2GM4A

An activated, tetrameric gamma-delta resolvase: hin chimaera bound to cleaved dna
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
183
structure length
179
Chain Sequence
MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASDRKGLDLLRMKVKEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDSIDTSSAMGRMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*AP*GP*TP*GP*TP*CP*CP*GP*AP*TP*AP*AP*TP*TP*TP*AP*TP*
publication title Implications of structures of synaptic tetramers of gamma delta resolvase for the mechanism of recombination.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Recombination, dna
total genus 47
structure length 179
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2gm4A03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2gm4A02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gm4A01
4FTHA 3ZQGA 3QPSA 5M5YJ 4AUXA 3ZQLA 2HOSA 2YUSA 5C34B 1X2MA 1HDDC 2AHQA 4G12A 5IOYA 2NVQJ 1RPWA 1JT6A 5GPCA 1F43A 3I4NJ 1HCRA 3GUVA 3MN2A 3VPRA 4XK4A 3JREA 3H0GJ 2JA7J 3ZQHA 2X6OA 3Q0UA 3GTGJ 2WAQN 2R5ZA 4IHXA 5E3OA 3HGYA 4I6ZA 4JP0A 1UHSA 2VI6A 3TEDA 3BG3A 3SDGA 5F08A 4A3MJ 3LOCA 1JKQC 3PO3J 2LLKA 1YRNB 3HEFA 1AKHB 2E2JJ 3LSPA 2XPWA 2CJJA 2XRLA 1TWGJ 3ZQCA 2JWTA 1MBJA 2LP0A 3BTLA 4MIMA 1H89C 1FIAA 1K83J 2MSYA 2DA4A 1GVDA 1Z0XA 5EF6A 1A6IA 1VF9A 5FLVA 2CRGA 3MKLA 1QPIA 2O7OA 4D7NA 3BQYA 1U9OA 3BR1A 2G0EA 1JKPC 2XGDA 2Y30A 3H3VK 3WHCA 2ECCA 1APLC 1IC8A 4BBSJ 4C3HJ 4L5EA 4A3EJ 2XPVA 3S1NJ 3PO2J 1FIPA 4B4CA 4M3GA 3BTIA 4BY7J 1B72B 3HOUJ 4QIWN 5IYCJ 1VNDA 2FX0A 5EZHA 3UJ3X 1B8IB 1HX7A 2DA1A 4I76A 1JJ6C 1UG2A 3DCFA 5DTDA 3BVPA 1H88C 2E2HJ 1JTXA 3CDLA 3HKZN 4A3KJ 1FEXA 1AKHA 1TWCJ 3M3YJ 1LE8B 2HXIA 1ETWA 4BQQA 2MG4A 2XGEA 1LFUP 4A69C 3HOVJ 1ZR2A 1S7EA 3RKQA 3S15J 5JLWA 3JRHA 4XICA 3L1PA 4M3FA 1VFCA 2HDDA 2JN6A 4C3IJ 3NARA 1JTYA 1MH4A 1ORKA 5GPAA 5E3MA 2OF7A 2XPUA 5EZGA 2R93J 3MVPA 1B8IA 3A02A 1TWFJ 1MBEA 1U8BA 1WH5A 2R5ZB 3QQAA 3GTOJ 1IG7A 3TP3A 4Y7NJ 1LE8A 1JJ8C 1IGNA 1Z77A 5J3LA 2ID3A 4NDLA 4AC0A 3TP0A 2ME0A 3ZOBA 2VPRA 3A01B 5FKMA 3NAUA 5J1RA 4D5CA 3IV5A 3BR2A 3GTPJ 1QVUA 1BJZA 2EZHA 4W97A 4V2FA 1VI0A 5EGOB 2JA5J 1TWAJ 4AYBN 2NVYJ 2DJNA 3FIWA 2ME6A 2M34A 3S1RJ 4M3BA 1TC3C 1GV2A 2HXOA 4FE4A 2DN0A 4BBRJ 1AU7A 1U9NA 2FQ4A 1HF0A 5IYDJ 3S1QJ 1JT0A 2EBIA 5J1UA 3K7AJ 3JRIA 4XRMA 4JYKA 1Q1VA 2EZIA 3ZQIA 2NS8A 3JRAA 3W6VA 5C31A 2HOTA 3TW6A 4FE7A 1GV5A 3QPLA 4DYQA 1W0UA 1PUFA 2O9LA 2GM5A 2TCTA 2HOAA 4QSHA 4CYCB 2DMQA 3BR3A 1H8AC 2DMUA 3IH2A 3BR0A 2QF7A 5EYRA 4ABZA 2L7ZA 4RDUA 2HI3A 3LSJA 4MLOA 3A01A 1OCTC 5F27A 3O8GA 1BW6A 3LSRA 2GLOA 1SANA 2EZKA 2GBYA 2L7FP 5EGOA 3GTJJ 2DA3A 2VKVA 3OSFA 5M3MJ 2DA2A 2K9NA 3S2DJ 1XS9A 1ETVA 3A03A 5EDNA 2L9RA 5C3EJ 2DA6A 3LNQA 2Y9ZA 2M8GX 1HDPA 1JKOC 4M6VA 4MFDA 1QVTA 3JRCA 2H1KA 2B63J 4IHVA 5F04A 4X1EA 5IP9J 3HDDA 1SFOJ 1ZK8A 1XC5A 3FKIJ 4LOCA 2HYJA 2PMZN 2LFBA 5FKOA 3SFIA 4FISA 2I10A 3UKGA 4MO7A 1POGA 2JJ7A 4CYCA 1AHDP 4A3GJ 1ETXA 3JR9A 2XB5A 2JK3A 5C35A 1ENHA 3JRFA 2P81A 3OOUA 1MBGA 1RKWA 2LY9A 1OJLA 5FLMJ 3PKZA 4MFEA 2K9SA 1BA5A 4A3JJ 4UUSB 5F1JA 4A3DJ 4DW6A 1JUSA 1JKRC 1IUFA 2L7MP 1ETOA 1RETA 3BG5A 3ILXA 5E3LA 2N8GA 2MHCA 2LTPA 4J19A 2XGCA 3BQZA 3OSGA 5M5WJ 2JA8J 2CQXA 4QTRA 1ZQ3P 5FKKA 2LVSA 5JLXA 3S2HJ 3HOWJ 1RESA 2Y0SN 3DEWA 5IPAA 1HOMA 3Q0WA 4B1RA 3S17J 4HNVA 4DYCA 1MSEC 1PUFB 1WCMJ 1G2HA 1WH7A 2R5YB 2VKEA 5M5XJ 2YS9A 4C3JJ 1WI3A 1X2NA 3HBLA 1FJLA 1ZGWA 4UUSA 2KT0A 3G1MA 5F0FA 5C32A 1W0TA 2DA5A 2IBDA 5C4JJ 3LSGA 3BG9A 2COBA 2XB0X 1R9TJ 1BL0A 4M3DA 1IDYA 3LHFA 5FKLA 4EEFG 1IV6A 1TWHJ 3BTJA 2VUMJ 3FISA 1MBFA 5K7HA 1P7JA 2L0KA 1K61A 3HOYJ 4A3BJ 1MSFC 1ITYA 3Q0VA 1U78A 2HQ5A 2R0QC 3B6CA 2ECBA 2IAIA 5DS9A 2R5YA 1O4XA 3ZQFA 1IJWC 2WV1A 4DZJA 1GHTA 1ETKA 1I6HJ 2NVXJ 1EF4A 2RAEA 1OFCX 3G1LA 2JA6J 5IP6A 2OPTA 2EH3A 3C2BA 4C2MJ 3GTMJ 2LKXA 1GDTA 3Q3SA 1XG1A 3IH4A 3HB9A 2CUEA 2ELKA 1Y1WJ 1P7IA 3CQZJ 4JX5A 3GTQJ 2D5VA 4BXXJ 4B3AA 2CUFA 2YU9J 3CCYA 1DU0A 3B6AA 5FKNA 3HOXJ 4DYRA 4A93J 5E3NA 3IH3A 1ETQA 3LHKA 1I3QJ 3M4OJ 2DMPA 2NS7A 3E7LA 5EG0A 2LD5A 4D5FA 3RZOJ 1JGGA 5EEAA 2H8RA 2FJ1A 4BY1J 1NTCA 3BR5A 2AO9A 2K40A 4D7MA 2Y2ZA 4BKXA 2GM4A 2QCOA 2MGQA 3HGGA 4XIDA 5BNGA 2M9HA 5IP7J 4RBOA 1JUPA 1OCPA 3RQIA 3GTKJ 4JX4A 2O8KA 2Y31A 3JRDA 4A3IJ 1MBHA 2WB1N 1LFBA 2EQRA 1HLVA 4M3EA 2R7ZJ 2MW8A 1JUMA 1BW5A 1WPKA 3I4MJ 1RR7A 4A3LJ 2X48A 2DMNA 4UUTA 1YRNA 1RKTA 1IDZA 3O8HA 5GP9A 2E2IJ 1Y1VJ 1T56A 3K2AA 3CMYA 2DA7A 5C44J 4IEJA 1ETYA 3D1NI 2RSLA 4V2GA 2DTZA 5IOZA 1IRZA 3GTLJ 2TRTA 1CQTA 3JRGA 2EZLA 3S14J 1FTTA 9ANTA 2W48A 4S0HB 1NK2P 2IEKA 3HM5A 2NVTJ 2JMWA 1E3OC 4XRSG 5IYBJ 2KDZA 5K7FA 1QRYA 5F0CA 4IHWA 4Y52J 3BTCA 5K7ZA 2DMTA 3G1OA 5M3FJ 2LR8A 3WHBA 4IHYA 4FCYA 1B72A 1D5YA 4GFBA 4A3FJ 2NOGA 1UMQA 5F0HA 2FD5A 2CU7A 1GUUA 2ID6A 3RZDJ 1GT0C 2R92J 3JRBA 1MH3A 2LK2A 1DU6A 5FJ8J 1T33A 2XSDC 3F0CA 2X9DA 3BT9A 1ZR4A 2E19A 3TW7A 2CQQA 3G13A 3BR6A 1ZTRA 5J1YA 2E1OA 1MBKA 2M2EA 4W1UA 5EG0B 1FTZA 1ZKGA 3HOZJ 2K9QA 3GBGA 4JX6A 4X6AJ 2M0CA 2Y9YA 3FK7A 4XRSA 1MNMC 1I50J 3OIOA 1WGXA 4A3CJ 5HODA 5C4XJ 2ZB9A 3S1MJ 3S16J 3PM1A 1X58A 3FK6A 1F36A 4DZPA 3SJMA 1NK3P 1A5JA
