2GM4A

An activated, tetrameric gamma-delta resolvase: hin chimaera bound to cleaved dna
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
183
structure length
179
Chain Sequence
MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASDRKGLDLLRMKVKEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDSIDTSSAMGRMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination, dna
molecule keywords 5'-D(*CP*AP*GP*TP*GP*TP*CP*CP*GP*AP*TP*AP*AP*TP*TP*TP*AP*TP*
publication title Implications of structures of synaptic tetramers of gamma delta resolvase for the mechanism of recombination.
pubmed doi rcsb
source organism Escherichia coli
total genus 47
structure length 179
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2gm4A03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2gm4A02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gm4A01
3A02A 1POGA 2M8GX 1I3QJ 5J1RA 2CJJA 1B8IA 2L7FP 3G13A 4JP0A 3JRIA 1U8BA 2X48A 1IV6A 1OJLA 9ANTA 1XG1A 2XB5A 4V2FA 2ZB9A 4M3DA 3B6AA 3HOZJ 1AU7A 1MBEA 5K7HA 1JJ6C 3BTLA 2DA4A 4DW6A 3TW7A 3S2HJ 2HXIA 2MW8A 2DTZA 2COBA 2NS8A 3BR0A 3HKZN 3S1RJ 2OPTA 2PMZN 3NARA 1Y1WJ 2X9DA 1RR7A 3G1MA 2CU7A 3LSJA 5IOZA 1ETXA 5IP9J 2NVQJ 3ZQFA 2LVSA 2ME0A 2L7MP 4J19A 3ZOBA 2XGCA 4JX4A 1OFCX 1ETQA 5C35A 1OCTC 1VI0A 5DTDA 2MHCA 3A01A 1F43A 5J3LA 2R5YA 1MH3A 5F0FA 2DMPA 4A3IJ 1K61A 3HOXJ 3M4OJ 3PO2J 3PKZA 2LFBA 3CDLA 2DN0A 1JKRC 2XB0X 1W0TA 1EF4A 1BA5A 3K2AA 1RESA 1H89C 2WAQN 1JUMA 1I50J 1P7IA 1TWHJ 1GV5A 2DA5A 4RBOA 5IYBJ 5M5XJ 2KDZA 2CUFA 3BG3A 4M3GA 1ZR4A 4LOCA 5IP7J 3Q0WA 4EEFG 4B4CA 2HDDA 1PUFA 3I4NJ 2ECCA 1MSEC 3E7LA 3HDDA 2Y9ZA 2R92J 3ZQIA 4L5EA 2LTPA 3FISA 4G12A 3WHBA 3SJMA 3GTOJ 4QTRA 5EG0A 1TWFJ 2CUEA 1ETKA 4A3EJ 3L1PA 2JA5J 4W1UA 1H88C 2H1KA 2HOAA 3UJ3X 3W6VA 4QIWN 4GFBA 2XPUA 1BW5A 2LLKA 1DU6A 2HOSA 1D5YA 2LY9A 1HCRA 3GTLJ 5C44J 1IC8A 2VPRA 1GT0C 3S1NJ 1E3OC 2EQRA 1W0UA 2FD5A 2DA2A 2GLOA 3Q0VA 1IDZA 3H0GJ 3C2BA 1ZK8A 1UHSA 5E3NA 3B6CA 1FIAA 1UG2A 3VPRA 3HGYA 5BNGA 1RPWA 5E3MA 2GM4A 3RZDJ 2EZIA 2K9SA 1ETWA 1VNDA 2QCOA 4C3JJ 3JRGA 4UUTA 1QVTA 1QRYA 1SFOJ 2JWTA 2JA7J 3MN2A 3BG9A 3FK6A 3FK7A 3MKLA 5FKMA 3BTCA 2ECBA 5F08A 2LP0A 2MG4A 5EDNA 1BW6A 1MBFA 1AKHB 3LSRA 5FKLA 1X2MA 3TP0A 2R7ZJ 4D5CA 1FTTA 2XPVA 2M2EA 1H8AC 1JKQC 1JT6A 1U9NA 4ABZA 3ZQCA 3OSFA 2Y9YA 1U78A 2RAEA 5JLWA 4I6ZA 4A3FJ 1P7JA 2E1OA 3BVPA 4DYRA 1Z0XA 2JK3A 2QF7A 4XK4A 4Y7NJ 4XICA 3I4MJ 1MBKA 2WB1N 2CQXA 2IAIA 2DMQA 3JREA 1B72B 4IEJA 2O7OA 5EZGA 2WV1A 2DA3A 5E3OA 5IYCJ 2K40A 2VKEA 2FX0A 1JUSA 3JRCA 3PO3J 2N8GA 5JLXA 1JKPC 4M3BA 3BTJA 4A3KJ 3HEFA 5M5WJ 1BJZA 3S17J 1RKWA 1JT0A 2LR8A 1FTZA 2Y2ZA 2EH3A 2YU9J 1ZTRA 5F04A 5DS9A 1U9OA 1R9TJ 5EZHA 1GV2A 3G1OA 1X58A 2VUMJ 2DMTA 2RSLA 2HOTA 1WPKA 1QVUA 3RZOJ 5IPAA 4D7NA 2FQ4A 4UUSB 1NTCA 3TP3A 3CQZJ 2TCTA 2LK2A 4MFEA 3LNQA 1SANA 3WHCA 5EGOB 3S1MJ 3LHKA 1HX7A 5J1YA 2IEKA 5E3LA 2E2JJ 3UKGA 1WCMJ 3RQIA 2R93J 3HM5A 1ORKA 2B63J 2O8KA 3QPLA 4FE4A 1BL0A 1G2HA 2I10A 4MLOA 3ZQLA 1YRNA 2G0EA 4FTHA 2EZLA 3GTKJ 2XGEA 4IHXA 3S15J 3BR1A 1MSFC 5C32A 3GTGJ 2MGQA 3SDGA 4IHYA 2HXOA 2TRTA 1ETOA 2M9HA 1JJ8C 1MH4A 1IG7A 3GBGA 3BQZA 3HOVJ 4AUXA 1LE8B 2LKXA 1APLC 3CMYA 4FISA 4JYKA 1IDYA 2CRGA 3IH4A 2DA6A 2R5ZB 5EYRA 5EEAA 1HDDC 2NVYJ 2Y0SN 1FJLA 1LFBA 1FEXA 2W48A 2AHQA 3HB9A 4BKXA 3OIOA 1AKHA 1Q1VA 4RDUA 1CQTA 1AHDP 2M0CA 5FKKA 1T56A 3DEWA 1TC3C 1TWGJ 1HDPA 3HOYJ 2D5VA 2XSDC 4C3IJ 1JTXA 1Z77A 3A03A 4Y52J 1VF9A 4BBSJ 2Y30A 2GBYA 1B72A 4D5FA 2H8RA 2NOGA 3GTQJ 4BQQA 1QPIA 4A69C 3HOWJ 3BR6A 2EZHA 2JN6A 4FE7A 1MBHA 5IOYA 2O9LA 2R0QC 3PM1A 4AC0A 1JKOC 2LD5A 2L9RA 2YS9A 2FJ1A 2ME6A 1K83J 1DU0A 4A93J 3TW6A 1ETVA 4IHVA 3LSPA 3JRFA 1S7EA 5FJ8J 2X6OA 4QSHA 3Q0UA 4UUSA 2EZKA 1O4XA 1HLVA 3GTMJ 5FLVA 1ETYA 5F0CA 3JRDA 3BG5A 2MSYA 5EGOA 4A3JJ 1JGGA 4DZPA 2GM5A 4M3FA 3GTJJ 2NVXJ 2HQ5A 2M34A 2ELKA 5M5YJ 5GPCA 1WH7A 2VKVA 4D7MA 3H3VK 3LHFA 2AO9A 5EF6A 1XC5A 5C31A 1ENHA 1GVDA 1WH5A 1WI3A 4AYBN 1FIPA 4DYCA 3F0CA 4DYQA 3O8HA 5K7FA 2JA6J 3G1LA 3Q3SA 4JX5A 3ZQGA 1ZR2A 5M3FJ 2JA8J 4BXXJ 2E19A 2VI6A 4A3CJ 2CQQA 2OF7A 2DA7A 4CYCB 1ZGWA 4B1RA 1MBJA 3FKIJ 4FCYA 1WGXA 4A3BJ 5IYDJ 5FKOA 5K7ZA 5F27A 4NDLA 1X2NA 5M3MJ 1B8IB 3BTIA 1OCPA 1VFCA 5C34B 1LE8A 2ID6A 2YUSA 4IHWA 1IGNA 2KT0A 3GUVA 4A3LJ 3QPSA 4X1EA 1JUPA 5IP6A 2R5ZA 1F36A 4XRSA 3MVPA 1RETA 1JTYA 2E2HJ 2E2IJ 4A3MJ 1HOMA 3S2DJ 2P81A 4V2GA 4S0HB 3BR3A 1TWCJ 2JMWA 1GDTA 2XPWA 3FIWA 3CCYA 3K7AJ 3ILXA 2EBIA 5J1UA 3LOCA 3DCFA 5C3EJ 3LSGA 5FLMJ 1HF0A 5F0HA 1IUFA 4B3AA 5C4JJ 3HGGA 4W97A 3OSGA 4BY1J 1A6IA 3TEDA 1GUUA 4A3GJ 3HBLA 2IBDA 3A01B 2R5YB 3ZQHA 3D1NI 4M6VA 4BY7J 1TWAJ 3OOUA 4DZJA 1LFUP 1Y1VJ 4XRSG 5HODA 5GPAA 3GTPJ 4HNVA 2K9QA 3SFIA 3NAUA 4I76A 3JRAA 2K9NA 3IV5A 4XRMA 3S1QJ 1ZKGA 3JR9A 1NK2P 2XRLA 1ZQ3P 3BQYA 1GHTA 1A5JA 2DA1A 2NS7A 4JX6A 1I6HJ 3JRHA 4XIDA 2L7ZA 3S14J 5C4XJ 1IRZA 1NK3P 1RKTA 5F1JA 2DJNA 1UMQA 3S16J 3BR2A 4C3HJ 1ITYA 3BT9A 1PUFB 2DMUA 1IJWC 2JJ7A 4BBRJ 2NVTJ 1MNMC 2L0KA 2XGDA 3HOUJ 4M3EA 2Y31A 5FKNA 1YRNB 3O8GA 4X6AJ 4MFDA 3JRBA 3BR5A 2ID3A 5GP9A 2HI3A 4MO7A 3RKQA 4A3DJ 1T33A 5EG0B 2DMNA 2HYJA 3IH2A 1XS9A 3M3YJ 4MIMA 4C2MJ 3QQAA 4CYCA 1MBGA 3IH3A
