB 4CEJB 3V4ZA 3B6KA 4C3VA 2CFOA 5A9TA 4P7JA 1U2DA 2OESA 3RPUD 4TS1A 5TPZA 2VQSA 1T26A 1Q0TA 1NOIA 1WY5A 4FOPA 3VDQA 3VRHA 2ZXUA 2WJGA 2G71A 1KWGA 2C9NY 4Q15A 4CV1A 1O6FA 2XVZA 5IK2D 1L3IA 4JQSA 2KMUA 3CJQA 4XGNA 1CVRA 3N8KA 3VR3D 1EFKA 5KCMA 1FIAA 1WMAA 3S2HJ 3M6UA 3UJ7A 2PWZA 2ESNA 2Q6KA 3SX2A 1C7QA 1IPHA 1IO4A 3Q3DA 3ABUA 1DC8A 1T38A 1FSFA 4MV6A 3I30X 1N5RA 2QZ4A 4FQGA 3EDQA 4PAMA 3VR2D 4MVJG 4RU1A 4WLOA 3T06B 3ZR4B 4LLLA 1B3RA 2OO3A 5DF1A 5F1OA 4PHGA 2YJGA 2OXEA 1CX9B 3Q6MA 4BQFA 4TMFA 1J2YA 1DC4A 3MMYB 5E6UB 3BXFA 5JQGA 2P0WA 2QAJA 3U1CA 2IUEA 4K2HA 3GRUA 4IXTA 4CCSA 4HLXA 4RGSA 1TIBA 2PA0A 1CDZA 4ZVUA 1XHLA 4CM7A 5DOVA 2YYYA 1M1JC 4JQCA 3LW7A 1BVUA 4F55A 2O07A 1CHNA 5EG0B 2HVRA 3IPXA 4PLPA 5JBQA 4YAOA 3NTRA 4ZYZA 2WPNA 3RR2A 2XI4A 4XZ3A 5B3AA 3KHKA 3W3AD 2QEXP 2AUTA 3KB6A 3EWAA 1T5HX 2JTVA 4WBNF 1MH3A 1UMDA 2ZJ1A 1RESA 2JEZA 4ZVPA 3EVCA 4EEFG 4B09A 1GUDA 3U3ZA 5K01A 4ZQFA 3M4JA 5EJFA 4IDDA 4NI5A 1S1CA 2ONCA 1JEYB 1A9RA 2BKEA 4I7ZC 3GN1A 1KB9E 1YL6A 3MUOA 5EZYB 3GRZA 2HFED 2A84A 4NKRA 4YCAA 2KK7A 2I7VA 4DJAA 3HDVA 4ZZ2A 1I2BA 1T2EA 4NMHA 3LG2A 1GL2A 2E1NA 5IVHA 4P34A 1EFPB 3F0TA 3A31A 3P9QA 4GSLA 1CNEA 4CKCA 1VLVA 1K06A 1YE8A 4MRSA 4Q4LA 4OIRF 1MO4A 2QZ8A 2NLOA 4YP0A 2IOYA 3V33A 1MHTA 5FI0B 4D9HA 4O2RA 2Q27A 2CVQA 2J3LA 3B1XA 1P4HA 3A1SA 1ORVA 3P97A 3B6EA 3D6TB 5KWSA 5ESRA 4MEYF 5FBKA 3ICQB 1L7BA 3ONDA 3HRNA 3JCZA 3RM3A 4WK8F 3F3KA 3ABZA 2NWQA 2I10A 1GZUA 4R1TA 1ZUNA 1XJCA 1XTPA 1GILA 2LDBA 5AIAA 1IJFA 1BA3A 5KTPA 4XB1A 2RHTA 5AW2A 4LE0A 1NAHA 1XMOB 1NBMD 4JSYA 3TRFA 2O7SA 2YL2A 3UF0A 5H83A 2FPKA 3R6DA 2VYFA 3O8LA 4WJKB 3OPVA 5I7UA 4PYKA 2A9PA 1OBHA 4AF7A 2HRZA 4J0DA 3R0XA 2CEKA 3F5QA 1E5WA 4M53A 2HBZA 4ZEXA 3V4VB 3W2HA 3SF0A 1JR3D 5L3FA 2AZTA 5KJ6A 1Y9ZA 4F3NA 5AW3B 3K4HA 4A0XA 3H2YA 2FP3A 3M9LA 4C43A 1TK9A 1LEAA 2M0MA 2F3RA 1TZKA 1M2EA 5HDGA 3R0QA 4JKYA 3P7NA 1WEKA 3V42A 3FBGA 4JEUA 3I55P 5F2NA 5F7XA 2D2WA 1YBAA 5CHEA 5E18F 2PKXA 1AJYA 3TCXB 3CT4A 3INGA 1E6MA 1HG0A 3IAM1 2J08A 3WKEA 4CCNA 2E7ZA 1BCCE 4D0SA 4G0OA 5CJ9A 4DW6A 2ZSHB 1XMAA 4DSNA 1NATA 2FFQA 2X41A 4JI5B 1J0EA 5HG0A 2BBWA 2P9QA 4YJGA 5K1YA 1W34A 4UHEA 4EW3A 3U44A 4KPUB 3FNEA 2DJIA 2X86A 3PDJA 3UJ9A 5FTMA 1UC5B 2OYCA 3MGNA 4P3KA 3G0OA 1CQJB 2N3ZA 3SC4A 3DAFA 1XQXA 4PXYA 5DNEA 5ESWA 3JZDA 4FZJA 2RCNA 1OLXA 4AWBA 2OV4A 5FOTA 2Z8XA 1ZXLA 1D1SA 3H1LJ 4ZYUA 2NTEA 2AMVA 4WZ6A 1PT7A 3LSIA 1KQPA 3AG6A 2V7QD 2CUFA 521PA 2XB5A 1H8AC 2G28A 4M4SA 1OWPA 5BSVA 1HSTA 1KE1A 4WY4D 3Q3JB 4OAOA 2EJCA 1YOVB 2UUPA 4B32A 3FKJA 2Z33A 1Y8CA 1QIJA 4A82A 1RYEA 