chains in the Genus database with same CATH superfamily
4CTJA 4N0MA 3EGVA 2BE9A 4ARBA 4DGWB 1NXSA 2YINC 3ACCA 2DQYA 2X23A 4EKDA 2HWYA 1Z8HA 3T0IA 3C85A 2WUGA 2X0DA 2YVAA 3EFOA 4QJIA 1GTWA 2YWXA 4FHTA 1K3UB 2FPWA 4RTOA 1UBSB 2CNNA 3KRTA 1AV7A 5A9SB 3DG9A 4BXOB 3T7DA 2M7BA 2ECCA 3BJ6A 1XXHB 4BUCA 4YREA 3ERCA 3PQ8A 3QUAA 2OBFA 4YRNA 5IYZA 2F1JA 4OGLA 1MLDA 1SULA 4AIRA 1YMVA 5IXSA 2JCXA 3P2YA 3TRHA 4NYMQ 2FWBA 1EQ2A 2AN3A 3G0OA 2E48A 1ULAA 1DSSG 4RA9B 3WX0A 4E88A 5EXEA 4D4JA 2DPDA 4IQ0A 2JFYA 3P4YA 3VPBA 4KZPA 2PV0A 4KQCA 2WPDA 2ZJ6A 2QJPB 5FA8A 1QK5A 3K5IA 3C16C 2D8MA 4NYJR 5JFTA 2XBUA 1PW5A 1T9AA 4AUWA 4FFNA 5KYKA 3EC7A 2P2ZA 1V1JA 3EYWA 2IDMA 2ZB2A 2X14A 1SWVA 3E9YA 5CGZA 4Z4CA 1Q0HA 3B36A 3QYBA 3H1IJ 1YMUA 4EH1A 4DUZB 3RSGA 4EY5A 1KWGA 1V5IA 2FHSA 4HF2A 2JLZA 2JAXA 1C9EA 3GA7A 4ER5A 3K4NA 3AKYA 5F35A 2Q4EA 4IRHA 2YWJA 3FGOA 2J9FB 3ZQUA 1E2DA 1Z9CA 2VKQA 1JTVA 5CCHA 4GLOA 4OHZA 4ALIA 4KAAA 4DRZA 2CG4A 1K7CA 2PS3A 4DIUA 3ZDAA 2PUFA 1NLYA 3I9NA 2X19A 2XZRA 2ZYVX 1WFXA 4KEAA 2ISSD 5I4CA 2PPVA 3QG5A 1QP7A 4PZYA 1P2UA 4XSHA 4BFVA 4NC6A 5CH8A 4PX9A 4UUOA 1XZEA 4HAUA 5APYA 5THKA 1YQAA 1XRRA 3L7DA 4BPBA 2E76C 2VBFA 1I7QB 1VQLI 1ZM3A 5CDFA 2XUOA 3JALA 3NP7A 3RV3A 2C95A 3UMFA 2Q3EA 3UZUA 2VONA 4KQJA 4Y9SA 3SKVA 4YK7A 5CCXA 2GXSA 2LPMA 2X7JA 1AKEA 4NBVA 3NRCA 4C20A 1GZHB 3BJZA 3IEIA 1OYYA 5KNBA 4UZFA 3N4MA 1OA0A 2Y6VA 1HTTA 1C9YA 1FDMA 3FN4A 4GOOD 1PJBA 4ESVA 1G2QA 1RWPA 4AC9A 1RKVA 1HEUA 2XJ9A 3BGSA 1LBIA 5L4SA 4ENNA 3I76A 4WRRA 1FSEA 4DZTA 2AG8A 3WSVA 5KEIA 4PHTA 3F3KA 1Y7HA 1DUXC 4F7DA 3HTUA 3HD7B 3WIEA 4M9CA 2EW1A 3JS5A 3MTIA 1T1GA 2H1LA 2QVZX 1YBFA 1MMGA 1ENYA 2LF7A 1NMYA 4RKYA 1ODDA 5AOAA 1BL0A 4PYMA 3TG8A 5FKLA 1J5XA 3U59A 2O6LA 1EJBA 3RTDA 4K35A 4Q05A 3LC7O 3R5JA 1ZM2A 3H2BA 4D0NA 1MJ9A 3EIXA 3FVTA 2G82A 4MLDA 1PK9A 1ZOLA 2R7RA 3LQKA 5B55A 1L5ZA 1T34A 4WECA 3Q3SA 3AIIA 2CUEA 3IUJA 2H6BA 4WCFC 1UJ8A 3BICA 3G7NA 2HPIA 4Q3LA 2PXHA 3WDKA 3DZHA 3AVUA 4X65B 2NSHA 5FGMA 1PYGA 1ILEA 4QICA 2HF2A 1DFHA 4KXYA 2V6FA 5C1OA 1LQUA 3GW2A 5DHSA 4YDQA 2E1MC 2Q0QA 2GF2A 4QUAA 3PFWO 3B6ZA 3U44A 1CZQA 1CNMA 2CLDX 4ABTA 3TXAA 5FJIA 1GW3A 2YRXA 1KI2A 3EXIB 3NNDA 5E0KB 2AFHE 2G83A 3BDVA 2G6BA 3BGDA 1U65A 4BNIA 3TNJA 1O0CA 3GFOA 2WSYB 2OZLA 3NEYA 4UVCA 4E7JA 3OO0A 3UAXA 5TGTA 4ECEA 2WFZA 3CC2I 1WB5A 4D96A 2OWEA 3V2HA 3CMAP 3GLKA 1DU6A 1ZR4A 1SQ6A 3FCOA 2YXPX 3EK2A 4UMEA 2Y9YA 4F2GA 2ZB9A 3PM1A 3IAS2 1UXJA 3CUSA 2EZ9A 4U0YA 4F9EA 1RKXA 3ZQGA 4UTRA 2BV3A 3OJWA 2N46A 3JAWA 1DD4A 3RHSA 1F9AA 2YDYA 3QPCA 3ONNA 2PZBA 3B5ND 1IXYA 2NYVA 1HE4A 4KMMA 4URYR 2JA7J 1MMFB 3TEDA 3GRKA 4S3MA 4IIFA 1D2CA 4A1FA 2FJ0A 2BP7B 4UHCA 2A92A 5BWCA 2FBHA 3LSPA 1YNSA 2BAGA 1JFSA 4Y7CA 1GV0A 1XYYA 5EJFA 3P8CD 4RQBA 4H6WA 2VAXA 4TMZA 1K9MQ 3G9XA 1ZGAA 1ZMXA 1UKEA 3RC1A 1M2EA 5E3HA 1U1GA 1TO6A 3TD6A 3BTIA 3GF2A 3PUKA 2DR3A 4LQDA 1KO5A 3HZJA 4K28A 2O6HA 2PH1A 4CEIB 1L5LA 1V48A 1E17A 1KAOA 4UULA 3TN7A 4D1YA 1XAJA 2BGLA 2RKOA 1U3DA 1XTQA 3VU1A 2HO4A 3OV8A 3RK3C 4ZI5A 4NFHA 3R3JA 3GUHA 1EA7A 1TZBA 3FPBA 3RI4A 4YRBA 3UC5A 5EIEA 3I42A 3RYTC 2I03A 2X6TA 1W25A 1GK4A 3PLRA 1Z39A 4NDLA 2R11A 3BCRA 5AICA 1Z7GA 5KAIH 1PTKA 4Z4QA 4MW7A 2C07A 1MJNA 3GCGA 2B92A 3W5DA 3FWHA 4PW0A 1ZINA 4LJKA 3WWPA 2WPNA 4G1MB 2CLLB 2GD1O 1E4YA 2NNNA 4LXUA 4Y6SA 1YQDA 2VT2A 4GMDA 3AI2A 4HLCA 4FE7A 2FR8A 4UB8C 3H5WA 1Q19A 1CDOA 2NZWA 5EPOA 2EFQA 1HM5A 1J23A 5D00A 4EHNA 2WT7A 1CZNA 4C2UA 4JFAA 1QCCA 1BW6A 1JU4A 1PR5A 2P11A 5KVVA 4KG7A 1JEDA 3KSZO 2BDUA 2R1VB 1KZ7B 3K4MA 3VGJA 3AYXB 2RJ3A 3DQVC 3PPVA 2UXCB 2NLOA 4KUHA 4R8HA 3LWZA 4IPAA 1NQUA 1TT5A 3LPNA 5AXCA 1LFDB 1H6CA 4RLQA 4MRAA 4QECA 1POGA 4FMCF 1M3SA 3ZJYA 3S2WA 3IP1A 2AEMA 2LY9A 2OCXA 1ZA1A 1H9GA 5TMEA 4DDUA 1YWGO 3QE9Y 1KH2A 2QTWB 3SPXA 2F59A 4ZZ2A 2EP5A 3I01M 1IBSA 5JAOA 3I37X 3MJEA 2O8BA 1VQ4P 4XGIA 3MELA 3H36A 3LK6A 3GH3A 1DRWA 1A7JA 3HHGA 3ZIUA 4GP7A 1HFKA 2I3AA 3LT0A 4RV5A 2EQ5A 1ADJA 2DPHA 3DE1X 2AA3A 1SBCA 4PBSA 1L0LG 1SUPA 2HV8A 3LDGA 2NTNA 5JRDS 1RR8C 3R0JA 4MZXA 1C3VA 3HNRA 1UAAA 6PAXA 4UTOA 2BSAA 4HWKA 2HU9A 3JZMA 1MO5A 1GT6A 5F1RA 2DMPA 4DIEA 2J3HA 1G2PA 5EEGA 3FTCA 3NHUA 4ZOLA 3ILSA 3EETA 1JYEA 3O1IC 1PP8F 1RYDA 4Y1RB 2XMBA 4RPHA 2QVYX 4Q15A 3LGXA 3TSWA 3V8PA 3F2IA 4WBXC 3MKZA 1QWSA 2IY9A 3ZRGA 1E92A 1QQ6A 2P7JA 1QORA 1P1JA 4I2VA 2ZBRA 3ZWWA 1E6WA 4TKZA 4GH5A 4M53A 4HI0E 1IZYA 1JQEA 2GARA 4FBGA 4BU0A 3OY2A 4JHLA 4PXAA 3ABVC 4BY9E 4BNNA 3DU6A 4A92A 3L71D 5B30A 3KVNA 5ANRB 2XMQA 3FNQA 2TMYA 4ESHA 1KB9H 1T5HX 5J9FA 3A6ZA 3WWYA 5ARDA 5BT8A 2GTIA 2J9RA 4TZTA 2FFQA 7AT1A 1TIBA 3R9XA 2DWUA 1EX6A 3R8FA 4JOSA 5COQA 3MTUE 1V7ZA 3OIOA 2J7PA 3AZOA 1PR2A 1E4OA 3GOHA 5TRDA 4ZJUA 3A8TA 3LPAA 3SXUA 3QV1A 1Q2NA 2X4GA 5IZ4A 4HAOA 4B4VA 4Z1MH 2OEPA 3DCYA 3ZH9B 5EUMA 2CLEB 4PNZA 3UW1A 4EHKA 4H0CA 4LZOA 3NQ41 3CO0S 4HGYA 6GPBA 3L7WA 2XUPA 3HDVA 5D8KB 1U9YA 5HKOA 3FH0A 1E8MA 1RJ9B 1TXGA 5LRRA 2D59A 3ZUPA 3KTDA 2ZSDA 4HGPA 1SU6A 4Q9IA 1CQPA 3HLYA 4Y99C 2PMCA 4JL6A 4BNJA 3F5HA 3RFCA 1A9PA 4PY2A 3D6UA 4DG5A 2ETXA 1Q7TA 2V7WA 3ND9A 3LCCA 1TJ5A 1V16A 1IF1A 1Y8QA 4H3KB 3GZNA 5JLWA 1UQUA 5KLIC 