1PFIA

Pf1 virus structure: helical coat protein and dna with paraxial phosphates
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords MAJOR COAT PROTEIN OF PF1 VIRUS
publication title Pf1 virus structure: helical coat protein and DNA with paraxial phosphates.
pubmed rcsb
source organism Pseudomonas phage pf1
total genus 20
structure length 46
sequence length 46
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1pfiA00
2XKMA 4IFMA 1IFNA 2KSJA 1QL1A 1ZN5A 2IFMA 2KLVA 3IFMA 2IFNA 1QL2A 1IFMA 1PFIA
chains in the Genus database with same CATH superfamily
1N73B 1K05A 3L72D 4OGQB 1T2KD 1N7SD 3OW2O 1IFNA 1K04A 2PAJA 1IFJA 1RE4A 4UB8E 4WY4A 5KKZB 1L2PA 1NOHA 2YNYA 2Y9ZA 4I2LC 3HUSC 3CXHE 3M0DC 2FXMA 1IFMA 3CMEP 2WPSA 3PP5A 3CCMP 5APWA 4PV1D 1YITP 3TYYA 1FJPA 2O01N 2B87B 3H1HE 1EZVG 1EXIA 1X79B 5KJ7A 3JC22 1JM0A 3M9QA 1KQFB 1G2CB 2H43A 2PRRA 4H44D 1LTSC 2XKMA 1SQVE 4QMAA 3JCUE 5CMZA 2OARA 1JUNA 2JP3A 1M57D 5C39A 2A45H 1JY3N 1FOSF 1YJ9P 1SQPG 3CCLP 1VQOP 1Q82Q 3AE3C 2QM8A 2OTLP 3M0DA 3GHGB 2BCCG 2QE7H 3E1RA 4H44B 1Q81Q 3V5BA 5TISE 1GD2E 5M1BA 3BRTB 2BCCJ 2J5UA 2HYNA 5K5GB 2WTYA 3O8ZA 3L36A 3QH9A 3L72G 3TGUG 3HTKB 2LKMA 4KT0J 2L91A 5AVZB 4IL6E 4K35A 3U1AA 1X22A 3L72J 1J1DC 2RKLA 1LNQA 2A45I 1S4XA 2IZ0A 2M5AB 5KLIB 1VF5C 3S9OA 2QEXP 3CXHD 2ZAEB 1QX8A 1LT1A 1OW7A 1CI6B 4RKUJ 2IBZI 3A0BE 2JKVA 5AW1B 1S5LE 3GLMA 3H1HD 5BU8B 1IC2A 1LTJA 1FDMA 3CX5H 2NPSB 1SQBK 3H32A 4JQ0D 1SQVD 2KNCA 1WT6A 2WSFJ 2GUVA 2O1JA 2YIUB 2HPCB 1PZQA 3O6QB 2C0WA 2WT7A 3TF5A 1Q7YQ 3G3ZA 3KQGA 1J1EC 3AECC 1RHZB 2L5GB 1VQPP 1PGPA 1HWTC 1L0ND 3IFMA 2XU6A 3GHGA 2R5BA 2N1TB 3AEBC 3ZDMA 1GL2B 3A3YB 3U1CA 4TT3H 1OXZA 2OQQA 2IX7C 5APUA 1DX7A 2JJLA 1SQQE 3CX5I 3HE4A 2E76B 3HTKA 4PD4H 3L74E 3B71A 3SFDC 4BRYB 1HTLC 3P8CE 1BDCA 4ZMDA 4EOTA 2Q7CA 5AVSB 4I7ZC 3S1KA 1SQXE 2ZT9C 1CI6A 3FXDA 3V2PA 3H1HG 2OYIC 2YXQB 5AVRB 1ZXGA 1Y47A 1U57A 2YKOA 3H1HJ 4LLHA 2XDJA 5APQA 1NTKE 2Q3EA 1FU1A 3AE7C 1SQVG 3L71D 2IBZE 2H7HA 1Y8AA 5BVZA 1NU1E 1YQ4C 2JEEA 1LT9C 2HODA 2OTKE 2B88A 1KQGB 2D2CD 1QLED 3O6QA 3RK3E 3H6PA 1GMJA 1JTHB 2POHA 5CCGA 1T3JA 1YI2P 2MJZA 1L0NG 1XTCC 4LGDE 3IAOA 2VRSA 3NFQA 2Q9IA 1VDFA 1LWUC 3AEAC 1L0NJ 1S9KE 3WUUA 3RK2D 2IYPA 1GK6A 1N86A 1NTMK 1VL2A 1KB9H 2OYHC 5E79E 4Y99B 3RGUA 1GK4A 1URQA 2I1JA 3V4QA 2QIWA 1RE3A 2FYZA 1N7LA 2D2CB 1SQQD 5DJTB 2FBWC 4H13B 1AA0A 5AW2B 4HJGH 3L74D 3OA7A 1OW8A 3BRVB 3AE5C 3GF7A 1H8AA 4L76A 1T8ZA 1LT9A 3P8CD 3CX5E 3F89A 2FFDC 1KZUB 3H1KE 4IFMA 1HUCA 1FZCA 4KJMA 2ZFCA 1EC5A 1OIPA 1NTZE 3MGNA 3D6ZA 1NKZB 1SQXD 4KHXA 1SFCC 1FDIA 1A02J 2Y9YA 2KZIA 1XTGB 1KB9I 5AVQB 2E75C 2R3SA 3AEDC 4YPCA 2ZJSE 1KYOH 3CCEP 2QJKB 3II6A 2M8RA 3HD7B 1N8RQ 4GOEA 2IZ1A 1NTKD 3L71J 2CPBA 1SP4A 3B5ND 1FOSE 2QVAA 1VQ4P 2IBZD 3IF4A 1OWAA 1FE6A 3RK3D 3ITKA 1JY3O 4IL6H 3C8VA 4NPDA 1QL2A 1SVFA 5AW4B 2FFDA 1L4AB 4LC1A 3M0AA 5AVUB 2FYUJ 3CWBE 3OAKA 4I1LA 3KDPB 1S9KD 2QG4A 4N3YB 2ZYGA 2Y0CA 1H89A 3Q3DA 1NKNA 1SFCA 4DT0A 4WY4C 1KYOI 2UWJE 1AQ5A 1H0TA 1SQQG 1HGZA 1NHLA 3G6EP 1KILB 3KZIH 1Y9BA 3A0BH 1KN7A 1X9VA 3L74G 1HJBA 2WITA 1SQQJ 4HYTB 5AVXB 2Q6QA 2XZRA 4IOIH 1ZP0C 3L74J 1PL5A 3VP9A 1DD4A 2E74C 1SQPD 3NTNA 2WSCH 2H88C 3V2NA 2O01H 5KJ7C 1ZR2A 2Z5HA 2OTJP 3T97A 3CX5D 4M3LA 1OFCX 1SQXG 3FWLA 4L73A 3GMAA 3VOPA 3TNUA 3HUSB 3LW5H 3V4WA 3L73E 2A45G 1NTZD 3L75E 1L0LE 3F5HA 1W2BO 1X8YA 3TGUD 1NTKG 4OVNF 2C0XA 1FZGA 2P10A 3BCCE 2IBZG 3QWOC 1BGYE 2CK3H 4L75A 3VMZA 1HH0A 1NTKJ 1FZFA 1KB9E 4DZOA 5KLVK 2LXBA 1FAVA 2JR8A 4I6MC 2N9BA 1EDIA 5AW5B 3D6YA 