chains in the Genus database with same CATH superfamily
1LC3A 1P74A 3BH7A 3TW8A 1UZNA 4MYCA 2I5PO 4NXNB 2M87A 3HOZJ 5J2TF 3ONVA 5JNUA 1YR1A 1ELOA 4F86A 1CZKA 1EIZA 3BTLA 5KU7A 3OPNA 4EMUA 4ENWA 1H3NA 3TQHA 3IURA 4BO6A 2H43A 5AHWA 4YMLA 2BZGA 3V5BA 2IPAB 1MHTA 3H35A 1SBHA 4PM4A 3HY4A 4JROA 1RLOA 1FJPA 3R3JA 1U5BB 3TFWA 3GG9A 5B7PA 4QTUB 5AVWA 2DMPA 4H0EA 5DU2A 3LCUA 5LU8A 4DXAA 1SFCD 3AB7A 5LP6C 1RIOH 5FTMA 2OO5C 4LHSA 1SUIA 4Z4HA 1DCMA 4XN3A 2E76C 2DCMA 4E11A 2RNGA 1Y4ZA 1AVYA 3S2UA 2C5SA 1GUYA 3D8HA 2Q62A 1XZBA 3U39A 3GUYA 3SC6A 5K4GA 1TWFJ 4ZZ0A 2COEA 2QQ0A 1AN0A 4BLVA 4QUDA 2OXTA 4XWAA 4D57A 3PUFA 2X5XA 3KOOA 5ECYA 2FN9A 2F62A 3HE5B 3GUHA 1L2TA 2O3FA 2YC4C 2ZFUA 3NONA 3AEQA 4D26A 2J48A 3K4CA 2Y0DA 4PU0A 2A84A 3JALB 2L02A 2RI1A 1PR5A 2WB2A 4WZAB 4QU8A 3FF5A 3VOTA 1S8OA 1IZ0A 1HDCA 4B3BA 4QDXA 2OZPA 3UPTA 1JE8A 3U2RA 4JT8A 4EMTA 4RH0A 3ZZ0A 4GI1A 4ZT6A 2NU8A 5CAEA 4A3FJ 1FDOA 4XICA 4F45A 2G1JA 4HYQA 3D7SA 4IEEA 4DJDC 2I4OA 3CYFA 3KPUA 5FLXA 4KQCA 2O8DA 2YV1A 3WTWC 1HDGO 3LCMA 1GAWA 4MYUA 5HIAA 1SD6A 5BO5A 1VF5B 3QWBA 3OX4A 3KX2A 4RNDB 4A8JC 5CLQA 4PSUA 3NYIA 3W7BA 4ZRMA 4RTJA 1K9MQ 1P73A 1FRFS 3UW1A 5D5WB 3EVAA 5DULA 3NH9A 3LLVA 4OMUA 1IVYA 3LVFO 5LB4A 5IT9Z 1JB0J 1M6HA 4EJUA 1GR1A 1JEOA 3L70E 2G4VA 4F5EA 2NYUA 2TRTA 3DR5A 3CC7P 5GTDA 3V2QA 1DZ3A 3F46A 3HXMA 3GBGA 4AG5A 3CUWA 3C3PA 1KYOH 1C9JA 3DJYA 4U0JA 3PNLA 5AD1A 3T9CA 2GCOA 2Q1ZB 3V97A 1WBJB 1BTOA 1K4YA 2XASA 1X2BA 2AQHA 4D5FA 2NZ2A 4O3FA 4QYIA 3HRMA 1S2LA 2WAQA 4TTTS 2RC4A 2FU4A 3ZN2A 3RSHA 2BGLA 2Z3WA 4C0XA 4WY4A 2ZSIB 3E9CA 2R8ZA 4REQA 2AXPA 4F9GA 4KRFA 1SBQA 2ZC2A 4MTEA 3R0ZA 4TKUB 2MSYA 2OUMA 5JO0A 2A6EF 1YTYA 2NX2A 2XZTA 3P0IA 2W6AA 2ZYGA 1JILA 3I9MA 3R4KA 3TTUA 3TDMA 5DJTB 3Q3SA 2LCFA 2OV2A 3TOCA 5EWLA 1EDEA 1U1IA 1EK6A 1SD4A 3HG7A 5M3MJ 1YR2A 2KUBA 4IICA 1DAEA 5F3RA 1VA5A 1TFRA 1F1BA 2QSFX 2D5AA 3CF2A 1RC9A 2A88A 2GCEA 3C6XA 4QLOA 3H1JD 5NULA 1Z7UA 3LMMA 3GRAA 3AM3A 3ZS8A 1UHWA 1E0SA 1SCQA 1XT6A 3Q41A 3OSGA 2RHLA 4KIGA 1PFQA 5FJJA 3RU9A 5JSHA 2RIRA 3AUAA 2NG1A 1UMDB 4QYXA 2DPMA 2WVGA 3JRAA 4H4CA 3JR9A 1WDKA 5ALMA 2NPFA 4R2IA 5DT2A 3I9OA 3WK7A 3OY9A 2AKEA 5JR3A 3MKYB 2DPDA 1NWCA 5KEIA 3EYWA 3I1FA 3OS0A 2WT7A 4N6JA 5I4BA 4MS4A 4YQYA 4RZQA 1L4FA 2X48A 2W6BA 5EGNA 1XNRB 2IOHA 3NBXX 4M38A 3T52A 2OK8A 3BGVA 4KIWA 3V00A 4F96A 2ZYSA 4OWRB 3W5JA 1WLYA 4CPDA 1E3HA 2I87A 3ISTA 2FQYA 1EZVI 2QMUA 4P5OA 3FMSA 4JX4A 2IYOA 1A8PA 1U6JA 1F12A 5ISMA 2WB4A 1GNQA 1YQEA 2P7VB 2HCJB 2HM7A 4IFIA 2RK4A 3U61B 5I51A 2ISQA 2QLJA 4BQRA 3U7RA 4EGJA 1O08A 3TM4A 1XJQA 4XH9B 3GL9A 4ZCRA 4Z1OA 2GD2A 2GEJA 4OJNA 3N2GB 2NUAB 3TZBA 5C39A 2HOAA 1GRRA 4YJFA 1ZA1A 4LC9A 2PU5A 3AHHA 1B1CA 3FUTA 1Z28A 4RF4A 3LL4A 5IWCA 4G9YA 3TTXA 3HRTA 4TYWA 1FOSF 2DKNA 3IR5A 2JBAA 1XZIA 1QIDA 4NH0A 3NDJA 5TVGA 1WPXA 4ZRDA 4BNIA 1EM6A 3DOJA 4ZAZA 3BEDA 3CUQA 2WKSA 2OGTA 2DAOA 2FPLA 2ZJFA 2V6BA 1XPJA 2X0NA 3KVNA 1GZ3A 4TL7A 4RS8A 1JKIA 2FPXA 5DB4A 4JK1X 2EBHX 4URVR 5IYCJ 2N42A 1IZ7A 1PJ2A 1NAFA 2GDJA 3OTQA 1LNSA 2RHDA 1DEOA 4OP3A 4LMPA 2CBZA 3I3LA 3CEMA 4J0FA 3SQOA 5KAFC 1OC2A 3VKUA 3AG6A 1KYWA 4Y3OA 2FEKA 2YH2A 4MDFA 3I9V1 3MJVA 2IFTA 2O20A 4NPHA 5CCEA 1ADFA 1U9YA 4EJWA 2MYUA 4PHCA 3BR1A 3M33A 4DNOA 4HRXA 1ZSVA 5FWNA 4FN4A 5AW0A 5KX5A 5CYVA 1U11A 2IYTA 4Q7QA 4ALNA 3NBAA 4ONEA 1K8YB 5DNAA 3R3SA 4GYIA 3SXUB 2VQLA 4EABA 1D7MA 3M6XA 1JIKA 1K2WA 1Z0ZA 3OY7A 4RENA 4C0KA 2HSZA 1ZJWA 3PNVA 1T9ZA 2FQ1A 2ZU0C 1JPUA 2WJGA 1YVDA 4CM4A 3E6CC 4FZVA 1C0PA 4NRDA 3DL0A 4C5BA 5K0TA 5EPUA 2O1KA 3DMTC 5CJ9A 1FYLA 2DJ5A 2J3LA 3IXLA 3H19A 1R5SA 1OBFO 1I7QB 1TO1E 4XIFA 3GI1A 5F23A 4TSFA 3A3OA 3JQAB 1PBTA 5A6SA 4FUTA 5FLVA 2P91A 3HRSA 4J75A 4DMUB 3ISVA 5GPCA 2PUDA 1GTL1 3LX8A 4CM8B 1BSNA 5TRDA 3DUWA 1MA3A 4E4YA 5K4AA 1KJQA 4OQDA 4WK0B 2HCFA 2YU3A 1OA0A 2D2CC 4X92A 4XB2A 3ZVMA 2CQQA 3MRXA 2P4UA 5FKOA 2C5AA 4KDEA 3I55P 1YZUA 3UO8B 3KR0A 2QYSA 3FOAA 1OCPA 1LLUA 1WBDA 1KJWA 2VAXA 1SXJD 4A2PA 2J4DA 5CB4B 2JAXA 1E89A 3BWXA 4D9GA 4BLRA 2CSXA 2PBRA 2C61A 2HN9A 2SKDA 4KXLA 1D8JA 1FSZA 3L6EA 1E9FA 3PEYA 3DVRX 1GUUA 3CVWA 3CZAA 2OQGA 1G8SA 3NDPA 1CY0A 3OQ6A 1K5PA 2VHCA 2DBYA 1GVNB 2FSVA 4LZLA 4Q7KA 1NBEA 5FOXA 3DMRA 1HSJA 2WOOA 2MSKA 2AN1A 3NIWA 4FWBA 3U1BA 4JOCA 3Q3HA 3MCTA 4DREA 2RGNC 3NWPA 3JSVC 1QHEA 1P5JA 1D1BA 4IVQA 3L6RA 3E6BA 1XS9A 1QF7A 3EYIA 3AF6A 3JD1A 1V25A 1RYDA 3HE4B 3ESQA 4ZD6A 1X3WB 3FUXA 4WINA 1J56A 4OMFG 1KDPA 3VX3A 3QEOA 1ZP6A 4PHFA 1HTTA 4EOGA 1Q21A 1Q7CA 3DV0A 5EJ4A 3GLHB 1OT5A 4OI4A 2GN0A 1T1IA 3LUBA 2COKA 3ZRGA 5CLHA 1E6KA 1OI7A 1U1FA 2EPFA 1OVGA 1IY2A 4U02A 1D0SA 3UCFA 1HFKA 3GZ6A 1D3YA 1GL2A 4ZDJA 1HQYE 4CMIB 5J4HA 4GZ3A 3GP5A 4JLNA 4W5OA 4G94A 5CYFA 3B7GA 5KNCD 2NTJA 3DDWA 3W05A 1F2UA 3K96A 1OBCA 1E64A 5DP2A 1WY7A 3CNOA 3D2LA 4DCTA 2Z5GA 3ET4A 4W1UA 1OFUX 1RWXA 3RFTA 4L0YB 3IOYA 3L6UA 5DZSA 1A7KA 1T8ZA 1KY3A 4FNOA 3ZWKA 4QBFA 5AXCA 4BQFA 2HLDA 3RTBA 3HO1A 4PD4D 5GADJ 1V6SA 4LPKA 3HKEA 2PKRA 1E0DA 3IIEA 4A6EA 4NABA 1TVKA 2YFKA 4TXMA 3HZOA 2WIFA 1I1GA 1N8KA 3JQQA 4BHCA 4XSZF 3ZE9A 1KMHB 3H2HA 3L4FA 2D8MA 4CG3A 4MEYF 3NIFB 2Q9UA 