1S02A 2BTOA 1N2ZA 2BISA 3CPHA 1TOAA 4MGRA 1YRBA 4E09A 1CI6B 1AU9A 3BSSA 4ASNA 1UPFA 3HR8A 1T8ZA 2HNKA 3MRTA 4BWNA 2HMSA 4PPNA 1DAHA 5L8RJ 2R84A 4P4LA 4QREA 4DZZA 5J3LA 1G3IA 2GWRA 3G7UA 4ID3A 5AVRB 5ITWA 3GXOA 1PEKE 2GVDC 3ST7A 3W78A 4KE9A 1NOHA 1OW3B 1UKBA 5KAFH 4BBRJ 3GUUA 5F3RA 1E2EA 1WSWA 1I4EB 1VF5D 1QO0D 2ZJ1A 1FXSA 3W5CA 4M9XA 4JLUA 3ANMA 1QAMA 4LF4B 3ZCPA 4E11A 1IXKA 3KZKA 1SCBA 2R7NA 3RKXA 3G2BA 1FJKA 2VKVA 1FLDA 2NX2A 2IK8A 1V1RA 5EDNA 4A2PA 2D2VA 3U56A 3W5SA 2J3DA 4BE0A 1HDPA 3MBKA 4IHVA 3BMNA 3OU6A 1GXPA 1PZXA 1AK2A 5JS8A 1GA6A 3A1CA 4TV9F 5AIQA 3W5HA 3E4DA 4TTPA 4UEJA 3RFVA 4DXHA 2C9YA 4ETIA 4QOFA 5SZHB 2IS6A 2YBDA 2PWZA 3MGNA 1YB6A 3FYHA 4KKXB 1IHYA 1ZBQA 3PU6A 1OR7A 1AKTA 4B7CA 2J08A 3HB5X 4BN4A 2D62A 2I2XB 1DQZA 4PIPA 1N73A 2OZUA 3CZCA 4GYWA 4MDEA 2Z6QA 3R74A 2BDTA 3C4QA 2NNWB 4M9SA 3OTGA 3BHJA 3V1MA 1VQPP 3FPCA 4BLPA 4AYWA 1GU5A 1M2OA 3G0GA 3EWIA 1T1EA 1KU6A 5D6OA 4N4NB 4BNTA 2QEXI 5JATA 4R9SA 3BTJA 1U0EA 5SZKB 4A6PA 1NTZD 4XR9A 3FMRA 4YTPC 1BQEA 1MJGA 2PZJA 2DTRA 1S3JA 1XTGB 1MFZA 4D3ZA 3OURA 2FYUD 1PEDA 3JCZA 3CWCA 4H6VA 2Z5IA 1CD5A 2NAPA 2UVPB 2JCGA 5CA1B 1BW9B 3FA2A 3KZYA 4CKXA 1CF9A 2BBSA 3J80K 1VM6A 4LZPA 5F7ZA 1RQRA 3KP7A 1GL9B 5JAQA 2HXYA 4NQWA 4BECA 4YONB 4EO4A 5AVKA 4A2WA 3JVIA 3W34A 1XU7A 1T95A 3E0JB 4JLJA 3K2BA 4Q1VA 3E7DA 1E3WB 2ZRIA 3KWLA 4EVSA 2XGOA 3C6XA 2Y0CA 2WI8A 1QZXA 2G0TA 3BXGA 4WXPA 5B3JA 1CR4A 1P4WA 2F43B 2GK3A 1QR2A 3MWKA 4ZVOA 2JBWA 4HT3B 3K1NA 3HA2A 1CEYA 3RK2D 5LBIA 4Y52J 4ADSG 1R3DA 5DLPA 1VE5A 1FUYB 1EVZA 2XDQB 1GL2D 1ZGZA 2EW8A 1ZOSA 1ZMOA 4CF3A 5AI9A 2I2AA 1ZQ1A 4N78D 1CR0A 2XCQA 4P6VF 2JTVA 2YXNA 3HFRA 4R5MA 5P21A 3THYA 4RGVA 3RF7A 2LV8A 1JEAA 5EZYA 4C0WA 1JT6A 1E9DA 4K7JA 3CDHA 3LDFA 2PE5A 4XOPA 4B2LA 2AZTA 5FLXK 1XA0A 4BVJA 5A4MS 3I9V1 4ZTJA 2B2CA 2GESA 2E2JJ 2FSIA 3MS2A 4ZQGA 1LSJA 1BYUA 3ZY3A 2FPRA 3DBHA 2J59M 1LTIC 2M4GA 3C74A 1Q3TA 2CMKA 1B6RA 5SZJA 3VDQA 4QGHA 2OLEA 1IC8A 4QPZA 2VZ0A 3SICE 1CWUA 2QQ8A 1OFUA 3C43A 4K3UA 4ES6A 1AHIA 2JB9A 3OZGA 4Z0TA 3NB0A 1EGMB 2ZU0C 1Z2EA 5E1WA 1X0VA 2WICA 3N75A 1I3KA 3WQBA 1WTCA 4HEJA 2CXRA 5KQGA 1GFIA 1R2QA 1SQBK 4K9MA 3G0CA 4MEBA 1VIVA 1O89A 3ZD9A 3OYHA 2WU8A 3GBSA 3NBQA 1L8OA 1I7NA 1PWZA 2UXDB 4A5NA 1LH0A 5BW5A 2QJYC 3N9IA 2AN9A 4WDRA 3RRBA 1XSXA 1KMQA 1OWAA 4G2TA 5I8ZA 4TWJA 4A8TA 3IV6A 1F6WA 4MJLA 5LU9A 4IJWA 3A7DA 2FF4A 5FOVA 4CT0A 1TYCA 3HI6A 1YZFA 3P8ZA 3JATA 2IUUA 3OYCA 1EIWA 4FVTA 2RGNA 1SQPK 2ZJ5A 1Z6TA 3QVMA 3V9PA 2BZTA 1J1ZA 3FXKA 3V4GA 1MPXA 1SIUA 2VH1A 2XMSA 3KQVA 1IH8A 1UANA 2HOAA 3T1BA 1ORHA 3TTSA 2C9MA 1HE3A 5JAMA 3NBAA 3LL4A 4M46A 3S1AA 2FPGA 4TRMA 3A3PA 1PP4A 2QT1A 3QOXA 1EKXA 121PA 3TRJA 1ZRHA 4FWIB 5JC1A 4OHCA 1GR1A 1E6EA 3LP6A 3A4NA 521PA 3CXHE 1FQJA 2EW2A 3VSAA 3L7OA 4Z9BA 1RWMA 4OJTA 3LVFO 2Q8QA 3OQIB 2CHUA 4U2KA 5LP6A 1X80B 1DCFA 2P9YA 1RBMA 1N3YA 4DW6A 3QVSA 2L7MP 1ZMBA 3S28A 3I9V2 4OGQD 3BULA 3DZDA 1KDTA 4CMEA 5DYNA 4NE7A 3A31A 3GQBA 1GDDA 3CD6P 4G6TB 2FUG6 1YRYE 3HOWJ 3GZ4A 2IW3A 4AKTA 1EGQA 3KCCA 2VQ3A 4NCAA 4AXXA 3K9NA 3ZWYA 4LQLA 4RFSA 5C4JJ 2IBZE 2P6NA 4IHTA 3VOPA 2J3QA 2HFHA 4ZZIA 3ZR8X 4RORA 3MB8A 2Z5UA 5AVVA 4Z7JA 1R1DA 5KAIE 5I7EA 5F76A 4D9NA 4UU1A 1YB1A 3D8RA 5AW3A 3TOXA 3GLQA 1YX5A 2VJ5A 2R5YA 4NCHA 3OP1A 1TU0A 3FUCA 4KFCA 4BNDB 4ZYWA 1IHDA 1NNEA 1T3JA 1YULA 1OWLA 5AK4A 1SBHA 2X5KO 3DE5X 3CCJI 3JSVC 2LWIA 1NVVQ 4G89A 4W5HA 2JASA 1FAVA 3VPCA 2NS7A 2BI4A 3KYCA 4YQYA 2O2YA 4CNBA 3OHSX 3DE6X 3C3MA 3ZW9A 2MDTA 1LBQA 4RS4A 2HQOA 3Q0IA 4HXGA 4JBWA 4PC6A 1U81A 1LY1A 2OO5C 3I09A 4BHBA 2GXGA 2H16A 5EXSA 2YXBA 4XD7D 5E9QA 4A0SA 3G89A 4MV7A 4CUJA 1M8KA 2AD5A 2HEIA 1A98A 4QELA 5F73A 4YAKA 5IANA 3ODGA 3L4BA 3OO1A 2A1UB 2HSZA 3EZYA 4E1AA 1YRAA 5A0VA 3GJZA 1WM1A 3KSBC 3OM9A 4OH7A 3GARA 3CL3D 3HMQA 4TTVA 4UXNA 5AVZA 4CM6A 1N0WA 3RBAA 1GU7A 3COYA 3AMVA 3JZDA 2OAP1 3WBKA 1CIVA 3SEFA 2JEOA 4BWGA 4UEOA 5BORA 1UMQA 5JXIA 1RC8A 4ND5A 3B7PA 3G3EA 2A9JA 2ZEJA 3NWTA 4LXXA 4LWPA 1TGYA 2AN1A 3QPVA 3KZMA 1QO7A 5I45A 1D03A 4OK3A 2BGCA 3JQ8A 1TLTA 1H1LB 2HLHA 3P2EA 4TQAA 4BASA 4BBPA 2WF9A 4EKYA 1G42A 3GLVA 3CZMA 2VP9A 2MU1A 1TT0A 5FPQA 4Y9RA 3L9WA 1T3SA 3ZGLA 4JXXA 1O95D 2ORVA 2J3IA 5KOHB 4JZKA 4DMLA 3NS7A 4P3OA 4A3MJ 3U5TA 4ENKA 1YSCA 3GEPA 1YJ9I 2C9LY 3N86A 3NHJA 1BCCJ 1A9TA 1VYVA 2TDXA 3AVYA 4MUFA 2OHVA 3PS9A 1QIGA 3ZDQA 3TTWA 1JKPC 3GT7A 3U6KA 1MB3A 1YR7A 4IG4A 2ZUVA 1JS1X 1PT7A 3AP3A 2ADOA 4KHPB 1VG0B 2YXLA 4OCZA 2XSJC 3FBTA 3KHTA 3EF3A 2I71A 3A9UA 2VP2A 1FJ2A 2DC1A 2A69F 1BWQA 3GGJA 3PB3A 5K20A 4ZU1X 3BB1A 4QIHA 5IC6A 4C0SA 2ORWA 2E5FA 5BSWA 1VDMA 4WBNB 3FB4A 1O5OA 1HRDA 4AG6A 4OGGA 1UP6A 5JPCA 4PNHA 1J1UA 4J01A 1LE8A 3IQFA 3VUEA 4KAFA 1YDGA 1CG6A 5LGTA 3O6QA 1KB9E 1SCAA 5EIXA 3CMMA 3FR8A 1AQLA 2P9CA 4FQGA 3RU7A 4P2GA 821PA 2RH4A 4HNUA 1HK7A 3AF2A 3M6LA 4O0MA 3AEQA 1JG2A 2UZ3A 2LIPA 2QQEA 2YQ4A 2BH2A 3HJUA 3ROTA 2IYYA 1KJNA 3INTA 1M6NA 5A9RA 2HSEA 2C8JA 4NH0A 1WE2A 4UUQA 3UOWA 3FDZB 4QHSA 5F27A 1N1EA 4W5QA 4GGPA 3HYLA 4GM0A 4NCKA 3HO8A 3G88A 2Q21A 1NTKK 3NBKA 4C29A 1CS0A 1SAUA 3JQEA 3ZXYA 3BX1A 1X7XA 3FDXA 4WLEA 2XRMA 4LOCA 3HIFA 5HS6A 3URKA 2NW6A 