3ORSA 1W59A 4I1RA 2Y3IA 4RJIA 3HLKA 2W71A 1S72P 4MI1A 4UHCA 4NAUA 1JPUA 3ILVA 4TLDA 4UZFA 4ICIA 5G0TA 1FP7A 2P2YA 3KEFA 1WQ4A 4N9QA 4B34A 4XWYA 4DGWB 2IBSA 5DTEA 2UYOA 2ELHA 3FHJA 3CNLA 4D4MA 5H8WA 4ID9A 2HRCA 4RL4A 1NV8A 3OE4A 3LU1A 1XMXA 1SXJA 1BEZA 3BH7A 4EMSA 4XRFA 3VYSB 1COWA 4QU9A 4US1R 1LBIA 2QRGA 3RVOA 2AHRA 5ICFA 3T7JA 1GL6A 2DA6A 1X1PA 4MQLA 1ULYA 1E18A 4MRMA 2AQIA 1VG8A 5JE8A 4J0QA 3DVAA 3L4JA 3S2DJ 3I1JA 2DT8A 4V2UA 4ZZIA 5MGNA 7ADHA 3F21A 2MIIA 2PS1A 3N4XA 2ZRBA 4IXWA 1URQB 4ILEA 4MIKA 2QD5A 3KOYA 3IOBA 1DMRA 1E32A 2M6SA 1RQVA 4R1NA 3I76A 3IEUA 5MHTA 1E6UA 1KBZA 3NGXA 1WNTA 3TIVA 1ZR4A 5EINA 1UQRA 4TSRA 1G5IA 3UJAA 4IXAA 1I5RA 2BTEA 4GQIA 1B0AA 3BOQA 1I5OA 4BNGA 3NBQA 3OESA 2Q8NA 3TQOA 1U1EA 2WNSA 3RUEA 3PT5A 3FRHA 5ITVA 2LBFA 3FGPA 1NUAA 5FBHA 1Z0KA 5LQSA 1MVLA 1N7JA 4G4JA 2MJLA 1GXSB 4S0ZA 3PFBA 2NS8A 1Q82Q 1DFHA 3GLHA 1AZSC 5JSZA 3SOZA 4N5HX 1WIWA 4I08A 4TL6A 1JTYA 1R3DA 3VO1A 4EMTA 4FUQA 3Q2OA 5IHXA 2WSCJ 4MPRA 4RVHA 4GVPA 2C3UA 4RJLA 4HDOB 3LYAA 2R8OA 5F33A 3OF2A 2DWPA 3ML1A 3MB8A 4EGZA 4GMKA 3G2KA 3BPVA 4IGKA 1TQ2A 2C4NA 3CF0A 3U59A 3VNVA 3C6KA 4FEAA 1SCJA 2B8EA 1W96A 3IMCA 4X9XA 1W7PA 3ELYA 3WADA 3D71A 4M0MA 2R5BA 3U3DA 1IK7A 3OUZA 1WCXA 5EG0A 2V7QH 4L9RA 3DDSA 4W5RA 1MGOA 4JI0B 1FJ2A 1VL0A 2XUZA 2KKOA 1NGMB 3HTKA 3ACCA 3QVMA 3MKLA 3H1IE 5G1OA 1E3HA 2XGOA 1YIJI 2Y69H 1KAHA 4F2HA 2QLBA 2NV0A 4BE2A 5KOIA 4B0PA 3B89A 3SN6A 1XVLA 5C5DA 3CCSP 5IJZA 3ZW8A 4LZLA 2ECOA 4QNMA 1Z36A 1SPBS 2F3PA 2OQVA 5GGXA 3OIFA 2P2LA 3PNTA 2GXAA 2BT4A 2P6OA 3IQEA 1E1KA 2LNDA 4QLBA 2CNBA 2I8CA 3H65A 4KLCA 4G36A 1TMYA 3ROKA 3O82A 1DD3A 1P29A 2QTHA 5EJ2A 5AUQA 2OECA 3THWB 2IDKA 1PK7A 3S7TA 2AO9A 1Z7YA 1NTZG 1W36D 5BR8B 5G0VA 3OZEA 3DMGA 1OBOA 2IH4A 3C16C 3DMPA 1FNBA 3DEHA 3N0TA 3ZDXB 1AU7A 1WJCA 3PCXA 2RJ3A 2JBHA 5JI3E 5ITZA 1FMCA 4OM7A 4Z6KA 3MJ4A 5D1HA 2A06D 4N6OA 2OCCH 3OIVA 4ZHQB 3ES9A 3E9DA 2X4IA 1I7NA 1SG9A 2ZWMA 3ERCA 1IVNA 1LUAA 3RS9A 4BNKA 4QOGA 4IO0A 1V2HE 3UH0A 3ZHQA 2AOUA 4Z1MD 1IUPA 2GNPA 4YO8A 2JLZA 1P4RA 1G3SA 1CUFA 1U78A 3MK31 4UUSA 3ZDMA 1FU7A 1GVHA 1N1MA 5DN9A 1K5GA 3CX6A 1W25A 3CRZA 5DRYA 3RC3A 3BTCA 2DMNA 4HTAA 1ZP0C 2WTNA 1C1XB 3FD8A 5KQPA 3VEPA 1HV8A 3DP9A 1XZAA 2LWIA 5G1NA 4IH1A 1E66A 1K89A 1O77A 1YMVA 3T0YA 2R5NA 2FPUA 3I39X 2IF2A 3TLKA 4D81A 3WSTA 1GZDA 3LBFA 1EX6A 1N6OA 2ZR8A 3PYMA 4I19A 4WMLA 1N73A 5DM2A 3VHXB 2YN2A 4FXOA 4B6GA 3CLRC 2FPGA 2YWRA 4F9GA 4WIAA 1QCCA 4JASB 3UA3A 2ZYRA 1IN6A 7MDHA 2EARA 3N07A 3HSEA 3PLAE 4OLJA 2I4LA 2G6TA 1U9OA 2MD0A 4QTRA 5GAGJ 4NHEA 2Z6AA 2D45A 