5MGNA 4RK1A 3UHFA 4F2PA 1DBRA 4BE2A 4Y0VA 5DM70 2BC9A 1QL2A 2V4MA 3B02A 4BRYA 2ZTSA 3K2ZA 4MQFB 1EQ7A 3MTBA 1TM7E 5K3FA 4RQBA 5UKDA 4MVJD 1Z4KA 2H52A 2V97A 1CQXA 1YR6A 3OKPA 2IBZI 1IUPA 1BI1A 5KAPA 5SY9A 3N2IA 4BVGA 3IPRA 2VDOB 4UD2A 4ND7A 2DLDA 4FVTA 1N2HA 2A1TS 5DVZA 2OXIA 5J4LA 1CDZA 3GGCA 2FGKA 1D6JA 1IUKA 3PR1A 1CJCA 3R40A 2XUDA 3F2IA 5T4FA 4JJAA 3N7NA 2VHQA 3MPUA 1XXHE 5M1BA 3AEKB 5KSPA 1CZUA 5C9ZA 3ZIUA 3CH4B 5EA2A 3VNRA 1KI6A 3HBMA 1TOAA 4NV0A 1NT4A 1I2MA 2K7LA 4TXLA 2EIHA 3HJRA 5LP6A 1GGEA 3IEIA 2OO5A 1QUEA 4YMSA 5CBKA 5DGCA 4RUKA 4XQGA 4PSCA 1BI0A 1MAAA 3GK3A 4P4GA 4UUNA 3EAGA 4PHHA 1UKYA 3HOYJ 4WGFA 2E21A 1YBHA 4R1TA 3P97A 5GM1A 3QWLA 1X74A 2KI5A 2W43A 1EJBA 4BOYA 5BQPA 3E22B 3M34A 3V4PB 4RJKA 1H65A 2GN6A 1E99A 1QP8A 2B1IA 2UXNA 2YY6A 2ZAGA 4BNYA 1P9RA 3R3YA 2ZIAA 2AR9A 4RK0A 4EI2A 4HCJA 2XV5A 3P45A 4UDXX 1KMCA 3PNSA 4G0NA 3CX7A 3WLEA 4M3FA 3JYOA 4X1IA 3GZ5A 3C6KA 3C7AA 5BOVA 2H2FA 1O95C 4Q3AA 2VT6A 3KQSA 3PT9A 2CW7A 2DSNA 3CCVI 1SHTX 3EIQA 5ILQA 1SG9A 2HCRA 2PWBA 4IRIA 1VQ6I 5BQFA 1D1QA 3PKIA 4K9PA 4F3NA 4JC8A 2Z5FA 3J80Z 2UYHA 4FWIB 4YRNA 4RAGA 3THWB 5FFNA 2STTA 4RHXA 4I3GA 2VA8A 1TCCA 4A8JA 3AI3A 3RJ5A 1ULTA 5A06A 2BT4A 3ZDYB 4BC0A 4RKEA 4EJVA 1R9NA 1O87A 1A95A 4BY7J 3E61A 2GD0A 2I2WA 2ZKIA 1HDIA 3TZKA 1Z67A 2IBMA 3G9QA 2F2TA 1PWEA 1I7SB 3RSZA 2WAXA 1URQD 4M72A 3B51X 2XNDA 4UXHA 3MKZA 2RKOA 5F7OA 4P9FA 5DI3A 4RGUA 3A6FA 4KPEC 1CR6A 2ZBRA 1VKNA 4J49A 3HTUA 1FNCA 3KAPA 4CA0A 3AY7A 2ZJ6A 1QQAA 1PJ8A 1SB9A 5KAFE 2GSDA 2NO4A 4JOBA 1Y1RA 1NTME 4BECA 2QJKC 2E4YA 1G6KA 5FB2A 5C18A 2X19A 4INPA 3JWPA 1QGKB 3FCOA 3A4VA 4IIHA 4RPIA 1KQSO 4B0PA 3T3IA 2XGCA 2C8KA 3SFEC 3RR2A 3E2IA 2ZT9D 4F4CA 4PX9A 2X1MA 2OESA 4QYSA 2V7WA 2X85A 3PGMA 1JWAB 3QITA 2J41A 3AZOA 2WTXA 1PL7A 1XAHA 3BD6A 2KB7P 3Q6NA 1AKQA 1RYMA 3WIEA 3ECOA 4RGVA 1O4WA 2K9LA 3TQCA 4ZU1X 3DWIA 5J2TB 1EUYA 3HCAA 3FXLA 2HD4A 5BV2P 2CDRA 2QAIA 3H5LA 1L8QA 4KC0A 1XMSA 4TV8A 3EDRA 4KU4A 4Y67A 4KO1S 3QU6A 1I6MA 2WF5A 2LIPA 1HE5A 1YZLA 3A28A 2ZWAA 1N33B 2BUCA 4K3AA 2VDPB 2Y1FA 3TWOA 4ETMA 3DKVA 4J0IA 2RVCA 1M34B 1XZNA 2KRCA 5I7RA 2BFWA 3BRCA 3OQJA 1MNDA 3QPTA 5AW8A 4K87A 3AVXA 1BX3A 1NTKD 2E1PA 1UJ6A 4BV3A 1MIOA 3WL8A 1XX6A 1E3MA 3UC5A 2BP7A 2Z2KA 3A4IA 4EPRA 2J3EA 4Y2RA 3ZDCA 2H06A 3A1WA 4KAFA 1P5FA 4BAUA 3O3MB 4W9NC 3DPUA 2CQNA 1VB3A 4P92A 3ITKA 1VSVA 1W0CA 2WMMA 2R7UA 3H1LG 1JIJA 1YL5A 3KTOA 4MRMA 4GX5A 1DBVO 1ACMA 1S2MA 3VAZA 3PFBA 5DO9A 4G37A 2X6XA 1CRPA 1SZPA 2LR8A 4EB6B 1OWAA 1Z63A 2V0NA 3TLMA 2RSLA 5CDYA 4Q5SF 4MWZA 2QL7A 4A6PA 3SN6A 3KCNA 1E7MA 3Q3JB 1BDHA 4M0KA 2ZBUA 1FSEA 1OBOA 2V74B 4LYHA 2WVRA 1U1CA 2ZVNB 2ZTMA 9GPBA 1R50A 2A86A 2QNIA 4BWNA 2CK3D 1SVWA 2J7PA 3IBYA 3OEED 2FPPB 2DCUA 5A4JA 4BYYA 4R0VA 3CCJP 7MDHA 4NOLA 4HLXA 4PICA 4WCDA 1Z2OX 1QIEA 1ZM2A 4RZHA 4E1BA 2YKOA 1C1HA 1HWYA 1JH9A 2ODTX 4KGZA 4MVJA 2QOEA 4QPPA 5HDNA 4PYQA 4RA6B 2W2NA 5DHFA 1RYZA 1N7JA 5GONF 5K0EA 2OC9A 1IQRA 1OU0A 2K9JB 2GSWA 1QIGA 4PPFA 2H8RA 2JVIA 4DV4B 4WA7A 4O2AA 3OZDA 4JYAB 2F4NA 3P9QA 4PZCA 3B5IA 2RGWA 2DFVA 1XN7A 5BN4A 2Y1LA 1YE9A 3FMVA 4AIDA 4Q7LA 4ASNA 4PJLA 5JAUA 1S7EA 1CYDA 4B79A 3QUCA 4CLHA 3QBDA 3KHTA 5AVRA 1LB1B 1Q1GA 3TMKA 2Y48A 1GCOA 2ZAIA 3MK31 3FMOB 3KUKA 1QH8B 1SK9A 2Z09A 3FSGD 1VE5A 4OGFA 1TCBA 3RKRA 1CZQA 4JX5A 3INTA 2XMSA 4RD0A 3GC6A 3M70A 2PJDA 2ECKA 3BMCA 4F46A 1QS0B 3HFGA 4HXYA 4ND5A 2Q4RA 3BGWA 4YTPC 2FR8C 1KZ1A 3HVRA 3MVPA 4P7JA 1GZVA 3NC1C 1NIPA 1PG2A 5I01A 4Z0HO 2FMTA 1COWA 4DV7B 1RBMA 2IPXA 1SULA 1NSTA 3EGXA 2WWIA 3PNBA 5IYZF 2XROA 4URYR 5ESWA 4LDQA 3DHWC 4DUZB 4BMCA 5HZMA 4QUGA 1H2FA 2ZBQA 4WCFB 1E5WA 1SZDA 4WFIA 2I1JA 2ZRKA 4FFRA 3FPKA 1L5GB 1DWPA 2P8TA 2GZRA 4KQ6A 3NBKA 4GSYA 4DNPA 4X6UA 4PYOA 3QU7A 3MJCA 5JBNA 3AVWA 4QD3A 2C98A 2W0MA 3V1UA 1K5HA 2H92A 3E9EA 1DJOA 2R6GA 3UQZA 5YASA 1LP1B 4BCDA 3M0AA 1OB5A 3H2GA 2TECE 3A02A 5AJYA 2DPUA 4KFCA 1Y4UA 5CT6A 3ADKA 2PT6A 3DMTA 3QWAA 3PFWO 2I54A 3IS3A 3UPDA 4AY3A 2XCLA 1NTZJ 1OQAA 1T0HB 4GKGA 5B6IA 1OFUA 1FFCA 1G5PA 2G0AA 1TMYA 1DOHA 4HWSA 3LA3A 1VCOA 4DIKA 2OFWA 2CYAA 4WTOA 3RSCA 3L1IA 3C3AA 4HB4A 4HNHA 4N6OA 1Z0SA 1IFPA 5K8CA 1FXWF 1U7XA 2JB9A 3OTGA 2BDEA 4AKIA 3EQ7A 4X54A 2CCGA 5CFMA 3SWWA 2ZOSA 3T1QA 2XB0X 4A1OA 1Q84A 2KP6A 1ODCA 3T5GA 4EM0B 3A4MA 3KVYA 3QEKA 4P5EA 4C0WA 3H1KE 3OKAA 3M07A 3H5AA 4DANA 1E3IA 1OX4B 1R5LA 4WJZA 2CT8A 3KJIA 5DLDA 4F72A 4MW5A 2N1TB 4BC1A 3ESZA 4MVJP 2ODAA 2E48A 3NIDB 4KQEA 5KU1A 1IZZA 5H02A 3AKEA 2B34A 1BO6A 3ZVKA 1CE8A 3LRTA 3W3AH 4Y0AA 3IBFA 5D6FA 5AHKA 3PG5A 3F49S 1MLDA 3KYDB 2WAOA 4JITA 3RTCA 1YTLA 1KFCB 2QEXP 3G0CA 1CLUA 2F00A 2UZIR 2QSJA 2RAFA 1B42A 3GDHA 2JFQA 1R4MB 1KH2A 3N0WA 4WK4B 1HGVA 1H93A 1ZBDA 5K5OA 4TKVA 1WY5A 3VPFA 1X8XA 4RE6A 3RGWS 2L9VA 3RK3B 3RNOA 3RUDA 3TS1A 2RGNA 2OKGA 4YDHB 2VXZA 2Q5FA 3HCCA 4XGNA 3TOZA 2ZRIA 3BC8A 2CLDX 5JHFA 4GDOA 2RAEA 5HQJA 4CKEB 3AG2H 2AXCA 2FW9A 1CUFA 1WJAA 2VDWB 2VYND 2HV8A 3GCZA 2D1QA 5DIFA 1DADA 1FS4A 3PA8A 3PQ7A 3DZBA 4OQZA 1KB9D 4L5IA 4BJTA 1EFLA 3H1JG 5A2QZ 2W9XA 3MQ2A 4ALMA 3CO0S 4FEGA 3AP3A 3RZOJ 3GP8A 3F9RA 3KZMA 2DEUA 2VJOA 1W93A 3P8MC 4HDNB 4OU0A 2C5HA 1YR7A 1KI4A 