2M32A 1CZUA 3MQ4A 1XTAA 1RIFA 3VR4H 3DBLA 1FL9A 1XLUA 3W3AH 2WU0A 3W2HA 1W4MA 3ROKA 1XZ8A 5MFPA 5F7OA 5L9AA 2PGNA 2WY8Q 4LDRA 1RCTE 3BXZA 2N1TC 4Q66C 4K6HA 1XZCA 3K70D 1U7TA 2JD1A 3VU8A 3H9BA 1EDLA 4HYQA 1HORA 3KP1A 2H85A 4D3XA 2PZGA 2BY2A 4FI3F 2QZPA 2OHOA 2LKPA 1ZXGA 1MGOA 3RG2A 4BXFA 1ZSYA 3H2IA 4UM9B 3G1MA 2EFEB 3E7PA 1I2MA 3EEFA 2P0EA 2FN4A 4DIDA 1S89A 2WA0A 4Z7OB 3GC6A 1IOLA 4RHEA 3ND6A 5JCOA 1B6GA 2MKVA 4QHTA 4BRZA 3E8MA 3EPLA 2WUWE 2L4AA 5H68A 4IFTA 4L08A 4M21A 3C2BA 3MMXA 1UAYA 5JJBA 13PKA 2NYRA 4XH9B 2JIQA 5HQJA 2J5XA 4EPXA 3T5XA 1VQ8P 4ZRNA 3RCBA 1S2IA 2FCAA 3ES9A 4H4EA 1FVHA 3E7LA 3RIMA 2HXSA 4BY1J 1EDOA 4IQ4A 2IPMA 3LPMA 3BR5A 5KQMA 1CR6A 3UUEA 3I4LA 2C7GA 4RA6A 3MWFA 5CDSA 5BNGA 1CU1A 4NBKA 1NE7A 2IY7A 3EDRA 4H17A 2BEVB 1MGPA 4PLHA 2KBFA 5DU2A 4X94A 1YJWI 3EXHB 2F8MA 1KYVA 3KR0A 3T9BA 1UPAA 3R6DA 5C8DA 4B3MB 1BGYE 2VJDA 1WQ3A 5AT1A 4XKJA 4PHFA 3D7MA 4C5CA 5B2EA 2EBWA 2Q99A 3HUUA 5HG0A 1N3BA 3AFGA 3HE5A 2CD7A 1P4XA 1NJFA 3V4ZA 1O5IA 3KOYA 3LS2A 1HTLC 3C5EA 2OBPA 1X9IA 4JF7A 1U3CA 1D5YA 5KVCA 2OV6A 2PUTA 1P7VA 3UM9A 4BH9A 4KXWA 2FN9A 2FZ4A 4JYPA 4ESBA 4RPIA 3FOZA 1O8CA 4P22A 1TCCA 2XXAA 1SG6A 1LBHA 3SJMA 4ZO4A 1BI3A 2BI7A 1Z1DA 1SXHA 2X9QA 1OMIA 3KYJB 5FRNA 5FPSA 5SYMA 2Q3IA 3VPRA 1JIIA 2K88A 1RRCA 3AKDA 5DNAA 1Y98A 1R0KA 2ATIA 1V4RA 3GQVA 1KI1A 1KQPA 3N2LA 4CNQA 4ESOA 1OD6A 1V6AA 1AQJA 5DI3A 4CEJA 1U6GA 4X66B 2UUAB 2BCCD 1XTRA 1H3FA 3PSIA 2IBSA 4JASB 3KC2A 4MS3A 2Y30A 4UCWA 3JD3A 4UVHA 5TDHA 1FYFA 1N6OA 5K0NA 2PUVA 4JBNA 4FYKA 4NYJQ 1P1CA 5T8KA 1OHHD 4QLCU 1FTGA 3B3JA 2VQGA 3RSNA 1NI4B 1LNZA 1DKUA 1LWNA 1WRJA 1R4NA 2DX7A 4TLFA 4TYMA 2QSHX 1TUEA 1UOQA 5CFPA 3GHGB 2Q4OA 5G1NA 1T4CA 2VK4A 1P61B 4YBZA 3GK3A 1RADA 3MFKA 2PY6A 1QQ5A 3OWOA 2VJMA 3KKZA 1KZYC 2ERXA 1FFHA 2IV3A 1YVRA 4OIOF 5JAZA 4HEA6 2RHHA 2H3HA 1LJ9A 4LOHA 3FNRA 4BXUA 3NANA 2VIXA 1X7ZB 5I9LA 3BYZA 2OHGA 2XAGA 2PLFA 2AQEA 2M34A 1T1SA 5G41A 3BM5A 2HLDD 2IGTA 4X62B 3RSCA 3WKEA 4PSAA 4ZEOA 4CGYA 3BE8A 5AVXB 3DFKA 5BVZA 2R87A 2JAHA 3LUJA 2P2LA 2QMOA 4U0WA 1R9MA 3F9CA 4Z0NA 5M5BA 3ZC3A 3W9SA 4GBED 1IFMA 5IM4A 5KAIC 1UFOA 1OC4A 2CXTA 3B2QA 4G5QA 3TE6A 1RKQA 3A2NA 1SU8A 3P4XA 3LZCA 5EIBD 2X8LA 2G08A 1UUFA 4HCJA 4I3HA 3DXXA 2RC4A 4HAVA 4J49A 1P0FA 4Q00A 5H9WA 4DJFC 2YHBA 1A95A 3TVTA 2O8NA 2KNCA 4B6GA 3EUKL 1Y3AA 3STUA 2CLSA 5F1JA 4A3DJ 4DPLA 3FIUA 4F1WA 1U5BB 1U4NA 1UJMA 4DA4A 3VC2A 3NKLA 2XSZA 1X7WA 3MM4A 3S8PA 1GTVA 4M7RA 1W7PD 1CQWA 1DS6A 3H92A 1YI0A 3VOBA 5CXXA 2IPOA 4WNAB 4CZ2A 2J6CA 3F47A 4URXR 2IE8A 4F4UA 3EZXA 5TEVA 1UQRA 3O2NA 1PPJD 1KQFB 5EERA 4JB3A 4XLFA 1H0KA 3QYAA 1XZFA 4RABA 2YZ2A 1D4OA 4RZUA 1DPFA 1Z5OA 4DDWA 3A3NA 3R77A 2FX5A 4U7HA 4B3AA 1XP5A 4P08A 2Q1ZB 3CF0A 2J5KA 3A32A 2Z6UA 3DLTA 4C76A 4N76A 1PV1A 1DQYA 3DV2A 3CF2A 4X00A 4X71A 4LIUA 1PR1A 2GM9A 5KX5B 4K87A 3VKGA 1M6VB 1FDVA 4E1VA 2Q3JA 4LJ7A 4A5OA 2PBFA 4M0CA 3Q6IA 4BAGA 1Z47A 4UUBA 5D5QA 4IOLA 1SQVK 2A3RA 2A3SA 1Z9BA 5FUYA 3FCAA 1HQYE 4C04A 1M0EA 2D5LA 1P6QA 1RFGE 2VHXA 3QPHA 1F2UB 5CA0B 3PFNA 1SXPA 2BVNA 1MZPA 1H66A 2CFXA 3R76A 4A6EA 1NU1D 3OA0A 2A78A 2E0IA 3BPXA 2VL7A 1QNFA 1QVFO 4XRGA 3SXYA 4A3FJ 2JFZA 2FMXA 4Y0VA 2ZETA 4MYDA 2WSFJ 4YV7A 5FLEX 3F1KA 2YXDA 2ZSHA 3E84A 1IW7F 1BJKA 1U4OA 5F3WB 3KOMA 1MBKA 2J9ZB 4QUDA 4RGSA 5IXYA 1YZNA 2OGSA 2ORED 2P6RA 4HNSA 1NLZA 4ZP1A 1M2VA 4X7RA 4K2EA 3LP8A 2VYVD 3K5PA 1C1HA 5HPYB 1TB4A 4EVQA 1EK5A 1T4GA 3A0UA 1U8UA 2RCYA 4CEHB 4C0BA 2WAQN 4H31A 2LRHA 4XQ0A 4ALKA 5CA1F 1IWPB 4ZH4F 4UZSA 2OENG 3MIIA 4F93B 2JUGA 1VZ2A 1YC2A 3ZGKA 1MBJA 1PJLA 3W2TA 1JA1A 2JARA 1T9HA 4FEEA 1HLFA 1FLNA 2C5HA 4MUYA 3TGPA 2G1AA 2K37A 3LYAA 4NC8A 2LIVA 3QTLA 2JLBA 4ZK6A 4BL5A 3AUSA 3R24A 5E1XA 3NRBA 5DM60 1DDOA 1VL1A 4LHZA 4H13B 5LEJA 1H3NA 1I01A 2XF8A 4LJSA 1I27A 4NMMA 3Q9NA 3EUWA 1WP9A 3DUFB 2XT6A 3ACBA 3S2ZA 3FPEA 1QXSA 1Y80A 4D9JA 2HA6A 4CYDA 1G64A 4P82A 5H16A 1N2DC 5BVHB 2J0SA 3MYRA 3AV3A 1FU7A 3MWGA 1AVOA 1R6UA 1Z4OA 1AGRA 4YAIA 1F0NA 1YS4A 4EY3A 1BYIA 2WJIA 1LPQA 3FZYA 1KAGA 2V5AA 5K05A 1V0JA 4IFIA 4ENVA 1XHEA 5M29A 2O8DA 1YLFA 2X1CA 1BGXT 5IDQA 2VJNA 2HNBA 4PAQA 1NH4A 2PO5A 2EBIA 3AR9A 2QORA 5CMLA 2F8LA 3QLVC 3COVA 4KRFA 1Z0UA 3CN7A 4P4NA 3NV9A 1U5TB 5EP2A 3B3AA 2G25A 3FF1A 3VEPA 4GMXA 1KEEB 4DCOA 4RVNA 1X1PA 4DLTA 3EQZA 1SZDA 2VQLA 4JLWA 2TMDA 1D0ZA 4R4JA 3F8NA 4NU8X 2R5WA 2EF1A 4AF6A 5KAFC 2YS7A 4L15A 4BU1A 4QEDA 2GOYA 4OLAA 3DAPA 2YNYA 4H77A 4UNNA 3TL2A 3PNYA 3JD1A 4OTZA 3GVAA 2DEUA 1FFSA 3AFOA 2V6CA 2Y2VA 1SFEA 5E8GA 4YHBA 1CF7B 4DDTA 2HRBA 4UUNA 3KZIH 1VKOA 4DG8A 2ZUEA 3DKIA 2HWVA 4GI2A 2IH2A 3JRWA 3TPZA 1VE3A 4I55A 4GXTA 2BMDA 1NY5A 3R8XA 4JENA 2ECPA 2Y0SN 3FM5A 4DV3B 4YP9A 4EYEA 1CUHA 4XZ3A 1CC1S 5GMOA 4B46A 3DOUA 3Q5RA 2ZUDA 3C3PA 5CNMA 1G8JA 2SKEA 1S5PA 4YRIA 2W5UA 1PJ4A 2VF2A 2P6PA 3SYTA 1LDGA 2JLWA 4IMIB 5L3SB 5J2TB 3IELA 1M9NA 5AOBA 2WSSD 3RVOA 2WUVA 4WZAB 5HX7A 2OTKE 4LA4A 4LX8A 4I50F 3L71G 5MGNA 1T8SA 4TZ0A 5LHGA 9ATCA 3HSFA 2FN8A 3LCJA 1TZMA 3E7XA 4JYCA 2GCOB 4ESJA 5KLVK 1ZI9A 2WKRA 2NTJA 4UTNA 2JJ2D 5IP7J 2CE7A 4DVGA 4DLPA 3M0DC 1OBOA 3JRDA 1J24A 4MUXA 3O83A 3HY3A 2YY7A 2HA3A 2A5DA 2RHBA 