2GM4A

An activated, tetrameric gamma-delta resolvase: hin chimaera bound to cleaved dna
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
183
structure length
179
Chain Sequence
b'MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASDRKGLDLLRMKVKEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDSIDTSSAMGRMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*AP*GP*TP*GP*TP*CP*CP*GP*AP*TP*AP*AP*TP*TP*TP*AP*TP*
molecule tags Recombination, dna
source organism Escherichia coli
publication title Implications of structures of synaptic tetramers of gamma delta resolvase for the mechanism of recombination.
pubmed doi rcsb
total genus 47
structure length 179
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2gm4A03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2gm4A02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gm4A01
2LP0A 3FIWA 5FKOA 1HCRA 1IGNA 1WGXA 4FTHA 2DA5A 3LSPA 2DA4A 3L1PA 4MLOA 2VI6A 3OIOA 4A93J 4MFDA 3WHCA 1JTYA 3S15J 3M4OJ 5BNGA 2D5VA 3ZQHA 5JLXA 2L7MP 3ZQIA 2LD5A 1MSFC 1YRNB 1IRZA 2R93J 3LHKA 1IC8A 2G0EA 3MKLA 1BL0A 3HGYA 2YUSA 1UG2A 4HNVA 2VPRA 5FLMJ 4A3FJ 2XPWA 5C31A 1F43A 2NVYJ 4W1UA 1T33A 1Q1VA 5C3EJ 5EG0A 4MFEA 3UKGA 1RKTA 3NAUA 4RBOA 1HDPA 2I10A 4IHWA 1OJLA 3G13A 1XC5A 5C32A 1ZR2A 1MBHA 4M3DA 5EYRA 5IP9J 2YS9A 5F1JA 4JP0A 1GT0C 3A02A 5EEAA 3GTKJ 5GPCA 4FISA 2MW8A 2N8GA 4Y7NJ 5EGOA 1MBFA 3BQZA 5F04A 3HOUJ 3IH4A 2ECBA 1I3QJ 5DS9A 5IYCJ 2RAEA 3GTGJ 3TP0A 1ETOA 2NVQJ 2EBIA 1HX7A 4QIWN 3S1NJ 3QPLA 2NS7A 2AO9A 2YU9J 3O8HA 2LTPA 1AU7A 5J1UA 2JA8J 1MBEA 2IAIA 1U9OA 3UJ3X 1JTXA 2Y9YA 4MO7A 2M0CA 2JWTA 2R92J 5IYBJ 3GBGA 3GTLJ 1FIAA 1HF0A 3ZQGA 1Z0XA 3TW7A 5EZHA 1ETWA 4D5CA 2LKXA 3JRHA 4CYCB 4JX6A 1WH7A 4DYCA 1RKWA 5F08A 1DU0A 4A3GJ 3GTOJ 4FCYA 1TWAJ 1VF9A 3BG9A 3GTJJ 3LSJA 1T56A 2E19A 3K2AA 1JKOC 4AYBN 3H0GJ 4XIDA 1F36A 2K9NA 3HOYJ 3HOZJ 2ECCA 1SANA 1GHTA 2HOTA 3HB9A 2GBYA 1LFUP 1Y1VJ 1A6IA 4J19A 3A01B 1ZR4A 4M6VA 4EEFG 1ZKGA 2CQQA 1Y1WJ 2VKEA 1HLVA 2Y31A 1R9TJ 3HM5A 2EQRA 2M8GX 1JJ8C 2EH3A 1TWHJ 4BKXA 4JX4A 2HYJA 1X2NA 5FJ8J 3JRAA 2MHCA 1TWFJ 3S1RJ 3SJMA 1B8IA 1ORKA 3LOCA 3S16J 3ZOBA 2O7OA 5M5YJ 2EZKA 5EDNA 2H8RA 3FISA 5C34B 3S1QJ 3TP3A 2KDZA 2IEKA 3Q0UA 4NDLA 4XK4A 5F0HA 4UUSA 2JA5J 1X58A 2DJNA 3BR2A 5IYDJ 2HDDA 3PO2J 4AC0A 1WH5A 2XGDA 5C35A 2CRGA 2QCOA 1MSEC 2HOAA 4D7MA 2XSDC 1ZGWA 1MBGA 1B72A 1CQTA 2DMQA 1AHDP 5FLVA 4A3KJ 1H88C 2OPTA 3Q0VA 2LY9A 1JT6A 2AHQA 2XPUA 3LNQA 5M3FJ 5E3NA 1U8BA 1H89C 3OSFA 3FKIJ 5DTDA 2Y9ZA 3C2BA 1LFBA 1I6HJ 2PMZN 5GP9A 2X48A 9ANTA 2L7ZA 1JUPA 2TRTA 3JRDA 3BTJA 1P7IA 1P7JA 2FD5A 3JRIA 2DA2A 1GV5A 2Y0SN 3HBLA 2DMPA 1POGA 2EZHA 3WHBA 5J1RA 4XRMA 3DEWA 2DA7A 3VPRA 3JRGA 1IDZA 1X2MA 3PKZA 2JA6J 3SFIA 1IV6A 4W97A 1PUFB 1ENHA 4C3JJ 4Y52J 1BW5A 4I76A 1H8AC 4MIMA 2H1KA 2FQ4A 1ZTRA 3DCFA 1PUFA 1HDDC 3ZQCA 1U9NA 5IOYA 2JA7J 4XICA 2HOSA 2DA3A 1IG7A 4UUTA 3S2DJ 4BY7J 4CYCA 1GUUA 2LFBA 1K61A 4JYKA 5EF6A 4A3MJ 1DU6A 3LSRA 3BR6A 1E3OC 3HDDA 1GVDA 2RSLA 3TEDA 3JRCA 1I50J 2HXOA 2LLKA 3IV5A 2DTZA 2NVXJ 2X6OA 4V2GA 2JJ7A 3HGGA 4BXXJ 2CJJA 3B6CA 5K7FA 4QTRA 4FE7A 3BTCA 2XRLA 4QSHA 3CDLA 1B72B 1JUSA 4S0HB 2DA6A 2E2HJ 1FEXA 3GUVA 1ETKA 4M3FA 4A3IJ 4M3EA 1IJWC 2XGCA 2K9SA 1RR7A 2CUFA 1GDTA 3MVPA 2R5ZB 3D1NI 3LHFA 3BR1A 2NOGA 3G1OA 2XB0X 1FIPA 5F0FA 3K7AJ 2DA1A 3BVPA 2M2EA 3LSGA 4M3GA 3RZOJ 4XRSG 3JR9A 1AKHB 1A5JA 1QVTA 4B1RA 1U78A 3HOXJ 1MH3A 3BTIA 5J1YA 1NK3P 2NS8A 1IUFA 2W48A 2ID6A 2E2IJ 2DMUA 3B6AA 4BY1J 2WV1A 1D5YA 1JKRC 4ABZA 2DMNA 1RESA 4G12A 2ME6A 5E3OA 1G2HA 1TWGJ 4RDUA 4DYRA 1WPKA 3A01A 2GLOA 2FX0A 1ETXA 4IHYA 1TC3C 2HI3A 3HEFA 4JX5A 1LE8B 1MBKA 3JRBA 1GV2A 3BR3A 3CMYA 4AUXA 1LE8A 3BR5A 1OCTC 4B4CA 5GPAA 1RETA 3IH2A 3FK6A 1NK2P 1ETVA 5E3LA 3QQAA 3ZQFA 3Q3SA 2NVTJ 1RPWA 1MNMC 5FKLA 1O4XA 1APLC 1W0TA 4X1EA 3W6VA 4BBSJ 3Q0WA 4I6ZA 5C4XJ 3TW6A 5EG0B 5M5WJ 3F0CA 2VUMJ 2EZIA 5IPAA 2E1OA 1JGGA 2M9HA 4D7NA 5M3MJ 2VKVA 5IP7J 3E7LA 2XB5A 4M3BA 3JRFA 3GTMJ 4XRSA 2B63J 4FE4A 2GM5A 2HXIA 1QRYA 1QVUA 2ID3A 4D5FA 5F27A 3HOVJ 2OF7A 1WI3A 4BBRJ 5HODA 3QPSA 3SDGA 5IOZA 1ZQ3P 3FK7A 2MGQA 2WB1N 2R5YA 4A3JJ 1MBJA 5E3MA 4UUSB 1BA5A 1ITYA 3O8GA 2DMTA 1ZK8A 1SFOJ 4IHVA 2LK2A 1XG1A 3HKZN 4A3DJ 2R7ZJ 2R5YB 4X6AJ 1OFCX 2R5ZA 2DN0A 2R0QC 1JKPC 1JUMA 2GM4A 2Y30A 2COBA 2CUEA 1VI0A 1IDYA 1OCPA 2ELKA 5F0CA 3I4NJ 2MG4A 4DZJA 5M5XJ 2O9LA 4A3LJ 1WCMJ 3BT9A 3A03A 3GTQJ 2P81A 1BW6A 5K7HA 2ME0A 3OSGA 4C3IJ 1FTTA 2K40A 2FJ1A 2XPVA 5EZGA 3GTPJ 2KT0A 4LOCA 2ZB9A 3G1MA 4B3AA 2XGEA 2WAQN 2QF7A 1EF4A 3BG5A 2LR8A 3RKQA 5EGOB 1VFCA 4A3EJ 2CQXA 3RZDJ 2JK3A 3G1LA 1VNDA 3S17J 1YRNA 3MN2A 4IHXA 1B8IB 4V2FA 1Z77A 4A3BJ 4A3CJ 1BJZA 5FKMA 5K7ZA 1ETYA 3S1MJ 2X9DA 2JMWA 4DZPA 1JKQC 4L5EA 5FKNA 1NTCA 2JN6A 3JREA 3S14J 5J3LA 4BQQA 4C2MJ 4GFBA 5C44J 1HOMA 2L0KA 1UMQA 1FJLA 1JT0A 3CQZJ 4DW6A 3BTLA 2Y2ZA 4IEJA 1AKHA 1UHSA 1S7EA 2HQ5A 2IBDA 2M34A 1XS9A 2MSYA 1JJ6C 3S2HJ 1ETQA 2EZLA 3BG3A 1QPIA 2E2JJ 5C4JJ 3ZQLA 1W0UA 2K9QA 3PO3J 4A69C 5IP6A 2L9RA 3BQYA 3HOWJ 3I4MJ 3OOUA 3RQIA 3ILXA 4C3HJ 3H3VK 1MH4A 1K83J 1TWCJ 5JLWA 3M3YJ 1FTZA 3NARA 2O8KA 2CU7A 3CCYA 3IH3A 4DYQA 2L7FP 5FKKA 2LVSA 3BR0A 3PM1A 2TCTA