3G1UA 1AQ5A 2I3BA 4KT6A 3T9BA 1VBKA 4OHWA 4TN5A 4LXTA 4L50A 5A7FA 3B1KA 1KU7A 1KR2A 1TZCA 3DL7A 3S15J 3CVUA 4BGEA 5CB8A 2YOHA 5P8WA 4XRGA 4D6XA 2ZDQA 4TMTA 3KZCA 3G5UA 3OS1A 5FL7D 2DOKA 3OJEA 3T99A 5IAJA 3OIOA 1YBAA 2O2DA 1IB0A 2QRLA 1TC3C 1WJBA 5K9ZA 2EWWA 1K9SA 1UFRA 3G8AA 1F4PA 4JJ7A 2QJTA 3GRRA 5BSFA 3W9UA 3U3XA 3VSKA 2CC2A 1ZRFA 1Q11A 3TD2A 3DW3X 4GLFA 2H4WA 2R68A 5LYJA 4R40A 1JEQA 4EHAA 1MHPA 4G86A 1L0BA 3HSEA 1IG0A 1JWBB 3UWMA 1C0WA 5KTPA 4LEIA 1SUDA 3IPYA 1HQKA 2PGJA 1AKYA 1OVMA 1Z4IA 3PV0A 1QA6A 1T9AA 4I4NA 4DR7B 3SK0A 1D1PA 3MVEA 4R51A 1T1GA 1ON2A 3RS4A 1NW5A 3TQNA 3U4DA 1DIBA 2AC4A 2VPZA 5FUYA 3HN6A 3ZKWA 4L4YA 3PFNA 4ED9A 4WN9B 4DBRA 4EVSA 2WAEA 2VK4A 2WINI 4QRIA 2C97A 2MH9A 4GOKA 2B87A 4MROA 4W5HA 2IFNA 2P7HA 3EAFA 1T0PA 3NHAA 2GZSA 4P7KA 1MVLA 3HJEA 4JZYA 3GD7A 4ZDPA 1COZA 1EDIA 4YP0A 4CTOA 3DV9A 1PL8A 3F1KA 3PL8A 1FUIA 3FDZA 5CXSA 4QFCA 2DA1A 1SMKA 5F3WB 4AW9A 2V59A 3C39A 1UJBA 4CE6A 4ZANA 4C3HJ 5E7JA 1B7GO 3MJEA 1KK2A 3QM1A 4Q1FA 4X0GA 2C9LY 4R9VA 3CCBA 1LPQA 1NN1A 1Y56A 3KT8A 4CGYA 3TIGA 1W9MA 3WTBA 2JNWA 1G59A 4NYMR 5L95A 4BB0A 4AROA 4HB0A 3FBNB 5A71A 3UMBA 1DCTA 1R4AA 1IY1A 1ZGAA 3FYHA 2PCLA 4DY6A 4JB2A 1VE3A 2BW3A 4CTKA 4IHAA 4ZTZB 2FE3A 2OCXA 4KRYA 1L4AD 3ZOBA 4DEYA 1Y4SA 1T39A 4G07A 4MQVA 1U5TB 2E36A 4HJRA 1R7RA 3GN1A 1YITI 1H1DA 3G2IA 2AOUA 4LDRA 4AB1A 2PLAA 2FMLA 3VR6D 3W67A 4DGQA 1CP3A 2EQAA 4ZVNA 1O95A 1CXZA 1BVYF 4KT5C 1RESA 5DCLA 3R5JA 4UFNA 5I5EA 4PS1A 2XW6A 2RJOA 4NC7A 2P9BA 4HLYA 4EHHA 3PEUA 1KSHA 3FPJA 4K7JA 3RC7A 4PC7A 2Q2QA 2JCSA 3A4NA 1P75A 4MLPA 3QX9A 1DJQA 5JYCA 4EUFA 4MV3A 1P8AA 1M2JA 2FHSA 2LLKA 5L3SB 5DEOA 1G5TA 2O0KA 1FYXA 3CUSA 2E89A 3Q7QA 3C2QA 3SSMA 1PG5A 2LYCA 3H0GJ 1M2KA 3GUZA 1Y3AA 1RQ2A 6NULA 4J0DA 4QLBA 3RYFB 5KYYB 1X7YB 2VVTA 1T5OA 3EDMA 2OAQ1 4R01A 4TT8A 4QPJC 3NEYA 3SZOA 1NJ1A 1SZCA 2BL4A 3T95A 4Z8XA 2MSWA 1CS0A 4NYIR 1CQIA 4LGDE 4C6RA 2GN9A 3LSRA 3F3MA 3OYIA 3TKYA 2ZXHA 4PDKA 4I6ZA 2NXCA 4WPGA 5IHPA 4B45A 1H4SA 1NJ5A 4ASUA 3CXUA 3OQVA 3UHAA 2ZUUA 1X7XB 3GLQA 1DC7A 2FQXA 4RY9A 1RE0A 1SJ9A 1ESEA 1N7SC 3A26A 2WAFA 3WZMA 2XRZA 3BTJA 1V37A 1XA0A 4F60A 3BBPA 1J0RA 3S17J 4MS3A 3JQ8B 4YP6A 1C8BA 3I4PA 1W73A 2IDJA 3Q2OA 1D5VA 4HQ6A 4D44A 1FP4A 5I7SA 1M7HA 3R7WB 1CUDA 3LKDA 1T2KD 4EW3A 1C1YA 3F3XA 2FW7A 2ZSFA 2WUFA 3EDPA 3U7FB 3BPXA 4RU1A 3FYTA 4B46A 1Y7LA 3UKGA 1YQAA 5MHTA 3JVVA 1NC1A 3IV6A 3ZW9A 2HA7A 1EE9A 2QQ5A 4D43A 1EIWA 3RHSA 3D31A 2GAOA 5LLQA 2ZE8A 3NTXA 4YXWH 3WNQA 3LOPA 3WIVA 2E43A 1KERA 3LUPA 4YAFA 1L0LG 1ZICA 1YO6A 5CNMA 2Y0SN 1EK2A 5B36A 5FUVA 4RDUA 2QA4I 2WAMA 4LJ5A 1RTKA 1JIUA 2GASA 3C6YA 5GZ3A 1MPTA 1PIWA 1MC1A 1ZA2A 4Q02A 3BGSA 2C2BA 3W1EA 4JBZA 3DEYX 3TDKA 4PNZA 4R9SA 1UXIA 4NC8A 5C1PA 5CGZA 4EITA 5EE9A 2QSHX 5CJJA 1T4GA 1FJKA 3PICA 1P4SA 2YO2A 4Q3BA 3G2MA 4JJEA 2WA2A 3KE2A 1KEPA 3HU3A 1B2RA 2JBWA 1NBMA 3F0TA 4KI7A 3V7NA 1A5BB 2XXAB 3IP7A 3NS7A 1P29A 3PSAA 4HDCA 4BIIA 3CZMA 4W9NA 3AR8A 5J5AA 2QHXA 1TYEB 4HY3A 3KL2A 3HVJA 1I4LD 3OZIA 4QHTA 1G6NA 1ETUA 3U19A 4YRDA 1GZUA 4DDWA 5F27A 2BGJA 1W7PB 1XCVA 4X20B 5I6DA 5C34B 3GFPA 1A02J 1JB9A 2VLBA 3CRQA 3VTPC 2ZJAA 4K46A 4WKOA 2EG9A 3F4KA 5JNLA 5J5CA 4BGVA 1NJGA 4IFBA 3FKQA 2O19A 3JQBA 1JCDA 4AWAA 1G7SA 3RYPA 2VDUE 4CCOA 1VQ4I 4TT3D 4BZZA 2BI7A 4ARZB 1H0HA 2GF2A 3WLIA 5DCYA 1D1AA 5KTSA 1E2FA 5F64A 2P2DA 2IBDA 2A45I 2VA9A 4HH0A 1G20A 1OW3B 3K1AA 3RT1A 2GXBA 2X6RA 3N59A 2GMWA 2D0IA 5LDHA 4CU5A 5GPAA 4EATA 1EX9A 5L3EA 4F85A 4GPEA 2LXBA 1B59A 1D2MA 4OOFA 5L3GA 2SNIE 1ODIA 3QKSB 2KBFA 4FOOA 5AICA 5H2FC 3OAKA 2VDJA 1AQTA 1Y48E 1KDRA 5FB3A 4HW0A 3QVSA 3DOEA 3D0SA 2FXVA 5HFJA 3MTIA 2H9IA 2ZJQF 3VVMA 3RM3A 3VU1A 4MVJG 5EG0B 3ABTA 1O5OA 4EW1A 4OBXA 2PKQO 3N1UA 2OBFA 2J31A 1GNSA 5KOIA 4ENKA 1IC6A 3QU4A 3QF4B 5JS7A 5BUCA 4TQAA 1RPZA 1JG3A 4EMBA 3CNHA 4IOKA 2EF0A 1KKLA 3TX2A 1J90A 1M1UA 2A94A 1DDGA 4I4TA 1HC7A 3V7FA 2NSLA 3H1AA 3ZX5A 1REQB 3HEAA 5DTDA 5KVSA 2QQBA 4YYZA 2WPVB 3IULA 5LMZA 3COJA 5BN5A 3HI6A 1U2GC 3B7WA 5AKYA 4HH3C 3CWBD 1TU3F 4WY4D 4QYMA 4PLCA 1UJ4A 5IVIA 4D5EA 5DXFA 1X8YA 3M49A 5C8ZA 1GKUB 1ODDA 3G2NA 2V5VA 3D6HA 4ISBA 4Y6RA 4DLYA 2FR8A 3REQB 4GMHA 3QVTA 3MGCA 5ANRB 2CL0X 3WWEA 2DYRH 1DNPA 5LD2C 5HS8A 5T7BA 2CNOA 2L69A 4INAA 3S29A 3VDMA 1VQ9P 2I7VA 3I39X 3FYCA 3H4VA 5IJ0A 5CA1F 1X8KA 1EFKA 3WL6A 4QO7A 3G5LA 5F9FA 1FX0B 1CG6A 4QOHA 2RJ3A 4PCAA 4ND1A 4U6NA 5E3NA 1ADCA 3GJYA 3ZR4B 1ID8A 3GJ5A 2EJBA 2NUTA 5H80A 2CFCA 1OMOA 3S2ZA 4P82A 4CHUA 5KPDA 4GPZA 4B76A 3LYLA 1Y3DE 2CNBA 2ZUFA 2ID8A 1GQFA 2A61A 2JI7A 2I1LA 3RS9A 2E4ZA 1M10A 1C0EA 1YYCA 3KXIA 3URKA 1ZRTE 4KT0J 4RS3A 5D8LB 1KYOI 5KI6A 3MS2A 5JJBA 1VDZA 4LF9B 1FT9A 3A37A 3E9YA 4KOEC 3BIXA 4GU5A 2I7CA 5HIJA 3FRIA 4QOJA 3O4FA 4D7NA 2N9UA 1NTCA 4KWTA 3D54D 5AVZA 1E1DA 4FIZA 1U9ZA 1OX3A 1GNTA 3TTTA 1WB6A 4KLZA 1E1YA 4FSXA 1YRNA 3FAZA 2VE9A 1PKEA 2XGEA 2ZULA 5T64A 4RGRA 3IR7A 1WRGA 3O2JA 1S7GA 1HJ0A 1BKYA 4PLFA 3FZGA 3G4SI 3TLYA 2MJZA 1A1SA 4NULA 3L8HA 2O6LA 2FUCA 4M0EA 3TGWA 3OZ7A 1W4ZA 3A14A 4P3OA 3FJYA 3VOAA 3DB1A 1ICIA 3IFMA 3W5IA 3DEWA 2O61A 3FWZA 4LZWA 4OHVA 3QE2A 3CVXA 3WXMA 1U99A 1VBNA 1N5RA 2Z8XA 1T98A 