2FYNB 2R3CA 4PD4D 2IPPA 1D7MA 2R5DA 1GTWA 1N73C 4GDOA 1N7SB 3CWBD 2LR2A 4OGQC 2GM4A 1VF5D 3H25A 5KKZC 1PP9D 2W8ZA 1PGJA 2HFED 3AE2C 1OZHA 1GZLA 2QJYB 4PV1B 4H0LD 3CD6P 2KP8A 2PP6A 1KYOE 3HE5A 1SQPJ 3BATA 2R44A 4NPEA 3CI9A 3CLQA 1T6AA 2XNDH 2BEZF 2WSEH 1UIIA 3M91A 1LTJC 1L0NK 4A7PA 1KQSO 1NTZG 3CCRP 3R4YA 4C7RA 1OVUA 1NTZJ 2NZ2A 3L73D 3L75D 1N2DC 2A06E 1N73A 5H2FH 3EFFK 2WPVB 3W67A 1L0LD 5GTIE 2KLUA 3TGUJ 1JY2P 1HGVA 3M9BA 2Y0EA 1KORA 1E79H 5E79H 3ABVC 3MP7B 3GHGC 2GUSA 1BGYD 2I8DA 4RJTA 2AXTH 3AE9C 2QJPC 1VPCA 5APYA 1KB9D 2YMKA 5CCHC 3MUDC 3KZIE 4GODA 4YXDC 2B87A 2MKVA 4H0LC 3RL0g 1KQLA 3FWNA 1VQKP 1G2CA 3CWBG 1JMMA 1BE3E 2V4HA 2WWWA 1H88A 1ZOYC 2HLOA 2M3EA 1FDOA 1EQ7A 1PP9G 3CWBJ 2WMMA 1MUUA 1SQBE 4ZKPA 2KS1B 3CL3D 5AVWB 1PP9J 3Q5RA 5KLIC 2JWDA 2Q5UA 2ZT9D 1AJYA 2KI7B 3WU2E 1GU4A 1NYHA 1EDKA 2QM7A 1M1JB 1M56D 2K9JB 3A5TA 1URQD 1KYOD 4Z1MH 1PPJE 4CPGA 1LTGC 2FYUK 1VQ8P 1YHQP 5CCHA 3MUDA 1NJIQ 2NPSC 4I7ZB 3L73G 2W90A 1YJNP 3L75G 1DH3A 1L0LG 1YTZT 2IFMA 2ZT9B 3H1IE 3L73J 2YIUC 3L75J 2A06D 5KAIH 1L0LJ 5CCGC 4C7NB 2OYIB 4EI2A 1SQQK 3FXEA 1BGYG 2M5AA 1LP1B 1M90Q 1X0TA 4DJGA 1BGYJ 3AE1C 1JOCA 1URQC 1LGHB 2CPSA 1FS0E 3MIWA 2H8PD 1RE3C 2YO3A 2M0BA 4K3AA 1BE3D 2NPSA 1IK7A 2AEJA 2K37A 1JMBA 3CCQP 1DD3A 2FY8A 3M06A 2KS1A 1DEBA 1SQBD 3SWYA 4AUWA 1SQVJ 5AVVB 2IYOA 2OYHB 2GA1A 5L8RJ 3TSIA 2HPCA 5APSA 1ZN5A 1FZCC 3V2RA 1M1JA 4N6JA 4GOFA 2K9JA 1SFCD 1FC2C 2BEQD 2O3JA 3H1JE 1QVFO 2E75D 5H2FE 2KSEA 4EIJA 2KUBA 1LTTC 2Q3IA 2R32A 2N1TA 3BASA 2G3AA 4U7JA 1GL2A 1NAYA 4WWIA 2KYVA 1NTME 3SFEC 3I5CA 1A02F 3D70A 1ZW0A 1IFIA 1S72P 4W80A 2AXTE 3P7KA 2JO1A 3A2AA 2YKQA 3KXDA 2W6AA 3RL0D 1KFNA 5EFWB 1IFDA 2A06G 1LJ2A 1WMKA 2KIKA 4BRYA 3H1ID 2QA4P 3H1LE 3VN0A 3BVHA 4JPZB 2YKPA 3WUTA 1SQPK 1Q90D 3RK2B 1BDDA 2ITAA 2OGUA 1FJKA 4WY4D 1U7MA 5AVTB 1GDTA 1JEKA 1J2JB 1R5SA 2AEFA 1RY3A 3CCSP 1MV8A 3WUVA 1S5LX 1BE3G 1EDJA 2BASA 3AEFC 2E74D 2K3RA 3AE8C 1K8AQ 2WQYC 5CHXA 5KJ7D 1BE3J 4YXWH 2C9LY 1SQBG 3RBXA 2O01J 1HF9A 1FZBA 1NU1D 1PFIA 3IR9A 1WRGA 3SWKA 1SLQA 1SQBJ 3RL0C 1JTHA 4WY4B 2K9YA 1RH5B 3KYQA 1IFPA 3LW5J 3LIEA 5GTIH 1VQ6P 1ZMEC 1MZ9A 3AE6C 3H1JD 5KAIE 2LXCB 3KHUA 3GG2A 2QSIA 5B5EH 3AEEC 2E74B 4D6TE 3MD0A 4EYYQ 2QJKC 3HD7C 1RF1B 1NTMD 4ASVA 3CCUP 3B5NB 4UB6H 1ZV8A 1VQ9P 3H1IG 4W7YA 1NO4A 1U7JA 3W68A 3RK3B 1VQ7P 3H1IJ 5B66H 5CJ0A 2P7JA 2RMZA 1Q2NA 1JB0J 5GTHH 2P58A 2KB7P 3H1LD 4OGQD 3AE4C 4DCKA 3AEGC 3H1KD 2V7QH 1USEA 1VQMP 1CZQA 3WU2H 2WSSH 1S3JA 1CSBA 4WB4A 1NVOA 1JY2N 1SQXJ 2RH0A 1PGQA 1KILC 4YTPC 3MHVA 4L74A 3JSVC 3HD7A 3Q1MA 2O1KA 5AVYB 1M8OB 1NU1G 3RBZA 4JBZA 2Z4EA 1GU5A 2C9NY 5AW7B 1GW4A 2W6BA 2ZVOB 1FBMA 4MN4C 1NU1J 2WSEJ 2AEMA 1ZLLA 2ZVNB 5KLVE 3H1JG 5APTA 3L70E 3TDKA 1L4AA 3H1JJ 1OX3A 1TU3F 2KXPB 3FX0A 2XNXA 2M3BA 4RESB 4HKZH 2E5TA 1NTMG 1S1CX 3VP8A 1BCCE 4D6TD 4JYCA 4B86A 1RF1A 1CW5A 2J58A 1P84H 3B5NA 1LTJB 3B8EB 1NTMJ 1KILA 1JO5A 5CCHD 4PJ0E 1HVVA 2J59M 1SQVK 1MFZA 2P67A 3H32B 1K73Q 3VMYA 5AW6B 2KNCB 2KK7A 2AXCA 3CC4P 3H1LG 3LIDA 1YTZI 4ASWA 4GT1A 2FYNC 3H1KG 2WT7B 1AFOA 1J1DB 3VMXA 3H1LJ 1L0NE 1T2KC 1N7SC 2KZJA 3EWKA 3H1KJ 4R4LA 3HUSA 1VF5B 4U3FE 1QVGO 1M7LA 2Q1KA 3M9HA 2KLVA 2H89C 2QJPB 2W6JH 1Q86Q 4WVZA 3TK1A 2JWAA 3L37A 1VQ5P 1P84I 2HR3A 4H0LB 4BXLA 3I56P 2QJYC 4PV1C 3C9IA 1KFMA 3OJAB 3HE4B 2HG5D 2NRGA 3A0HH 5B5EE 3BCCD 5TJHA 2P1JA 2P2UA 3EFGA 4JF7A 4H44C 4XFJA 4HH2A 2NPSD 4N78E 3P32A 3UIAA 1LTAC 4UB6E 1T3UA 2K88A 5KLVD 1AQTA 1RF0C 1MFTA 5CCGD 3L70D 1OVVA 4BWNA 1J1EB 5B66E 1N7SA 4D6TG 3PRJA 3Q5PA 3D71A 5GTHE 