chains in the Genus database with same CATH superfamily
2JLUA 5DM2A 4HFNA 1MGTA 2B1QA 3F8NA 3KLNA 2XMRA 3UAYA 3O91A 4CMBA 3B1FA 1GL6A 2Q4EA 3LHKA 4EJ2A 1O5TA 4G8DA 4I5DA 3FX0A 2ZI6A 2OOSA 5AI6A 1JXMA 3L72D 2NVYJ 4OINF 4ERNA 4CKEA 2EC5A 5LRSA 4EPRA 2EXXA 1YJNP 3LT4A 1G7SA 4UKDA 3RPEA 3ZQKA 2WMNB 2CGPA 4YXDC 3PFYA 3GTKJ 3CZQA 4Y7NJ 4CL0A 2ZYAA 2G9NA 3QIAA 4XWKA 1DX4A 2Y0CA 3DQZA 4AYBA 1YIJI 2LNDA 3LRXA 2IY8A 3FWPA 3R09A 4YJ2A 2B4AA 1KB9H 2JLCA 1E69A 3N8IA 1OPXA 3M5WA 2G9ZA 4MGIR 3A0HC 3KEYA 5IAKA 3QFFA 1WH7A 1O7FA 1W5TA 3EZFA 1FJKA 2PZEA 3H3JA 1RRPA 4AM3A 2CLHB 2MSEB 1LI7A 1A4UA 4X95A 5DBIA 4DLPA 5F9HA 4GZ5A 4WLVA 3T9CA 1S2OA 1CZKA 3SZRA 4EEFG 4LF7B 5AUQA 3K5IA 3PUZA 3D0KA 3OEED 5AHRA 3W2AA 3JWPA 5H16A 1K66A 5APSA 1XO1A 1YQ3C 1YQQA 3FISA 2IKSA 4DVGA 4AXBA 3L7IA 5ARDA 2VQ3A 3HE4B 3QBEA 3CRZA 3A04A 4BYMA 4C14A 5HQ3B 3D8BA 1UBTS 1IO2A 1K73Q 5H1YA 1Y3BE 1MO4A 3ZGXA 5EE9A 3EULA 2GUVA 5JRDS 5AW9B 4YAGA 3D1LA 2HEGA 3EXFB 4G0VA 1Z7YA 3TSIA 3O2NA 3WL6A 3TIFA 2AOWA 3RK2B 1T6BY 2OFWA 2J3EA 1U5AA 3B13B 2D2WA 5AO9A 2HYGD 3DP9A 1DQRA 4LBYA 1Z2AA 5J1TB 3HTKA 3KPVA 4IKFA 1G2PA 4RVSA 1IJWC 4ZREA 2VBZA 1R5BA 4PLTA 1MVNA 3BR1A 1J22A 2HCFA 3A6KA 2F00A 1H2WA 2VYCA 3CR3C 5CDFE 5FQOA 1HLFA 3T5XA 3VTFA 1SA0A 1NK3P 1HT1E 4M54A 2FZWA 4XUGB 4JK3A 3A1CA 1G3IA 1QG2A 2ZT7A 4JL8A 4EUEA 1Z6TA 2PJDA 2QK4A 4Q6WA 4UULA 3RTEA 1LV8A 3TI7A 1DDIA 1WBJB 3FH0A 3SSUA 3AH8A 4KI7A 2OO7A 4YPVA 2XHZA 3HB0A 3KTDA 2VK4A 4NL4H 4I6ZA 1DBIA 1JJFA 1P0MA 2HXSA 2MSWA 5DBHX 2E1OA 3SS7X 4HQ0A 3PIOF 1BI2A 1B2LA 4YUXA 1I6LA 1JDPA 5IZCA 5EMKA 5HZHA 4FW9A 2GYUA 2IYNA 2XGMA 1NT2A 1NQ5A 1I7NA 4MUIA 2ZUTA 1OX4A 3IWZA 1IAWA 3GFLA 2KRFA 1Z4MA 4RZQA 1OX4B 2EEZA 2KLOA 4LX8A 2VZ0A 4RL4A 4OP1A 4D9FA 4ENWA 2QYTA 1Y81A 1JCDA 3TFWA 2IGBA 4RTMA 3MAGA 3ABKH 1FOEB 3T5CA 1VYTA 3RW9A 1AY0A 1UOEA 2PEYA 5G0UA 1A3CA 4GWGA 3SOZA 3WIEA 4J03A 1UXIA 2WF9A 1BGYJ 2JDIA 4WESA 4G36A 2Y76A 1DQNA 3SDSA 3L4BA 4J6EA 4N3YB 1ZSVA 3AB3A 5EJ5A 3B3QA 1ELOA 1KQLA 3N0RA 3GAZA 2Z3WA 1MX3A 1DELA 1JKQC 1MW8X 4ND2A 5I01A 4XCXA 5F3DA 2D2CD 3ZHVA 1NUPA 3DLAA 1PO7A 1I2DA 2EZLA 4V2UA 4ZAYA 2OV3A 1BHO1 2FQYA 3KSAC 4BAYA 1AHNA 3ML1A 1KH3A 3JWHA 3R77A 1NE7A 5CD9A 4JOSA 4M8KA 3QKTA 2DF8A 2BFCB 3LUPA 5AHOA 3IJEB 5G41A 3LSPA 3NYQA 4I1OA 5YASA 1ZUIA 4H35A 3TAUA 4DW8A 1JSLA 2PUJA 1PNOA 4IDOA 5FOTA 3ZTTA 1GGMA 2XX3A 1SQQE 3IC5A 3KP2A 1QA6A 4G0PA 4DB4A 2DI3A 1SAYA 3A05A 1F5TA 3X2EA 5BVHB 4I9GA 3DOCA 4WX9A 5BOVA 4TRRA 2VTVA 4AECA 2QTHA 3EFBA 3DV8A 5DO9A 2FR1A 3G7SA 4FGZA 2C7QA 3HYRA 4IZHA 2ECBA 3BB1A 2D8AA 5CJJA 3IAM1 4XQGA 2F59A 2V6IA 2YNMC 4XR4A 1DBWA 3LL7A 3HUFA 3QXSA 4YJ3A 3V80A 2QN7A 1DHRA 3SNKA 5MN4A 2HKOA 4IMPA 1LQ2A 4O2RA 2FRHA 1IN4A 2V4ZA 3BG9A 5BPIA 4M2LA 3OCWA 4ROTA 3OYKA 4JBAA 1W96A 3H0GJ 4HX8A 3VKGA 4JX9A 2P3QA 1R8EA 1H8ED 3DLBA 3GUYA 1V5EA 2D45A 2DFIA 4LQ4A 1U3WA 4JOCA 2WE7A 4MKZA 3T1NA 2GD1O 4JX4A 1QQBA 1ORVA 2OSVA 2KOGA 2Q5JA 1TA4A 3ABLH 4WN9B 1NE2A 4QUIA 3WOHA 3CPSA 4OGWA 1UBHS 2O2JA 4CKZA 4D8WA 4IO9F 4OGQB 1SQVG 2ZEJA 1L4AB 3ZVRA 2D1QA 2XUQA 2D2XA 3OCUA 4UHCA 4ISCA 2DLDA 3NBYC 3L2VA 3C8MA 2V9KA 2RHCA 5CPFA 4BFXA 2Y9ZA 1JFFA 2Z6AA 3KPYA 4K46A 2A0UA 4ZH4F 2C5LA 3IKTA 5HTOA 1MW9X 3PB3A 2LWIA 1F9AA 2PCLA 4MN4C 5ITZA 1UCRA 2H9YA 3IXLA 3SYNA 1YQUA 2Y71A 1HDDC 2EX1A 1S2MA 3UFXA 4UUTA 2APJA 3D64A 4QUDA 1K7XB 1GKUB 2L4AA 2YUTA 2QVBA 2ZIXA 2RGUA 1KFCB 4HRVA 1DKQA 2IZ5A 4W5HA 1VHJA 2J5OA 1FNSA 4K88A 4OQMA 3TX6A 1ONVA 4Y0NA 2DH5A 2Z4SA 1L5YA 3DMFA 2XB2A 3OHMA 1R9MA 3HJGA 1JLLB 3PT5A 4MV0A 1GWNA 3G6KA 5TMEA 3OX4A 1PEDA 1QVTA 1BXGB 1MO2A 4EYKA 2ADUA 3HKEA 4BY1J 4QFCA 1NTKG 1UM9A 4MWBA 4H0EA 3Q3IA 5BUQA 3HEFA 1Q74A 2DH6A 3A7OA 1CQJA 4RS8A 4FBLA 4NFHA 4XD2A 3FWYA 4NFLA 4BRUA 1VSBA 3ANXA 4HFRA 3LI2A 1DBPA 1XJQA 3HA7A 3IV6A 2GX6A 4M0MA 3B02A 1D1SA 3CXHE 3JRNA 1UZAA 2OHHA 3T61A 2L2OA 3IPYA 3P7MA 2QUHA 2B8JA 4HNTA 2V6FA 5JDIA 3QF4A 2DPHA 5J2TF 1WI3A 4O8ZA 3A0RB 1ZQ3P 3CZPA 3A1NA 2ZIUB 3UZUA 1E2IA 5TVKA 2LK2A 3LDFA 2QIWA 4CV1A 5DHAA 1LQUA 3LCMA 3BCUA 4L08A 5M5BA 2X7HA 1UFMA 1CVLA 1G5QA 1I3KA 2A05A 4HLUA 3BCCG 2A59A 2GZHA 3URMA 3MFQA 5GV8A 4KFCA 2QJOA 5KYYB 4LOCA 5EIBC 2H7VA 4YONB 4ZTBA 3VC2A 2Q6VA 4KXUA 3MERA 1Y39A 3M4XA 1KZ9A 1QFJA 3ZJ5A 3WE7A 4K8RB 3TG2A 1NUHA 1KVRA 1GL2B 3W3AH 1PFUA 1MJAA 2PSJA 5HFNA 1PE0A 1F38A 4Z99A 1XZEA 2NVOA 4QDJA 4JASB 2VO1A 3QHAA 3GGSA 3BTLA 4CMAA 3HTKB 2AXTE 1VOTA 1VE6A 2PLNA 1K3UB 4LYYA 1L5SA 2YFKA 3CR7A 2XZPA 1NYQA 2HJRA 2WP8J 2IDMA 2JASA 4PNPA 2NNWB 3OOJA 2I6FA 1VQMI 2PT9A 4WXMA 2NQ8A 4QO7A 4N6JA 2B4TO 3OWOA 2ATVA 2XADA 4V0NA 4JKOA 1V5FA 1KJ8A 5FBQB 2FWAA 5FPSA 4AMGA 4KPUA 4LVCA 1I14A 1R5HA 5IM5A 4P2GA 1GGFA 2QY9A 3OZXA 5KTSA 2FLKA 5ED4A 3QFRA 4Q4JA 4LTDA 3CFYA 5KVCA 4YMWA 2XNDD 2IEAA 1BMFA 3IP7A 5H70A 1L4GA 2G7HA 4ZT5A 3IOMA 5DJ5A 1YA8A 3B6MA 4LJRA 1RAGA 1Z6RA 1SIWA 5GTDA 1CV2A 3AF2A 4MV5A 4O2BB 1UBEA 1PZGA 4KPEC 4QNMA 1WBBA 2QMOA 1Q44A 4I09A 1DPUA 2J5RA 5IJ9A 1FFSA 1VQ9I 3LY8A 1A8SA 2BKAA 5CJ2A 5FLXK 3AM1A 1TZ2A 2CVHA 1VF5D 3INYA 1JB9A 3TPZA 2HV9A 1ZHOA 1AU9A 4UARA 3TM5A 2UXBB 3BM5A 3TMKA 4B3SB 3TZHA 1B74A 3A4YA 4UUMA 