4V1CA 5DCMA 1UKVY 4R0VA 1GYRA 4CQLA 2GXUA 3MRTA 1GDHA 4D7AA 4OA8A 2CUZA 2VNJA 3H2JA 1LCIA 3IUNA 1A5JA 2BMFA 5IJ9A 1ISHA 2O2ZA 3NNSA 3AUXA 5C18A 3PQ2A 2DMPA 5JATA 1JNYA 4EG7A 3ZZTA 2ONJA 2R7VA 1JGGA 3QPVA 1NJ8A 3HUSB 2SCUB 3CEMA 3PDWA 4E21A 4UUMA 4W1SA 4LKRA 1FMWA 3OYGA 4D97A 2V9PA 4HYEA 1QJ4A 3Q11A 4EJ6A 1X1AA 2KFDA 1I6WA 3OZBA 2PZJA 1T3SA 2EHDA 2LE0A 4FYJA 2QSZA 1OPCA 2RGNA 3H05A 3IQGX 5I3ZA 5JAPA 2H6CA 3A6JA 2HK9A 2B8TA 4RTRA 3ESYA 4NECA 4DLLA 4AO7A 4CZZA 5AVYB 1A7KA 2ZWIA 5A06A 2ETVA 3DC7A 1Q5PA 5F6FA 3D6VA 4AMBA 1OTHA 3G5TA 1HMPA 3WISA 1C3JA 1JECA 3F6CA 3MS2A 2KIUA 2Z8YA 3MERA 1GK6A 5BOSA 4HK4A 1GR0A 1N2DC 1HNNA 1XTIA 3BATA 4BXOA 4JT8A 1K6YA 4NBVA 5TLSA 1TBXA 2FN3A 3NXSA 1E92A 1QCYA 4E5PA 1XCBA 2NT4A 1UQTA 3OE5A 4XR6A 2ZZNA 3UKDA 1DV2A 4HMPA 5FNZA 3RG2A 4PYJA 3SFDC 1M8OB 3PITA 3LUHA 1T34A 1G55A 1PGPA 3AE2C 1XNQB 4I99C 4BO4A 3CCEI 1MOSA 4ZREA 5AW6A 5HS9A 4QVKA 1O95D 2FXIA 3BFXA 2PJDA 1MKMA 3VYVA 2Y76A 1ZM9A 3IRUA 3DKRA 1APBA 2B4YA 2PX5A 3OAKA 3K1JA 1QNFA 3WK5A 1VCMA 5JCXA 3PFYA 2SPZA 1BW9B 1F5TA 5MDHA 3GPLA 4O1IA 1RM4A 4UV9A 1E2JA 3A4TA 4FWIB 2GUSA 3R5KA 3I56P 3I2KA 1JZQA 4K9NA 2ZBVA 3C5HA 4LF7B 3T4XA 5HMLA 4I4TA 4IVRA 2XB9A 1J49A 2YZNA 5BQTA 1FMJA 2JLSA 4OJQA 1US8B 4B6EA 3PUZA 5EPUA 4RAGA 3TGWA 2HT6A 4GODA 3L7AA 4IG9A 3T3DA 3E58A 4A2PA 4MQBA 3WB0A 3BAZA 5DHAA 2QX9A 2EIJH 3PJFA 4WZZA 5BV8A 1Q6ZA 5B66H 2AR9A 1L4GA 2GN1A 4RE6A 4NZZA 3MELA 2QMEA 2HRBA 3CZ6A 2H3HA 2HMTA 1FBSA 1TRKA 3FXUA 4YMSA 5ALDA 1OZAA 4ZTBA 3LWNA 4Z3KA 2UUAB 3GG9A 3N6RA 1NVMB 3R3ZA 4FGKA 3UT0A 1YI0A 2PZEA 1CFZA 4EF5A 3G5AA 3VTFA 2ZZKA 4NZYA 1PP9E 3D3QA 1AK2A 1XTKA 4LY6A 2DOFA 3KBOA 1PS0A 3ZCUA 4Z2YA 3A3YB 5K0SA 2BGCA 2G70A 4UAJA 5E2IA 1QQ6A 4LJ8A 2P6UA 2LZ0A 4GZ3A 1NI3A 4FT8A 3DXZA 3QU3A 4AZTA 3SZMA 3R3VA 4FFRA 3OTHA 3REQA 1Z28A 3KIOA 2OV6A 1RZRA 5EMJA 2ME0A 4GM4A 4GG1A 1RBMA 5LEJA 4ZO9A 1P4AA 1GPYA 2IHVA 5F1PA 1YDEA 1AKHA 1JAHA 3PC4A 3U4QB 5FF9A 1TTQB 4PYNA 2K9LA 1FZAA 3CCBA 1NI4B 3I59B 3EZFA 3ND6A 1QF7A 2DFHA 2J46A 2O2EA 3ST7A 4QJ3A 1QM5A 1R36A 2ZSJA 2FJUA 4ZKEA 2QJWA 3U4HA 4K9PA 5F51A 4Q18A 4Q93A 4A3CJ 4EA6A 4L5JA 5JNUA 2MSWA 1FTTA 2P65A 4NHOA 2QEXI 3CSDA 3FYCA 2Z1NA 1DO8A 3FWKA 4EJSA 3Q3IA 1CIPA 3NHWA 3GYGA 1LDKB 2NU9B 4QFBA 1FX7A 4RIGA 4R4MA 4YJHA 1FVOA 5G53C 3KLBA 4HRXA 1QG2A 1YX5A 2RONA 1ULAA 3KP5A 2BKXA 2E4WA 5ALTA 4O4JF 4I76A 2Z2KA 3FTCA 3QX8A 2I6TA 3W68A 3Q7SA 4FKZA 2PJZA 2F64A 1IAVA 4MWGA 2CMFA 4PYRA 4KL8S 4CU5A 2WV7A 5DBIA 1G16A 4YWHA 1C4KA 5FLXZ 3NHPA 3WNZA 7REQA 2PBZA 3CZCA 4QEZA 2C4TA 4NV0A 1O6CA 3EIWA 4V03A 2YUSA 