3I55P 3G4SP 1SS1A 3K5BA 4O9BA 5CBOA 2N1TD 4D6TJ 1BCCD 1YBKA 3MZWB 3PTZA 1GL2D 3USSA 3VTPC 4AYCA 3Q5SA 5CBNA 3GF3A 3L71E 1AVYA 2OYOA 1KD1Q 1YQ3C 1EZVI 1M1KQ 1E5WA 2E76D 2HODB 2ZXEB 4JYBA 2W27A 3SSUA 3CC2P 2RN0A 2FYUE 2PFXA 2N9YB 2WPRA 4NPFX 1GW3A 2W83C 1JY3P 1RF0A 1QGKB 2SPZA 1NAFA 3E1IA 4U3FD 4OWFA 1FZEA 1VQNP 5KTBA 1M1JC 2WPQA 2DW3A 3V6IA 1URQB 3BCCG 4XA4A 3NXSA 1RQVA 5APVA 4GKGA 3BCCJ 2N1TC 2E5YA 1KC8Q 1GL2C 5APXA 1P84E 4Y28J 5KLVG 5DJUB 2K1AA 3R2PA 1LT9B 4N78D 1ZRTE 2WSFH 5KAFH 4GIFA 3L70G 1FZCB 5KLVJ 1K9MQ 1SQXK 2E76C 2QRXA 4XE5B 1NGMB 1R5LA 3N4XA 1PIXA 4IFFA 3L70J 1LTBC 1QL1A 1BCCG 1LWUB 3G71P 1YYCA 3IN6A 1JCDA 2IDBA 3V2QA 1BCCJ 1HJ0A 1NTKK 3B4SA 1R8EA 2FXPA 1EDLA 1NU1K 3WMM0 4PD4I 1KILE 2G8YA 1OVRA 1IK9A 1LTIC 1HBWA 4H13D 3CCJP 1OMIA 5AW9B 3A0HE 2YMYA 1PPJD 4C46A 4IFDK 1PGOA 2WZ7A 1EZVE 1YJWP 1Z56A 3VYIA 2FFDB 1VQLP 2FYUD 4U3FG 4EDFA 3EQ2A 1EXJA 1YIJP 2KOGA 5AW3B 4UB8H 1BSNA 2JDIH 1AVOA 3L35A 3KPEA 4U3FJ 1NH4A 1JY2O 3CXHH 2ZXXA 5AW8B 4IL6X 1SFCB 4WBAA 4C7NA 2OYIA 1H0TB 1JCCA 2E75B 3A7OA 1USDA 3N7NA 3NMDA 3L4FA 1BSHA 1LP1A 1SQPE 3P8MC 3GW6A 4ZNCA 3HD7D 3HRNA 1QEXA 2E43A 4AQRD 4PJ0H 1AV1A 4Y99C 1RQUA 3CMAP 1P84D 2BCCE 2Z5IA 3G9RA 3T97B 3JCUH 1ZRTD 3RL0B 1W2EA 1NTZK 2D2CC 1IJDB 4H13C 1G1JA 3TNUB 5BU5A 3CPWO 2I1KA 1L4AD 1LWUA 2WSCJ 3CXHI 3L72E 3TGUE 1PV3A 4TLFA 1NWQA 2OYHA 3L71G 4ZKUA 5CJ4A 3RK2C 1G1IA 2V7QJ 5TISH 3E7KA 3S4RA 1S2EA 3U59A 1KILD 3SWFA 3PH0A 2IFNA 1KV4A 2FKWB 1PPJG 2FYUG 4PD4E 3PJSK 1MKMA 1DIPA 3VMAA 1IO4A 4W7ZA 2PGDA 1JNMA 3CCVP 1EZVD 3CC7P 3PHLA 2XV5A 4DOJA 2E42A 2WVRA 5KAFE 2Y0DA 1PP9E 2B89A 2KSJA 1RE4C 1OW6A 3FGAD 2FXOA 1IZNB 1W5CE 1FZAA 1KTMA 2ZYDA 5AW0B 1DEEG 1KMIZ 1L4AC 3C1LA 1ZR4A 1S5LH 3HE5B 3Q2YA 3PLNA 2B9BA 1RF1C 4HB1A 4OH8B 3B5NC 2ZYAA 2BCCD 2YO2A 4RO0A 2YXRB 3MTUE 4R4MA 1L0LK 3RK3C 1UIXA
chains in the Genus database with same CATH topology
1N73B 4HH2A 2NPSD 4N78E 3P32A 1XTGB 5AVQB 3UIAA 1T2KD 1N7SD 1JOCA 1IFNA 1LTAC 1URQC 1LGHB 2CPSA 2PAJA 1IFJA 1T3UA 3MIWA 1RE4A 4WY4A 3II6A 2H8PD 1RE3C 2M8RA 1NOHA 2YNYA 2YO3A 1RF0C 3HD7B 4I2LC 3HUSC 3M0DC 5CCGD 2FXMA 2NPSA 1IFMA 1J1EB 2CPBA 1SP4A 3B5ND 1FOSE 2WPSA 1N7SA 3PP5A 5APWA 3M06A 3TYYA 1OWAA 1FJPA 1DEBA 3SWYA 4AUWA 4O9BA 5AVVB 2N1TD 2OYHB 3TSIA 2HPCA 5APSA 1ZN5A 3RK3D 1X79B 5KJ7A 3V2RA 1FZCC 1M1JA 1GL2D 3VTPC 4N6JA 1JY3O 4AYCA 3M9QA 1G2CB 1SFCD 2H43A 2FFDA 1QL2A 1SVFA 5AW4B 1LTSC 1L4AB 4LC1A 2XKMA 3M0AA 5AVUB 3OAKA 4EIJA 4I1LA 1LTTC 2Q3IA 2R32A 1E5WA 3KDPB 2N1TA 3BASA 5CMZA 2HODB 1S9KD 2ZXEB 4JYBA 2OARA 4N3YB 1GL2A 1JUNA 2KYVA 2W27A 1H89A 1NKNA 1SFCA 4WY4C 1AQ5A 3I5CA 1A02F 1HGZA 2A45H 1NHLA 1JY3N 1IFIA 1FOSF 1KILB 4W80A 1X9VA 3P7KA 1HJBA 2WPRA 1GW3A 3A2AA 2YKQA 2W6AA 1JY3P 2WITA 3RL0D 4HYTB 5AVXB 1RF0A 1KFNA 2QM8A 1IFDA 1NAFA 2XZRA 3E1IA 3M0DA 1FZEA 3GHGB 3VP9A 3NTNA 2WSCH 3V2NA 2O01H 5KTBA 3V5BA 1GD2E 5KJ7C 1M1JC 2WPQA 1ZR2A 2Z5HA 3T97A 3BRTB 3VN0A 1URQB 2HYNA 4XA4A 3BVHA 2YKPA 3NXSA 2WTYA 4M3LA 3O8ZA 1SQPK 5APVA 3RK2B 4GKGA 3VOPA 3TNUA 3HUSB 3LW5H 3L36A 3V4WA 1FJKA 4WY4D 2N1TC 3HTKB 2LKMA 2A45G 5AVTB 1GDTA 5AVZB 1GL2C 1J2JB 5APXA 3U1AA 1RY3A 1X8YA 1J1DC 1LT9B 1MV8A 3R2PA 4N78D 2WSFH 2A45I 4GIFA 2C0XA 1FZGA 1FZCB 2BASA 1SQXK 4XE5B 3N4XA 3VMZA 1HH0A 5CHXA 4IFFA 5KJ7D 1FZFA 2C9LY 1LTBC 1CI6B 1QL1A 1FZBA 1LWUB 1PFIA 1YYCA 3IR9A 4DZOA 1WRGA 5KLVK 1JCDA 5AW1B 1SLQA 1FAVA 3V2QA 3RL0C 4I6MC 1JTHA 1NTKK 2N9BA 4WY4B 5BU8B 5AW5B 1IC2A 1LTJA 1FDMA 3KYQA 2R3CA 3LIEA 2IPPA 1NU1K 3WMM0 2R5DA 1GTWA 1MZ9A 2NPSB 1SQBK 1N73C 1IK9A 