3W68A 1P84I 2ANBA 2VJOA 3T7IA 2CNDA 4BZPA 5LIRA 1P73A 3DVAB 5DCWA 2QRZA 1N34B 4XQGA 3ASNH 3ONDA 4PG7A 4DIKA 2YYAA 3CKLA 2VPZA 1IC2A 2BFNA 1TBXA 2AKYA 4MLCA 3FSEA 3LV8A 3IOMA 5HIMA 1DX6A 1TJ4A 4PC2A 2I4NA 2VP4A 2PBLA 3QU7A 4QOJA 2JBAA 4V0SA 4EYOA 4OUKX 2HJWA 3HBJA 1P1KA 4GSLA 3A4LA 4KX5A 3CCSP 3JRXA 4AU1A 2Y93A 5REQB 2IP2A 2OCIA 4NV1A 3IVMA 4GDFA 4Y0NA 3AW9A 1GG5A 4A0ZA 3PRKE 5BWMA 4QATA 3I9MA 3D2AA 3H1ID 2QR5A 1FFEA 4WQMA 3SSOA 3RFFA 3MIZA 4IRXA 1WXHA 2NVQJ 2EKLA 4PSVA 5F1YA 4PJ0H 4MNTA 4LJRA 3H0GJ 1GL2B 1CV2A 4DAEA 1LLDA 1C1XA 4AYXA 2EJRA 1SVUA 2D5AA 4CMIB 4M1ZA 1LPAB 3PT5A 4R81A 3M1EA 3A11A 1S1MA 1URQD 2Z1NA 4G7OF 2C78A 3L0BA 4XWOA 1O3SA 1A5SB 1K5DA 2IA2A 2KS1B 3JD0A 2OPHA 3MPUA 3DONA 2G7HA 1OLXB 3Q8WA 3DKXA 3UFXA 2JRTA 1QVVA 3Q72A 1SC4A 1CDZA 4E2WA 3HV0A 4FXPA 2L19A 4UEQA 3NDBB 3TR5A 2K9YA 1EK6A 4TXJA 4IXWA 4DG9A 3LQFA 3IAS1 1H0TB 3LOPA 3TJMA 1IONA 1RMQA 4HUQB 2VP5A 4B3TB 3NGXA 3MVPA 4AMGA 3ROGA 1L0NE 3Q3IA 4RSHA 4WVFA 1DHRA 2R8ZA 3D8SA 1HSJA 3HPRA 4ZT7A 3LY9A 1JDBB 2PS9A 3TL3A 3R41A 4U3JA 1NIPA 4GLBA 3CY6A 3ZI7A 2NZVG 2UXBB 3MN1A 3CR8A 2ZGVA 2YPRA 1OILA 1I1GA 4HLQB 4NU6A 3E9QA 5HIAA 4FE4A 4FR2A 2R8YA 4IHQA 1D5WA 1Q84A 1ZU5A 4F7ZA 4OGFA 1UFQA 1WS6A 4UNQA 3O84A 4YRCA 4NG5A 5F9FA 3AE3C 1R8SA 1FQWA 4KPEC 1H8AC 4F3KA 3W8FA 4K2HA 2GD6A 3SOPA 1GPKA 5I3CA 4FKZA 2XVXA 1VE6A 4Q4AB 2SKCA 2BFWA 3GCDA 4ZVVA 2MABA 2P1RA 4DZRA 4RC9A 3BZWA 4P3YA 4M8IA 2POHA 1HG1A 4S24A 2AC4A 5DXAA 2LC2A 4F8JA 4KUMA 2CSOA 2FYUG 4KYVA 3WLOA 4EAAA 4EGYA 1HTBA 3HMKA 4E07A 3LQ4A 2QU8A 4H4CA 2Y3IA 2EJBA 1OXTA 1GV1A 5APTA 2JGNA 3EFFK 1G66A 1Y7TA 1TUBB 3RE1A 1ZUNB 2VTBB 3NBUA 1BSNA 4CI0B 2PX8A 1P80A 3SLGA 1TVKA 3K8ZA 4XDYA 3D0KA 3NYQA 4HNVA 2QW0X 4NJMB 3CJTA 2HTFA 1N75A 4WBNF 5EZ6B 3F8FA 4RLSA 3H35A 5F0FA 2H4HA 2J9XB 3IC5A 4M86A 4OGQB 5IKMA 3TNUB 3DMNA 1K88A 4MV4A 5K2OA 3IAEA 2RB4A 3JU3A 3RT1A 3LPLA 5B6IA 4HS4A 3H5OA 1SXJB 5AVOA 4LYJA 1JR3E 4HLYA 2P2NA 2JAUA 3RKUA 1G21B 1ONOA 1RNLA 1NGSA 1OFCX 1NP3A 2UU9B 4R2JA 1HYEA 1OTXA 3FHCB 4P7BA 3SBXA 5FB3A 1JDPA 3SR4A 5KSPA 4IDFA 2F2EA 3KM0A 4X1YB 2WYIA 1HYBA 2SICE 5BV7A 2Z3WA 3EVNA 4YY3B 2LD5A 2HI0A 1P2DA 2AO9A 2EERA 2LDXA 4YAFA 3FOAA 3KUKA 1JFVA 2NUBA 4U6QA 4DL9A 3C6ZA 1HLVA 2PMWB 1WV0A 3QPUA 5JNUA 5ALKA 5G3ZA 1OFIA 1G20E 3OIYA 5FORA 3U19A 4E22A 4HVCA 3AJRA 1VKRA 5DSXA 2H5LA 4BJ6C 1KYIA 3O8HA 4EJSB 3VOTA 3CT6A 3H2SA 3SX0A 4WV3A 4RX1A 4EJMA 4MQ9F 2BY1A 4P4GA 3X0DA 5K0TA 3CURA 5H2FH 4TL7A 3J81A 2Q9BA 4BMVA 2Q6LA 4KAJA 3VTZA 1ACJA 1ZA2A 3K4QA 5HMMA 2PLWA 5DWDA 1E4VA 2Q45A 3D7KA 4XKVA 3E58A 5ARCA 3AHGA 4MK4A 4GHWA 3H9GA 3IB6A 4GR9A 4RCYA 3S1MJ 3S16J 2QVOA 3P7MA 2K5UA 3AZPA 2XKPA 4EZIA 2CEKA 3H1LE 1KILD 4Q4HB 1VKZA 2B3DA 2XBMA 4FEAA 4IQGA 3UGQA 2ZXEA 1RI4A 1M83A 5C1BA 4Z3OA 4KACA 4IZ6A 3FKSD 3VMAA 1WB4A 3MWMA 5CQEA 4HDMA 4US0R 4RK5A 2QDKA 3DQQA 1EDZA 4ONEA 3P9RA 1COZA 5EHIA 3FHLA 4IDDA 4H4DA 5G02A 2XTAA 4M7OA 1NBOA 4FQ7A 3ZX5A 1CUXA 3IPAA 3AXTA 4BEJA 1XU9A 5JBIA 2VYCA 1PV4A 2HHCA 5DLDA 3B8EA 4UVGA 1PJ2A 3EXEB 1U7DA 1WJFA 1M1JB 3DZKA 3S6JA 2GB4A 1KYOH 4TROA 3VV3A 4NARA 1OLSB 1VLMA 1BDHA 2G9WA 5ALMA 4E51A 2QW1A 3G5UA 3C6BA 3I3SR 3ABLH 1XCJA 1BE3J 1P81A 3UMBA 3GG2A 4J0IA 2IYSA 1A9QA 3M1YA 3R5SA 3E5RA 3ELDA 3LWFA 1X9GA 1NHLA 4MVJH 1TM5E 3TZKA 1LBTA 1EX9A 2ONJA 3HYNA 1XO1A 3VP9A 3DO8A 1CTQA 1V4VA 3UT5A 3HNPA 3H9UA 2Q5QA 3PRYA 3VR6H 5HYVA 5E4FA 4D0PA 4BQOA 3WHPA 2NACA 4E5KA 1L8LA 4DIOA 1MOSA 2JRCA 2IYPA 1XJ0A 1DBQA 3N28A 2GXQA 3DGEC 5APXA 4N6JA 3EQLF 3WSTA 2HDOA 1LUJB 3GHHA 3T35A 2AUNA 2BN4A 3VO8A 3B89A 2GILA 5ADVA 2R96A 2VJPA 1RJFA 5F1KA 4ZEWA 3OT1B 4E5YA 3OLVA 4M87A 2JZCA 1RAAA 1OF1A 2EBHX 4UM7A 1Y56A 3AERA 4LY6A 4N9HA 4MKIA 2AFIB 3RUPA 3PXDA 2WPSA 1YRQA 3BL8A 4HUTA 3LWDA 3FPFA 3ZCOA 1Y34E 4UASA 2AG6A 4P80A 2UXXA 2WU4A 1Z33A 4Z7NB 2P3LA 4TN5A 2XB4A 3FPAA 4DY6A 4O2AA 1X6VA 4NPAA 1V55H 2LVSA 4H08A 2VJJA 3DPTA 2XLBA 3P94A 5JFOA 2O61A 5D6NA 2ZFCA 4LSWA 2MD0A 1M34B 1JECA 3DC7A 1DQUA 1JUDA 1O97D 2H57A 2YRFA 1FMFA 3K70B 4WKGA 4MUBA 1Q0LA 1T1RA 5JJCA 3MD2A 4C4RA 5I9BA 2G6TA 1GL3A 2IZ6A 1D1PA 4BQIA 4LQCA 1CJUC 2ZZNA 3VYSB 2NU7B 3O26A 2LD4A 4ZA2A 1LGHB 3X3HA 2OO3A 3C3WA 2ZUCA 1UAGA 1PS0A 5H0IA 2B5OA 1KU7A 1V7PC 5AKXA 3S2IA 5K8CA 4UVEA 5J58A 4I98B 1PZHA 1U3TA 1VSBA 4H0LD 3IV7A 1WBDA 5KJCA 2EZ8A 4BGIA 1QTIA 4N41A 4KLZA 5KDLA 1IDN1 3GLHB 2PYDA 3U21A 3KKMA 4D8UA 4YP0A 4BB0A 2WWIA 3VYWA 4DCCA 2HH9A 5JJLA 2WU3A 4WH0A 2CE2X 3G3ZA 2F1OA 1SU4A 3AH8A 3LBAA 2DFKB 4OX9B 2WG2A 1W8IA 1E0KA 4V39A 1GCOA 3TSZA 4UW9A 2WG1A 5DE3A 1M1YA 4YWJA 2JJYA 3LVBA 2ZB8A 5LLQA 3KZXA 2XLCA 4X1IB 3AIKA 3S2FA 1QDEA 4PAMA 1VYTA 2ZJSE 1K66A 4Q03A 1QJ4A 5CEEA 2ASVA 4RANA 3CLSC 1KDYA 5KPDA 4LDQA 3A5TA 1KONA 4GEGA 5H02A 3ABOB 1A4UA 1GLVA 3FCEA 4PSWA 2P3QA 2LY2A 1CCWA 5BN5A 4IS3A 5KNBH 2FEWB 1L5HB 1Q7RA 1V39A 4U2FA 3UMRA 4DQ2A 2H17A 1S8FA 3A9RA 3BZKA 1IUOA 3WJ2A 3ZHYA 1D07A 3RVRA 4HTAA 1Y1SA 2EWVA 4MO2A 4ZAZA 1CY7A 3UJDA 3DO6A 2H59A 5KYUB 4P4SB 4MIMA 4HRVA 3TS1A 3A7OA 4D02A 5A2QA 4D7NA 3U3DA 5EQFA 2EXXA 1DLIA 1ISIA 4XWAA 1M7LA 4JSTA 1GL7A 3RTAA 1T6YA 1TD1A 5KX5F 3QA9A 3TTXA 2FNAA 1AA0A 4QIWN 2EF0A 2B82A 2C2HA 