3A0HC 2CV2A 1Y7PA 1MOZA 3RS2A 2Z2IA 3G8BA 3P4XA 4DEXA 5JVDF 1RIFA 2B0JA 2BM8A 2EHDA 3GJ3A 2F1RA 2XNSA 2P62A 2H0AA 3NT4A 4O2BF 3R60A 3GN2A 5BSUA 1MO2A 2A45H 3U3JA 3UENA 2FX5A 4Q4JB 1YZTA 1FNDA 4MI3A 2NV2B 1B8VA 2KM1A 5GONB 3ZEIA 1YI2I 1B6RA 3GH3A 2QTZA 3W6NA 1HGXA 1JHYA 3UUWA 1CZNA 1QCZA 1QRUA 1P2TA 2J5PA 4P58A 2QWXA 1B8IB 2NZUG 1CEYA 3FTCA 1L4KA 1Q81Q 3BSYA 5REQA 1IEVA 3MMYB 1N6LA 1DBSA 2MA3A 4M1TA 4OLBA 3V55A 2Q6KA 3RIEA 2VRBA 2AT1A 1GILA 2H1WA 1BEEA 1JDJA 3FB1A 3DNMA 4PYNA 5K2OA 4V0LA 1E1LA 1VPDA 4OKNA 1SQPK 5H3LA 3GX4X 1SQBJ 1KAMA 2GRAA 2NSHA 4DJ5X 5HKBA 1W2HA 2PH1A 1ZRMA 1JCCA 3VH4A 3E9RA 1Y1VJ 3CEAA 6LDHA 2HPVA 1E8DA 3UFXA 1V11B 3NH6A 4AJLA 5IULC 1NTKG 3WB0A 2I6QA 4BCBA 2CLEB 4RL6A 2BKUA 1U0GA 4YVFA 3HMKA 1CZHA 1PS9A 3VJLA 3WY9A 3E8XA 1RQGA 5ITZA 5TB5A 4A6XA 1BOAA 2PT9A 4Q4LA 3AW8A 3LRPA 2WJWA 1C7RA 2CMDA 1DG9A 2NYXA 4NK5A 1P2FA 3M3YJ 5KHDA 3RDIA 3CG0A 3ND8A 3RKSA 1WJGA 4U87A 2BYVE 3MZWB 3O74A 2CZCA 5IYZB 3UMGA 3I54A 1DSSG 1MRSA 3N87A 1ZELA 2Q2EA 1XG1A 3MJ4A 5DM60 1VDFA 2PSHA 5B58C 4CQJA 5K7HA 1SVFA 2D7DA 4TT3A 1PZGA 3R5HA 4HWOA 2LRHA 2PKEA 5IOZA 1PT5A 3HUTA 2PO7A 4BWFB 4CVNA 3H1TA 2QMEA 1UEIA 1SELA 4KFRA 4MB0A 2FW0A 4FHTA 2D6FA 2NS0A 1E4VA 1BXZA 3KXKA 4X6XA 5EHIA 4V0KA 4TRNA 4BO3A 4R2MA 1WZCA 4TSFD 2FVXA 2X8JB 3RTGA 4B47A 1FXSA 4NR0A 2V7QJ 2Z5VA 2C8JA 4YJ2A 3KUCA 3QXGA 3CU5A 2O5RA 3IC7A 4QARA 3CJRB 3SSOA 1G9TA 3I6IA 4DPMA 5B6PA 1WEKA 2J9RA 4E51A 1S01A 2D7CA 3P7NA 2CZGA 4D8WA 2O8FB 3AE3C 4AL4A 4OVKA 4GRIA 4BU1A 5BWNA 2FFHA 5LM3A 4Y2JA 5HF9A 4D9KA 2FUG1 4WE3A 2DA2A 1KV4A 3JTEA 1JMVA 3ZBTA 4OFZA 1GCUA 2UUOA 2EFCB 2BY1A 2JFOA 3GA7A 2CVZA 2EZIA 4B0OA 3L4JA 1FBTA 1L0NK 4CT5A 2W6MA 2NUBA 1L9XA 3KDSE 2OL4A 4JY7A 3Q5GA 3JVIA 1Y3HA 4IHQA 4UHKA 4Q7EA 1NBOA 3P19A 4R0MA 3VYRB 4ID9A 4G0QA 1MDFA 1ORVA 3PRYA 4LF5B 3NB0A 1QL1A 2FX0A 1BJTA 1X9IA 1HC8A 1ZWLA 2ZW9A 2FMFA 1Y42X 1SBYA 2Q7XA 2MFZA 1WRBA 1ZTRA 4M71A 5EZHA 4NQWA 2NXNB 3EFOB 1LJUA 4FB5A 1XDWA 3TBIA 5BWCA 5CD1A 4FB4A 2IEYA 3ES9A 3TSAA 4WFJA 2CQ7A 2IEKA 1PX0A 5K3CA 3R7LA 5H2FE 1FZGA 3ZY5A 4X3OA 4G4SO 2LNDA 3HDQA 5BUZA 2YXBA 1VJGA 3AFIA 3AGQA 1CZOA 1DEHA 2VSNA 1IFMA 4DIEA 3C5WP 3QH4A 4HRAA 4P0PB 1G7CA 4FHEA 4F3YA 5GJWC 1RM5A 2IUYA 5KQGA 2ZWIA 1JO5A 4JXXA 3CONA 1XHEA 2EJWA 1Z4MA 4ZAFA 1E3LA 3L0SA 4TZTA 3CDIA 4R4LA 2L82A 2H18A 1MGTA 2ZROA 5IXYA 3EYYA 1SAUA 4I4IA 2ZXEA 2BXZA 1W0JA 1IAWA 4OVNF 3B1WA 1OLSB 1DI0A 1GL2D 3MT0A 3RIRA 1LF5A 4ZT7A 4QL3A 4BKUA 3TD9A 4ENTA 5EZYA 1YX5A 1ATZA 3AX6A 2FOWA 3K2QA 2Q5QA 4G4IA 4LZNA 3PUVA 4BFYA 3DE1X 2WQ7A 3JZDA 4M54A 2C5BA 2XB6A 3OYAA 4JEUA 3K09C 1Z3YA 5CA0A 2HLDD 3TAXA 3D70A 4W6QA 4NBVA 1RJWA 4RD1A 2DK5A 4FFLA 3F0CA 1LS1A 1F20A 3BWVA 4CEIA 2BLLA 3T7DA 4JEHA 1ZGWA 2VP4A 4IJ6A 1JBEA 2PBIA 4Z99A 3JXEA 4GP6A 1N7SA 4I8DA 1EB8A 1FS5A 4M98A 1L5MA 4QRHA 2PP6A 4WLUA 5FKJA 2WSCJ 1AA6A 5AKIA 3UK1A 2HA0A 2W25A 1FVOA 4OTZA 1TD9A 2VHWA 1ZLLA 3B6KA 4DQLA 1C7QA 3QEMB 1G60A 3OU2A 2QX6A 3OZEA 4Q37A 3BRQA 3T4EA 2EBFX 4TLEA 2HRZA 1NK3P 3GGPA 3ZWPA 1IHDA 3FNEA 1ZH4A 3T3GA 3ZDZB 3EVNA 4E88A 1N0HA 4C9BA 2G40A 2A1UA 2F4MB 4OBBA 2BOLA 1M1EB 1LTJC 1R6DA 4JV5B 1ZRHA 1P1RA 3L6OO 1MMAA 5AKXA 5L3DA 3HYTA 5A03A 1LJ8A 2OAP1 1I3OA 3R2PA 1PVOA 1UBGA 4ENNA 1IO2A 4PQEA 2E76D 4PPYA 2DPHA 1X80B 4ZO9A 5KYVA 3BRTB 4YIHA 4IRXA 2W6PA 1SPBS 4RETA 2O8EB 3IYLW 1TFUA 2G7HA 4CMHA 5DJ5A 1HYQA 1NUHA 3UGKA 2RREA 2QIWA 3WQBA 3B36A 4ND6A 3KSDO 4PZYA 3IKTA 4JUCA 3GFOA 4DOJA 5JJLA 1NVGA 4D0PA 4WX9A 3X2EA 3SC2A 4GWGA 2HF8A 3VRHA 3L2VA 2HR1A 3B85A 1QUFA 2VYCA 4G0XA 1H0SA 5AP9A 2YIUC 3E7LA 3A0HE 2GAJA 3KQGA 3E3NA 4NBLA 3EY9A 3HR4A 1FDVA 4AAYA 3TSCA 4P55A 4EA7A 4BO5A 4HG2A 3RYIB 1CVIA 3V2GA 2LGJA 1VKOA 1RFGE 4PSVA 2XZDA 2DBBA 4X7MA 4D0NA 3I9V6 3ENZA 4B7XA 2LC2A 2DHCA 3G02A 3PZRA 3ZPLA 2F8MA 1ZK8A 4URHA 4F3CA 5CDUA 3K32A 4QODA 3NBMA 4JEIA 4HA8A 1A0OA 1RLIA 2K37A 2OEPA 2QCOA 2W2XA 1BE3E 4NFHA 4JQOA 3P9NA 1K04A 2EKZA 1Z2PX 3LGSA 1BCCE 3ZHVA 2Y67A 2ZJ3A 4GKAA 2O05A 4JBGA 2NP7A 1U7OA 4OHZA 1YI1A 2JFWA 5KUTA 3FSEA 4IEJA 4EV0A 1WCWA 1OI4A 5CH3A 2R1TB 2JGAA 4DOMA 1I33A 4EG0A 3QQ5A 1J9ZA 2XNDD 5D5QA 1A9QA 1C0IA 3A04A 2Y0MA 4PIVA 3PPIA 2X13A 3S2IA 1O94C 1HWTC 1DC3A 3C70A 4OSPA 4N0MA 3ZJ4A 1JH8A 3N5KA 5LA6F 2G8LA 5TPWA 2CQKA 1LT1A 2Y0BA 2H6BA 1Y33E 1X3ZB 4LBZA 3TBFA 4B6PA 3AI2A 1U2GA 4N5IX 5I5GA 2QTWB 1MOPA 2XDJA 4Q15A 1FMCA 3LLCA 3VJMA 1WQ4A 4PO3X 1WW2A 2VBCA 3FKSA 5JU6A 3DMHA 4RF2A 4ZT2A 2EKBA 2HA5A 1Q0UA 1JA0A 5D6OA 2VBGA 2C0PA 3A6KA 4ETSA 1NF2A 1YDMA 1X77A 1APBA 1D0YA 3GTQJ 4XR4A 2C29D 1UP6A 2HNHA 1L0LD 2CMKA 1KSJA 4INZA 3CNLA 2XYPA 1BGXT 1JDBC 1TJ5A 4UV9A 1LI7A 4DIDA 1LBTA 3GJ0A 2PU7A 4H59A 1KDYA 3FDXA 1PP9D 2RBGA 1YI0A 3H97A 4HAXA 5AJTA 4LGMA 5FTNA 3NG1A 2QM8A 2FSGA 2BLNA 4EJTA 1N5IA 1FYVA 3ELYA 2EK5A 4GPAA 4CYCB 4GP9A 4UREA 1MBJA 2PPVA 1S3SA 3W8RA 4EI9A 5IYDJ 2GI4A 3GQBB 1LJ2A 2I2CA 1DMSA 1DWUA 4X1OA 4EZEA 1JAHA 3LSTA 1E79H 2H16A 4F21A 2AF4C 3KZZA 1P62B 5H1YA 1M9NA 3PKJA 1H0TA 4J7XA 3QZUA 4ZDWA 2Z5UA 3BHIA 1RAEA 1ENOA 2W4IA 1H9TA 4JELA 1CR0A 5CJ0A 5C3EJ 3BYZA 3QKTA 1H23A 1AA0A 3GLSA 4K2HA 5JZSA 3HKZA 4EUEA 1DTWB 4IX9A 4DZJA 1OH7A 2IIQA 1OXXK 