1N7SB 3H32A 1LTIC 1HBWA 1WT6A 5AW9B 2GM4A 2GUVA 3MD0A 2O1JA 2HPCB 2HFED 2C0WA 2WT7A 2YMYA 3HD7C 4C46A 1RF1B 4IFDK 3G3ZA 2WZ7A 3B5NB 3KQGA 1Z56A 3VYIA 2FFDB 1J1EC 1GZLA 3EQ2A 2KOGA 2L5GB 1ZV8A 5AW3B 4W7YA 1HWTC 3IFMA 2XU6A 3GHGA 2KP8A 2R5BA 1NO4A 3L35A 2N1TB 3KPEA 2PP6A 1NH4A 1JY2O 3HE5A 3RK3B 3BATA 1GL2B 3A3YB 3U1CA 3CI9A 5AW8B 3CLQA 1SFCB 5CJ0A 2P7JA 4WBAA 4C7NA 1OXZA 2OYIA 2WSEH 3M91A 1LTJC 2IX7C 1JCCA 1L0NK 2KB7P 5APUA 1DX7A 2JJLA 3A7OA 3HE4A 3N7NA 3NMDA 3L4FA 4C7RA 3HTKA 3P8MC 1CZQA 3HD7D 1CSBA 4WB4A 3HRNA 1HTLC 1JY2N 1N2DC 2E43A 4AQRD 1N73A 4Y99C 3P8CE 2Z5IA 1KILC 1JY2P 4EOTA 2Q7CA 5AVSB 3RL0B 1HGVA 3M9BA 1W2EA 1NTZK 3HD7A 2O1KA 1IJDB 5AVYB 1G1JA 3TNUB 5BU5A 3GHGC 2GUSA 2Z4EA 1GU5A 1CI6A 1VPCA 5APYA 2I1KA 1L4AD 1LWUA 2C9NY 5AW7B 1GW4A 3V2PA 2W6BA 1FBMA 5CCHC 2OYIC 1NWQA 5AVRB 1ZLLA 2OYHA 1KQLA 2YKOA 4LLHA 4ZKUA 2XDJA 5APTA 1G1IA 3RK2C 5CJ4A 1G2CA 5APQA 1JMMA 2WWWA 1L4AA 1FU1A 1H88A 2HLOA 3U59A 1KILD 2H7HA 5BVZA 3SWFA 1EQ7A 2IFNA 2JEEA 2FKWB 2XNXA 1LT9C 2HODA 2M3BA 4RESB 1MUUA 4ZKPA 5AVWB 3CL3D 3VP8A 4JYCA 3H6PA 4B86A 5CCGA 1JTHB 2POHA 1RF1A 1T3JA 2Q5UA 1CW5A 2J58A 3B5NA 1LTJB 2QM7A 3B8EB 1GU4A 2MJZA 1M1JB 1IO4A 4W7ZA 1KILA 1JO5A 1XTCC 4LGDE 3A5TA 5CCHD 2VRSA 1JNMA 1HVVA 3NFQA 2Q9IA 2J59M 1VDFA 1SQVK 1URQD 1MFZA 2XV5A 4DOJA 1LWUC 2P67A 3H32B 1S9KE 2E42A 3VMYA 3RK2D 5AW6B 2KSJA 1GK6A 1N86A 1NTMK 3LIDA 1RE4C 2OYHC 1YTZI 1LTGC 2FYUK 4Y99B 4GT1A 1GK4A 1FZAA 5CCHA 3MUDA 2WT7B 5AW0B 1AFOA 1J1DB 1URQA 2I1JA 3VMXA 3V4QA 1L4AC 2NPSC 1ZR4A 1RE3A 1T2KC 1N7SC 2FYZA 1N7LA 1DH3A 3HUSA 5AW2B 1YTZT 1M7LA 2IFMA 2KLVA 3M9HA 3OA7A 3BRVB 3HE5B 1H8AA 5CCGC 4C7NB 1T8ZA 1RF1C 2OYIB 1LT9A 1SQQK 4OH8B 3P8CD 3B5NC 3TK1A 2FFDC 1KZUB 3L37A 3C9IA 2YO2A 4IFMA 1HUCA 1FZCA 3MTUE 1KFMA 2ZFCA 3OJAB 3HE4B 2HG5D 2P1JA 1L0LK 3RK3C 2P2UA 3MGNA 1NKZB 4KHXA 3EFGA 4JF7A 1SFCC 1A02J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XKM A;  4IFM A;  1IFN A;  2KSJ A;  1QL1 A;  1ZN5 A;  2IFM A;  2KLV A;  3IFM A;  2IFN A;  1QL2 A;  1IFM A;  1PFI A; 
#chains in the Genus database with same CATH topology
 1N73 B;  1K05 A;  3L72 D;  4OGQ B;  1T2K D;  1N7S D;  3OW2 O;  1IFN A;  1K04 A;  2PAJ A;  1IFJ A;  1RE4 A;  4UB8 E;  4WY4 A;  5KKZ B;  1L2P A;  1NOH A;  2YNY A;  2Y9Z A;  4I2L C;  3HUS C;  3CXH E;  3M0D C;  2FXM A;  1IFM A;  3CME P;  2WPS A;  3PP5 A;  3CCM P;  5APW A;  4PV1 D;  1YIT P;  3TYY A;  1FJP A;  2O01 N;  2B87 B;  3H1H E;  1EZV G;  1EXI A;  1X79 B;  5KJ7 A;  3JC2 2;  1JM0 A;  3M9Q A;  1KQF B;  1G2C B;  2H43 A;  2PRR A;  4H44 D;  1LTS C;  2XKM A;  1SQV E;  4QMA A;  3JCU E;  5CMZ A;  2OAR A;  1JUN A;  2JP3 A;  1M57 D;  5C39 A;  2A45 H;  1JY3 N;  1FOS F;  1YJ9 P;  1SQP G;  3CCL P;  1VQO P;  1Q82 Q;  3AE3 C;  2QM8 A;  2OTL P;  3M0D A;  3GHG B;  2BCC G;  2QE7 H;  3E1R A;  4H44 B;  1Q81 Q;  3V5B A;  5TIS E;  1GD2 E;  5M1B A;  3BRT B;  2BCC J;  2J5U A;  2HYN A;  5K5G B;  2WTY A;  3O8Z A;  3L36 A;  3QH9 A;  3L72 G;  3TGU G;  3HTK B;  2LKM A;  4KT0 J;  2L91 A;  5AVZ B;  4IL6 E;  4K35 A;  3U1A A;  1X22 A;  3L72 J;  1J1D C;  2RKL A;  1LNQ A;  2A45 I;  1S4X A;  2IZ0 A;  2M5A B;  5KLI B;  1VF5 C;  3S9O A;  2QEX P;  3CXH D;  2ZAE B;  1QX8 A;  1LT1 A;  1OW7 A;  1CI6 B;  4RKU J;  2IBZ I;  3A0B E;  2JKV A;  5AW1 B;  1S5L E;  3GLM A;  3H1H D;  5BU8 B;  1IC2 A;  1LTJ A;  1FDM A;  3CX5 H;  2NPS B;  1SQB K;  3H32 A;  4JQ0 D;  1SQV D;  2KNC A;  1WT6 A;  2WSF J;  2GUV A;  2O1J A;  2YIU B;  2HPC B;  1PZQ A;  3O6Q B;  2C0W A;  2WT7 A;  3TF5 