2FX0A 3W90A 2XA1A 3W5UA 4OB8A 4PQGA 1EP9A 4UTVA 4XDHA 3N5CA 3S15J 5THXA 2G3YA 3IAM2 5LQAA 1SXGA 3R6SA 3O8QA 4TUYB 5LYJA 1VBFA 2G4LA 1SQBE 3A70A 3SJUA 1ADFA 2A6EF 2Y1LA 2GJ8A 4D6TG 5CA0F 2EIKH 4IDOA 3ABZA 1Q21A 4L2IA 2GN9A 1OFUX 2ZJZA 3KJIA 3JTHA 4E7PA 1EDDA 3CR7A 3C8VA 1VGVA 3NGLA 3PI7A 2C0PA 1NBMA 3MMYB 4PYOA 4DSOA 3ZHOA 2ME0A 2JPDA 4ARZB 4QFBA 4Y1EA 2A45H 4G5HA 5C4IA 4BLRA 4DIFA 2H1CA 2ZJQF 1HLGA 1WVMA 1CUSA 2H09A 1SQPE 2M5WA 1N7HA 1QLHA 1YJ5A 1JZSA 2V6BA 3ZMZA 2H2GA 3IH2A 3VNRA 4HB2A 2QTCA 5IAOA 2VP6A 2GLOA 1XMAA 4WJKB 2ZUSA 3SCZA 2O20A 4IDNA 2FYNC 3GTJJ 2H9YA 1BXRB 4OHRA 1P4AA 4LTDA 2VRSA 1KFMA 5JALA 4H7JA 2DETA 3TBIA 1Z8DA 3FKQA 2VUUA 2OB2A 4K6KA 4IJ6A 3E3LA 1YHNA 2ZJBA 3P26A 2OGUA 1K04A 4D8VA 1VQLP 2B1JA 2Y76A 3BMOB 2P9HA 3D4PA 1HC7A 2EYQA 4C7KA 4BN5A 2BHTA 1SEVA 4M8KA 2HYNA 4V2UA 4YT4A 5HCUA 1LTBC 5IF9A 2WV9A 3UWOA 4D4GA 4F3CA 1W4CA 4X92A 2AC2A 4BACA 2WT9A 1IBMB 2A9VA 1U0JA 1V8OA 5DIZA 3JQ7B 3BRCA 1JCCA 1FNMA 1LP1B 5AM4A 5JLXA 3G0IA 2OHFA 4DYCA 4LVUA 2HUNA 2ID4A 3GPCA 3UT6A 2PMDA 1LX6A 1U7HA 1UKYA 2WUFA 3MGKA 4WLVA 2OK7A 1WBBA 1OQAA 1J8DA 2WIFA 2XZPA 6Q21A 4IOIH 3M7GA 3CUQA 1MFPA 3OJCA 5A3JA 3OYFA 1SD2A 4ZQIA 3BWMA 5CUQA 3UAYA 1PNVA 2BGMA 1J1EC 3ZJTA 5JNLA 3IEMA 5IKPA 3DVSX 3BTVA 1MPTA 2IFNA 1YL6A 3TQNA 4XB6B 3B02A 1ISGA 2OPTA 4OLHA 1C3OB 3A1FA 1NOIA 3ZWDA 3FB1A 4JOCA 3GD5A 2I8CA 1G60A 1VMAA 2WW8A 2PUDA 3RLIA 5HLTA 3IBGA 3L01A 1JPNA 1SQXJ 3CXUA 3U7QB 3ESAA 3O4JA 2X76A 2HK9A 3S3TA 1TQHA 2PGJA 5JAHA 3BG6A 2OZ6A 2IT1A 2AIRA 5B5EH 3U40A 2GFQA 3G2LA 1AWCA 4L9WA 2WB1N 2DSTA 5HOEA 1MJHA 1WPKA 1IK7A 4HDCA 3PD7A 3QFFA 1SNYA 3O3CA 3D3KA 5E2IA 4BNLA 2ZAEB 4RH3A 3P7KA 5ALTA 1XD2B 3ZU3A 1L7QA 1Y5LA 2BCCG 3U39A 4B83A 5EHNA 5B1HA 4EGSA 4F6LA 2I33A 1AMOA 2CJFA 5BSHA 3JQBA 4N3GA 2CYAA 1N6PA 3KL2A 2G8LA 3L07A 5K0CA 4TYPA 1GU4A 1C4XA 2X2PA 2FXVA 4ZAGA 3CQ9A 2LGJA 3B1JA 3CC2P 2Z5VA 5SY4A 1H2RS 1WGXA 3IRRA 4LLGF 4B87A 1TK2A 1NZJA 5L7TA 1UBJS 4F06A 1YK1A 4JGBA 1W46A 2Q49A 5J2TF 5AW7B 2P0AA 1VKNA 5LJLA 4KKVA 1GPMA 1XTJA 3C18A 2P75A 2GS9A 4GOKA 1NJGA 2E75D 3ADPA 5JVDB 3ZVLA 1P1HA 2P1DA 4EEZA 621PA 1Y42X 1K6MA 2GZ2A 5M1BA 3A6PC 5IWAB 4N9IA 1MABA 5B5SA 2R4TA 3L75J 2H92A 3ABTA 3HYIA 2AOTB 4QXQA 2QJKB 3TLXA 4RZIA 1IHXA 1KP2A 4TRJA 3K2EA 3VN0A 4RPKA 2PG3A 3EW9A 3MUEA 4PCQA 2I5PO 2Q46A 2OD9A 3EUHA 3GRAA 1V3TA 4FFWA 1H88C 1XB2A 3IT3A 2E2HJ 1RRKA 4MVCA 2PT9A 1BCRB 2HO5A 1JY3N 3IFMA 3K69A 4ML3A 2ZWPA 4DANA 4YUYA 4BB6A 1S7EA 4RYLA 3AWIA 3WISA 3RSQA 4RDCA 1T5DX 3V4FA 4TN1A 1FZPB 4C3IJ 3F2VA 3KAPA 4H9GA 3VX3A 3CVVA 1NTME 5K5OA 1RS0A 3EFHA 1HEIA 3H4IA 3NIFB 1HOTA 5HLIA 5FQNA 3ITDA 3HADA 3AL0B 4MTLA 5CQGA 1SCDA 4ZTFA 2C5AA 3PRHA 1E18A 3W2IA 5K5EA 2F3TA 1ARZA 2E85A 3AE6C 4B3HA 3DMFA 1SFCD 4AVPA 4A82A 1E1QD 3PL8A 1RC0A 3RODA 1JDZA 2YBEA 3TG2A 1G3SA 2C92A 4NH4A 1T15A 5C39A 2Z16A 4W8HA 2Z04A 1T6XA 4PPFA 1S2LA 1JE8A 2GBIA 4ZVPA 5MN6A 1DC6A 3ZNPA 4YRJA 4B6SA 2Q9IA 3OIFA 1SUSA 3RNOA 4DBQA 1YDHA 1CR1A 4WZ6A 4EABA 4H44D 1WPQA 3V7YA 5CT4A 2F5CA 4ABZA 1OCTC 3WWOA 4LV8B 3AEDC 4MLOA 4RB3C 4FSXA 1T0BA 1Y82A 2DOFA 5FFZA 1TL7C 1WEHA 2NPSC 3LY5A 1YZUA 2X6WA 4OU0A 2ZJ8A 4H18A 3OLCX 1NTKE 2BBWA 5JYCA 1HL7A 3KOXA 3QMMA 1PPJG 3IFSA 2D4AA 2OD7A 1XK7A 3OA2A 4V0KA 4YCCA 1C3JA 4JT2A 1SPXA 2WKQA 2PHZA 4YELA 2B83A 3Q3EA 4ZCQA 2JCBA 5COAA 1VZ3A 4IP0A 2WMDA 1BA5A 4QJBA 4Z3DA 5EJ9A 4IIJA 4MI1A 3P2MA 4FNMA 1NW4A 4F5WA 3E8SA 3T97A 3KIOA 3S3NA 2CL7X 3FF5A 1Z2CA 3HKBB 3C8MA 2WDPA 3CR3C 2NSYA 3IOYA 2CMGA 3V8VA 4QTUB 1SVLA 3O21A 2C5LA 1GG8A 4YJGB 2VPWA 1WCMJ 3H13A 1QH1A 4U3FE 4I4NA 1L3IA 3KXKA 2C5FA 5JVGF 2FU5C 2HQSA 1BXGB 1G0NA 3HXMA 3AJ8A 1LWUA 4E03A 1O87A 2MLGA 1T38A 1R5ID 1QRRA 2VHTA 4WAUA 3GN2A 3ICPA 3I6QA 2JFFA 5FOUA 3HKCA 3EGXA 2W8ZA 1R1TA 3CWBG 3KK0A 1SK8A 2IYTA 5LZ9A 3B48A 1GYQA 4GIFA 3DH0A 3ENZA 2A58A 2UZAA 3Q85A 1KXJA 1LTJC 2YMMA 4NCIA 1AH2A 2C04A 1P29A 1NU1G 4JJZA 1FU8A 3VISA 5KHDA 4BLWA 5HW0A 3UPUA 2IYNA 4CDMA 4B2YA 3NHZA 1I3QJ 1YZGA 3IB3A 2VAPA 3CSSA 1HZZA 4OHWA 1BWPA 4R6WA 2J8ZA 3OY9A 5ESXA 4EJVA 1ZRNA 1BCCD 4IEEA 1F9NA 3NTNA 1DB3A 1K9VF 2VDWA 1ZONA 4IV0A 3LAPA 3EGIA 1JXSA 4O9BA 1HW5A 2X48A 3OFNA 1DPRA 1LKZA 3U60B 1NDHA 1UF9A 3P2JA 3IJ5A 3VFZA 2QE7A 2NZXA 1JLLA 1OE0A 3QE4A 4X6XA 2A5LA 2I9PA 4R9RA 1KH1A 4G1EB 4YRLA 3AIMA 3DHNA 3LT5A 4ASUA 2PWBA 3I04A 4PV7A 3OJEA 4OSPA 1R5BA 2EG9A 1SM4A 2ID6A 4LK0F 4QEZA 2VSYA 4DS3A 2YWHA 2XRFA 4MQMA 1ZRTE 2MINA 4Q1CA 2E19A 3P52A 3ZLVA 3LA3A 5HLHA 3HOZJ 1CGPA 3ZJ4A 1NDUA 4QLAA 1M2KA 3WL8A 5IJZA 4OXIA 2NOAA 4W1RA 4PX3A 2V96A 5DXJA 1QRSA 2F2TA 2VDVE 4QKQA 1VTNC 1OLTA 1VHQA 3K10A 2R8PA 4LWZA 4BKRA 2IKQA 4FQ5A 3PC3A 1GTSA 1KDPA 4DCPA 2IDZA 3L1JA 2H1SA 3HKEB 5H3LA 2AFRA 4YIKA 2X5XA 2QRPA 1EFCA 2E74D 4OEHA 3HUGB 4P3PA 2R6CA 5FOSA 1W36C 5DBHX 2NV2B 4M49A 3H3VK 2DHEA 3OL3A 3WLEA 2LCIA 3ADKA 4EB6B 5LZ5A 2MC3A 1DUSA 1OA1A 4XEHA 3ZU4A 2IZ0A 2FE4A 2P6MA 3R40A 3DL4A 2QYSA 1A77A 1WXFA 3A3YA 4DHWA 1LFUP 1IIBA 1URQB 3WMRA 2QTRA 1X1BA 4JOMA 3RTGA 4PEVA 1VFCA 2W2QA 1T36A 2OK8A 1LDBA 4M1OA 1YJNI 4D74A 3TTTA 4OFXA 1N6IA 4EQ6A 1QMPA 3SEQA 5D4RA 4IVPA 4Y6GB 3H32A 3EA5A 3SHVA 4AWXA 2OJED 3KUCA 5DCYA 