4ZQHA 3F9IA 4JT4A 4EW2A 1OZHA 2VOEA 2WJAA 1T5BA 1FS5A 4WN9A 1Y42X 3L73E 3L2RA 3PQCA 2YICA 4MVJD 3ZVMA 4R1LA 1JKXA 3CUTA 5IZCC 2AIRA 5IDXA 2E0IA 3QKWA 2PSHA 4KXFB 1ZPDA 1L0NJ 3S2SA 1QLJA 1SXGA 1KTIA 2V03A 2KL4A 3E82A 2XNDD 5LN1A 4YXWD 3OQMA 3C0KA 4IJWA 2O7RA 2ZCVA 1GU0A 1FQWA 3FNFA 3RYIB 2BH9A 4IDGA 2EG5A 2BDEA 3IV5A 3OOJA 4PLGA 3DYIA 5FKKA 5ILGA 4J03A 1YQ4C 4J1TA 3VSLA 2JFNA 4L9TA 1ZH4A 3SWWA 1Z6YA 3Q3CA 4RKRA 1R9GA 4NHJA 1JG6A 3U49A 1PR5A 2FQXA 3HVUA 2IVMA 1L1RA 4RD2A 5EI5A 2PDAA 3F4BA 1Z3IX 3TBFA 4JOCA 1SQVE 1Z6QA 4BQRA 1LBTA 3DE3X 1V95A 3RVQA 1A02J 4PHHA 2OQRA 1E3DA 1S9DA 2VSNA 2IS6A 3NOQA 1P77A 3PDUA 1BWPA 3K92A 4N78D 2GAJA 1Z4QA 3OU7A 1OLXB 4LZOA 1E1CA 1X1SA 3NTUA 4KN9S 1RXVA 3F97A 1B8IB 4M8IA 4WCFA 1YKFA 4KXMA 1BFKA 2V6IA 3RUAA 4Q3AA 1P5RA 4PX2A 4HPWA 3ICWA 4AM8A 2IYVA 4ZI7A 3CO5A 3T7DA 2B2NA 1E2QA 5CFMA 2OXTA 4BE0A 2RGUA 1TQIA 1YX3A 5B7GA 2ZCJA 3F8FA 1JRLA 3WHLA 2B8WA 3BREA 3ZCTA 1SVKA 2QW0X 1N2SA 1N0VC 3P9ZA 1TWGJ 2GPNA 2BFCB 1M3SA 1K61A 2IDZA 4CDMA 5T4HA 1POXA 2HX1A 1SUIA 4BJ5C 2BEOA 4RZ2A 3F8CA 1V4BA 1GZ4A 4MW0A 4Y2SA 3D3KA 2VE8A 1KBOA 2V6GA 3TMKA 3R7NA 1E2KA 1H3EA 4LXUA 5BR4A 2R1TA 4QAJA 4GLFA 1BWQA 1FDRA 2H1IA 3E9NA 2CRGA 2HO5A 1Y34E 2NO9A 3ZLJA 2WAYA 3QENA 1KQSO 1SZJG 4ZVSA 4B3XA 1RD4A 5ALWA 2R3SA 1PAUA 4G5GA 1QHHA 3P0EA 3VV3A 5DDGA 1ZD5A 3ZHCA 4BMZA 2E1PA 1EEHA 1TWAJ 3KZYA 3F0CA 4HAMA 1YJ9P 3U80A 5EJ8A 3CUQC 1J0DA 3OHMA 3WGGA 5FWYA 2GAUA 4UM7A 4KLAA 4IHVA 4HLDA 4LCJA 2IXAA 5AT1A 3ZVKA 3I4LA 2OXRA 3D0RA 1IQUA 4O4IF 3CUQB 1NNUA 3TSAA 4E7ZA 1DDOA 1CEQA 3PFHA 2I34A 4KT6A 3KSZO 1XYYA 3OG9A 2IZZA 4N49A 4EPXA 5KTMA 1LWUC 3HB7A 2WAXA 2O8EB 5JVDB 3TTYA 3G17A 5K0GA 2WDPA 1RY3A 3ZJ5A 2DAOA 1K7YA 4H35A 4ZJPA 2NVWA 3A1CA 5JSKA 5BPHA 3ML6A 4KE6A 4UVCA 1FYVA 2GYYA 3T9AA 3CWBJ 1JG4A 2A3RA 4GX0A 1RT9A 5JQWA 1RLJA 4EIWA 5AP9A 3ITKA 4YXWH 1MA0A 4MGYR 1XK7A 5A3JA 1F4PA 1U3GA 5C39A 3IR9A 2XB4A 1FYFA 2WDZA 1NXVA 1UF9A 4ZYWA 3KVVA 5HNFA 2EP7A 3B85A 4CR6A 4Y1RB 4NZ9A 4KX5A 4ZALA 5CUQA 1F9AA 4Y52J 4PRZA 3M0DC 4PYLA 1PP9G 2LKMA 4DRZA 3HWWA 3BMOA 1G5PA 4IL6E 2PYIA 4QYSA 5SY9A 4D9MA 2ZJQF 1LDJA 3CX5D 1P9LA 2RGRA 1MMFB 1OXMA 2RHLA 2VOJA 2FQQA 3HFJA 5D00A 3LA6A 5C8VA 3QI7A 3NANA 4XUCA 3WP1B 5DHSA 1BKDR 4PZCA 3C15C 3L0SA 3NP7A 3D5SC 5FL7D 2EQAA 1Q11A 3OZVA 1X79B 2ZANA 1DJMA 3NTNA 2GJKA 3FTFA 1EDJA 4BNIA 1CCWA 3E9EA 3JD4A 2DWCA 2YDXA 1CJUC 3P2YA 3L74J 3IUPA 1CT9A 1Q1GA 1OR7A 3FSRA 3W2TA 1URQD 5D5WB 2Z5UA 1YS9A 3O8NA 5AI5A 1X7YA 4OKSA 2VQCA 4CT5A 4MN4C 2W84A 5BQPA 1SBTA 2CK3A 2B8JA 1EK2A 1SK8A 3AYZB 4N3GA 3ZI0A 1GXPA 