4L9VA 1GU7A 3LYAA 1UDCA 3WJ7A 4OEHA 1QU3A 2WY2D 4I3FA 2YSRA 1GNRA 3QY9A 3H1KG 2YN0A 2G77B 1VHLA 4B4DA 1V8OA 1R0BA 3KLMX 3VU3A 3I62A 3ZV6A 5JLAA 5TGTA 3SX2A 4X6LA 3EIHA 3FVRA 4D0NA 1DMRA 2PGDA 2V0CA 3P71T 4DXAA 3NWSA 2QKYA 3AUAA 3DVAA 4UREA 5BO5A 3HXQA 2PZKA 1U0BB 3MXTA 3UMVA 2ZJFA 4YRCA 4BX3A 3LKZA 3OZAA 4QPZA 5DI3B 1N2ZA 2R4TA 3PJRA 1QDEA 2CF5A 4D80A 4PO9A 3OYBA 1PFYA 3M82A 2CNWD 4C3VA 5BVZA 2C5EA 1R0RE 4P36A 4H7HA 2BY0A 5KYXA 5AKGA 5A06A 1QR6A 3H1JE 2YWGA 3RCOA 3QNWA 1YJCA 4FE7A 3WMGA 1LC3A 2JSPA 2H43A 2R97A 2ECOA 3O8OB 1DRVA 2UWMA 5T3UA 1JQKA 4DN6A 2HMSA 4LKOA 3U7JA 2HQNA 4H4KC 3UK7A 2FN3A 3ZWXA 2QZ9A 3HNRA 2XTNA 3VNRA 2J9YB 2IP2A 2ID6A 5HM6A 1HDYA 1PQUA 4HS9A 3PQEA 2MWMA 4EG4A 1ZK4A 5J2UB 3UY4A 4C7OA 4OGFA 4PHFA 2HCBA 3DFMA 1VF5B 4KAFA 3O0TA 2GZSA 4I81A 3MT8A 3WY9A 2AQKA 4EG7A 3J7ZI 4IOKA 3OPVA 4LNHA 4P81A 1B23P 1ZVVA 2X6TA 1U28C 2Z5IA 5JAHA 3K0CC 1D1QA 1SC7A 4NYJR 3G8DA 3RIHA 4D9HA 1H42A 2AHRA 4NCBA 2CNLA 1QVUA 4IXAA 5CG1A 4TTTS 4ZP1A 1MNDA 4TVOA 2IHJA 3FMPB 4DQXA 4CM3A 3DZBA 3CX8A 5E3MA 5CFMA 3I37X 1CJKC 5CGQB 4GR5A 3ZG6A 4RGUA 1OFCX 4ZJUA 3Q9VA 3SX4A 3T9DA 4QUJA 3E27A 2H17A 4CCJA 1NJ1A 2CBZA 2MG4A 1J2JB 3AR4A 1U8RA 5L53A 1Z91A 4WXDA 1FOSE 3UWPA 4P53A 4WK4B 3NJRA 3QJYA 1EZ4A 4L0MA 1JEEA 2W6PA 3GLIA 1E9RA 4KO4S 4AUKA 4F7WA 2QP3A 4F12A 1P18A 4G5FA 4TWRA 4DLSA 3RWMB 2QN2A 5B66H 5DZSA 3EBLA 1KVUA 1DAEA 4GGOA 3ETGA 4D8UA 2X6XA 2YYSA 2ZS7A 1KH1A 3GMIA 3PHBE 1P7PA 4BECA 5FL7D 3TS1A 1GL2A 3N97A 1U8AA 4URHA 2H6CA 1QU2A 5BPDA 5GMOA 1MX1A 3TB6A 4PXYA 1TUGA 3DT6A 1TVKB 3RIXA 2LCQA 1EFAA 4J6FA 2ODNA 1VQOP 4QPPA 2OYCA 1P2SA 4U9HS 4M4SA 3PI7A 2CW7A 3UMBA 5HS4A 5DTMA 2DC1A 5H8WA 2JRTA 3U2RA 4PS1A 1D6SA 2B2NA 4LMYA 2OKGA 3X2FA 3CF5F 4WBNB 3NARA 1JMVA 5DT2A 5JFTA 1TM7E 3I5UA 3R9KA 3T3IA 3ZCXA 5JAZA 3IWFA 2CJFA 4H7FA 3KSZO 1G9SA 2J33A 2ZUVA 1E18A 3TL4X 4QBIA 4PU0A 3USES 1T8IA 1ISFA 1Z4LA 2WA2A 4U87A 3EFOA 1X3WB 2QXYA 4OHUA 1UG2A 1MCZA 2QTGA 2X8WA 4R05A 4ZXPA 5F9MA 3VMXA 3EGVA 3S0JA 1GCAA 1Q22A 1VI2A 1DIOB 3MD9A 5HWSA 4HATA 2V74B 4FGKA 4PEVA 5L3ZA 4XDYA 2R11A 1E1MA 1KO4A 3S1NJ 4ZZDA 2XD4A 3H04A 5I9TA 2V5AA 3QPVA 2PL1A 3EF3A 3UJ3X 3ESDA 1ZLXA 1PL6A 3PT9A 4RJLA 4NYIR 3C6ZA 2PUEA 3SM9A 1QCZA 3COZA 3PHCA 1B3RA 4Q9HA 4H17A 1N6HA 5HKAA 2XYRA 1QPZA 4ECEA 1GKYA 2P78A 1ZLYA 4D4HA 4DIMA 1K27A 1YDEA 1RE1A 3L7OA 2DQZA 1F36A 2YINC 1H4TA 1QH8B 2CCKA 1SQVK 2VDVE 4QOIA 4N4NB 3HDJA 3WAKA 1LBSA 2IYRA 1YB4A 4LXTA 3W9UA 2FYUK 3SS9X 2VPWA 2R1VA 2WYUA 1RF0C 2VBYA 2EFJA 2I1WA 4TL8A 2G6BA 1UKYA 4LUCA 4HDKB 4QG7A 2Y2VA 4RGSA 2FPSA 2IPQX 5FA6A 4JLDA 1ES9A 1XTCC 1BAPA 1XRNA 2HOAA 2R6HA 4LOIA 1ZN2A 3DWFA 2W6QA 4MP8A 2ZCUA 5FLVA 4Y7CA 3OYGA 1GTL1 1SZDA 3DB1A 4XR6A 4E33A 4B33A 2QZ8A 3IAOA 3HB1A 2VKQA 2B1GA 4RV4A 1IBCA 3E53A 2I65A 5ILOA 2F17A 2QM0A 4FTWA 1FBNA 3HG7A 4PHCA 1XMSA 2ZJ1A 2GM3A 5KZMB 3P5JA 1X14A 4NKRA 4EGQA 5IWCA 2OBXA 1T9DA 5KVRA 3KU4A 3CC4P 4CYCA 1NRXA 1SFCB 3BWEA 4W1QA 2XJ4A 5MGNA 4V0RA 5J2TB 2GJKA 3OT1B 4C07A 4OJYA 2C3PA 4HPJB 1C1DA 2NUBA 1U5TB 1X4PA 1LC0A 3TVTA 2A69F 1D0SA 4CR7A 3GWGA 4HG2A 1EX9A 3BGVA 2BY3A 3GXBA 1UJ6A 1GDTA 5CYVA 1OI7A 4N18A 4QPCA 4E5UA 4HF2A 5D01A 3NBXX 1XXHB 1IK4A 5GADJ 2WMOB 1T2DA 3FPLA 4JBWA 4QYIB 1RBQA 3R0XA 5GZ1A 2H1CA 1QZ3A 3ZHQA 3OR2C 4Q82A 4C6TA 4HW0A 5I7OA 4U4AA 1DAGA 3HBJA 3M07A 1Q0UA 4WIAA 1X80B 1R5LA 2WAFA 4RGQA 3U44B 4Q1DA 3FTEA 3TVYA 3Q9SA 1CS0B 1X7XB 1F2TB 2AL7A 2PJRA 3TW6A 1Z88A 1BJTA 3V4VB 3AETA 5FJIA 3LLUA 3T7KA 4IV0A 5BV7A 3CUVA 1NQUA 2W6NA 3CYFA 2Y0SA 1URPA 2IVFA 2X15A 3EG9A 2RCYA 4M37A 5HDQA 1NY5A 1TTYA 2PVSA 4B4OA 2H2IA 4C4PA 4CMIA 4QOEA 3ADPA 1E77A 5F2NA 5K6AA 5F76A 5JAPA 1QZYA 1EUDB 3IA2A 3RU2A 5E7MA 2C9MA 1UQRA 4TZ0A 4DA7A 2CXQA 4LIPD 4ER7A 5ICFA 3RVBA 1M90Q 2HPAA 2QTRA 3ONVA 4KUGA 4FFPA 5DX0A 1M7GA 4CWAA 3WMM0 4E7PA 2KPMA 3ADKA 1QK5A 4BLUA 1SXJC 4OMZA 4PLYA 4UDYX 1QHGA 4QTZA 3W2WA 3NNSA 4TL9A 4XIJA 3EK2A 3UEOA 1KOLA 3I0MA 3AUYA 4OIMA 1U1EA 5ALSA 4OQPA 2QSGX 2C99A 4X24A 4DEXA 2GA1A 4A5OA 1JTHA 4KT5C 1LUJB 4LZJA 1Y1LA 4GPZA 2UUCB 3MWKA 1YB6A 3KAJA 1FZFA 2OARA 4MUGA 4E7HA 3S1LA 1MJNA 5DRTA 1WSAA 1N2SA 4FGSA 2RMKA 4NTZA 4MLOA 3EX7C 2CB0A 3KQQA 1E6EA 3EFOB 4RK4A 1JH8A 2CNDA 1AK9A 5DXJA 2O03A 4LSMA 4AP6A 5BMVB 1C2TA 4DQ2A 3AFOA 3WG9A 1GG8A 4MHOA 3BCSA 3IESA 1JMYA 2CL0X 5CLQA 4MFEA 3IAUA 4YREA 1ZH5A 5HJ5A 1NOIA 1R4MA 3VP8A 3U59A 4GMHA 4OP2A 1DWUA 5ILQA 3TDZC 1GILA 3MUDC 2YMYA 1X3ZB 1X1DA 4ZCRA 4B4WA 2KKOA 3VAYA 3G2OA 1ESEA 3AF1A 2XNHA 3A7EA 1VYUA 3O8QB 1SQQG 3B5JA 2M0CA 1HH4A 4XSGA 1I0IA 1XQXA 2O20A 2GFHA 3PITA 4D5CA 2GA8A 1GTJ1 3RF6A 1QCYA 3ZKWB 5HGJA 1ZRDA 1G3UA 4K9LA 4OCZA 1GPLA 2QN8A 3NR2A 3LP6A 4D02A 1H6AA 1I3NA 1FFYA 1T1JA 3TAHA 4JUFA 1YYCA 2EYUA 1QKJA 4F97A 4PWYA 3H7IA 2ZNYA 2HIHA 5ALFA 4H13C 3SJMA 4YPCA 5I48A 3CUQB 1W36D 3OWTA 3F5MA 5AWFC 2FEMA 2AOTA 1S9HA 3CC7I 2QRJA 4ICIA 5GOZA 5IYDJ 3NBKA 2OKCA 3DYIA 3NHAA 4LFUA 2O48X 1ZGWA 1YAJA 1BDJA 1NVDA 1QL2A 5C7IO 2ZIZA 2CLCX 3OFJA 2LNBA 2OPTA 1P2TA 2R8PA 2X3FA 3I9LA 3F8BA 4AS2A 2WUVA 2IVMA 4BB0A 2WUWE 1Z4KA 4J0FA 1RKQA 1EA3A 1X1RA 1ZN7A 3KTOA 1H66A 3A3PA 3DA8A 5B2ZA 3V7NA 3PQ2A 2NAPA 2CFCA 4WJZA 