A;  1Q7Y Q;  3G3Z A;  3KQG A;  1J1E C;  3AEC C;  1RHZ B;  2L5G B;  1VQP P;  1PGP A;  1HWT C;  1L0N D;  3IFM A;  2XU6 A;  3GHG A;  2R5B A;  2N1T B;  3AEB C;  3ZDM A;  1GL2 B;  3A3Y B;  3U1C A;  4TT3 H;  1OXZ A;  2OQQ A;  2IX7 C;  5APU A;  1DX7 A;  2JJL A;  1SQQ E;  3CX5 I;  3HE4 A;  2E76 B;  3HTK A;  4PD4 H;  3L74 E;  3B71 A;  3SFD C;  4BRY B;  1HTL C;  3P8C E;  1BDC A;  4ZMD A;  4EOT A;  2Q7C A;  5AVS B;  4I7Z C;  3S1K A;  1SQX E;  2ZT9 C;  1CI6 A;  3FXD A;  3V2P A;  3H1H G;  2OYI C;  2YXQ B;  5AVR B;  1ZXG A;  1Y47 A;  1U57 A;  2YKO A;  3H1H J;  4LLH A;  2XDJ A;  5APQ A;  1NTK E;  2Q3E A;  1FU1 A;  3AE7 C;  1SQV G;  3L71 D;  2IBZ E;  2H7H A;  1Y8A A;  5BVZ A;  1NU1 E;  1YQ4 C;  2JEE A;  1LT9 C;  2HOD A;  2OTK E;  2B88 A;  1KQG B;  2D2C D;  1QLE D;  3O6Q A;  3RK3 E;  3H6P A;  1GMJ A;  1JTH B;  2POH A;  5CCG A;  1T3J A;  1YI2 P;  2MJZ A;  1L0N G;  1XTC C;  4LGD E;  3IAO A;  2VRS A;  3NFQ A;  2Q9I A;  1VDF A;  1LWU C;  3AEA C;  1L0N J;  1S9K E;  3WUU A;  3RK2 D;  2IYP A;  1GK6 A;  1N86 A;  1NTM K;  1VL2 A;  1KB9 H;  2OYH C;  5E79 E;  4Y99 B;  3RGU A;  1GK4 A;  1URQ A;  2I1J A;  3V4Q A;  2QIW A;  1RE3 A;  2FYZ A;  1N7L A;  2D2C B;  1SQQ D;  5DJT B;  2FBW C;  4H13 B;  1AA0 A;  5AW2 B;  4HJG H;  3L74 D;  3OA7 A;  1OW8 A;  3BRV B;  3AE5 C;  3GF7 A;  1H8A A;  4L76 A;  1T8Z A;  1LT9 A;  3P8C D;  3CX5 E;  3F89 A;  2FFD C;  1KZU B;  3H1K E;  4IFM A;  1HUC A;  1FZC A;  4KJM A;  2ZFC A;  1EC5 A;  1OIP A;  1NTZ E;  3MGN A;  3D6Z A;  1NKZ B;  1SQX D;  4KHX A;  1SFC C;  1FDI A;  1A02 J;  2Y9Y A;  2KZI A;  1XTG B;  1KB9 I;  5AVQ B;  2E75 C;  2R3S A;  3AED C;  4YPC A;  2ZJS E;  1KYO H;  3CCE P;  2QJK B;  3II6 A;  2M8R A;  3HD7 B;  1N8R Q;  4GOE A;  2IZ1 A;  1NTK D;  3L71 J;  2CPB A;  1SP4 A;  3B5N D;  1FOS E;  2QVA A;  1VQ4 P;  2IBZ D;  3IF4 A;  1OWA A;  1FE6 A;  3RK3 D;  3ITK A;  1JY3 O;  4IL6 H;  3C8V A;  4NPD A;  1QL2 A;  1SVF A;  5AW4 B;  2FFD A;  1L4A B;  4LC1 A;  3M0A A;  5AVU B;  2FYU J;  3CWB E;  3OAK A;  4I1L A;  3KDP B;  1S9K D;  2QG4 A;  4N3Y B;  2ZYG A;  2Y0C A;  1H89 A;  3Q3D A;  1NKN A;  1SFC A;  4DT0 A;  4WY4 C;  1KYO I;  2UWJ E;  1AQ5 A;  1H0T A;  1SQQ G;  1HGZ A;  1NHL A;  3G6E P;  1KIL B;  3KZI H;  1Y9B A;  3A0B H;  1KN7 A;  1X9V A;  3L74 G;  1HJB A;  2WIT A;  1SQQ J;  4HYT B;  5AVX B;  2Q6Q A;  2XZR A;  4IOI H;  1ZP0 C;  3L74 J;  1PL5 A;  3VP9 A;  1DD4 A;  2E74 C;  1SQP D;  3NTN A;  2WSC H;  2H88 C;  3V2N A;  2O01 H;  5KJ7 C;  1ZR2 A;  2Z5H A;  2OTJ P;  3T97 A;  3CX5 D;  4M3L A;  1OFC X;  1SQX G;  3FWL A;  4L73 A;  3GMA A;  3VOP A;  3TNU A;  3HUS B;  3LW5 H;  3V4W A;  3L73 E;  2A45 G;  1NTZ D;  3L75 E;  1L0L E;  3F5H A;  1W2B O;  1X8Y A;  3TGU D;  1NTK G;  4OVN F;  2C0X A;  1FZG A;  2P10 A;  3BCC E;  2IBZ G;  3QWO C;  1BGY E;  2CK3 H;  4L75 A;  3VMZ A;  1HH0 A;  1NTK J;  1FZF A;  1KB9 E;  4DZO A;  5KLV K;  2LXB A;  1FAV A;  2JR8 A;  4I6M C;  2N9B A;  1EDI A;  5AW5 B;  3D6Y A;  2FYN B;  2R3C A;  4PD4 D;  2IPP A;  1D7M A;  2R5D A;  1GTW A;  1N73 C;  4GDO A;  1N7S B;  3CWB D;  2LR2 A;  4OGQ C;  2GM4 A;  1VF5 D;  3H25 A;  5KKZ C;  1PP9 D;  2W8Z A;  1PGJ A;  2HFE D;  3AE2 C;  1OZH A;  1GZL A;  2QJY B;  4PV1 B;  4H0L D;  3CD6 P;  2KP8 A;  2PP6 A;  1KYO E;  3HE5 A;  1SQP J;  3BAT A;  2R44 A;  4NPE A;  3CI9 A;  3CLQ A;  1T6A A;  2XND H;  2BEZ F;  2WSE H;  1UII A;  3M91 A;  1LTJ C;  1L0N K;  4A7P A;  1KQS O;  1NTZ G;  3CCR P;  3R4Y A;  4C7R A;  1OVU A;  1NTZ J;  2NZ2 A;  3L73 D;  3L75 D;  1N2D