4G0QA 4M1QA 3ZX4A 2A86A 1QNTA 1U8FO 3U2RA 1SKBA 5A7FA 3L7DA 4DEVA 5AW0A 2I78A 2DCUA 4HGYA 2A5GA 4AKIA 1HVVA 2P35A 4HSTA 2H08A 3AVTA 4AN4A 2ZJFA 5E0OA 5GVSA 3BF7A 1GM5A 2GN0A 1OTYA 1PVOA 3QPAA 1GW3A 5APWA 5FKLA 3HI6A 2DBZA 1DKOA 3JVEA 4DBZA 5EEHA 4L9WA 4AUEA 2Q8PA 4MA4A 3E3OA 3D1NI 2RMZA 2CHUA 3DVAB 5HLIA 4Y4RA 2WYHA 1KILE 4B2LA 3FMGA 1X7HA 2GDZA 4C2MJ 4LNUB 2J6HA 1J5XA 1JDSA 3HO1A 1SKYB 2FW0A 4OIMA 2XGGA 2WVAA 1LQTA 2IGTA 1ABBA 1YI2P 1T2KC 3GFRA 4NABA 1P61B 2K88A 1FXSA 1SD5A 3I8XA 1HDOA 4M3FA 2C03A 4PRKA 2DPUA 1ZJ5A 4LYDA 5CLSA 3L7WA 2H29A 1D03A 3SC6A 2V6MA 2WWYA 4XRSG 4M1MA 3TSZA 4NK5A 1AVOA 1SULA 4BMSA 1E3PA 2BMJA 4TTPA 3BTOA 3RS2A 1YQXA 4XQGA 1HQKA 5HLGA 2YZMA 4X66B 1TXGA 4TZ0A 2PUGA 1CY7A 1C1DA 4MUJA 3EZ7A 5K5RA 1EUQA 4Z9AA 1ZEMA 1XR3A 1Z67A 3CZMA 5CXSA 2NZ8A 2LY2A 2QUAA 3KKPA 3L6CA 3KB2A 2W8ZA 2F4VB 5DTIA 4UD2A 2XCUA 5K3OA 3MGKA 3BCCE 3M1YA 3THYA 4I55F 2ZB7A 1T2VA 4NDZA 4EJWA 4FDAA 3EZ6A 2OTKE 1NMZA 3NUGA 2M3AA 4TSFD 1M1ZA 3SF8B 2E76D 3UMMA 2H1VA 3HE4B 2IS4A 5D5QA 3UHPA 1X1CA 1RJWA 4XPZA 4YP5A 5EN4A 5J58A 2A78A 3SYRA 2R5ZB 4OMFG 3BFKA 3LVFO 5GMOA 2MHCA 3ZQJA 2ZUDA 1CRPA 1JT0A 5CDGA 3WTZA 4M1EA 2ZREA 3B1YA 2Y31A 3MKWB 1CUYA 4Y1FA 2DYKA 5I51A 5PNTA 1BKYA 2B1RA 5TX7A 5BMVF 4HSRA 2WYVA 1R71A 1J0CA 4QHSA 5AXDA 2W98A 2GRAA 2V4HA 2G77B 4OGQC 1LTKA 4FHFA 2XQVA 4BHPA 2CJXA 2ZT7A 3G1OA 4DM7A 5AK3A 3KPVA 4AU7A 5AVXB 4V24A 1CUHA 4RHFA 3KJNA 3G2BA 1PLJA 4R81A 2FFDB 4Y7CA 1KO4A 4DV1B 3OS1A 2R8YA 1G59A 3TFQA 1WOMA 3BICA 1GTG1 5JJBA 3UV7A 4A36A 4IPTA 1QQAA 3CG4A 2A4MA 3PNKA 3RPUA 1H2AS 1GPDG 4KQ9A 1C30B 4PLCA 2O0HA 1YL5A 4UXIA 2H57A 4BQQA 1QK3A 2LC2A 3MF4A 2X0NA 4HGNA 4N3CA 5CA0B 2G8YA 2IX7C 4FKMA 3PV0A 2GBLA 2IOQA 3I56I 2D5BA 3W3AA 4BDSA 2HIHA 3V8NA 4XFKA 4XVCA 4YFXF 1MMNA 4HQLA 2LV8A 4GYWA 3HVJA 1X15A 3RK3C 4JCCA 1SQSA 2OCEA 3VU3A 5CB4B 5IULC 4D79A 3U39A 3UBMA 3NQOA 4LIUA 4RAOA 1NTKD 2B4AA 1ZJJA 4Q3OA 5FI1B 3GLRA 2ZBEA 2ZROA 3P9RA 3O6QB 3B73A 3DE1X 2Q4BA 1Z21A 2HQSA 4REMA 3OETA 2JRLA 5FNVF 4KIWA 2WHPB 1KO7A 4X64B 1DCKA 2WPQA 4IFTA 1SZCA 2B2CA 4D80A 4GI2A 1UXOA 5FOSA 4YRRA 5ENVA 1FBQA 4A3MJ 4AJKA 1R6UA 3UATA 1DAPA 1IG7A 1XPXA 1D9XA 2GO7A 1M5TA 4U7WA 2FWMX 3H1HD 3CGWA 4DR7B 2QTFA 3F5SA 3AX6A 5EP4A 2STWA 4QREA 2WVJA 2NVUB 4Q7EA 4D98A 4QICA 4UAUA 1P6UA 1PNVA 3DL7A 2DQZA 3NV7A 4ENMA 1RWKA 1X4OA 5F2EA 4BRZA 2J87A 3K1AB 3G1UA 2RG7A 3OECA 3HTSB 1B2RA 1O5TA 1JR6A 1CK4A 1SQBG 3EIEA 4U7DA 5EJ6A 3ZWXA 4FMPA 4C0AC 1PJZA 5ER9A 3O8RA 3QU5A 4OMZA 1TYBE 2R4UA 1ELOA 1N2HA 1O94A 1KQLA 3L2CA 5B2FA 2ZMEA 3IVGA 3GJYA 4L85A 3NC4A 