5EWJA 4JJFA 3L84A 2C0CA 3OIQA 1D2HA 4UVHA 1YB1A 1M2WA 5JHHB 1RKVA 4N47A 2CDAA 3E1RA 1PP7U 4FETA 5TIIA 3ZBTA 2J48A 2B6NA 5ULLA 5JVDA 3K31A 4BXXJ 1CBUA 2GQ0A 1JEKA 1QGDA 2VRWA 1CGPA 2YYAA 3DEAA 1PX2A 4A3IJ 4EB6A 1MR3F 2IJGX 3L73D 5DM0A 3GLIB 3R6LA 5GM2A 1Z75A 3RTCA 1IY8A 3ZN1A 3P9PA 3DXZA 4GXTA 1CHDA 3NASA 3H9EO 3H1FA 4ASWA 2FFQA 2NTVA 2VTKA 4LNAA 2IIPA 3AR6A 5IH7A 1EH8A 4URZR 2HWUA 4G0QA 2ZBFA 1F06A 2V7XA 3JRBA 3ZWDA 4UBMA 2IPLA 2KYRA 3W67A 1V8PA 3OHPA 1AA7A 1H3FA 1J90A 2E71A 1OASA 3OZIA 3G2QA 2GVZC 2QT9A 2GPNA 3SYMA 1N77A 2AEJA 5LLTA 4I02A 2YRFA 4RY8A 2ZSIA 3EPKA 3QVTA 1FP6A 3GDGA 5I5EA 1Y63A 2FX3A 3OQIB 3WOVA 3SDGA 4MJ7A 4QKQA 4PD4I 2JI7A 3H4VA 1THZA 5ADHA 2G09A 1I6MA 1RRMA 3MHTA 5EIXA 2WZCA 5AK5A 2NNNA 3CLUC 3NU1A 1SS1A 1N32B 5JZ9A 4KEAA 5DRYA 3R23A 2IFTA 4M0UA 2QPLA 3LPAA 1RI7A 2N9BA 1IATA 5LZ7A 3E5UA 3A0BH 1LB1B 4DLVA 2DWCA 3WQQA 1OI2A 2P3LA 2P7CB 5JOQA 4BOYA 1MFZA 4R9RA 1BE8A 2Q1WA 5KKZB 2O8NA 3TOZA 3R4KA 2H1IA 3G0DA 2H1WA 1S5LC 4TTPA 4G0UA 1Q92A 1N75A 1NU1J 1FLDA 2PUDA 4NJEA 1RM5A 3R7LA 2IE8A 2Y0EA 1Z17A 2NTNA 3DGFC 4PXAA 3U1KA 3SHQA 2HI0A 1FC0A 1J2TA 1Y5NA 4GNKA 1Q7RA 2VG8A 3WIUA 1O6ZA 1QWSA 3LA2A 2I76A 5FOWA 4RHXA 3E6CC 5FWXB 4NULA 2NZJA 1OMIA 1MP0A 3WP0A 2IZZA 5KNBA 4QXAA 3A9CA 4WKCA 5CT8A 3GT7A 1CZRA 1TC1A 1WULS 1AVTA 4C7NA 5GV7A 4X5OA 2X3YA 2OBYA 2B2CA 4Q3DA 5F73A 4UHHA 3BDIA 3KYDB 2FQWA 1O96B 1FFXA 2P10A 3L01A 2Z9OA 1LZLA 4U0KA 1AZTA 4JMLA 4M89A 2X14A 4J0IA 1A2OA 2YJ6A 3A4TA 3FUVA 1A9XB 4PLCA 2O19A 2WVGA 2HODB 3REGA 4XW2A 5CURA 4AIKA 2W11A 3UB4A 4JBIA 4C0KA 1WRGA 1AQ6A 4LGDE 1RI1A 2A06E 2V3VA 2J09A 2JAWA 2VWGA 3O21A 3KHKA 4FLEA 1YI8A 2JEEA 2XZDA 3BSYA 2G07A 5F7XA 4OKSA 3L6EA 4TSKA 1JR3E 1E3WA 5DLEA 5JNSA 2IDZA 2M1BA 4KDFA 5EJIA 1UM9B 1V95A 3UFBA 1HF0A 4AZWA 5T41A 5AVOA 3HKEB 3EGIA 4C01A 1D1AA 2VUUA 3QU7A 3B1YA 1IY0A 1DX6A 1H3EA 1IHOA 3OE7D 5BN3A 4LTMA 4LD5A 5HP4A 2E19A 1BD3A 2C9CA 4MZXA 2ZRMA 1OAOC 2H6BA 1E7MA 4HN2A 3ESYA 1OR7A 3L09A 1N57A 5GIPE 2E48A 1BWSA 5B64A 2BE5F 3TL2A 5CLIA 1L0NJ 2EH3A 3VOSA 3JRAA 5IAAA 5DD4A 2VEDA 3VM6A 4M55A 1I7QB 4UB6C 1DKNA 1WE2A 3N76A 3S55A 1E4OA 3GFBA 4DT1A 3AE8C 1KONA 1E0EA 1HRDA 2E82A 3FMFA 3U1TA 3NFRA 1L7DA 3BR2A 2Q3FA 2E7WA 1NTZG 1NTME 3FZNA 4IV5A 1TLHB 2C31A 5DLPA 2ASEA 3B3GA 2C3YA 4N41A 2XUJA 4TLEA 2AW5A 4A6XA 4PZYA 1I80A 5AONA 4IICA 2DBVO 3TCKA 5KAIC 4WA8A 2XOKA 1P7IA 1IFNA 1W5FA 4Q3EA 1JN0A 1RQPA 2IW3A 3GJ8A 3Q1MA 3ENVA 1IDZA 3PS9A 1ENHA 1Q15A 5HUHA 2PJPA 3IUJA 3V7FA 1IBSA 4OHPA 1N7SC 4TMFA 3QE2A 1ZOLA 1EDKA 1RJ9A 1KJWA 2CXNA 1B7GO 5KVVA 3CDLA 2EBUA 3INGA 2M0BA 3H2ZA 2XNSA 4KQ6A 3O3OB 2XE7A 3OZCA 5FAXA 3BSSA 4DJEC 3BZBA 1JTVA 2DA1A 5DJTB 5CDGA 3HOXJ 2FSGA 4J00A 2F1HA 3HV2A 2P90A 4LZNA 1UMCA 2XBMA 3ETHA 3ROZA 1U28A 1PDNC 2DVMA 4TVKA 1SLQA 1U57A 4F7DA 1HZZC 4IO0A 3DEFA 1P7VA 1Z0JA 3Q1KA 3HWX1 1T2KD 3LL4A 4ENTA 2FPOA 4QSMA 1GAJA 1O4XA 2F8LA 5AXDA 1B1BA 3S2EA 1N8RQ 1TZJA 5BVGB 1ZM7A 2E2WA 1FDIA 1YI1A 5HDKA 5KX5B 2XIJA 3D43A 5IOZA 1CUEA 2GAOA 1J1ZA 1JS1X 3F6VA 2ZTHA 3WL4A 1G8MA 3U9LA 4PLZA 4B8WA 1HXDA 3S1KA 3DLIA 2DN0A 2ZAYA 2ZRNA 4CKBB 1N5LA 2P62A 2W71A 4F0JA 3ROTA 2EWVA 1HM5A 3CPWO 4BO6A 5K0JA 3SN6A 1K8QA 5H3HA 2PRRA 1LGHB 3BATA 3MWLA 4HQKA 1YQ4C 1G4DA 3QBVA 4CCSA 5BQTA 1WMKA 4R8HA 5KS2A 5JHUA 4R6WA 2JBHA 5LQNA 3C3JA 3NM5A 5LP6B 5K8CA 1PUJA 2XKKA 4O63O 2Y4NA 1TT5B 5JSZA 1OCOH 1MC5A 2VJYA 1C1DB 3FCOA 4K3VA 2FR0A 3UHOA 1HE3A 3ZGNA 2D0PB 3EUEA 1YXMA 2A9QA 1EESA 1OVMA 3QRWA 1U1GA 2I66A 2QQBA 3J80Z 3K1YA 4EBBA 4K3AA 3RL0g 3HWRA 4ZDIA 4EY8A 3GJQA 3DXJF 2OD9A 2H59A 2X4DA 3LA8A 1S96A 2F6CA 4IRUB 1HC8A 5EYPB 2CSUA 1E3PA 2P68A 1T95A 1KU9A 3TW4A 3WBKA 5AVUB 3PQ5A 2ZXFA 4AZ3A 2E5NA 4EVQA 4DJTA 4DTCA 3U3KA 1F5NA 4MW2A 4MV9A 1IRXA 1MSFC 2JH8A 2R87A 3G0HA 3R7SA 4M53A 3QPTA 1ATZA 1ZRCA 2ZWOA 3LDHA 2OXEA 2HK6A 1JDTA 2QOEA 1G16A 1RMQA 2IYZA 1MKYA 3Q41A 5BN1A 2HB6A 4MIKA 4CKWB 3WLTA 1E6WA 4WW0A 2LRDA 4QWMA 3P0HA 2NO6A 1DDNA 4HMOA 3DFGA 1A82A 1OI3A 3RTAA 3ZWNA 5JH7F 4EI2A 1JQBA 2IJLA 4EFLA 1CNMA 4AMVA 1HJBA 4HWGA 4K6FA 2POCA 2AZDA 1ZO8A 5TJ9A 1PD1A 2DDBA 3RSOA 1VMEA 2BFDA 3P7NA 2WU4A 5J8FA 1RAFA 1BN7A 3M6AA 1KB9E 4QYMA 3PGA1 3UENA 1LWUC 5IZ4A 3TH5A 3KP4A 2B3TA 4BLWA 2R79A 5BOSA 4PG7A 1C80A 1BCRB 3HH8A 2VOEA 2ZQZA 1SQBD 3IURA 3VOAA 2CJYA 2OD2A 3MIWA 1OGYA 1JI0A 3NIBA 2E1PA 2FWNA 1OFTA 2BTQA 2C4HA 3WU2C 3HNPA 3AEBC 2DSTA 1XHEA 4OIRF 4RNCA 2F6RA 1SVNA 3ABZA 4D82A 3O1HB 1E9FA 4Y2VA 1TU3A 4X85A 4U7WA 4XVRA 1XU9A 2VF4X 2R68A 4ZU6X 2BUAA 1GTVA 1T24A 2QNRA 2H8PD 3O83A 2VAMA 3JRGA 2ZITA 3M83A 1X1BA 2HA6A 3AEDC 5TB5A 4KOEC 3STWA 3IEMA 4KT0J 4B3IA 5LGUA 2I55A 5AW0A 2FSVC 5IOYA 1TUIA 2VDMB 4XIGS 4FOLA 3B9PA 4S1NA 4MYTA 1DUVG 2YDYA 2IIQA 1NW9B 1SXQA 3IAFA 4AY5A 2ORIA 5DNCA 4BE2A 1J25A 2OAP1 2RGBA 3VO1A 2GERA 2ZRIA 2Z09A 1OLSA 1ORTA 4F6RB 5CFPA 3ZDMA 3O8OA 3V8JA 4D0GA 3AL2A 5JCOC 5JANA 4LC0A 4YJGA 3CUOA 1RQXA 1C3OA 2IIVA 2PRYA 3BTIA 4Q7EA 1MH1A 4OOFA 2IUUA 1WW3A 4Q7QA 4UUBA 2FGKA 1OH5A 4P3YA 1YZLA 4RSMA 4U2EA 2KUBA 5AW9A 3CX5I 3TI9A 3VSEA 1V9SA 4QREA 2Q2NA 1XRPA 4YUYA 4UNRA 1ETVA 1KIFA 5E79E 5F2OA 4ZYZA 3AOEC 2K9JB 2OC9A 5FOUA 2VLIA 1TEXA 1TA9A 