5CYFA 5TX7A 4YASA 3D7SA 2Z4EA 5EZ5A 4QAQA 1NUQA 2L2QA 3A01B 2KP8A 4JGIA 5CDFE 4RSRA 3VV2A 1I0IA 3CEMA 2XVYA 3OEHA 1ZJ5A 1NVGA 4MMXB 5IYDJ 3S1QJ 2BEJA 2IUSA 3N2GB 4MW4A 1L1EA 1WHUA 5C9ZA 1LEBA 2C98A 4GEKA 2I7XA 1D2HA 3E0XA 5KAFE 1JAIA 2DMUA 2YV4A 4ZVLA 3FX0A 4N39A 4RMHA 1K5HA 1L5SA 3O2JA 3RS4A 2EZKA 1XMKA 2DFTA 3RTCA 1S4QA 3AC0A 3VNBA 2Q5EA 3QEMB 4ZQBA 1YOBA 4RAQA 1I5RA 3EULA 4OXRA 1YOVB 3K2QA 3H16A 4D8TA 3CJQB 2V79A 3IQIX 4C9YA 1R7RA 4Q9DA 3BRWD 4HAMA 2ZKIA 2IHKA 1JTEA 1M54A 4EM6A 3KB2A 4F5EA 2W70A 2K9SA 3ZCXA 1CY2A 5JXHA 3KOUA 2CUKA 4LNUA 1RIIA 4J7CA 4X93A 4B7AA 4G0UA 5FLXZ 3NCHA 3W8DA 2W6MA 1ZQ9A 1XDBA 2R00A 4NI5A 1VA4A 1MOQA 3NVAA 4Z5XA 3CU5A 2NT3A 2AOUA 5DM6F 3Q1LA 5ENDA 3QBEA 4ZI3A 3VSKA 5A3SA 2WSEJ 3SYKA 4MUIA 4DV1B 2G7MC 2XQVA 1SZCA 1FMCA 4RGBA 4O2BB 4G9GA 1H0MA 2IEYA 1JJBA 3OETA 2QEXP 3FUTA 4FJ2A 5DTIA 4DHEA 1KQLA 3KYDB 3FOWA 3LQYA 1U5CA 2FW1A 4BB9A 1Y1WJ 1EUCB 3GEGA 3PIIA 3BGOS 3FYSA 1YVPA 1TK3A 3IH3A 4U7TB 3WV4A 5DBFA 3P2IA 1R5HA 4JBXA 4LRSB 4E13A 4W1SA 2R7DA 2WOOA 5CX1A 1Z3IX 1UPXA 3OTIA 4IFEA 2F8SA 4DDMA 3II6A 1Q86Q 3B5NB 3H1IG 1X1CA 1FBSA 3WRVA 2O8CB 2HFKA 2JF0A 3BJMA 3TRKA 1DV1A 3ANTA 2E4AA 1RWBA 3JVUA 3NYIA 2J0VA 5KOJA 2R4QA 3FLAA 3VM6A 4YEDA 5ALNA 1H94A 1HT1E 4X7PA 1M72A 4HMOA 1PVVA 5ERYA 3GLXA 2I6FA 1NK2P 1UPUA 2QT9A 3S3OA 2DULA 3LC0A 5IYBJ 4HH4A 2BGWA 3F9IA 5F0CA 1PO7A 2D1HA 5AVUB 4W7YA 1ZVKA 4HQFA 2V7PA 4V0ME 1R5LA 1H9CA 3FHOA 3TLEA 2D5CA 2EU8A 1IOWA 2K7FA 5JSQA 5H4HA 2EGUA 5FBKA 3RRMA 3PYMA 3GBGA 1N2IA 4ICIA 4LFAB 3OY7A 4DR7B 3GGSA 4Z86A 3ANYB 1NKTA 1ZD8A 2ZYTX 1QX8A 2IY8A 5A0TA 3ZQ6A 3KKQA 2DTXA 2KPOA 3U62A 2V7EA 3JREA 4DC1A 4E30A 4I6EA 3I59B 1U31A 1U3VA 5GGXA 4QDUA 3ZI4A 1BTOA 4CG3A 3HDYA 3PWKA 2VHYA 2FE1A 3NU1A 4B48A 3VVMA 3O74A 4K3VA 1WSDA 4CKWA 1IK6A 2PD3A 1LQTA 4FIDA 2K9LA 2E1PA 1CE8B 1UKAA 2RGVA 3RWMB 4B5KA 1LS1A 3PO2J 3FFXA 2OHIA 3BQNB 3ZYZA 3DEJA 4KAXA 2O52A 3M3PA 2D2FA 5K01A 2NZ2A 3LUDA 3L8YA 3EHDA 2J0UA 3CDLA 2XMZA 4RFVA 1J06A 2O8FA 2EARA 3TLCA 3TO5A 4LTNA 1L4FA 2WT4A 2QQ0A 4UCFA 1WXGA 2GXAA 2P5SA 3BS4A 1LUAA 4MMYB 1NJ8A 4ZIRB 3U80A 1AVYA 5IAEA 2WPRA 4AUNA 4NENA 3LDAA 4MA4A 5IK2A 4HH0A 4JITA 3ICCA 5HVNA 5CIWA 5DT9A 2HAEA 3KJEA 4D9IA 3SAJA 4D3FA 1AZLA 2V7QA 1HT3A 1E6KA 2WA1A 4AC0A 4L5IA 3SWKA 4YJ3B 3PNVA 3E6MA 3HEMA 1KQGA 1SLQA 4MHTA 5KYVA 1RWNA 2YZGA 1U0BB 5LD2B 1GWNA 3ZKWA 4C6TB 3AHHA 2QNRA 1LLQA 2Y1FA 3DDZX 2AZXA 1JT0A 1BSHA 5JNSA 3IDSA 3M4XA 4QQRA 5L3EA 2HHLA 4X6YA 5E8IA 5BNIA 1OV4A 2QP4A 4AQDA 3IN6A 3K16A 1TKRA 3GDGA 1XGNA 1VYHA 4QYMA 4YECA 4PZEA 2K9NA 1XLWA 4OK6A 3UT0A 4X5OA 4BRUA 2YXEA 1D0IA 1UEXC 3O2PE 3Q5SA 4MDHA 2JFOA 4LV5B 2DCMA 3UB2A 4BXLA 2C0CA 4EECA 5EJ8A 4AX8A 3M70A 4ZDPA 5F2NA 3P9NA 5HJ2A 4IF6A 4O08A 4JVSB 5IT9A 2ZMEB 2ORYA 4OXYA 5I4KA 2B9SA 3NC0C 4TUYF 3LFTA 5A5VA 2ZATA 3OPYA 4HP8A 3R8CA 3UANA 4B4OA 2RGDA 4MYHA 3JZIA 4I5FA 3NWBA 4KFRA 4R7GA 3DTKA 5L6LB 3N70A 3EVCA 2XD9A 1AY0A 3KJNA 1SO8A 1PUJA 1FB5A 1C7IA 2XB0X 1R9TJ 2CKDA 3HHEA 3BXPA 3R3XA 5T6MA 1JTHA 5BN3A 2Z09A 1MKYA 4YT8A 2O5VA 1Q7GA 4LBWA 1F2TB 5H5JA 5E95A 2V1NA 2R6AA 3R23A 3OMLA 2YKPA 3COZA 1GHTA 4AJHA 2RAEA 4P8RA 5K0ZA 3EBLA 4KYUA 4RV9A 4GPEA 5ERIA 2QGFA 1O94C 1KQ9A 5ER6A 2CN1A 3U2RA 2A05A 2FDXA 2FFDC 2R751 3FSRA 5IPFA 3BZBA 3S9OA 1E61A 3G6EI 2P67A 4PTYA 3LGAA 3MCWA 2GZ1A 4J91A 3J81K 2HPZA 3CCJP 4LZAA 3DXYA 2JI8A 4AMUA 1T2KD 3AB3A 4XNFA 2AXEA 2D13A 3DD1A 2W6JD 2QLMA 1CEEA 2PSFA 3C5HA 5IF3A 4A0GA 2LTAA 1W96A 3ZZ1A 1H1DA 1EINA 2OUIA 3U3OA 3WGTA 2BR5A 5FOWA 2R7AA 4BP3A 2GRJA 3ANSA 1RR7A 4ZYDA 4LBZA 3LIDA 4H0LB 1KFKB 3L04A 4BQAA 2VXOA 1UJ4A 4JVLA 5L3BA 1XJCA 3COWA 3WP1B 1IL0A 2HV9A 4W80A 3H1KE 5JBNA 2HW8A 1NVUQ 4HN4B 2JEZA 4JBZA 3MTAA 3VO2A 5C5IA 4RETA 1GSIA 2Q9CA 3DOHA 5A2GA 2PAAA 3U48A 1GRQA 3UH0A 3THOA 1R0XA 2C57A 1QGKB 2FD5A 4XBFA 1U9ZA 5GY7A 4AJNA 1XEXA 3C3XA 4UKDA 1ZGBA 5IXJA 3WE2A 4PZDA 1NXTA 2OA0A 1KSHA 4RJKA 1WKMA 2O7RA 4NX2A 2H63A 5HDKA 3AEUB 1CY4A 4PHGA 2FV8A 4MQLA 4WERA 3HGYA 2UZ1B 4B6EA 1BEUB 4UVIA 2IYXA 3LX5A 2X3YA 3HEFA 1ENZA 3PP8A 5FXMA 4FYJA 1MDMB 1PHPA 3D4IA 1YJ9P 1QPIA 1WCIA 3DUWA 2CSXA 3BQYA 4LI3X 4I0WB 5K99A 2CYBA 2QW8A 4BNCA 1C81A 2EFGA 5CAEA 1VF5B 3SNKA 3SFTA 1TP4A 5U1PA 2IW5A 3WQQA 1KSJA 2FMIA 4DA7A 5A9TA 1T08B 1P9QC 2FSHA 3DOFA 1EJ2A 2FSUA 2R8OA 5CR9A 4M0LA 1J56A 2GFIA 2XEXA 3O8LA 3H0KA 3FRHA 4LXIA 1TNTA 2OYIC 2DVMA 2O7QA 5GPAA 2PBZA 4DJTA 3UA4A 1R8XA 2NT4A 1SVMA 5CCGD 5HQ3A 1OXKB 1Q7EA 4MKGA 4IIBA 5C51B 4FDVA 2GO7A 3GJXC 5KBYA 1A97A 1KC3A 3GTOJ 1XP8A 1R18A 3IUQA 5JAUA 4XKCA 3IMCA 8OHMA 4HX7A 2WM2A 3AI3A 1XLVA 2KDOA 1LT9B 5E7IA 2VE8A 2VOJA 1LVAA 1II0A 3QMPA 2F3PA 2QYOA 1WCWA 4BFCA 1UXHA 2J30A 2NO0A 4N5MA 1IAQA 1XVUA 2BFCA 4KH1A 3BD9A 2AUMA 4PGMA 3ZGVA 3CLTC 4JWKA 2DQLA 3ZX4A 4U2BA 1QQIA 3TSOA 2PL5A 3DLBA 4DNFA 3BHIA 4HB3A 5A4KA 1QCDA 2V7FA 2KLVA 4O4LB 2NU8B 1J7JA 2BFEA 3OQ6A 2ZDHA 2XAJA 2H5EA 4KK4A 4TVOA 3EDQA 1V8DA 3R3YA 5D1HA 3N2KA 1G6KA 4IMPA 1OBHA 2FG7C 3DCJA 3QFHA 4U39A 1I8TA 3AXSA 1W4AA 4GZ5A 2IYQA 1ZJZA 5BYBA 3HJRA 2J09A 1IVSA 1FUKA 5MGBA 3UAOA 1NZFA 2F4VB 4EG1A 1DUVG 3VC3A 1I5ZA 4ATNA 1I14A 1Y5RA 5FUBA 3M49A 4MGIR 3ACDA 1TTQB 