3GJSA 3AUFA 3TMOA 4UU0A 2IXDA 4XORA 4D3XA 3AWDA 4YROA 1Z8DA 3AL3A 4B3MB 1G8MA 3TFWA 5CEEA 2YWEA 3HGTA 4GWLA 4JSTA 3DDUA 1YDHA 4GNKA 3E2PA 2XGXA 3G73A 4QRDA 4F1WA 1FE6A 2YVQA 4K6MA 1CE8A 5GIPE 3IV9A 1AHDP 1VGQA 1KMMA 2O20A 1OIPA 1SFXA 3QVXA 1B0PA 3P4UA 3S2IA 1DB3A 1WLSA 5LZ5A 1GGEA 1IATA 3UGQA 3CX5H 3VH4A 2A3SA 2FK7A 1JQEA 3ZDRA 1BXRA 4WZBB 1GNLA 3R6SA 5BSKA 3OFJA 1LWUA 4L4SA 1D4FA 5KOJB 4LI0A 1MV8A 3IE2A 4FZVA 5AVRB 1JAIA 4RV5A 4WD3A 1C9DB 3DQQA 4B1RA 3BG7A 5HJ5A 1JW9B 2ZOSA 5DLEA 2G8LA 1ERDA 4ALLA 4L4YA 5JT1A 3G2HA 2BVNA 5KBYA 4PSUA 4EPRA 2D1FA 2X4HA 4DLKA 4O4JB 2REQA 3KOWA 3M8FA 1A95A 4IKFA 1GZ7A 4B2PA 1ZOSA 4KFTA 4HUTA 2X85A 3QU9A 1Q7GA 3DMDA 1QQTA 4BV2A 3DFFA 3W05A 2BP7A 2ZRPA 2KOGA 3AW9A 4Y33A 2VCEA 4ZOCA 1QHNA 5AJWA 3R5SA 5B6IA 2PBFA 3E3AA 3OKCA 1MB4A 2JH3A 1MGPA 4HNSA 3W8NA 3V7SA 4IL6X 4INPA 4R9SA 1H4SA 4F38A 1ODDA 3A1NA 4DUGD 4MWCA 4NVRA 5DTQA 1OVRA 4U9UA 3NWPA 4PE5B 2ZXWH 2FMHA 1V39A 3S2YA 2O5EA 3V3TA 4HNVA 3D7MA 3THXB 2FHSA 3DEKA 4LRTB 1KU2A 4TTVA 2HSWA 5FRNA 1TKBA 3NWSA 1J9IA 1VZ3A 1PHPA 1XD8A 2C94A 3QWBA 5DPMA 1MB9A 4KXWA 1ONSA 1M76A 1Z6RA 3OR2C 4LEIA 1TAGA 4CNQA 4MRNA 1S3IA 3ZN2A 4WUVA 2YZ7A 3A7EA 4P2BA 3IVAA 2DLNA 3NT2A 3S70A 1N86A 4B5KA 2MCFA 4TWJA 3BIWA 1JDBB 2I2CA 2M30A 4ZEOA 1BDJA 3ETLA 2QY6A 4AY6A 3R7BA 3ORRA 3E6DA 2ITAA 4HBZA 1PL8A 1MC5A 2P5LC 3BZWA 1JDBC 2C5EA 1V8OA 4B3JA 1DPRA 3VVCA 3AF0A 4R2XA 1B23P 4HDSA 3JATA 1EB9A 3HGQA 2CXOA 1SQQJ 2QW1A 3QM1A 3TINA 3DBHB 1MPXA 1P2SA 1KN7A 1NW6A 2NP7A 1SXJD 2QUZA 4MRAA 2EKLA 3BLYA 2W37A 4GT1A 2HMVA 4A8JA 1RE4C 2X23A 4BZWA 2I99A 4HLCA 1EDBA 3NS7A 3C4JA 3D8UA 4KOEC 3OYHA 5I45A 3ZCRA 2K7FA 4E3WA 4C3ZA 3TNJA 1OQAA 3BE4A 5KYUA 2IYNA 1M1YB 3CF5F 3SC2A 2KS1A 1B8UA 3O9MA 3HE4A 3OM8A 4R84A 2RKBA 2VE9A 2NUTB 4PR0A 1F0YA 4G0VA 2LTPA 4DR6B 3ROZA 1AGPA 5FQNA 3WK6A 2D00A 3VAAA 2PLYA 3K69A 1L7MA 3H8SA 1HCRA 1R49A 5HUJA 2Z04A 1UK6A 3OPYA 3V8VA 4EHJA 1ZQ3P 3R9XB 3WUVA 3AI1A 4PIMA 2YNMC 3LPCA 1G21E 2PMUA 5KLVG 3ESBA 1DBSA 4OP1A 3L7KA 3QEOA 2HU9A 1AXGA 1T13A 2D8MA 2CG4A 4LLHA 1QNLA 1WTCA 1QFXA 3FIJA 1LK5A 1EDKA 2G8NA 5I9LA 1JEJA 2Z4EA 3HOYJ 5D3MA 4K9MA 4ZHSA 4XYEA 3G88A 2JJ7A 2O8CB 4F7DA 1F0NA 3OZIA 4B4WA 4QOJA 4R2HA 4EJOA 5K3AA 5DD4A 1Q7YQ 3HJUA 3KQMA 1GITA 4E7IA 2RKLA 4TKLA 2MW8A 1E79D 3S2UA 3EZYA 2JVIA 1LP1A 3P0IA 5L7TA 1TQ6A 2WPDD 3QXJA 2RHRA 5CAEB 2QR5A 2Y9YA 5J4YA 2QN2A 2OHXA 4Z1OA 1O3QA 1VJCA 2WWIA 1JVSA 5F3WB 1SVWA 5A7GA 4N5IX 1V4RA 1P7WA 4NYJQ 3O8OB 4DJ5X 2H54A 2EFNA 4YGXB 2Q5JA 3S15J 3N2YA 5LOVB 4EJSC 2MABA 1VHDA 1Q2XA 2IAIA 4B17A 2H0RA 1V1RA 2FN8A 