2W2OA 2ZSIB 1E0SA 1EE2A 2ID7A 3LD9A 3LHSA 4R9VA 5EMHA 4KLNA 1G21B 3GDFA 5LM3A 3L0BA 1JDSA 1T0BA 4F9EA 1GUFA 1XLTC 2Q5OA 4CFSA 1XTJA 3ORFA 4HDOB 3FTFA 1POXA 2CFRA 3WB9A 2GHRA 4NAHA 5BOSB 4GIFA 5EE3A 1MF7A 3VMFA 2R0QC 1UBLS 2QTWB 1QIIA 1D7OA 1H5NA 2JRLA 2YJZA 1J7KA 1NTOA 2BMFA 2C5GA 3OZRA 1YJQA 5E1WA 3FHOA 2RVCA 4L0ZB 1RYMA 2ZJ7A 1KI8A 3ABQB 2FSHA 1CIVA 5AVZA 4IOAF 1E5TA 3IV9A 4I0BA 2CQXA 3Q9UA 5CB4B 3D7SA 3S17J 4AJ4A 2RNJA 2OC6A 3PFFA 3CZRA 2FN8A 4MTLA 5K7ZA 1N86A 1M0WA 1VIDA 2PS3A 2F8MA 5CITA 4DV5B 1U4NA 2FPIA 2A1TR 5AVVB 4IQ0A 2CMKA 2A0KA 5AIAA 1G41A 3S2HJ 2HXYA 4IJMA 1BOOA 1HKHA 3IRVA 1E61A 2YWEA 2P65A 2WG1A 5K0EA 4EB3A 3VOEA 1I5OA 5KJFA 1RZUA 1VF5C 2NV6A 2E75B 2HHCA 4JI6B 4EB8A 4N7MA 5HRCA 5HFJA 4OI1A 4Y9SA 3OEWA 2BEUA 2BCCJ 3V3KA 3W7BA 2F4NA 2XAQA 4QHYA 2WZQA 3JW4A 3M9XA 5EP4A 4KVFA 2D5VA 2HCRA 1QO0A 3PF8A 5DW3A 2Y1XA 3VPDA 1S8AA 2A7QA 1UELB 3F8WA 1NDHA 1KKLA 3FAKA 2R86A 5HS9A 4AULA 2RNGA 2ZVPX 1B0PA 3D6YA 3ENNA 2J3KA 5IP9J 1HR0B 1KI2A 1II9A 5TS2A 2VASA 4O4HA 4HXYA 3QEJA 4LF9B 5BT9A 3QRFF 5FUWA 1HSOA 1N73A 1AD2A 1TIPA 4KYUA 4XYBA 1MB3A 5JECA 3EXEB 4D7AA 4W8OA 4MUHA 1U6KA 5FR2A 1HT0A 3WFIA 3OM9A 5F2EA 3BZ6A 1MEJA 4X41A 2HLDA 4J07A 1WJEA 1EB9A 2QROA 2VKTA 1Z25A 2KS1A 5FGMA 3Q0EA 3CCQI 3GU3A 2WWRA 4G0XA 4KZKA 1JQDA 1RRCA 1KYOI 4G4JA 1ZEMA 3AI1A 1AMNA 1R9TJ 3UMJA 3BBLA 1AE1A 4KWEA 4BU2A 1N34B 2HSEA 4F1KA 4DKXA 3DO5A 2R7QA 1G3TA 4I55B 4BQIA 4BX0A 1UKVY 1P84H 5DBOA 2XUOA 4GR9A 5FBZA 2QL6A 2ZZNA 3A0HE 1MORA 1VHTA 4TM8A 1WCYA 1PYVA 4YUVA 3Q85A 3FMRA 4FMBB 5ALOA 5TJJA 5M34A 5HLGA 3A1YA 2PU5A 1JHUA 1E66A 4ML3A 4GL4A 1WTAA 3STHA 2ZS8A 3C1DA 1Z63A 3GJTA 4BX9A 3PQ7A 4Q1FA 3JAMA 1QVGO 1BSVA 4A0SA 4B0OA 5JNUA 2I7DA 1QLWA 4EQ6B 3S4YA 5FB3A 2VTDA 1J2EA 4EGJA 3LVQE 4ZYLA 3BZCA 2D1FA 1J33A 2AG1A 1UZCA 2EFCB 1N5OX 4PD4D 3UIAA 4A0HA 4CLXA 1UJ4A 1X2BA 5DYYA 4M1QA 4BVGA 5KNLA 3N4XA 3KVOA 1XJ0A 3EASA 4W80A 1TK3A 1IFJA 3PNOA 1RTTA 1QIHA 3S2ZA 3F9RA 2A4KA 2GO7A 4YACA 4MI1A 1X7WB 3CT6A 4JC4A 1P1HA 3HL4A 3QQ5A 3RIRA 2RGVA 2EWNA 4XLHA 2O4CA 3GYGA 1JECA 2ZKZA 1XRJA 2O1JA 1LUAA 5TX7A 1JAZA 1BEZA 5L6LB 4O4JA 1JO5A 3DPTA 4BMNA 2GEDA 1WMBA 3AG3H 2O01N 3UNXA 3NONA 2Y1LA 2ONCA 5SV2A 2ZI9A 3UKOA 4UV9A 1Y9AA 2K7LA 1GV2A 2EZ9A 4DMCA 1U1FA 2GK3A 3GNLA 2C3MA 2CYCA 1O95A 1EP3B 3NORA 1NK2P 1P4HA 2JFFA 2HA4A 3BLYA 3CW2A 1GNQA 4E94A 3FKSA 2ZJYA 1VYVA 2J3MA 4Q9LA 5C4XJ 1LFPA 5F5LA 4ZODA 3RVMA 4IJVA 1HT3A 2ZB4A 3E7LA 3IUQA 4AJKA 3VPGA 3K73O 2J5QA 3EIUA 1DCKA 2IRFG 3OW2O 1K7EB 3MJDA 1PJCA 4B7AA 3W4IA 4PLWA 3ZV3A 3F6RA 3K6GA 2ZSAA 2OBFA 1NSTA 3VZQA 2IXTA 1W0CA 3L75G 1N25A 4M0DA 4IHSA 2CV0A 3KSBC 3T7CA 1U11A 1CJCA 3Q7QA 2HJGA 1QBGA 3JY6A 5DCUA 3FPFA 1N2CE 2RGCA 3TSWA 1R6TA 3PPIA 3QMVA 1ECFA 2XPVA 1NKNA 3HXKA 1QE5A 1TE2A 2WC1A 3PTZA 3E58A 4O2AA 5K6AC 3O4VA 5HQJA 3C6QA 1RZRD 2P77A 2YHIB 4RGRA 4TGLA 4FSDA 3RVLA 3UV3A 2F90A 1BJZA 4GVPA 2X6RA 4BVBA 2MYPA 4QRDA 4MVJI 2WR8A 4Y2SA 1QRSA 1PZMA 2K9MA 1P0FA 4L8FA 4IEJA 2HZBA 5KTPA 2VNAA 1XZAA 1SXJA 1Y1PA 1OYVA 3BSFA 4I1UA 2VC2B 5H3LA 4MS3B 1Z6PA 2JFHA 1B6AA 3RQIA 1FW8A 4TTQA 4NCKA 4DPKA 3TLJA 1H1LB 1GGJA 2O57A 2BFEB 1LH0A 3VX4A 2XUKA 3KKEA 4O4IB 1KOJA 1EIWA 3PUJA 3O94A 1J24A 1XE3A 2O14A 4E4RA 4GLFA 4I5FA 2REQA 3HGYA 3N8HA 1KORA 1KAGA 2ZAMA 4RTJA 1L1FA 4MTDA 1LCIA 2DCMA 1F2UB 2K27A 1GTZA 1GXSA 4GCVA 5HCNA 3HA5A 1TW2A 4OX9B 1GA6A 2ZJ0A 2K87A 2HO4A 1T9KA 2PRSA 3KAQA 1TT5A 4CCNA 1I3QJ 2B4RO 1Z6QA 2R8EA 2ISYA 4PVCA 2B0CA 4MO2A 3VH1A 1MZVA 4LF4B 3GJSA 1N5RA 3RVQA 3N2GA 2Z5GA 3ZQGA 2AIRA 2ZE6A 5JMOA 2GPYA 5KIAA 1CZUA 4LC1A 2DKNA 3GTOJ 2GAAA 2Q6IA 4LPSA 4KNYA 2PX2A 3EW7A 4GECA 2PA3A 3B38A 3AP2A 3KJIA 5HF9A 2IX3A 1QZXA 3BF7A 3WDLA 1XEWY 4Z7JA 5E1ZB 2HU7A 2EGHA 4P4GA 2HCJB 4M8SA 4L74A 3DAOA 1OWNA 4I4CA 4FGLA 2AZTA 2DU8A 4FDUA 3S3MA 2PLYA 5EP1A 3K1AA 2F4OB 1RVV1 4HDSA 1PZFA 3OKPA 2O1KA 3H5WA 3U21A 3CKLA 1JB0J 4JUCA 3KU1A 1Y3CE 2QX4A 3G5LA 2H51A 3MD0A 5BS6A 3IQIX 3BRCA 4L5BA 4YWHA 2GFQA 2V9ZA 3OHSX 1GU0A 1QMGA 3QTTA 4Q4HA 1TO1E 4UFNA 4RB0A 4YJ2F 2R6AA 1NP3A 5ER6A 1YK0A 1LFBA 2VA9A 4EJSA 3TOCA 4NFYA 1MMSA 1DIBA 4U2GA 2HGSA 1NZJA 2VHEA 1Q0RA 5TRDA 2WSMA 1LPPA 3D2CA 3A2AA 3KQPA 4RPCA 4AFNA 5CJ9A 3PFKA 1VQ5I 3GFFA 3H83A 3BTVA 4BU0A 1XKLA 1YZNA 4ARCA 4W6ZA 4Q9JA 3P32A 2H0AA 1RI3A 3DCJA 1GUAA 3D7LA 5CRIA 3D6ZA 3HGGA 5ALYA 3PWZA 2Q27A 1A2BA 2GHQA 2IS4A 3MGNA 3AQ4A 1LFAA 1N3LA 3CXRA 3JQ8A 1YF3A 4TT3H 3IBCA 4A4DA 4G5SA 4XVHA 3SWKA 3IC7A 2JKVA 4AG5A 1IOWA 1EYZA 1MG0A 3EQ8A 2HM7A 4CGZA 3PWTA 1B59A 2J9FA 1FNDA 4QEDA 1TYDE 3JX9A 2G9UA 1U04A 3NKLA 3DVAB 2IBZD 2IA1A 3JASB 4EEXA 4MS1B 2VK8A 2FW9A 4MRRA 4Q4JB 4YQYA 2DYRH 2JD2A 3KJEA 1KO8A 1ZD5A 3SJZA 3UB3A 2W2VA 5J1SB 1IZ0A 2WIBA 1PLLA 3VI4B 4CM9A 1A5TA 4LMAA 4XN0A 4AYTA 3CEPB 3R0IA 3FW1A 4V0LA 1ZMEC 3WDMA 5AQ1A 4ZMRA 4TZKA 4C4OA 1TM1E 3GEMA 4PV1B 2JGRA 1QRRA 2ZAGA 2VJKA 1EZVI 3E8SA 4X6AJ 1ZD8A 4CL8A 1I1NA 4C7RA 2VPXA 2LSOA 1T4MA 1WB5A 1Z22A 1EEHA 2PQ0A 1RQLA 3GK3A 2UUZA 1X39A 1A8PA 5FP0A 3K0BA 2B4KA 1REQB 4U0WA 2M2IA 2IT1A 1ACIA 1RJWA 2KB0A 4N6OA 1EGMB 1PYOA 4UNNA 4GZMA 3ZQUA 4CXMA 1GTSA 3FF4A 1OWMA 1D1CA 1H22A 2X2PA 3LFKA 4JLJA 1W4CA 4IUDS 