C;  2A06 E;  1N73 A;  5H2F H;  3EFF K;  2WPV B;  3W67 A;  1L0L D;  5GTI E;  2KLU A;  3TGU J;  1JY2 P;  1HGV A;  3M9B A;  2Y0E A;  1KOR A;  1E79 H;  5E79 H;  3ABV C;  3MP7 B;  3GHG C;  2GUS A;  1BGY D;  2I8D A;  4RJT A;  2AXT H;  3AE9 C;  2QJP C;  1VPC A;  5APY A;  1KB9 D;  2YMK A;  5CCH C;  3MUD C;  3KZI E;  4GOD A;  4YXD C;  2B87 A;  2MKV A;  4H0L C;  3RL0 g;  1KQL A;  3FWN A;  1VQK P;  1G2C A;  3CWB G;  1JMM A;  1BE3 E;  2V4H A;  2WWW A;  1H88 A;  1ZOY C;  2HLO A;  2M3E A;  1FDO A;  1EQ7 A;  1PP9 G;  3CWB J;  2WMM A;  1MUU A;  1SQB E;  4ZKP A;  2KS1 B;  3CL3 D;  5AVW B;  1PP9 J;  3Q5R A;  5KLI C;  2JWD A;  2Q5U A;  2ZT9 D;  1AJY A;  2KI7 B;  3WU2 E;  1GU4 A;  1NYH A;  1EDK A;  2QM7 A;  1M1J B;  1M56 D;  2K9J B;  3A5T A;  1URQ D;  1KYO D;  4Z1M H;  1PPJ E;  4CPG A;  1LTG C;  2FYU K;  1VQ8 P;  1YHQ P;  5CCH A;  3MUD A;  1NJI Q;  2NPS C;  4I7Z B;  3L73 G;  2W90 A;  1YJN P;  3L75 G;  1DH3 A;  1L0L G;  1YTZ T;  2IFM A;  2ZT9 B;  3H1I E;  3L73 J;  2YIU C;  3L75 J;  2A06 D;  5KAI H;  1L0L J;  5CCG C;  4C7N B;  2OYI B;  4EI2 A;  1SQQ K;  3FXE A;  1BGY G;  2M5A A;  1LP1 B;  1M90 Q;  1X0T A;  4DJG A;  1BGY J;  3AE1 C;  1JOC A;  1URQ C;  1LGH B;  2CPS A;  1FS0 E;  3MIW A;  2H8P D;  1RE3 C;  2YO3 A;  2M0B A;  4K3A A;  1BE3 D;  2NPS A;  1IK7 A;  2AEJ A;  2K37 A;  1JMB A;  3CCQ P;  1DD3 A;  2FY8 A;  3M06 A;  2KS1 A;  1DEB A;  1SQB D;  3SWY A;  4AUW A;  1SQV J;  5AVV B;  2IYO A;  2OYH B;  2GA1 A;  5L8R J;  3TSI A;  2HPC A;  5APS A;  1ZN5 A;  1FZC C;  3V2R A;  1M1J A;  4N6J A;  4GOF A;  2K9J A;  1SFC D;  1FC2 C;  2BEQ D;  2O3J A;  3H1J E;  1QVF O;  2E75 D;  5H2F E;  2KSE A;  4EIJ A;  2KUB A;  1LTT C;  2Q3I A;  2R32 A;  2N1T A;  3BAS A;  2G3A A;  4U7J A;  1GL2 A;  1NAY A;  4WWI A;  2KYV A;  1NTM E;  3SFE C;  3I5C A;  1A02 F;  3D70 A;  1ZW0 A;  1IFI A;  1S72 P;  4W80 A;  2AXT E;  3P7K A;  2JO1 A;  3A2A A;  2YKQ A;  3KXD A;  2W6A A;  3RL0 D;  1KFN A;  5EFW B;  1IFD A;  2A06 G;  1LJ2 A;  1WMK A;  2KIK A;  4BRY A;  3H1I D;  2QA4 P;  3H1L E;  3VN0 A;  3BVH A;  4JPZ B;  2YKP A;  3WUT A;  1SQP K;  1Q90 D;  3RK2 B;  1BDD A;  2ITA A;  2OGU A;  1FJK A;  4WY4 D;  1U7M A;  5AVT B;  1GDT A;  1JEK A;  1J2J B;  1R5S A;  2AEF A;  1RY3 A;  3CCS P;  1MV8 A;  3WUV A;  1S5L X;  1BE3 G;  1EDJ A;  2BAS A;  3AEF C;  2E74 D;  2K3R A;  3AE8 C;  1K8A Q;  2WQY C;  5CHX A;  5KJ7 D;  1BE3 J;  4YXW H;  2C9L Y;  1SQB G;  3RBX A;  2O01 J;  1HF9 A;  1FZB A;  1NU1 D;  1PFI A;  3IR9 A;  1WRG A;  3SWK A;  1SLQ A;  1SQB J;  3RL0 C;  1JTH A;  4WY4 B;  2K9Y A;  1RH5 B;  3KYQ A;  1IFP A;  3LW5 J;  3LIE A;  5GTI H;  1VQ6 P;  1ZME C;  1MZ9 A;  3AE6 C;  3H1J D;  5KAI E;  2LXC B;  3KHU A;  3GG2 A;  2QSI A;  5B5E H;  3AEE C;  2E74 B;  4D6T E;  3MD0 A;  4EYY Q;  2QJK C;  3HD7 C;  1RF1 B;  1NTM D;  4ASV A;  3CCU P;  3B5N B;  4UB6 H;  1ZV8 A;  1VQ9 P;  3H1I G;  4W7Y A;  1NO4 A;  1U7J A;  3W68 A;  3RK3 B;  1VQ7 P;  3H1I J;  5B66 H;  5CJ0 A;  2P7J A;  2RMZ A;  1Q2N A;  1JB0 J;  5GTH H;  2P58 A;  2KB7 P;  3H1L D;  4OGQ D;  3AE4 C;  4DCK A;  3AEG C;  3H1K D;  2V7Q H;  1USE A;  1VQM P;  1CZQ A;  3WU2 H;  2WSS H;  1S3J A;  1CSB A;  4WB4 A;  1NVO A;  1JY2 N;  1SQX J;  2RH0 A;  1PGQ A;  1KIL C;  4YTP C;  3MHV A;  4L74 A;  3JSV C;  3HD7 A;  3Q1M A;  2O1K A;  5AVY B;  1M8O B;  1NU1 G;  3RBZ A;  4JBZ A;  2Z4E A;  1GU5 A;  2C9N Y;  5AW7 B;  1GW4 A;  2W6B A;  2ZVO B;  1FBM A;  4MN4 C;  1NU1 J;  2WSE J;  2AEM A;  1ZLL A;  2ZVN B;  5KLV E;  3H1J G;  5APT A;  3L70 