5JYBA 1XTZA 4I76A 1SUAA 3V7UA 3GRCA 2G09A 5BQXA 2IHNA 1FE6A 3RJMA 3QIVA 3NBZC 2OHXA 4P5DA 2PUFA 1BDIA 5E1BA 4ZOAA 2DKOA 1JM0A 3UK6A 2AJLI 4BUPA 2WJ4A 2FOLA 3P9YA 2J7PD 3IKJA 4CMCA 3MXOA 1ZG1A 2E71A 4OHKA 1PJZA 1OZ0A 3EZFA 4LCJA 1ORIA 1WHTA 1EWTA 2W00A 3PFCA 4UB8H 3IDOA 4ANFA 2PLFA 2QBYA 1SK8A 2GPSA 4NNJA 4H7IA 5J2UF 3CVJA 1CIPA 1A77A 3WSVA 1SQQE 3SHOA 3KZIE 2OHFA 3V9AA 5IX8A 1RR7A 3HTSB 1GUFA 1SCUA 1Z74A 5HW0A 3K1YA 4UFPA 2P2ZA 5SZHB 1DHTA 3FMRA 2HCTA 1K5GA 1MQ8B 3RGUA 5TISH 2AYYA 1SBZA 1LKZA 3AV0B 2Y1CA 4IVPA 2DA5A 1E18A 2W2PA 1S3GA 3WODF 3B70A 3D8TA 1N6PA 4GMXA 4P3YA 1WTCA 4M0UA 3BGDA 3AP1A 2BBTA 5LPNA 5JYDA 1OIXA 1Q0QA 3GGJA 2X2OA 1T0JB 5LJLA 2YSRA 1FPQA 1F5SA 1HDOA 2NTVA 2HBRA 1RF1C 3K20A 1PT6A 3UJ3X 2WM9B 3T9AA 5HDQA 1XYVA 4BDZA 2N9BA 1QTIA 4UDYX 5CVIA 4XE5A 1QZ3A 3ZV6A 1I4OA 5ICEA 3P9CA 1H3EA 1KP2A 4WBNF 4IS2A 1A6QA 4A92A 2AUNA 3KXPA 1COWD 5KKZC 5G02A 1JJIA 1JE0A 1NR5A 3D71A 3Q1KA 4XQEA 2PYIA 3TD6A 4YASA 5AKEA 5EIXA 3LK7A 4MKGA 3BTCA 1NTMD 3BSSA 4YMUA 3L0CA 3JRNA 4U5XA 1NPTO 2HBQA 1JFLA 3E2PA 5JFOA 2M2EA 4ABZA 3WTVC 1QKKA 2JLRA 3BY6A 3MEQA 3AVTA 3LUKA 2XKBA 4ZPJA 5CA1B 2P8SA 5F1RA 1R74A 1QNFA 3IQXA 1JA1A 1JI3A 3WWCA 2NUPA 2BE5F 5AW3B 2HSGA 4RV9A 1I1OA 4ZI7A 1VE6A 2HYNA 3ZJVA 2Q2VA 2VXCA 4Z1MA 1WWXA 3PC8C 1O3YA 1BU5A 4G0PA 5CB6A 1RC1A 3R3VA 5HKOA 3WGGA 3ROMA 3ZCXA 3V4QA 2XB8A 1P84I 1P0IA 2A92A 1HFEL 4TSRA 3F71A 3ZHQA 1AS2A 3AHFA 3AE5C 1U28C 3I53A 4Z0NA 1G2HA 4BDYA 3SD7A 1DWQA 3GTKJ 3T8YA 2VKDA 1FBUA 5K0NA 2QPAA 4TPKA 2QX8A 1IN1A 5JRZA 4Q9DA 5TS2A 2VJDA 3L8CA 4HZUB 3CM0A 3HQ4O 3BXOA 1AZLA 1NURA 2EFJA 4JIMA 1NRXA 5E9AA 3AHEA 1T56A 1X13A 3CH7A 2YXNA 3F5HA 3BRSA 1JSLA 2D2CD 4P6VF 1YB6A 5FLXZ 2EYQA 3EVCA 1Z8DA 2MMGA 3OSZA 3R1IA 4IXMA 1S89A 4PTYA 3R5KA 1BH2A 1T6NA 1VQMP 2XQVA 4C0QC 1KBZA 4AC0A 3CNNA 2LD5A 3JVEA 1ZUNB 2OQVA 4Y1RB 3RPEA 4B8ZA 4E7HA 3TEFA 3ZMSA 1DAIA 4HF1A 3Q5DA 1HDYA 4GC9A 1NGMB 5AHXA 4MYRA 4CMBA 1ZQ1A 5LXTF 1QHFA 4RB1A 4WZBB 3FI9A 4FYPA 3DVLA 5IARA 1T9BA 4YY3B 1E60A 4MR8A 1R7JA 2K87A 1UQTA 1OBHA 3CWBG 3F7NA 4PLWA 4ZJPA 4I2LC 4HEA1 4DJFC 1X2NA 2WSIA 1JDSA 4W99A 3HM2A 4D4JA 4IJVA 3CX5E 5JVDB 1KI3A 1V9LA 2HT1A 5C1BA 4IX7A 4KK4A 1XJ0A 4QVIA 3WE2A 2E2HJ 5F51A 3EPJA 3RUFA 5TGDA 4RAFA 2JMWA 1OXMA 1NAHA 4O2BB 1EXIA 3VC7A 3TRKA 5D1NA 2A68F 3M83A 4N7RA 4BNNA 4FLEA 1KO5A 3P5BA 5IZCC 3ABVC 4UMVA 1UWKA 2HA4A 5BMVA 2B6NA 2K9QA 2ZUDA 4KE6A 4IDEA 1A82A 3FYSA 1EFHA 2OAGA 1WBBA 3GYHX 4MDYA 3TOBA 2CDBA 1RXWA 4ZGWA 3W06A 4NP6A 3WLNA 3MS7A 1VL5A 4XSVA 2RNJA 4J3FA 4X6AJ 1EJ6A 3UIAA 2JLCA 5IN5A 3HR8A 3JV7A 1XXHA 3ZBUA 2AZTA 2QP9X 1FLVA 3K9CA 3N3AC 2BONA 5EJEA 5A5GA 1R8SA 5IF9A 3PD0A 5LDGA 3QYFA 3WGIA 3BERA 2WLSA 2GN1A 4DC1A 4XM0A 2IHBA 2FP3A 2I71A 4LGCA 4L78A 2P4EA 2ZLBA 1F5TA 4JYMA 1GXSA 2FWBA 1OE0A 4NARA 1E96A 2HDOA 5EY5B 3ISPA 4P4SB 4IDNA 1JJBA 2X8LA 2OOSA 4X45A 4V24A 1GTJ1 3FFTA 1UK9A 1CCWA 3K09A 3H9CA 4CW7A 3LIIA 1NFQA 2JHGA 1YDEA 4MX8A 2J5UA 1G3RA 4J0EA 1QRDA 2Q3EA 2C2MA 3SS9X 3AEXA 3ZXUB 3QI7A 4NAUA 3ND7A 3PIDA 3Q2KA 5HM6A 1BE1A 1RM3A 5TRTA 3FGOA 1KNXA 5DHRA 2QNBA 2IOQA 3HKDA 4GRAA 1BMDA 1LC0A 1LF0A 4N7BA 2YOGA 3IQEA 5CJ4A 4AVPA 2QKYA 5KKCA 1RPNA 4R1MA 2HMTA 4LBWA 1MQ9A 1ZL0A 2PX3A 4FYKA 5IJZA 3OPVA 3C7JA 2JTVA 1VCNA 1XSDA 3V2RA 2BM0A 4BB6A 5ALHA 4DRXB 2OAZA 2GLOA 3D4PA 4F3RA 3KSZO 2PXCA 4M99A 5AHOA 3O2NA 4N5DA 5C7OO 1RXCA 1JP7A 2JAHA 3TNDA 3GO4A 5SZKB 3K69A 5TC4A 1YF3A 4MNUA 3HD7B 2JANA 4MAMA 1DEEG 5CCDA 3B52X 1WABA 2DU9A 3SQXA 5DFAA 1P84H 2C00A 5KWEA 1SIOA 3AFGA 2CV0A 4RZ3A 2OTLP 3BG9A 4OMCA 4J0HA 2GETA 2ECBA 3NIGB 4GXRA 3LXXA 1AZTA 1XD2B 2ZO4A 3GVIA 1FTTA 3NVKI 2EX0A 2XYVA 3FTPA 2I7XA 1Z6TA 1MTZA 4HUQA 4AQ7A 4P0QB 3BVPA 2AZDA 3NWSA 1LTJA 4XQ0A 5K6RA 4MYTA 2WQYC 4ZU3A 5JJCA 3SIWA 3V8LA 5FWYA 1X1PA 4UNPA 4YMTA 1OR8A 1YVRA 1UM8A 3R41A 2A6HF 1JLSA 3UR3C 2OD2A 2MINB 4B44A 4CEHA 2Q3HA 3OZVA 2FQ4A 3M9WA 2G17A 1E0KA 3AY0A 4FX0A 2V7FA 4INJA 5FOQA 3MD9A 4MCHA 4MLZA 4I9GA 1GR0A 4JUBA 4B2LA 2SCUA 3RUEA 3R4VA 1B6AA 4ID3A 2X0KA 5EN4A 4M89A 1AIPA 3MMNA 1SC4A 2L9NA 2GO7A 3QNMA 2VHXA 1NG1A 1PR1A 3U0BA 3BCBA 3AEBC 3GPBA 1W88A 2UUZA 2IOFA 5EE0A 3ZQJA 1R0SA 2HQNA 1NQTA 3S6JA 3EH2A 4MCJA 4BP8A 4OXNA 3CC2P 5ALNA 3MW8A 4F4FA 1AZWA 1TWGJ 5BT8A 1O95D 2EGUA 2RB4A 1Y5NA 2ZMEC 3NM4A 4GI3A 1WZIA 3P27A 2WIAA 1MZPA 4BV8A 1EXNA 4JA0A 4MOWA 4O9BA 4IUDS 2JN6A 4B5KA 1XZJA 1UJ2A 2AEEA 2FR1A 3NWEA 4WFKA 1MFPA 4W9MC 1BXGB 5M5BA 2R7QA 8GPBA 3WX0A 4Q03A 1XMQB 1TGYA 1USWA 1TCVA 2WU4A 3GFRA 5I3CA 3WU0A 4PJ0E 1J0XO 4BKOA 3R09A 2IY8A 2OCIA 2C3YA 3SEQA 4BTEA 1G64A 5M5YJ 1BJKA 4CLDA 1SUWA 4EG5A 2K5UA 2QYHA 2YKGA 3KQKA 3DZDA 3GFIA 1J1DC 2AV6A 5CVJA 1MAHA 1EKXA 4IDBA 2MTBA 4H7FA 5HGXA 5TEVA 4I98B 4LXIA 4IHWA 4K28A 3GJ8A 3ITNA 5CQGA 2P58A 3UZUA 1TL7C 4H3KB 2KIUA 2FPWA 3CUUA 5EUQB 2UZ0A 1HZJA 4WLEA 2I8CA 5FI1B 4C6TB 1YJ9I 4FGUA 4R3NA 1LA2A 1NRIA 5FO1A 3OM1A 1N1MA 1SVOA 2X3FA 1O94A 5AVUB 5IUKC 4ASUD 2FWAA 1SVLA 5KYXB 1B8OA 3JRWA 3W8FA 4YFVA 2DFIA 4IJAA 5LYYA 1THTA 4KYTA 1M1YE 2JVHA 4P83A 3IELA 4I5EA 4MW7A 4B3CA 3QW2A 1T8WA 2OY0A 1B3RA 3NPMA 2IU0A 1MDMB 3JD3A 1N9ZA 1GU4A 1MMGA 4ZALA 4EG4A 1C9KA 4C3OB 3M8FA 