1XR3A 5KSWB 3TLMA 1YRNA 1OLOA 4ARAA 3MQFA 2P2CA 4BFUA 3C1OA 4E2ZA 1B42A 4EA6A 4ZV9A 2IYSA 2XF2A 1I1GA 4IWYA 3WWOA 4BQQA 1HW2A 4HN9A 4BQEA 2UVQA 3CQZJ 3DBLB 2R7SA 1PP9J 1J8YF 1Y8ZA 1JJ6C 1ANKA 3SHVA 3C3DA 2AQIA 2I2FA 3I54A 5I7EA 4NRDA 3H3VK 1R3DA 3L6CA 4R0MA 2GK4A 1NQTA 4U0YA 3K6SA 1SRQA 5FBWB 4ER5A 2Z1DA 5AW4B 1UJNA 3N53A 2I4OA 3UYLA 3ETEA 2VS1A 1YCGA 4I08A 1HTTA 1RHKA 4ZYEA 4ZT6A 1GTRA 1W36C 3CJTB 2PV7A 5TEWA 1Y3FE 4DWOA 3RLIA 1IO4A 2VQDA 2HGCA 2HADA 2KIMA 1KZHA 4BRWA 3RGUA 4P7JA 3CPHA 1FJGB 3S8PA 2M6LA 3O26A 3EH2A 1XRSB 1PS0A 5JBNA 4HMQA 1S4MA 3M4JA 4RLHA 1RZRA 3B9BA 4IDPA 1PKEA 3VBCA 2DTEA 2ZT6A 1JI8A 2F9FA 1VFPA 1MJHA 4CR6A 4OQNA 3N0WA 4M0CA 5LB2A 1Y7PA 3QVSA 1ZOOA 4MVJG 4L2IB 3GBGA 3UJDA 5KKZC 3CVUA 4C9YA 3QG1A 1Y48E 2JZNA 4ZU3A 3V9AA 4CPDA 3SJUA 4DLBA 4YRAA 3OU7A 3HCDA 1R27A 1L0LJ 4A03A 4WK6A 3H1GA 2XDWA 4MW0A 3C39A 3TNYA 1JIIA 3NRBA 3B1WA 3W2FA 2W2MA 1GNTA 3BXGA 4ESOA 1I2MA 2WD7B 1F5SA 4RCZA 1DIPA 4N49A 2PMUA 2WPDD 1JHMA 2F4MB 5KLIB 2PT7A 3ONEA 4BMDA 4LDQA 1BGWA 5FIUA 1CJSA 3M91A 1ESZA 2G1AA 3KS9A 2XT0A 2D62A 2ILVA 1TL7C 3NBUA 3V8NA 2XT6A 2J7PD 4B3GA 3OJCA 2KJQA 1LX6A 3MTQA 3SQMA 3C5CA 4R2MA 1SO8A 1M76A 4ODIA 1XZHA 2QRXA 2Q9IA 2IT0A 3TZKA 2EZHA 2VN8A 3AEKB 3ZQ7A 3G1TA 3EWAA 2VP5A 3K0AB 5AVZB 3WK5A 4ZOAA 4IDDA 2K3RA 4TMVA 2H52A 2K4JA 1SB9A 5K3CA 4IOLA 4D6XA 3T06B 4NCXA 2ICAA 5LLSA 2OWDA 4PNZA 4E30A 2R7AA 1RFGE 2E36A 1ADCA 3H92A 4C1BA 5EHZA 2NVXJ 3PV0A 2NV0A 4O0LA 4DCGA 2FYNC 1GIAA 3NT5A 2GXAA 1QPBA 3WBBA 4K7JA 5JIBA 3R7WB 1Q2NA 3BD8A 4KFTA 5JRJA 3AWIA 1H9BA 4PZCA 3MTEA 1SQPJ 4GYGA 5BQOA 3A0HH 1JYFA 3OCVA 2G36A 3ZU6A 3IDAA 2NYXA 3JD2A 3IMKA 3KZ1E 4NVRA 4E7SA 1RH5B 4DZTA 3F5FA 1MBKA 3HPHA 4XZ3A 3FUTA 1E3DA 2V7FA 1NUTA 1W0JD 4KACA 1A7UA 1XVUA 3MJ4A 4AO8A 4UTNA 1W1UA 3L72J 3U3OA 3B3AA 4KSCA 5C18A 1GVJA 1Y4SA 1W8IA 3M06A 3KV1A 1T9HA 3HKZN 3ZE0B 5LQDA 2ZYUX 2GBIA 1VPLA 4KMSA 2IHNA 3VU1A 1EFHA 1VM6A 2C5AA 1SHTX 4GM4A 3M4ZA 5EFOA 4DQDA 2QN1A 3T38A 4GYKA 4EZBA 1CC1S 3TGPA 1SBNE 2QSUA 2J9ZB 5JC1A 3OY2A 2B82A 3TSYA 1ID1A 3PL8A 4ZYAA 2ZSJA 5ARBA 2YHBA 2XCSB 1VLHA 4M71A 5EA2A 1EWVA 4PFJA 3H3UA 1EF4A 3CPJB 3BCHA 2WU8A 1ZCJA 4P4TA 4RQUA 5CFOA 1U3DA 2J41A 2JK0A 1FOSF 2QHXA 3K0EA 1Z77A 1E3JA 1GUZA 2EJRA 4IQGA 1NLUA 2JN6A 3B8HA 4C2MJ 2AW3A 1T3UA 3A1DA 1RC1A 4XTCS 4LXYA 4XDHA 4B44A 4LNUA 2ZWVA 4HH1A 3LQ2A 4X92A 4EGAA 4RTNA 2MJLA 3F9IA 1HG0A 3L43A 3RG2A 3Q1LA 2CNBA 1A9OA 2QTTA 1NWCA 3PLNA 3LUGA 2BEQD 5GP1A 3RDPA 1BMFD 1QJCA 3IBFA 5C7OO 4EI8A 1NKTA 2DA4A 3NBZC 2K7ZA 3OZBA 3VR6D 3ZVNA 2UZ3A 3E5XA 4DV3B 1J8QA 4UHFA 2VXBA 1N4AA 1ZJJA 3K4JA 3MKLA 1PJ2A 3KYQA 1SVLA 1NQWA 2VPRA 1X80A 3HL0A 4EKDA 1BIBA 3NEYA 4MVJE 1OLUB 2VHJA 1XVIA 2YWBA 3GJXC 1IM2A 4DSOA 2GTPA 1NC3A 1JR4A 4B6GA 3R3WA 2XWQA 3RD5A 2YU9J 4MARA 5L7TA 1KK3A 2YJ3A 4MO7A 3WSTA 3H9UA 2DBYA 3JRHA 1LP1B 1Y1SA 2ZRAA 4DYCA 3VC3A 1HBXG 3FDYA 3W6ZA 1O8BA 5L3BA 2VI5A 2QD5A 1T56A 4B48A 2GKGA 3LX6A 3HYTA 5E38A 3JYHA 2C1XA 2QB5A 4I66A 2QTLA 2M98A 1RRVA 1Y5LA 2WOOA 3IYLW 2H92A 4EZEA 4Q16A 3TF5A 1U0EA 3T8RA 5B2FA 1LSSA 5GVRA 5CIQA 1H2BA 4BKUA 4D2IA 1EFPA 1E3EA 2BMAA 3U7EB 4OB7A 4L3VA 3T3MB 1PWZA 1KWKA 1MSEC 2WT7A 4D43A 1BCCG 2QUKA 3W5HA 4JB3A 2YV3A 5EJ4A 5COQA 4BFSA 2P7HA 4E7OA 1EVQA 3RYHB 3Q6IA 1XGOA 4DIUA 4YAKA 4YRVA 2Q0OA 4HOBA 3OFND 1KY5A 4ENKA 2E76D 4HH4A 2O3FA 3WV4A 3H7AA 4AUEA 4RB3C 3HZJA 1A8IA 3FTPA 3BAFA 2FNAA 2F5VA 1X9HA 1Z45A 2K9YA 3KKNA 1AB5A 4HAIA 6LDHA 4XDZA 2C7OA 2FQ1A 4I7EA 3MS7A 4DY6A 1FP1D 4XDGA 2Y9MB 5KLVG 4NBNA 5AI5A 4IGKA 2EFOA 3EXEA 5EPOA 1XTAA 1YITP 2NUTB 5AMXA 4CM8B 1CLEA 3TIVA 3RL0B 1YVUA 3H87A 1TFRA 3IAAA 1QVWA 4DSTA 1E62A 4XTRA 1E7SA 1UPTA 2C57A 1M57D 3GJYA 3ZOKA 4L22A 2EX0A 1D8KA 4NF2A 2W43A 1YA4A 3C7TA 3WKCA 1P0QA 4IJ5A 4MHGA 4IRXA 2W6MA 4INZA 4YWJA 2EV9A 4BGDA 2ENUA 1ZM9A 2PLWA 4MQLA 2ZYVX 1QUFA 3JARA 2GB4A 4RVNA 2A35A 3QENA 1DMSA 4ZVUA 1KTVA 3NAGA 2JLVA 4HXGA 2C5BA 4CM4A 5B53A 1S2DA 1G4HA 1AKUA 3PQKA 1C9MA 3NHKA 2WZ7A 2X13A 4CV2A 2C4MA 3FKJA 3U5TA 3A1EA 4HWTA 4FUQA 2NOAA 4LHZA 1Y5RA 3GFRA 2GAIA 3QI2A 3HO8A 1GUYA 1EHCA 3C3WA 2F2EA 1OIWA 3T3PB 4ZEOA 2O8EA 4E1AA 4YCLA 1AJEA 3KKPA 2A5WA 4BN0A 3SQOA 3OEEA 3M3DA 1LT9B 1GZ4A 4ZEVA 3R0QA 1DO8A 2RGGA 4MPDA 2QGZA 4MGHA 5JVGF 5ALVA 4NHJA 1P2DA 3MTBA 1W94A 5FUXA 1WZIA 4RKWA 3UWOA 2JLZA 3WQSB 4AG6A 1E6UA 4R2LA 4YLYA 3ZIDA 1I8TA 2JNWA 3LSIA 2C2WA 1BOAA 2OORA 1JEQB 2R7XA 5DP1A 3U1BA 3I32A 4AMUA 1CF7A 4HQEA 3VPFA 3HV0A 1ERDA 5EWJB 4FT2A 1CUBA 2H9AA 4YI3A 1V54H 1ZCFA 1DIHA 2AXTC 3LA6A 1ZISA 3M8JA 2WW8A 1YQTA 1X13A 1LKZA 1Y37A 1HDCA 4QXMA 1IN1A 3T1OA 4C7NB 4CQMA 1R37A 4QT4A 1BE6A 4J94A 3FIWA 3FETA 3NDJA 3UJ9A 4P4UA 1QX8A 4MPPA 3VZBA 3ITEA 2IGNA 3EMVA 1R8YA 2PH3A 2X6YA 4FNAA 1N0UA 2O3QA 1RP7A 1BL0A 1F4LA 1CZHA 3WNDA 5CU7A 2Z04A 2NRGA 1X7DA 3NM6B 3ZCPA 3H5AA 1U5CA 2HMUA 2Y1EA 1FUEA 1OVGA 2JCYA 1V35A 3N2IA 4UVGA 1R6RA 2VWQA 1NLZA 5DDIP 3KYLA 2YS9A 1EK1A 3PFIA 1OGJA 4F6RA 4YCNA 4CYDA 1HORA 4ZEXA 3ICPA 3GUZA 4LHSA 1RWXA 4KMRA 2DX7A 1Q1ZA 3IB6A 1J1EB 2AXNA 3GB9A 3Q0IA 4X20B 3UK1A 1BC7C 2OCBA 4N0EA 1L8OA 2WUEA 3MWJA 2XTMA 2IF0A 2Z9CA 1ETWA 2ZE8A 3J80A 3SNHA 1UBFA 1Q1EA 1Z18A 5AW1B 