E;  3TDK A;  1L4A A;  3H1J J;  1OX3 A;  1TU3 F;  2KXP B;  3FX0 A;  2XNX A;  2M3B A;  4RES B;  4HKZ H;  2E5T A;  1NTM G;  1S1C X;  3VP8 A;  1BCC E;  4D6T D;  4JYC A;  4B86 A;  1RF1 A;  1CW5 A;  2J58 A;  1P84 H;  3B5N A;  1LTJ B;  3B8E B;  1NTM J;  1KIL A;  1JO5 A;  5CCH D;  4PJ0 E;  1HVV A;  2J59 M;  1SQV K;  1MFZ A;  2P67 A;  3H32 B;  1K73 Q;  3VMY A;  5AW6 B;  2KNC B;  2KK7 A;  2AXC A;  3CC4 P;  3H1L G;  3LID A;  1YTZ I;  4ASW A;  4GT1 A;  2FYN C;  3H1K G;  2WT7 B;  1AFO A;  1J1D B;  3VMX A;  3H1L J;  1L0N E;  1T2K C;  1N7S C;  2KZJ A;  3EWK A;  3H1K J;  4R4L A;  3HUS A;  1VF5 B;  4U3F E;  1QVG O;  1M7L A;  2Q1K A;  3M9H A;  2KLV A;  2H89 C;  2QJP B;  2W6J H;  1Q86 Q;  4WVZ A;  3TK1 A;  2JWA A;  3L37 A;  1VQ5 P;  1P84 I;  2HR3 A;  4H0L B;  4BXL A;  3I56 P;  2QJY C;  4PV1 C;  3C9I A;  1KFM A;  3OJA B;  3HE4 B;  2HG5 D;  2NRG A;  3A0H H;  5B5E E;  3BCC D;  5TJH A;  2P1J A;  2P2U A;  3EFG A;  4JF7 A;  4H44 C;  4XFJ A;  4HH2 A;  2NPS D;  4N78 E;  3P32 A;  3UIA A;  1LTA C;  4UB6 E;  1T3U A;  2K88 A;  5KLV D;  1AQT A;  1RF0 C;  1MFT A;  5CCG D;  3L70 D;  1OVV A;  4BWN A;  1J1E B;  5B66 E;  1N7S A;  4D6T G;  3PRJ A;  3Q5P A;  3D71 A;  5GTH E;  3I55 P;  3G4S P;  1SS1 A;  3K5B A;  4O9B A;  5CBO A;  2N1T D;  4D6T J;  1BCC D;  1YBK A;  3MZW B;  3PTZ A;  1GL2 D;  3USS A;  3VTP C;  4AYC A;  3Q5S A;  5CBN A;  3GF3 A;  3L71 E;  1AVY A;  2OYO A;  1KD1 Q;  1YQ3 C;  1EZV I;  1M1K Q;  1E5W A;  2E76 D;  2HOD B;  2ZXE B;  4JYB A;  2W27 A;  3SSU A;  3CC2 P;  2RN0 A;  2FYU E;  2PFX A;  2N9Y B;  2WPR A;  4NPF X;  1GW3 A;  2W83 C;  1JY3 P;  1RF0 A;  1QGK B;  2SPZ A;  1NAF A;  3E1I A;  4U3F D;  4OWF A;  1FZE A;  1VQN P;  5KTB A;  1M1J C;  2WPQ A;  2DW3 A;  3V6I A;  1URQ B;  3BCC G;  4XA4 A;  3NXS A;  1RQV A;  5APV A;  4GKG A;  3BCC J;  2N1T C;  2E5Y A;  1KC8 Q;  1GL2 C;  5APX A;  1P84 E;  4Y28 J;  5KLV G;  5DJU B;  2K1A A;  3R2P A;  1LT9 B;  4N78 D;  1ZRT E;  2WSF H;  5KAF H;  4GIF A;  3L70 G;  1FZC B;  5KLV J;  1K9M Q;  1SQX K;  2E76 C;  2QRX A;  4XE5 B;  1NGM B;  1R5L A;  3N4X A;  1PIX A;  4IFF A;  3L70 J;  1LTB C;  1QL1 A;  1BCC G;  1LWU B;  3G71 P;  1YYC A;  3IN6 A;  1JCD A;  2IDB A;  3V2Q A;  1BCC J;  1HJ0 A;  1NTK K;  3B4S A;  1R8E A;  2FXP A;  1EDL A;  1NU1 K;  3WMM 0;  4PD4 I;  1KIL E;  2G8Y A;  1OVR A;  1IK9 A;  1LTI C;  1HBW A;  4H13 D;  3CCJ P;  1OMI A;  5AW9 B;  3A0H E;  2YMY A;  1PPJ D;  4C46 A;  4IFD K;  1PGO A;  2WZ7 A;  1EZV E;  1YJW P;  1Z56 A;  3VYI A;  2FFD B;  1VQL P;  2FYU D;  4U3F G;  4EDF A;  3EQ2 A;  1EXJ A;  1YIJ P;  2KOG A;  5AW3 B;  4UB8 H;  1BSN A;  2JDI H;  1AVO A;  3L35 A;  3KPE A;  4U3F J;  1NH4 A;  1JY2 O;  3CXH H;  2ZXX A;  5AW8 B;  4IL6 X;  1SFC B;  4WBA A;  4C7N A;  2OYI A;  1H0T B;  1JCC A;  2E75 B;  3A7O A;  1USD A;  3N7N A;  3NMD A;  3L4F A;  1BSH A;  1LP1 A;  1SQP E;  3P8M C;  3GW6 A;  4ZNC A;  3HD7 D;  3HRN A;  1QEX A;  2E43 A;  4AQR D;  4PJ0 H;  1AV1 A;  4Y99 C;  1RQU A;  3CMA P;  1P84 D;  2BCC E;  2Z5I A;  3G9R A;  3T97 B;  3JCU H;  1ZRT D;  3RL0 B;  1W2E A;  1NTZ K;  2D2C C;  1IJD B;  4H13 C;  1G1J A;  3TNU B;  5BU5 A;  3CPW O;  2I1K A;  1L4A D;  1LWU A;  2WSC J;  3CXH I;  3L72 E;  3TGU E;  1PV3 A;  4TLF A;  1NWQ A;  2OYH A;  3L71 G;  4ZKU A;  5CJ4 A;  3RK2 C;  1G1I A;  2V7Q J;  5TIS H;  3E7K A;  3S4R A;  1S2E A;  3U59 A;  1KIL D;  3SWF A;  3PH0 A;  2IFN A;  1KV4 A;  2FKW B;  1PPJ G;  2FYU G;  4PD4 E;  3PJS K;  1MKM A;  1DIP A;  3VMA A;  1IO4 A;  4W7Z A;  2PGD A;  1JNM A;  3CCV P;  1EZV D;  3CC7 P;  3PHL A;  2XV5 A;  4DOJ A;  2E42 A;  2WVR A;  5KAF E;  2Y0D A;  1PP9 E;  2B89 A;  2KSJ A;  1RE4 C;  1OW6 A;  3FGA D;  2FXO A;  1IZN B;  1W5C E;  1FZA A;  1KTM A;  2ZYD A;  5AW0 B;  1DEE G;  1KMI Z;  1L4A C;  3C1L A;  1ZR4 A;  1S5L H;  3HE5 B;  3Q2Y A;  3PLN A;  2B9B A;  1RF1 C;  4HB1 A;  4OH8 B;  3B5N C;  2ZYA A;  2BCC D;  2YO2 A;  4RO0 A;  2YXR B;  3MTU E;  4R4M A;  1L0L K;  3RK3 C;  1UIX A; 