5HS6A 4M8NE 3HCDA 1NSFA 1NBWB 4UMEA 1DRWA 3GTQJ 3CXRA 2Y1KA 4M3DA 1KMIY 1R6RA 2Z4RA 3U7RA 1H2HA 4R1SA 4MR8B 4QGHA 2DO7A 3T7EA 4BMDA 2Z4SA 2V1DA 4Q16A 3U1TA 2HOAA 4BB6A 1M75A 1GPUA 2JFPA 2H7VA 3KLNA 1CQIA 4B3CA 5U1PA 3ROUA 3C2HA 1KR5A 1E7SA 1FVFA 4IRGA 3NKVA 4M8KA 1I3MA 1Q74A 2NTYC 3G2OA 1UFOA 4ZAVA 2CZCA 3KVYA 1JTVA 3WAJA 2WA1A 4PGGA 1B93A 1FQJA 3O8HA 1MC4A 2ZE5A 4X7PA 1BRMA 1L5HB 5H20A 5ALEA 4WBNB 5K8VA 2ZRDA 1YVDA 2H89C 3WGTA 3TTTA 3B9PA 1OA0A 4R1QA 4WL0A 1Y6ZA 5D01A 1Y6RA 5A4JA 2HV9A 4CQMA 2WADA 2WITA 4BBAA 2A45I 3MINB 3SBDA 4BAYA 3OOSA 2VQ6A 1NDQA 2GBYA 2FSVA 4ESJA 3B5EA 3GH3A 1SQGA 1U7TA 1XQ1A 3RROA 5JAUA 1L5OA 2NNWB 1T6YA 2E2WA 4EABA 3WTCA 3QYFA 4ZMSA 1QBGA 2MTBA 1N2CA 1TJ3A 4OJNA 3J80Z 2BGTA 3ANMA 3QA9A 3I37X 3NBKA 1F9NA 1BI2A 4DSUA 4FHDA 2ZSBA 2Q8QA 2BY2A 1R64A 5LYYA 3E22A 1GNTA 5EZQA 4ALMA 5ENDA 3JZFA 3RL0g 4GM0A 5ILQA 2QRPA 4MUGA 1ZA1A 2R2GA 1RHJA 1SHKA 3BGSA 1XU7A 2QXUA 3D8BA 3A0HE 2O0JA 3HKZA 3LDAA 1S6LA 1PRYA 4TV8B 5DHFA 1TU0A 1OWOA 3LSYA 4D9BA 2VNSA 5KTTA 5K5OA 4IJKA 4URUR 5CNKA 3EC7A 4F06A 1T5OA 3LXXA 3M6WA 2FBIA 9ABPA 3UMYA 3ZMZA 4XBFA 2E6KA 1KS2A 4IGIA 2DHEA 3C4VA 2PGLA 3NHUA 2O0KA 1RI4A 2WV0A 4G5XA 4OHKA 1MJ9A 2HOQA 2Z3WA 3DVLA 4BXOB 1Y3DE 4FMBB 3L7YA 3ND9A 2YKGA 1DADA 1S7OA 2YXLA 1AZLA 4UOQA 5I6DA 3WC4A 5C4MA 4A9AA 2LKPA 1TNSA 1S2GA 3CLUC 3D2AA 3OY9A 2BSXA 3UK6A 5LD2C 2STTA 4GMDA 2GLXA 3EVTA 1U2PA 3UXYA 2VIXA 2RHGB 1AV6A 2YO3A 1MLDA 2ZYHA 4JJ6A 5GIOE 3FNIA 2VXZA 2XY4A 3E9ZA 3NBUA 5ARCA 1NUHA 5JECA 3B71A 1OWLA 2ZBQA 4MGHA 3L2QA 4LMRA 4MOWA 3AVUA 2VK1A 1W1WE 3V2UA 1DAOA 3AFMA 3F8SA 5CH8A 4CEHB 5L6MB 1IZNB 1YCFA 3ON5A 2AXQA 3K3PA 2HYIC 2QQ9A 2GTHA 3DT8A 1QGYA 5JRDS 3LUBA 2B89A 2HA0A 2IOHA 1REQB 4YTEA 5KSYA 2WWTA 4J6FA 4F5ZA 3W8RA 1T10A 3ZI7A 3OZTA 2DR3A 2JLCA 1XOIA 4MKGA 5JZVA 1BH2A 3BJAA 4DADA 5TJHA 4JFAA 4P4LA 4J90A 3DB1A 4Z1MH 5GJWC 2ZULA 1ZZGA 4KUGA 2AW3A 4JUBA 1MNDA 4TXNA 4UE6A 4ND2A 2O5RA 2OUKA 1S0UA 2PHZA 4PZEA 2C9CA 2HPVA 4IIUA 4WZBA 3O03A 2VQFB 3PIRA 2Z43A 4XGQA 1NQUA 5F0FA 3LLMA 4MW5A 1JXMA 2JH9A 5CX1B 3DKWA 4R6WA 3JASB 3ZH2A 1FL9A 4Q4HA 2VP3A 3FMFA 4W99A 4JU8A 4JR2A 5BRJA 4Z7NB 4ENSA 4E2WA 3HBJA 1X86B 4RMJA 4JLWA 3HJEA 3BD9A 5BUSA 1DXOA 3PR2B 3JASA 4OQFA 5AUOB 2DETA 2MBFA 1TRHA 3W90A 5IDYA 5TR9A 4PZUA 4B43A 3SVZA 1O95A 1Y7LA 1CG6A 2YNMA 3AEKA 2XMZA 5THQA 1HO3A 4XQEA 2GZDA 4M99A 3F1LA 3L7IA 4WACA 1V7CA 3WMWA 3KP6A 5AVQA 1E3WB 1WPQA 3WWEA 4E4YA 1B8NA 1BGYG 2I2WA 4N40A 2O2SA 2QRHA 5H2FC 3RYHB 1LWNA 2YXRB 3E5XA 3GLGA 1XTTA 1X39A 4DIQA 2AN3A 4LRUA 2X8AA 3IQXA 2LOOA 4BWFB 1L7AA 