2VC0A 2CVZA 3V33A 3FYDA 2AN4A 5AKHA 3INRA 4XIDA 2AXLA 1LW7A 4WVLA 4RQAA 2P79A 5FFNA 3BH7A 1ZGZA 2QR3A 3KFLA 4B73A 5BSHA 4OXYA 3BAZA 3O38A 1FTGA 1UC8A 1C30A 1M2GA 3KZZA 2QRUA 3TKLA 2XY4A 2NNLD 4LJZF 1TMYA 3N87A 1F14A 5KAIE 1BVHA 3OY9A 5JZMA 3DOHA 3F74A 1CQWA 1CW2B 5BQXA 3BIJA 2O0YA 4F2WA 2HIMA 2A94A 1JT2A 2XVXA 1MUUA 1UFQA 2DODA 4OOIA 3LNQA 5M3FJ 5EZQA 1W9HA 1BHJA 1MJFA 2HZ7A 4P86A 1NBMA 4MQEA 1U7ZA 4TMZA 3K4PA 3UQYS 2IS2A 1U2RA 5ETJA 1XVVA 2N1TD 3K4HA 2I3DA 2BGNA 3SFIA 1P4JA 1SQQD 4W97A 1V48A 3JQAB 3GEZA 5KNBD 2ZBEA 4JUBA 4AJLA 1ZTRA 4NE7A 3TDNA 1Q14A 3ZQCA 3OIWA 4OLHA 3H1AA 5JYDA 2HKIA 3WMRA 4ZTUB 1QQTA 4U3JB 4RF2A 3LO8A 4BXFA 1DC3A 1MNAA 1WZNA 3TBHA 3NS7A 3OLVA 3W4KA 2X6OA 4W8HA 2Q1XA 3FM5A 4KXVA 2JAQA 4N0QA 2OB2A 1QIJA 4RULA 3QLTA 1ZFNA 5JXJA 2HUPA 3NV7A 2X85A 3BX1A 2P27A 1ABBA 2YASA 1JPNA 3GLFA 4MLZA 2WSIA 4ABYA 1XJWA 3DF9A 4Q0MA 1ZK3A 1GADO 1M83A 5TISC 4DB2A 2XMSA 2GBGA 3FDZB 1JKRC 4IRIA 3L4SO 2AEMA 3I2YX 1O94D 3TZQA 4PYIA 1STZA 4Q21A 3FDIA 4XLTA 1E1RD 3BQNB 2R1TB 3LIIA 5KVSA 3G3ZA 3ZI0A 3TNDA 5EGNA 4CKCB 3PQ3A 4LZWA 2VJ5A 3IQGX 1CJVC 4XPIA 2BUBA 1FZAA 1U8XX 1S2LA 2QYHA 4PBRA 1H4SA 2AEEA 4RYLA 2VK1A 5ITVA 2BV3A 5D3KA 3ZHXA 4EVRA 2QSJA 4RUKA 4Q4DA 2XUGA 3WLOA 4QGGA 3FKQA 2O01J 2OF7A 1ZI9A 3I5AA 1BA5A 1BXRA 3TOVA 4N40A 4LK0F 4WB4A 5IX8A 2OOKA 1BXGA 3UJ7A 4AU7A 1VJ0A 1AV1A 4RVHA 2OILA 1VB5A 1VL0A 5TQ2B 1FY2A 1XUOA 3JTMA 4P93A 4LLGF 1LPQA 4LGWA 5LEJA 3PFGA 5EGSA 3ZMDA 2AX4A 4U7JA 1CDOA 1KJYA 2DB3A 1M8PA 2POQX 4A23A 1K5DA 2BBSA 3I92A 2XKPA 3TVDA 3H1JG 4J8PA 4RX1A 2W22A 2CLLB 3USCS 1G17A 1SXIA 4QYTA 5AKKA 5CDYA 4R69A 4D99A 4DM7A 1M74A 4CXFA 1P84E 5EZYF 1KHHA 1KEVA 3UJ8A 1GLGA 2STWA 4UEOA 1G20B 2P4WA 2DKOA 1PP9E 2B5OA 3N2NA 3TTSA 5THQA 4Y3UA 1BGYE 4ZEMA 2BGIA 3T9FA 1G1AA 4KQJA 4I50A 4L72A 4C0JA 4Q9IA 2KMLA 3MGCA 1YBVA 4LHVA 1JJAA 3JWEA 1WGXA 5KK1A 2Z83A 1AX9A 5A1TA 1VLZA 4JC0A 1YB7A 1H5QA 4QTTB 1SK9A 1R6BX 4PBTA 1SQBE 2RGDA 1G2CB 1YRNB 3OS0A 3B3JA 5CYOA 1I2ZA 2WHPB 2RCNA 2FQ3A 3AY6A 1U7WA 3KJQA 4FXOA 2CGEA 5K3BA 1K6XA 1WLYA 2FW7A 4BIIA 1GCIA 2H27A 4Q37A 3ISVA 3LPMA 2EOAA 1T2VA 1RC9A 3ZUGA 4P54A 3T1VA 1A88A 4BCBA 5AVYA 3O95A 1FZBA 1Z7GA 2AQEA 5BV0A 3FUCA 2CJXA 5DM1A 2EBIA 2F3TA 5CGZA 2OV4A 3KHUA 5J1UA 1NR5A 4I98B 2DQYA 1BJAA 2YJ4A 3CEAA 2P58A 5AK3A 1V7PC 3LLSA 4QQRA 3RAPR 4EI7A 3SG0A 3I61A 5F08A 4QLCU 3L0CA 4JODA 1XLTA 2BPOA 4PAQA 3MB5A 1QRTA 2DW3A 3URKA 4QDKA 4KXMA 2K9NA 5K1ZA 3LECA 2ZJ8A 1BGYD 1AO0A 3V7UA 4M6VA 1P1RA 1RJGA 1ZEJA 5CBPB 2QTVA 5LBQA 4D57A 5B1AH 1BWRA 3LF1A 3AM3A 1NI4B 5EDNA 1A35A 3ESCA 1P6XA 2NPIA 5F0HA 6REQB 1SKQA 1E96A 2FEWB 3HBNA 3C2QA 3GFSA 5FTJA 4TMKA 5AJVB 3GBSA 1PR9A 2W2LA 3MC1A 1F8FA 2DMQA 5B5EE 3CZ6A 2Q6TA 4DIEA 1BCCE 1PUIA 4UOQA 3FJOA 2FPPB 4I2VA 2YDXA 2VH2A 2HU5A 3ZV5A 4DIBA 2GMWA 1WPXA 3I39X 1Y56A 4XRMA 1HW5A 4P0QB 5AVTB 3KCQA 4B1FA 2L9SA 5MGBA 3ELDA 4H0FA 1RYHA 4XLAA 1GFSA 2NU8A 1OU0A 1QGAA 3GCMA 4ZZ1A 4DV2B 3A26A 4HB2A 4EPXA 4U0JA 3ROUA 2W2PA 4Z3OA 2JKYA 1NQAO 2GFIA 5G1PA 1QVVA 5E8RA 4P31A 4PLGA 3RSHA 5KLVK 3WGHA 3H99A 4PGGA 3KJGA 4DMMA 3KP3A 9LDBA 5CDUA 4C4AA 1MH3A 1S8NA 4TQAA 4HQNA 2QX9A 5CCHC 1KAOA 2BKEA 4GAEA 3C0KA 2BCCE 2G71A 1ZJWA 4JT9A 1DIGA 4M1OA 2RHWA 4KOAA 3L2CA 2L91A 4DVJA 2BM1A 1R8SA 1OX5A 1QYCA 5FROA 2XCUA 1CB0A 1H88A 1LNZA 2QKLB 1DL5A 4MHSA 3N7AA 4NOLA 4ZKDA 1A9YA 4O3MA 2PHZA 3K0SA 3CVYA 5CLGA 5AKIA 1A72A 3DZHA 4QXRA 4GX0A 5CLHA 5TQ0B 2VP9A 4UU8A 3ROKA 2YX1A 3DCYA 3RR2A 4JP3A 4PQGA 1ZM3A 4DV7B 1GKIA 1PW5A 1GGHA 3O8GA 4HH0A 3L92A 2DLCX 4ZO6A 1CQXA 2ZXEA 3CH5A 2BHNA 1P29A 3SHTA 4U39A 3PPXA 5L45A 3OF5A 4A3LJ 4F11A 3L18A 1QIGA 2VBGA 3O47A 3SFEC 2PL5A 5JYBA 4I5IA 4EGCB 3N86A 1IAQA 5EOVA 2A1UB 3BG5A 1FFAA 1E2BA 3W06A 3WTUC 3G23A 3ZWQA 4BNHA 4YV0A 5KJ7C 3CCQP 5EJAA 5HYVA 3H5LA 1YOVB 4UASA 1IQPA 3PCXA 2O8FB 1DFIA 3IV7A 1ZCBA 1G20A 3U0BA 3HXTA 1J49A 1UHSA 4DBVO 1NMQA 4HZUA 1L7AA 5FX2A 1MH9A 2GSDA 5C4JJ 4MX8A 2BHLA 2QL9A 2B83A 5IANA 3A9VA 3G2HA 3CEJA 1I7LA 2NXNB 2XWSA 4D3FA 4C4TA 1HQDA 4FHFA 3V8LA 3I4FA 3T97B 4D8YA 1CF2O 1BM9A 4A93J 1QPGA 2B0LA 2R8BA 2ZBUA 1UMKA 3ASOH 4S3MA 2L7MP 2K88A 1A8UA 3EQZA 3GLHB 4HSTA 1RSZA 1F0YA 1D07A 2JLQA 4A73A 1EX7A 1U7OA 3T0FA 3D02A 2LUOA 2O5EA 2EV0A 2QORA 1ML4A 4HEA1 2FYUE 1T6XA 4UBNA 3A02A 4MNUA 1SFUA 1F8UA 1G3MA 2FFBA 3RABA 4HVCA 5AM5A 4C0XA 3L2UA 1VE1A 1I4EB 3PNTA 1DCMA 2RN0A 4G09A 4HYQA 4R4JA 2O06A 4ZDPA 5IEJA 3OZWA 1NFQA 3V8RA 2BYVE 2GN4A 2HRBA 3DFUA 2O2YA 5TVGA 4G0MA 4GOEA 5G0WA 1JY3N 4PRKA 5TMDA 3SQDA 3MQ4A 3O4JA 1WUTA 3D4OA 3GTJJ 3VYTB 3L7LA 3CEMA 1LJ8A 2GJ8A 1U4OA 2M4GA 3KUDA 5J2UF 1RWPA 2OHIA 3KLBA 3AEAC 2ECCA 1PWHA 2HODA 3M1YA 4R2IA 3F49S 1Y1VJ 2XXBA 1OYIA 2VKEA 4G4GA 1RAIA 1QG0A 2XCRB 1U7XA 3NAQA 4GHWA 1J1IA 1HJ0A 1Q11A 1I6WA 2KDZA 3HFJA 4DBQA 4ND4A 4BASA 4IL5A 4NXNB 3EIWA 3WS7A 1IRIA 4LI0A 2PNJA 1WU8A 4PGMA 3KFXA 3RSQA 4KSBA 2AXEA 2IHYA 2KNCA 4UZEA 1WZEA 4A9AA 2D4HA 3FCCA 2MBFA 1IWOA 4ZYDA 1HNWB 1E6KA 4QTYA 2XYQA 3SZ3A 1XZPA 1Q77A 2AVNA 4JVMA 3HBLA 1R10A 1Q19A 3KR9A 2GYYA 2ZAIA 1FOXA 5FFXA 4LE1A 1ZRFA 1C81A 3U6BA 1IG7A 2ONJA 5I7WA 3G6WA 1VLLA 2W0MA 5CTJA 1Z2OX 1L5WA 3VJRA 4MH0R 3B52X 