1JW9B 3L2RA 1J25A 1HFWA 4K5QA 2Q3HA 1GSHA 1WX1A 5E3LA 4L7VA 4I5IA 2ATVA 2HA7A 3GZ5A 5M34A 2XKJE 3GPBA 1WJCA 3D4NA 1DDNA 3UKOA 2FOLA 2DE0X 2CHVA 2AW5A 2QRLA 4EF4A 1S9KE 4B43A 2Y1DA 2VFAA 2Z08A 1TZJA 5HZHA 4O4IA 3HWX1 4G5SA 2V74B 4C87A 1X7YB 1F3LA 3L4FA 3JYPA 1KAMA 2I6XA 4M98A 2PMZA 3V97A 1MBFA 1EZVD 4CL0A 2NXCA 3JD4A 4E4HA 1Z7LA 2RNJA 1KVUA 4MIOA 1PJRA 4GUAA 4HX8A 4EHBA 3RK2B 4YMUA 2VZ8A 4ZKDA 4WZBE 4GNRA 3PKIA 2WB4A 5DNCA 1DG9A 1RFLA 4OVNF 2V3CC 1YYVA 4B31A 3HB7A 5EWJA 3DW3X 1J2UA 1CVLA 3L43A 4QWWA 3T94A 2JLAA 1N2GA 4WY4C 1P2FA 1WDTA 3WGGA 5IEJA 1SVIA 3K9FC 1T4MA 1FZAA 1AOYA 2DHRA 4XIDA 2ZAIA 5AK3A 1OCPA 3GIWA 1H89A 3DBRA 1HXDA 1JHUA 5C81A 1XL1A 1NG1A 3C7TA 3HBAA 2BEKA 2WITA 1N8KA 1SMYF 2VB6A 1Y7LA 3GNSA 3E7FA 2X51A 1YJWP 5CTAA 3UJ8A 1XCOA 3FRIA 3CMYA 3HGQA 3JQFC 2BY0A 4C0XA 2ID8A 5I47A 4H4KC 5EVCA 4ZYAA 3ASVA 3N2IA 4L8GA 2XF6A 3EDOA 3T5DA 3ZD7A 1TCBA 1N7SA 2Z1MA 4ZN6A 2JK0A 4PF1A 3RKWA 1HDYA 2ZVOB 1LPNA 1Z68A 2YDXA 3TGWA 5JJIA 2QL5A 4HGQA 1X9VA 3PQ2A 3V2UA 2WIBA 3KUDA 4IZHA 1XFAA 1RXSA 1NXVA 4DIQA 2FR8C 3RREA 1YACA 4F4HA 4NY1A 2GWHA 1ZGGA 3I2IA 1UPBA 1F36A 2H2IA 1K7AA 4G65A 1KVSA 5GQSA 4RD2A 4N5DA 1F6BA 4J0DA 4UY8I 5L53A 1KERA 3CO6C 3H8SA 3F78A 3OZBA 1GPJA 4KGXA 3I2KA 4DMCA 3AEKB 4NECA 5TQJA 1RYBA 4YT5A 3TFWA 4TSFA 5DSTA 5K4GA 5JCXA 5AVYB 2JLUA 4I81A 4AF7A 3LCVB 3HVJA 5H83A 2ZIWB 3WLIA 2V1DA 1ZVQA 4BRWA 3AY7A 3N74A 2G1KA 4DWWA 2WF8A 4JNCA 4TT3A 3HCCA 1NTZG 4G0YA 5FHQA 4MRSA 3VDNB 1WV1A 4BY7J 2E75B 3N58A 4R4LA 3E15A 1FLAA 4ZCRA 2W2XA 3OZAA 5K5RA 1JAHA 4RL4A 3CH7A 1QC5B 4EL5A 4II7A 2HREA 1FOWA 3A0RB 2EGHA 2OF7A 1FTQA 3FOCA 4KPFC 4I5EA 5LMUB 1N2EA 1VSVA 3OCZA 3ZDZB 1VBMA 3TTYA 4PV1C 3F6BX 3FKJA 4XE5B 3CJRA 2PZ8A 3SR0A 2R93J 1BE8A 3KHUA 2I4OA 3HUSB 1SELA 5CB4A 3ABIA 4NU5A 4DLXA 2LY1A 5F64A 1E9CA 2G07A 2XF2A 3M6UA 3W4KA 1HRKA 1EQ7A 3PFKA 1KJ9A 4TWZA 4EGAA 2QX7A 2O03A 4G4GA 1KOGA 2C5SA 2E37A 3GXBA 4A6XA 1S7AA 4N01A 3M4YA 1L4KA 3Q0EA 3RPEA 2CGEA 3RIRA 1GHCA 3ECOA 2GM5A 3E27A 3PGKA 2QPAA 1UBCA 2ZANA 5CBPB 3RAJA 1US8A 1J8MF 2I4IA 1AVTA 2IHJA 2B78A 1F51E 5BMVB 5ALHA 3FWKA 2ZT9D 1L7RA 3M3DA 1G98A 1KRHA 4AZSA 2FK7A 2X6QA 5A5DA 1S5LX 2V7BA 4RD0A 5A1JA 3WDSA 4ZC3A 4I7EA 4CYCA 2DDAA 3DU5A 4H44B 3GFGA 3WOVA 4V3BA 4MH0R 5H3CA 4A3JJ 3BILA 2JVKA 1YR9A 1WWKA 1IUFA 2PU7A 3MWYW 3KTFA 1G6Q1 3PR2B 3IQWA 1EQAA 3EPHA 3CS3A 3RC7A 1LJUA 2YJ3A 2HJ9A 4KN6A 3QOFA 4Q5SF 3H1HJ 1TEVA 2C4MA 1TVCA 1ORWA 3A6HA 3H1HD 3C3AA 2HG5D 2A1TS 3DOOA 1VL8A 1L3CA 1BZYA 1NVEA 5E1MA 3RANA 4GC9A 3P19A 3BD6A 3VMZA 2GA9A 1I13A 3KQUA 2OBNA 1LDMA 3T7KA 2FEXA 1WDLA 4R1TA 2GN6A 5LQSA 1SY7A 1CUYA 1WF6A 1XNJA 3U4DA 2QU7A 3CLVA 3BJAA 1HURA 1P3DA 2L9VA 1MA3A 3WI7A 4PS1A 5AK5A 5DTEA 3IJRA 1CZRA 3FJYA 4P0QB 2VASA 5AW1A 2FBWC 2ZBPA 3QWAA 2D2XA 1DT3A 1UK8A 4J3JA 1C9NA 2CFIA 1VLQA 1ZL2A 2XTZA 3VWBA 3FYTA 2DDBA 4F45A 3FVWA 3WTUC 3ROFA 4B2PA 4FMPA 5DHRA 4EJ6A 1DO8A 1YE8A 2R7TA 2WILA 4C4ZA 2QT0A 4MJ7A 2NSLA 4M6WA 4QYWA 2PN1A 4C7NB 3MFYA 1CK4A 1DXHA 1QHEA 4M3EA 1JBKA 5F23A 2R9VA 4HF7A 2VPTA 4GMKA 1YA8A 1XTSA 3HCDA 1E6UA 1E7QA 3CRVA 2WTUA 3EQ9A 5AM0A 1Y1VJ 1DGRM 4S04A 2C88A 4C06A 4Q7LA 3EARA 4ETNA 4QQKA 4M1WA 3RIXA 2XUFA 1UR5A 4FOTA 2L3DA 3BXEA 1FS6A 3QX7A 4ZCLA 1BE3D 4F6RB 1KI4A 3NCTA 4UBMA 2VDPB 2GAUA 4RNDB 3OIQA 1BDBA 1SXQA 1XWIA 1XMXA 4KQ6A 1RYHA 3FCSB 2WWTA 3PGJA 4UAVA 1PZEA 4YP5A 1MQSA 3RIGA 1L4AA 4KNVA 4O2BF 5FTWA 3BA6A 1BR4A 3D2CA 1U9IA 1REQA 1E1YA 2ZSAA 1LI5A 2PNJA 3NM6B 4OAPA 2D2EA 2ZRQA 4JEMA 1JFFB 3M6MD 1RI2A 1R71A 4JT8A 3HCFA 1ECBA 4NG4A 3WGOA 5KVQA 3ISTA 3C1DA 1C9MA 1I7DA 4H35A 2B7BA 3JWGA 2AI1A 4BQFA 5KTKA 3UCEA 3VR5D 1QIDA 5CX4A 1MF7A 2WJJA 2L42A 2MJZA 3FYUA 1P1FA 1XRQA 2FE3A 5IJWA 4JR1A 4ARVA 4LRQA 3L4JA 1IZ1A 1J2JA 2UYCA 1P1RA 3PDIB 2QN2A 2QGZA 2J3LA 5HS8A 3HKZN 2YV2A 4UHTA 3N7NA 2E74B 5KYXA 2XBLA 1YIDA 3H6KA 2ZROA 4EAQA 4LFBB 5LQRA 1RF1C 2BXZA 2ZYGA 5IJAA 1ZLYA 1U7XA 3B73A 1OIVA 2JH9A 4WCVA 2VBWA 4OK5A 4P7KA 2FEOA 5DCMA 4ZVMA 4RH0A 4IS2A 3BCSA 4L50A 2HNAA 4XJVA 2R8EA 1JXAA 3AIOA 3D5LA 4E7LA 1BNCA 4URVR 3SZGA 3PPWA 5KAMA 2Y6UA 3Q3GE 1EV7A 3EVDA 3RQ4A 1KU9A 3KFXA 1UBKS 1Z91A 1FLIA 2F90A 1E9EA 2NVBA 3CHYA 3U1TA 1C3XA 3H11A 2P0YA 5DULA 3KSUA 2RJOA 2J5RA 4GSYA 1C50A 4N0QA 1SA0B 2DH5A 1IK9A 4XRRA 4DUGA 3TLKA 3PXGA 2YFKA 4LF6B 3IAM1 5EGOA 3Q7QA 2ZRBA 3TCKA 5ESWA 1Z5UA 4JUIA 4AO6A 5AJXA 2DLDA 2NRAC 4FMDB 4EHFA 1IY2A 3S93A 4TRRA 2VJQA 5ILOA 2IGOA 2LFBA 2ZREA 3KZOA 4GI7A 3RDPA 1K4KA 3BH7A 4IGFA 1L7OA 5JHHB 4MFEA 1AKWA 1SVFA 5C52B 2GUVA 1PL8A 3THXA 5A4DA 1XJWA 1THGA 3I55I 3KZIE 1SKQA 3L7KA 1W48A 1QPGA 1KMHB 4B1RA 3V7UA 2M1BA 2CW5A 2QMQA 3HBFA 5JTUA 1EX7A 3ROXA 2MYPA 3F6RA 4REQB 1BC8C 3EIQA 2WMMA 1BE1A 4PZ0A 4X85A 1W1UA 3STVA 2J3EA 4I36A 5DEQA 3MWDB 1RRVA 4J1SA 2GAJA 1OH7A 2H2FA 5BWLA 2WT8A 3H3ZA 3TCNA 4YJ3F 3PA6A 2BFBA 2RI0A 1N5RA 2PL1A 2P6SA 2O2IA 5AVSB 3GFJA 1FCJA 2G63A 2KM1A 3JW8A 2WUDA 1LB2A 4JJGA 2VE9A 6ADHA 2E1CA 3I01A 4F85A 3A1WA 4JBAA 1GZ5A 2XCIA 1E98A 1YGPA 5ALVA 1KHTA 4AYTA 2BW0A 1QU3A 2KPMA 2VHUA 3OQVA 4YRVA 4L0ZB 3HM2A 3GPIA 3IP7A 4BO5A 1BGYJ 2PZFA 1OZ0A 3FWLA 1XLTC 2WSIA 2ZR7A 2WD8A 3G0HA 3NWEA 4FT4A 4CZCA