1PJAA 3FDJA 3ZWQA 5KAFH 1PTJC 1MMGA 2DE0X 5AI4A 2OAP1 3AF5A 1PDVA 1ZSYA 3PNMA 5DHTA 3PFIA 3A26A 4LOJA 1A76A 1DRVA 4KQXA 3GC6A 4ITUA 1UOPA 4R1UA 1KDTA 3PGKA 3SSUA 5LOVF 1RP7A 1NXWA 1J0AA 3IIMA 1Z2EA 4YECA 3U5TA 4U02A 2GPAA 4QJ4A 4CMKA 2XPCA 1D3YA 3EIOA 3VPAA 2WJ6A 3Q3SA 2MYNA 2B87B 1WVIA 1GVNB 4JP3A 4BNZA 2ZBGA 3PUXA 1FBNA 4E2ZA 5DTJA 1RUOA 4OSEA 1DPGA 4OWRB 2VNHA 4E09A 2JIBA 4UU7A 4TGLA 4P3XA 1B8VA 4B9EA 4R8KA 5GV7A 2W6IA 3BC1A 1E1YA 4B4UA 2G36A 4WK2B 3DEZA 4ZK2A 4PWYA 1F3OA 3OU6A 1SEVA 3AXTA 2GKGA 1ETVA 1QF9A 2XPUA 4YJ3F 4HAZA 1XSEA 4E15A 3UMFA 3UFXA 1OREA 2H65A 3BJMA 2NAZA 1R4MB 1Q91A 3E7XA 3D5TA 4LITA 1EX9A 2V3WA 4B2IA 5DBOA 1U98A 1U81A 2UYHA 5K7ZA 1E2MA 2X4LA 4TS3A 1T8UA 4XM2A 5IJ0A 4MV8A 1LVHA 1NN5A 3CX3A 3W4IA 2AJTA 3TJMA 4DG9A 1FMFA 1N1DA 3BN3A 1O6BA 1T24A 3RZDJ 1M9NA 3MA0A 4BNVA 3QGMA 3ZU3A 3UUGA 4UMDA 1QYDA 5FWAA 3KBBA 4XQCA 1MN6A 1KTVA 4DQDA 1I7QB 3U4QA 3I55I 5JD4A 3ZU6A 3RTDA 1I8TA 1L2TA 3K0HA 3GMIA 3ZOBA 1SQQG 2HIAA 2D3TA 2G1JA 3GJTA 2DOAA 2M0CA 3ZDAA 1LPMA 4RZXA 5C80A 3AERA 1ZHHA 1QDEA 2G09A 3T7SA 2P9ZA 5JMWA 3A4YA 2ORED 5JR3A 4M3BA 1WPXA 3MZ0A 1TZBA 3LA2A 3TG8A 3B6MA 2G9RA 2PZFA 4AROA 1Q7CA 4HWSA 3M1LA 1W93A 1WUHS 1O0BA 5BNGA 2A33A 4XLEA 1S3FA 4RH3A 4MB0A 1KP3A 5MFZA 4TT3A 2HPCB 3AKCA 4H16A 4TYMA 5AVWB 4RADA 2ZR9A 5AVYA 1TLHB 5KJ7D 1KH1A 4KRYA 2QLJA 1JFVA 4LJ6A 1SLQA 3CPEA 5BN1A 3HRSA 4GI3A 2IEKA 2V97A 3PXDA 3X2FA 4LTDA 3MWLA 3SSAA 3ICOA 1IAQA 5K8TA 2HFKA 2AXTH 4BS9A 2FFRA 1NBOA 5I7HA 4G6TB 4BZQA 4IDCA 4F85A 3DUFB 2AWNA 3INTA 3MOIA 4HQKA 1VBKA 5AI9A 3OS0A 5C52B 1YS4A 4IDQA 1JEQB 3GX1A 4L9VA 5L40A 4L4UA 3N74A 4MYRA 4AVZA 5AM2A 2QD4A 4R68A 3OD1A 3TD9A 1WZIA 1TYCA 3CXHH 2VXOA 1H9CA 3USZA 4OSPA 4F72A 5A3QA 3GFIA 2QWXA 4EAQA 1H6DA 3C7AA 2IE8A 4AC9A 3KUXA 2Z3YA 2DHRA 2GZAA 4LPKA 2B4QA 1FOSE 4CLEA 2FN4A 2VQDA 2VDPB 1JHHA 4B47A 4BJHB 4UVEA 4NC6A 1VCHA 3KQTA 4IL6C 4K2AA 3WQSB 1C7FA 3GRRA 4BWGA 3ERED 1EUDA 4U7BA 3K1PA 3H1LG 1Z7GA 4XJVA 5HDBB 1XTBA 5DISB 3DWEX 1UZNA 4TX1A 3TGUD 4Q6BA 4CMAA 1Z2DA 1L4AA 2NTJA 5HM8A 2VH5R 5H0IA 2VS1A 4PTZA 4BNYA 4WFIA 1EVIA 4URHA 4YAGA 3HR4A 1GPBA 1CUJA 2BKLA 2ORVA 1VQ4I 1KFEB 1YR8A 1F8XA 2XRFA 1B72B 3I1YA 2C0PA 4PZZA 4QG3A 2GPBA 4I1SA 4X1OA 5EHNA 2FDCA 1WABA 1A31A 1HFJA 2BY0A 4H6PA 4RKFA 4IFFA 1JO5A 3CZAA 3JQBC 2E74D 2C9ZA 2ERYA 3GVAA 4NNOA 2VKHA 4FDUA 1Z2PX 1E6EA 3FMPB 1R7JA 3KOOA 3QOWA 2D13A 1ZN9A 3WDSA 2FLKA 5WRFA 2QQAA 2NOJB 3L46A 5CB4A 4CO8A 4CL2A 3RRYA 1P6QA 3WGQA 1ZNWA 3TVTA 2RI6A 3IT3A 3WWCA 3RYIA 3UXHA 1KFCB 2J9FA 5KNCH 2KSJA 1ZYRF 3SZPA 4KR0A 2MU1A 1Z63A