4E6EA 2X40A 2M8RA 2JHAA 1QRSA 4FGWA 2B5OA 4I1PA 3T54A 5A4MS 4PSAA 4FT8A 4H44C 2GYUA 4YLYA 2JD0A 2DTZA 1Q0RA 2Q07A 3FWYA 1V8OA 1YTZT 2E74B 3FPFA 1N3IA 3KKMA 2PMZN 3NWBA 3VR4H 4FS3A 4DJGA 1IK9A 1VE9A 4E5NA 3B9QA 1DOZA 2MHCA 4NU0A 3AIIA 4LTDA 5KNBA 2NO0A 4AJ2A 4GH5A 4DCVA 3LX5A 3M9HA 4O2RA 5HHTA 1MB0A 2R84A 4OAZA 3TG8A 1UCRA 3M6IA 2PLYA 1NBMD 2X58A 4IL6X 3T4XA 4DZRA 4YQZA 1ZH2A 4DW8A 3GF3A 3P20A 2B1JA 2FAXA 4PRKA 5IKMA 4PFKA 1WB4A 1WUIS 3BJAA 4GUAA 2ZB8A 2P2NA 5ADWA 1X7HA 1ZUD1 3BWMA 5ALRA 4Y2TA 2QZSA 5GAGJ 3K4PA 2L18A 1S4XA 4FHZA 1Z3CA 1A7UA 3RRNA 1DQNA 4JODA 2NXEA 3DE2X 4KFSA 1FX7A 3ADPA 1HQCA 3B9BA 1FTGA 2UZAA 2BAGA 2BIFA 4HN2A 3S5JA 1XMXA 4XWWA 2FE1A 3SKXA 1P6RA 3K6JA 1FOEB 3ND9A 4LJ4A 2QLLA 2E1OA 1HK7A 2PI0A 3GEPA 1K06A 1JT9A 1IFDA 2D1RA 5HG0A 4TSKA 1FUEA 4KP7A 3ZDQA 3PD1A 4A15A 4U2DA 1QV6A 4OYHA 4LX0A 1D9XA 2P2SA 2ZIFA 4CXFA 4R4MA 1OKRA 3BZUA 3DHEA 5C3UA 3NOOA 1HKUA 1ULBA 3RRBA 3QUAA 5KK1A 3OWXA 3ADCA 2P4QA 2BEQD 1JLLA 1T34A 1DUXC 5IWAB 1MF7A 1ZH8A 3ZKAA 4HQMA 4H1WA 3K2EA 4C4SA 2K85A 3CF4A 4WAUA 2AFVA 5FOUA 1XFAA 3SMVA 4AIKA 2R6JA 3ZG6A 3WE7A 1ZVVA 1XTVA 2AJTA 4B7CA 4C7KA 3DDNA 1FJLA 4PC3A 1I6WA 1XTKA 3SYRA 5LOVA 2VYQA 2X0FA 2VP6A 1Q77A 1A88A 3N6RA 4C3IJ 1RF1A 1K8ZB 1V8FA 1XZEA 4YN3A 2Q6QA 2CVOA 3G68A 3OIUA 4IDCA 2EGGA 2R48A 4NU8X 5LA6B 3C8VA 4YB8A 1RW4A 4EHKA 1P91A 2CDCA 4C4AA 2KISA 3J7AY 4ZYXA 1U9IC 2R65A 1BWRA 3RK2C 3VR5A 2YS9A 1DJMA 3GPDG 4K26A 4R31A 1MJNA 4Q9IA 1DG3A 3DE6X 4ROTA 3UF0A 2I22A 1VPCA 4DV6B 4EQZA 4KAAA 2DERA 4ZOLF 5KAIC 1W4LA 2BKEA 4KLRA 4DG9A 2M34A 2FOIA 4M4SA 1SCBA 3H3VK 1N5OX 3FOFC 2G7ZA 4UQLA 3MGBA 2OC4A 2VI6A 2WNHA 2YRXA 1R6RA 3KOZA 2YVAA 3RAPR 1WCIB 4F52A 3EBPA 4DDKA 3L2CA 4LV8B 3PC8A 2KSEA 1KWKA 3ESDA 2MSLA 3FIWA 3AINA 4YROA 2VJLA 4D25A 5F7ZA 1L7RA 5C3MA 5AVYA 1PZEA 4BLPA 2CKMA 1U28A 4A9AA 1MP0A 2HMAA 4YRSA 4MN4C 1PZFA 3GTPJ 3W5BA 4UTNA 2ZB4A 3TSZA 1XZKA 3V4VB 4MW6A 3QVGA 3LO5A 4XUGB 1KEEB 1B26A 1UMQA 3GMEA 1MZBA 4NXMB 3TZ6A 2HQ1A 2HL6A 1YUMA 3ZDBA 1HSZA 2KIQA 1F51E 4H16A 4LLGF 3K5HA 4E7IA 3I2FA 1PWXA 4CM9A 3OH8A 4DPKA 4DCPA 3RYCA 2QM3A 1J23A 3O6QB 1NFFA 3KD2A 1ZD3A 2R6FA 4CCAA 4HJGH 3T1OA 2DT7B 2XBLA 1M3SA 3K0HA 4NHJA 3L41A 2R1VA 3R7DA 2NM0A 5IH7A 5EWJA 2QJWA 2P5LC 2AN5A 2P77A 2WABA 1Z6PA 2X76A 5JSUA 2VSQA 3FOWA 2V9VA 1ZCBA 4V0QA 4KGDA 4RFSB 5D2CA 3BE5A 1VPEA 2JKYA 3ROGA 3AT1A 3QKWA 4BZXA 4JCOA 4XGQA 3BJEA 1EG7A 4IM7A 4WFQA 5GADl 5LCXA 1X1AA 2P4SA 2DY0A 2KDZA 4CV0A 1Q2UA 2LBFA 4IL6E 1OXBB 4KXNA 1FNSA 1TK2A 1W44A 1N3BA 3R44A 1M6VB 5J2UB 3L73D 3KZOA 2W24A 5LRSA 1U3UA 3HMQA 2P9TA 2JFZA 3E5MA 2FZLA 3R9KA 2H1KA 3W6VA 1O2DA 3OZAA 1D5YA 3L6CA 1HE1C 1R0RE 2LY9A 5U1PA 1MMNA 4AMGA 4LDNA 2EQRA 1HRDA 2JRLA 1R8EA 3F8SA 3PK0A 2WA1A 5LUBA 2BMVA 2CFIA 5IZCA 4GMFA 3RT7A 4AT1A 5BNZA 3G7NA 1NQXA 2H17A 1KR5A 2PJUA 4JMLA 3ZMTA 3ID6C 1JIVA 5KC9A 2ZB3A 2P2YA 1PP9G 1II8B 2IPLA 1TKAA 1SFOJ 1EK5A 3D4LA 2SHKA 4AJEA 3BS4A 4V39A 4L08A 3V8NA 3SF8B 4DDMA 3V4OA 5JD5A 1MBFA 1S4MA 1W4RA 1E0JA 4QBTA 1DGRM 3GAZA 3F47A 2JEEA 1ECBA 3PQ8A 3BN3A 3IMKA 1XAIA 3L75D 4Z4FA 4Q4CA 1EFVA 3E7PA 2VUIB 1SD7A 2WV1A 1K4MA 5B1SA 4C7XA 3LW5H 3E58A 2HU9A 3I0MA 2W2KB 2X4HA 3QELA 4RYDA 1SFCB 4WBNB 1DKRA 2HWVA 4O3MA 5FWXB 2G8YA 2QV7A 4RIGA 4CQMB 2J09A 3JSOA 2LK2A 3WBKA 3FM5A 1Y4DE 1UBMS 2Y4NA 3BXZA 3CKLA 1NOJA 2O8KA 2OUKA 3N0VA 1YRQA 3QE9Y 5JNRA 1Z7WA 3S1AA 4C3ZA 4ZV9A 2Q5EA 4I1LA 2WTUA 1SMTA 1U7TA 2IXFA 3MMXA 3T35A 1XZMA 5CT4A 4I6MC 4CRWB 1SKBA 1B14A 2N47A 2IYFA 1Z26A 1CQTA 2W82A 4EEZA 3HZJA 2ZIVB 1F0KA 2D8AA 4EM6A 4DN6A 3J81A 5CBNA 3OICA 4CM6A 2PZLA 1ZGZA 3GHGC 4XSXF 2AE2A 2O2ZA 3JSXA 1VJ1A 3RVNA 4E3WA 4BXOB 5JS1A 4F6LA 5IS2A 4A36A 3BMOA 2C2OA 4KXQA 3ZTTA 1F2DA 3AEZA 2LE0A 2BOVA 2TMKA 1H1TA 1U8YA 2Q6VA 2O5EA 1CY2A 2SPZA 4UTPA 4OB8A 2XDQB 2P0WA 4WNCA 1K6EA 2Q3FA 1L5QA 3VPDA 2HQRA 3G2JA 1T6ZA 4RVDA 1WCV1 1FIPA 2WM2A 1BGYJ 3ZN0A 3WKDA 3G8YA 3S2SA 3I37X 4AVZA 4FGJA 3U56A 1MMDA 3JQDA 4Y3UA 2CCKA 1ZRNA 1ZONA 3WL7A 3SZLA 3ODPA 2HQOA 1W2EA 2V7GA 2O3QA 1YZKA 3OLWA 2GUSA 1GXQA 2J7KA 1X14A 5K0BA 1NVVQ 1IFIA 1TTPB 5LXTB 1SGWA 3USSA 4XXHA 1KMIZ 3LA7A 2QQ8A 4LX8A 4MDHA 3T1NA 1O5IA 1S3JA 2V5UA 1JG4A 4HLUC 2PRJA 4HAVA 2O3UA 3EUWA 5G4KA 4X41A 4BE9A 1DV2A 4IQ0A 4ZMRA 4NEQA 4MMYB 4XN0A 3TL6A 4TLCA 3S40A 4AWBA 1PJBA 2RHBA 4V2IA 3A6GA 1F7UA 4I7EA 3DXJF 1ITYA 4UU7A 5CITA 1RWNA 4K6KA 2RHCA 4FYVA 1NTMG 3WMXA 1GA1A 3FSJX 3ROFA 2H54A 1T10A 5J1TB 4LMBA 3STYA 3PLAE 2O01H 5GTHE 5ARDA 4PPNA 1HFWA 4CR6A 1KAEA 4L3WA 2ZMEA 4QBKA 1L5YA 3EXAA 1IUOA 1NV9A 1B41A 1UBRS 1NI4A 4P32A 3OM9A 2HXIA 3LGXA 1PVDA 2YVQA 2WSSH 3WLAA 2H94A 5BMOA 2M7AA 3ANSA 4UNOA 3E8MA 3A4YA 3WTUC 1W0JD 4DWJA 1BXKA 2UZ3A 1JPVA 5HIIA 5CLFA 4RVUA 3ZHBA 4I7HA 4HSEA 3IVAA 3ZVRA 3KE9A 3PKZA 1YGYA 3AL3A 3G1TA 1H1LA 3USCS 3E9MA 1IY8A 1BSHA 3SDSA 2ZR8A 1YBVA 3Q9LA 5E2AA 5FOTA 5TY0A 3RAGA 1GV5A 3M1CA 3BFKA 1U4NA 3HL2A 4OHPA 5LZ8A 4LOCA 1I1HA 4NDZA 3KPHA 4M7PA 1NQWA 3FVRA 4MWBA 4K9DA 2VE8A 2XU6A 4MV0A 1ZGBA 4MR9B 3FISA 4PGHA 5E0OA 4PZ0A 2K3RA 4AKGA 1DMRA 4K05A 4RGXA 4FI3F 2WSEH 5FORA 4N01A 2O0YA 2PZFA 2Y99A 3GIDA 3SWKA 4R54A 4DLUA 3BIWA 1UM9A 3EDQA 2WF6A 3AM1A 4N49A 