4LRWA 1ZRNA 1E4YA 3RS4A 4V2GA 1R0WA 3VSBA 4L95C 1O9GA 1DC4A 3SEAA 1F7VA 4F55A 3K0FA 4CKWA 4DGQA 1JY2P 1QKIA 1T5TA 2F3SA 3N05A 3VR2D 5IABA 5IVIA 4PCVA 5D85A 1XJCA 2VRBA 3LUFA 2XB0X 3R3SA 2WQ7A 5EESA 3PWSA 4KO3S 1IZ9A 1Z15A 4DS3A 4BVLA 2PKYX 1ICIA 4HDNB 2ZBDA 1KSGA 4DTIA 2ZMEA 3FOEC 2M7AA 4OU0A 3KOUA 4LJ7A 2XTJA 3DR5A 1KJ9A 2VF8A 1PQWA 2GSWA 2Q49A 2FN9A 4FS8A 5AVUA 3EVEA 3K9LA 5FQNA 1W9MA 2BFOA 1E2GA 3ZI4A 5AI0A 2GD6A 4O4HF 4TLCA 5DSZA 5HK8A 1F60A 1M72A 4WKNA 1RIFA 4IG9A 4R84A 1PWXA 4KQMA 3VSAA 4LMBA 2WHRA 3JD3A 4RL6A 1DQYA 4O02B 3UWSA 4FD2A 3SCZA 2IIBA 2QXUA 2R7ZJ 4NOJA 1K4SA 1ECGA 5IT0A 3F72A 3FCEA 2GZMA 3B1VA 1AA9A 4BQNA 4EWLA 1A5BB 1ZXGA 1SD7A 4NI5A 4JQYA 2XB8A 5JS1A 3L93A 5FI0B 1DAMA 5EXTA 1CJTC 5EJ7A 5FEUA 1P2BA 4ZO4A 3LQKA 4XGKA 3I6QA 4HA8A 1JKMA 1VQ4P 2UV1A 3BGOS 1P1FA 1JNXX 1TYZA 1S89A 3AUTA 1TB4A 2Q41A 2Y1GA 1L5GB 2H8GA 4IHXA 3X1DA 1A5SB 2OCAA 2W98A 4Y33A 2UKDA 1UK9A 4RC9A 3H2YA 2UU9B 1ZJ5A 1HGXA 3S14J 4RXUA 3PQ6A 4CKEB 3H1HE 5EKDA 1OWPA 2PL9A 3PDJA 4EJ0A 1UK8A 3NC4A 1GDDA 4E4TA 2H1SA 2BH2A 2TRSB 2H4WA 1Y5MA 5K5EA 1EX1A 3JYPA 3CUQC 1IN5A 4GGGA 5IP6A 5MF6A 5DCWA 1PEYA 1JSZA 1JG6A 1K83J 4M1EA 4QLOA 5KYNA 1HF9A 3C24A 3A1VA 4ZOLA 1A02F 4HZFA 2QQ9A 3OSZA 2L7FP 1VJDA 4ZRDA 1NR7A 4H4DA 5CDFA 1N73C 1CVIA 3HUTA 3NALA 1QR2A 3DLPX 2FEAA 3NQOA 2W6IA 2XXAA 2AJCA 3EBOA 2J59M 1T2FA 2IPNA 3JPYA 3TFQA 5DCMA 1TAHA 3O5AA 2IGMA 4TMWA 3RBXA 5AESA 3SKXA 1N2EA 2FDCA 4BEHA 3NAUA 4CPGA 2W6BA 2NN3C 4FFWA 3HNOA 5CB0A 3DBHA 3RS3A 5JVDB 4A6EA 3RSZA 2HJHA 1Z3CA 2FB9A 2D00A 3HY4A 2PKCA 4MB0A 2OCDA 1E2EA 3IQWA 2GKSA 4TYPA 1VMKA 3Q9LA 1KYOH 2N1BA 4PRYA 4QPOA 1OFIA 1YL5A 3B53X 2XEDA 4DSAA 1I13A 2HAEA 1TQ6A 1UXGA 5BNIA 2V54A 4QUBA 4V1CI 3RFXA 4W5JA 3OYEA 1Z0XA 4WCGA 1C7ZA 3AVWA 4H60A 5B1DA 3KZVA 3RYTC 4F4FA 1ABEA 2ETXA 1MJGM 5E1BA 3OKCA 1TKBA 3PRHA 2VSQA 4G41A 1ESCA 5AFSA 3I83A 2GBYA 1IG3A 2R5NA 2CC2A 4XLLA 1FMJA 2HJWA 4PO3X 1NTMJ 1P3DA 2Q5FA 4Q4LA 5KOHB 4FP9A 4ARZA 4YRQA 4L0CA 1KFBB 5IULC 3SLKA 3WRWA 3IQXA 4YJHB 2P7IA 3SC2B 1HLGA 4GZ3A 3CVVA 5HM8A 1CDZA 1PGOA 1H0TA 5TRTA 4MRVA 1FJ2A 1J7JA 2DCEA 4JJ4A 5LWHA 1T2EA 4F3YA 3H1IG 3OEYA 4GYWA 3F5HA 1YMVA 3P2JA 3V1YA 1SMKA 3B5IA 4QGHA 2G80A 2FWBA 2X58A 4WF2A 4M6XA 5I9MA 3L35A 5C8YB 1RM0A 2HN9A 2WJYA 3EWSA 5EIAA 1ZOYC 1NDQA 3LPLA 2GRAA 4UHKA 1IYZA 5AJHA 1FMVA 1E9AA 3AERA 2VQHA 3THXA 2CW5A 4XE5B 3DMHA 1Y6GA 4W5NA 1ZH2A 3PEWA 2DA7A 3DHYA 1H8AC 4X6YA 3DCFA 2OPBA 1PZXA 3U1AA 4M60A 4LVUA 3T0GA 4DR7B 1FRNA 2NP7A 1LF0A 3Q8MA 2LP4Y 3FHLA 1JG4A 2AS0A 4ETMA 5JNWA 2AN1A 3DV2A 3H5RA 3KEMA 1ZITA 2Z2JA 2GPWA 4J0CA 4NBSA 3DBRA 2IELA 3Q3DA 3DZFA 1QLJA 5AKEA 4URUR 2RN7A 4KN6A 4HAWA 2EZTA 3HKBA 3AHIA 1SU8A 5DLDA 1PK9A 1ZMBA 4XYEA 2JIZA 4N8EA 1OYWA 4IGFA 3AB7A 4HJXA 2GI4A 1KXJA 3BWBA 4XA8A 1J59A 3HVHA 4I50B 2QU7A 1KO7A 1MQSA 3CWCA 3HLTA 2Y27A 5EJ8A 4S0XA 3AVUA 1FFXB 2V7TA 4L8GA 5KOHA 5TDHA 4OFWA 2JEYA 1ETHA 3BE4A 3EMDA 3DBVO 1XVAA 3BL8A 2Z1MA 2XVYA 1L6RA 4IRGA 4YGYA 1I0LA 5M5WJ 3EAFA 3EYYA 2ORWA 1EC5A 1SZCA 3M81A 1FDMA 3JRFA 2JRCA 3MTIA 1E1NA 1N6NA 1DI0A 3RUAA 1E0KA 4HI0E 4QRHA 2OCIA 4BIMA 3IBYA 3I2KA 8ABPA 4MDYA 3QOXA 4OLJA 3SM3A 1NVGA 4MWCA 4KV7A 4INPA 3R0ZA 1NWHA 4AX4A 2GAJA 3PLRA 4LJ6A 3ONQA 1BGVA 3AG4H 1KNQA 2JHGA 1GQ2A 4YI5A 3EGXB 4PICA 4YO7A 3A4LA 2CXUA 3V34A 1WCMJ 3T1BA 2P69A 3JAMK 3DL4A 2YZGA 4C22A 1KD1Q 3HRIA 1BFUA 1FTTA 3OPYI 4B4UA 5AKJA 3OTHA 1YDMA 4QE3A 4GMGA 1W4BA 2RHBA 2XGEA 5HZMA 4FYWA 3VC7A 5LEKA 3P26A 1Y6JA 5FNZA 5U1PA 3DZDA 3TPFA 1H0KA 2QUBA 1E9CA 1B8IB 1L0BA 4BNTA 2PX4A 1CUYA 3FSGD 2F8TA 1U0OC 1ZI6A 4P55A 3WE2A 3QU5A 3JREA 2VDJA 2B87A 1CETA 1EXNA 3S29A 1BSHA 2XUDA 5AUPB 1Y9EA 4OMFG 3C74A 2IOFA 5C39A 4HEHA 3DMTC 2WQYC 4YMSA 4JSTA 3R9XA 4KQKA 1NXWA 1L4AA 4AJ1A 3L75E 3GPIA 4H2DA 5HJ7A 1U3CA 1XA4A 3KD2A 4ZQFA 2NYUA 2AE1A 3KUUA 2Y1CA 1YI2I 4FMDF 1Y33E 1U0SY 3L37A 4KZPA 4N9WA 4NZ9A 3LRPA 1CPYA 4RMJA 3ODGA 2CG4A 2OZEA 1PQ4A 1X22A 4FMPA 1KZ7B 5CFQA 3KQUA 3ZE8A 4DC9A 4GGMX 4B8ZA 1V41E 2VP6A 2Z3YA 3VV2A 1GTMA 2XGOA 3PENA 1V45E 2W6JH 3CIOA 4D6TE 5HMLA 2DETA 5EZSA 3A70A 5KOJB 1ZIYA 4D4KA 4N12A 1KYTA 3CCBA 4GZLA 5KCZA 2C1EA 5FTMA 4FHTA 2ERCA 1YZYA 1XB4A 4NP6A 3C6BA 2YNYA 3G9RA 1UDWA 3LSMA 2H89C 3ZE2B 3RK4A 2W90A 5H20A 1W76A 3T34A 1KVTA 4ZANA 5KJEA 4ZI5A 3AW8A 1ZKMA 3II6A 1RDFA 4ZOLB 1XQVA 5LXTF 4C6HA 1XQWA 4ASUD 3L0ZA 1ZIOA 3E3LA 5F23A 2VAXA 3BSWA 3F8CA 3AE5C 2PZGA 3L02A 3D1JA 4EPYA 4B87A 4RBNA 3LVFO 4OXXA 4AYXA 4PD4E 4RJJA 2L9NA 1S4QA 2HF7A 1O94C 4R5MA 5CIWA 4E5MA 1I4LD 2XROA 4KVZA 2EYQA 3MWDB 1ZOSA 4CCKA 1JDBB 2EW8A 3C3KA 3VTZA 2JA5J 3MZ8A 1IZ8A 4HPQA 5SZIA 2D1VA 4XLZA 4DR6B 3T7TA 3D3WA 3HTUA 3I09A 4LXXA 3RAGA 4B4VA 4DWJA 3ZNPA 2RG7A 4OYHA 3SWWA 5CM2Z 5CCGD 2X1HA 3FNIA 2A1TS 1N0VC 1BDDA 5J47A 5AIBA 1WSWA 1R6DA 4RK6A 3VVMA 5J63A 1GAXA 1SA0B 3RTDA 3H8SA 1JV2B 4XGNA 3E0QA 1DXQA 2PMZA 3AEKA 1OLUA 2XEXA 3HI4A 2E4AA 4BY7J 3EGDA 2PIAA 3OC0A 3QXGA 1JBKA 4YDSA 2NVUB 3C8ZA 5KJ1A 4EFMA 3BPVA 2J9XB 5JG7A 4I46A 4N5IX 8ATCA 4K9QA 5ARCA 2ZSEA 4DNQA 4M21A 5AUNB 3FOFC 3ZDYB 5IBRA 3MVPA 2JHFA 3JTHA 2AXPA 4RORA 1AKHB 4BKQA 4DLZA 3PC7A 2OCPA 3B6AA 2BRUC 4FQ5A 3D8NA 1XMXA