1N6KA 1N7SD 1L7QA 1N1GA 2Z9DA 2CEAA 5KAIE 1DBWA 2VPTA 3N39C 3I59B 3PDIA 3O03A 4DMMA 1L5LA 1HEYA 1PJAA 4I9UA 3WQHA 2J07A 4M37A 4HX4A 2NU7A 1A9XB 3X2FA 3QUBA 2VPIA 4AU1A 4QOGA 2CHUA 4HGZA 2ZSUA 2RHTA 2UV8A 3KYBA 3GFBA 1QC5A 3EA4A 5I9LA 1MBKA 1AGXA 1NP7A 4ZI3A 4JB8A 4EYYQ 3U31A 2XE6A 2N8GA 2QSIA 5C8VA 5ALOA 4L95C 3HOTA 1QTRA 1FSFA 2VO1A 3DFFA 4TTIA 1ISPA 4DMCA 3L05A 1ZNYA 1QKIA 4LOLA 1NOKA 4OIMA 4IJQA 1O9BA 1RI4A 1N8NA 5C46F 4MFEA 3AECC 4XVHA 2X9VA 3PITA 1ZN2A 3WHKA 3DS8A 4YUYA 4N48A 1MJGA 4WCVA 4R69A 3H1PA 3ZHXA 3C74A 4C1NA 2I3GA 4HPWA 2FSFA 1P6XA 3L70D 5DGIA 3C6MA 3IVRA 4RESB 4AIJA 1HW2A 1ESNA 2YRWA 4Q4AA 1XMOB 3FFWA 2R7DA 2YN4A 3GLGB 2NU6A 3IEKA 1QYVA 3ECHA 4HWKA 1XX5A 1MX9A 5DBEX 1L5SA 3HU2A 2YWGA 3WGNA 3BULA 3OPQA 5JMOA 3AE8C 2G1AA 1KYZA 4ROSA 3HUGA 5THXA 2ABWA 2M1BA 3SVZA 4YV0A 2XDVA 5EESA 1TCAA 3PHJA 4IG9A 1MBHA 1YRLA 1JKOC 2BCCJ 2O3JA 3OHSX 4OIPF 4IYJA 1JY2P 4C88A 3ITEA 3I6MA 4ZK6A 1TO6A 2VSYA 4A3SA 4R2XA 1LGHB 1LRKA 1MNAA 3LY8A 1PUJA 1M8FA 5F1OA 3GXOA 1N1DA 2WYOA 5DNEA 4LNUA 1DKOA 3UHJA 4WVLA 4O4IA 2J9FB 3C3JA 1JQBA 3M8EA 2JA8J 5M7EA 1D8KA 2O1EA 2HWWA 2REOA 2Y0PA 1LPSA 4Q4HB 3A1VA 4A73A 3EPLA 3O8RA 3M89A 1ZRDA 2XQFA 2QMZA 5CG1A 1DLIA 2P5SA 4E1VA 2CYCA 5JD6A 3OJAB 2Q46A 3KAKA 2PBLA 1OWPA 5KDLA 5ITWA 3H18A 4E2WA 4CR7A 1O57A 2MIIA 4UXJA 1XG5A 1CF7A 4XLFA 4YPFA 5FLMJ 4BY1J 2X5OA 2OCEA 2VNHA 5IAEA 4K5QA 1I3AA 2QD2A 1PNQA 5CVEA 4U5QA 3R9IA 3KD3A 1FSGA 1I10A 3CCSP 4YECA 1NK2P 3MYYA 4BO9A 3W0LB 4KUMA 1GHTA 3ACCA 1I6LA 4DBQA 1N2OA 5C4XJ 3F8TA 4KW7A 2DJNA 3A3YA 3GG2A 2BTQA 3WV5A 3STWA 2XH8A 5DGDA 4QM7A 4RK7A 1XRMA 1HSOA 2DLNA 3LY7A 5AM5A 1K7EB 5THKA 1UT8A 4PE5B 4YMIA 4D79A 3ANYB 1QMGA 3V4RA 1KTMA 1MBGA 2OLJA 4WECA 2IZOA 4Q48A 3FKSD 4QPOA 4B3HA 4P84A 1FBMA 2W83C 2FUG6 4H7DA 3OT5A 1LH0A 1U9IA 1FMTA 2YFQA 3N2NA 3ET5A 3V33A 3H1KG 1VL6A 5G0UA 4B6GA 4B3GA 1EHYA 1SXJB 1K6IA 1RI1A 1P4RA 1INLA 2R4TA 4DARA 4Q18A 1LNQA 1QG4A 7ADHA 3VC1A 2XUPA 5DTQA 2ZUTA 2E34A 4OYLA 3UT5B 2A5FA 3QUSA 3W9BA 1TWHJ 1NVEA 3D8BA 4JI6B 4IZ6A 4X66B 5HS9A 5CHEA 3ULQB 5FP0A 2WM3A 3KVRA 2DK8A 4M8SA 4XLPF 1D09A 4KN6A 2HDDA 2GZWA 5ETJA 2F8LA 3KZIC 3PYMA 2A14A 2ZETA 2C0XA 3ICVA 1DCKA 1T5HX 2WWTA 2YHUA 1ZOLA 1RE4C 4JGGA 5JJ5A 2R8PA 1TLFA 1Y7IA 4YUAA 1NTZE 1RPTA 1R8JA 5D86A 4GKKB 4H6XA 5D3QA 4UMDA 1MJGM 3E2MA 4E4HA 2GHTA 1ULSA 4RWZA 4UBMA 4EJSC 1RXIA 5U9CA 2BZSA 4RACA 2CLKB 3FVTA 4QTXA 2GM4A 3ERMA 4PZ9A 4F92B 4E5SA 1NG7A 1J20A 4K9QA 4BX9A 4WMLA 3D43A 1ORHA 2EGHA 2ZRPA 2A1IA 3PFIA 2JARA 4Q05A 2Q2NA 3WLHA 4YWJA 4CM3A 4Q66C 4D7AA 4DNFA 1AMUA 1JKMA 3WUTA 2X0RA 3RAFC 4MJ3A 1M2WA 1L8AA 3DBIA 1P4XA 4R2HA 4B9EA 1VQPI 4O2LA 1Y5LA 1LS6A 2REQB 2EH3A 1U9OA 2OV8A 3ESWB 2HPMA 2OXEA 2GZ1A 1SQSA 4UUSB 1O03A 1IB6A 1FP6A 5D5HA 1NF9A 2P7JA 3KCQA 1DDOA 3U9LA 4RVSA 5DWVA 4IDOA 4KJMA 3T97A 1DX4A 4ALLA 4N9WA 4M1EA 1W52X 3IODA 3FDYA 1W8DA 1JSZA 2ZQ5A 1APLC 2EFPA 2QE7H 3HBFA 4G8DA 4FISA 1NUSA 1A71A 1KY2A 1Q20A 3VTZA 4MUNA 1GAQA 2HS5A 2IELA 2IUEA 1WW8A 3STUA 3VMYA 2YXLA 1H3FA 2KS1A 2H4YA 3ERED 2EL9A 1CUUA 1KOGA 5JQWA 3A6LA 3IOMA 3BM5A 3NC0C 5JAZA 4AP9A 3KQWA 3MIIA 1RE3C 4P2GA 3SHWA 2Q4BA 2FFDC 3U1CA 2IKSA 4CMKA 1BCCD 1NUAA 3KYCB 1E6UA 4JLKA 1G17A 4FBGA 2NZVG 3WI7A 1II0A 2YZ2A 1NIJA 4H7HA 4E6PA 1AKMA 4RSHA 2I4RA 3ZQ6A 1VG0B 1GAJA 1PG0A 1IL0A 1Q1AA 5HE8A 4YP9A 2JFUA 1JXMA 1C50A 2HRBA 3AF0A 3MRVA 1RYEA 2VPYA 3FHTA 4F4JA 1TVEA 1XEXB 4YAEA 3NHLA 3WJ1A 3ZDXB 1JY3N 2NVOA 3P0FA 3M8KA 4H1TA 3RC3A 1Q92A 3WP1B 1S2DA 3PNOA 4Y28J 4GYYA 2GEUA 4CV1A 5LLTA 1VHLA 1LE8A 2IHZA 1WU8A 1XMJA 2VC2B 5C1IA 3L6DA 1TCUA 1T36A 1TNTA 1RETA 5F1KA 2I1WA 2IUUA 4X93A 1AWCA 2P1ZA 2WU1A 1C3OA 2EFOA 5A4DA 3D2AA 4ZOLB 4B6JA 1I14A 5A0FA 3KEQA 2IZ6A 5B2ZA 5IAOA 4G2NA 2C1XA 4Z1MD 2IH4A 1SFUA 4Q9KA 1JZSA 1YGPA 5FD5A 3HE3A 4X0EA 2JASA 3RIMA 2GQ0A 2XI4A 4FYHA 2I66A 4MUHA 1YULA 4K81B 1X4OA 3OYNA 1QPMA 3LDAA 5JV5A 4RQUA 3TW4A 1H8EA 3A7EA 4LZZA 4K3VA 4QEDA 1S0UA 2PJZA 2BJVA 5L53A 4DLLA 1UPAA 5GP9A 3NDIA 2KLUA 2FR0A 2HZ7A 4C2MJ 2LZ0A 3N2ZB 2BEOA 2CE2X 4IDFA 3E18A 3GHGA 1Z37A 1SQPJ 4ZFNA 4HI0E 2Q3MA 4UHCA 2KLBA 1KC8Q 4GHWA 1GPUA 1KZGB 4EAQA 4IJ5A 2EV5A 4N18A 1WOMA 4Y98A 3WU2H 3K8YA 3X1ZA 3AUXA 4BBPA 1QO7A 1VYTA 3NKFA 3O3CA 2B0CA 3SAJA 3HDVA 4DLVA 3EZ7A 1Z0UA 1Q1ZA 3HOXJ 4OATA 2GTPA 1JFRA 3GJ7A 1H0MA 4O29A 4BMYA 3OLQA 1XNJA 3V7RA 3QW4B 3B1XA 2JK1A 3W5DA 2V0GA 2J33A 4GPD1 3BCSA 4XA4A 2Y9ZA 4E0BA 1OWOA 4BWYA 1SQXK 2LTPA 2PAJA 1AXEA 2OUIA 5BSWA 3FOCA 4QAQA 3FNRA 4L9TA 5A6VA 4AQYB 4EX7A 1JZTA 3CY6A 1URQB 3CCRI 1M8OB 1KQ9A 2DTXA 4JLJA 4LOHA 1PQUA 1W0UA 1DIRA 1FEZA 5K45A 3EXIB 3ZH2A 4MQ5A 2V0CA 3O90A 4TM7A 4HLUA 1HDEA 3WK8A 3Q3VA 1TT0A 2GPYA 5HLGA 3BZWA 5L3QB 1N6IA 2UWMA 4H13C 1U8FO 5DMXA 5ABPA 3ABIA 2OM6A 4BNHA 4ZJUA 5C8XA 1PLLA 4P3XA 3PNTA 4YQEA 1VHTA 4ERNA 4ENJA 4AY4A 3VPBA 1UMBB 2POCA 3ZQKA 4MR7A 2B35A 4S2UA 1EE1A 4ZV4A 4KUHA 1BVRA 3RBZA 3MSXA 4JBIA 5J9FA 2ZT9B 2ACWA 4IDQA 2XITA 3K1JA 4L9NA 1AV6A 2JG3A 3QRWA 1G63A 3NEUA 4Y9UA 4DUGA 2Y2ZA 4AZ3B 1ZC3A 1O8BA 2QD1A 4MI6A 4QYWA 1A1VA 3RFUA 3AVUA 3HV0A 2OVBA 2J30A 1BEUB 5B30A 3E3MA 1P19A 1VQOI 3KPEA 2PSSA 2YXDA 2O2JA 4IXTA 3IO3A 4UVGA