#chains in the Genus database with same CATH homology
 1N73 B;  4HH2 A;  2NPS D;  4N78 E;  3P32 A;  1XTG B;  5AVQ B;  3UIA A;  1T2K D;  1N7S D;  1JOC A;  1IFN A;  1LTA C;  1URQ C;  1LGH B;  2CPS A;  2PAJ A;  1IFJ A;  1T3U A;  3MIW A;  1RE4 A;  4WY4 A;  3II6 A;  2H8P D;  1RE3 C;  2M8R A;  1NOH A;  2YNY A;  2YO3 A;  1RF0 C;  3HD7 B;  4I2L C;  3HUS C;  3M0D C;  5CCG D;  2FXM A;  2NPS A;  1IFM A;  1J1E B;  2CPB A;  1SP4 A;  3B5N D;  1FOS E;  2WPS A;  1N7S A;  3PP5 A;  5APW A;  3M06 A;  3TYY A;  1OWA A;  1FJP A;  1DEB A;  3SWY A;  4AUW A;  4O9B A;  5AVV B;  2N1T D;  2OYH B;  3TSI A;  2HPC A;  5APS A;  1ZN5 A;  3RK3 D;  1X79 B;  5KJ7 A;  3V2R A;  1FZC C;  1M1J A;  1GL2 D;  3VTP C;  4N6J A;  1JY3 O;  4AYC A;  3M9Q A;  1G2C B;  1SFC D;  2H43 A;  2FFD A;  1QL2 A;  1SVF A;  5AW4 B;  1LTS C;  1L4A B;  4LC1 A;  2XKM A;  3M0A A;  5AVU B;  3OAK A;  4EIJ A;  4I1L A;  1LTT C;  2Q3I A;  2R32 A;  1E5W A;  3KDP B;  2N1T A;  3BAS A;  5CMZ A;  2HOD B;  1S9K D;  2ZXE B;  4JYB A;  2OAR A;  4N3Y B;  1GL2 A;  1JUN A;  2KYV A;  2W27 A;  1H89 A;  1NKN A;  1SFC A;  4WY4 C;  1AQ5 A;  3I5C A;  1A02 F;  1HGZ A;  2A45 H;  1NHL A;  1JY3 N;  1IFI A;  1FOS F;  1KIL B;  4W80 A;  1X9V A;  3P7K A;  1HJB A;  2WPR A;  1GW3 A;  3A2A A;  2YKQ A;  2W6A A;  1JY3 P;  2WIT A;  3RL0 D;  4HYT B;  5AVX B;  1RF0 A;  1KFN A;  2QM8 A;  1IFD A;  1NAF A;  2XZR A;  3E1I A;  3M0D A;  1FZE A;  3GHG B;  3VP9 A;  3NTN A;  2WSC H;  3V2N A;  2O01 H;  5KTB A;  3V5B A;  1GD2 E;  5KJ7 C;  1M1J C;  2WPQ A;  1ZR2 A;  2Z5H A;  3T97 A;  3BRT B;  3VN0 A;  1URQ B;  2HYN A;  4XA4 A;  3BVH A;  2YKP A;  3NXS A;  2WTY A;  4M3L A;  3O8Z A;  1SQP K;  5APV A;  3RK2 B;  4GKG A;  3VOP A;  3TNU A;  3HUS B;  3LW5 H;  3L36 A;  3V4W A;  1FJK A;  4WY4 D;  2N1T C;  3HTK B;  2LKM A;  2A45 G;  5AVT B;  1GDT A;  5AVZ B;  1GL2 C;  1J2J B;  5APX A;  3U1A A;  1RY3 A;  1X8Y A;  1J1D C;  1LT9 B;  1MV8 A;  3R2P A;  4N78 D;  2WSF H;  2A45 I;  4GIF A;  2C0X A;  1FZG A;  1FZC B;  2BAS A;  1SQX K;  4XE5 B;  3N4X A;  3VMZ A;  1HH0 A;  5CHX A;  4IFF A;  5KJ7 D;  1FZF A;  2C9L Y;  1LTB C;  1CI6 B;  1QL1 A;  1FZB A;  1LWU B;  1PFI A;  1YYC A;  3IR9 A;  4DZO A;  1WRG A;  5KLV K;  1JCD A;  5AW1 B;  1SLQ A;  1FAV A;  3V2Q A;  3RL0 C;  4I6M C;  1JTH A;  1NTK K;  2N9B A;  4WY4 B;  5BU8 B;  5AW5 B;  1IC2 A;  1LTJ A;  1FDM A;  3KYQ A;  2R3C A;  3LIE A;  2IPP A;  1NU1 K;  3WMM 0;  2R5D A;  1GTW A;  1MZ9 A;  2NPS B;  1SQB K;  1N73 C;  1IK9 A;  1N7S B;  3H32 A;  1LTI C;  1HBW A;  1WT6 A;  5AW9 B;  2GM4 A;  2GUV A;  3MD0 A;  2O1J A;  2HPC B;  2HFE D;  2C0W A;  2WT7 A;  2YMY A;  3HD7 C;  4C46 A;  1RF1 B;  4IFD K;  3G3Z A;  2WZ7 A;  3B5N B;  3KQG A;  1Z56 A;  3VYI A;  2FFD B;  1J1E C;  1GZL A;  3EQ2 A;  2KOG A;  2L5G B;  1ZV8 A;  5AW3 B;  4W7Y A;  1HWT C;  3IFM A;  2XU6 A;  3GHG A;  2KP8 A;  2R5B A;  1NO4 A;  3L35 A;  2N1T B;  3KPE A;  2PP6 A;  1NH4 A;  1JY2 O;  3HE5 A;  3RK3 B;  3BAT A;  1GL2 B;  3A3Y B;  3U1C A;  3CI9 A;  5AW8 B;  3CLQ A;  1SFC B;  5CJ0 A;  2P7J A;  4WBA A;  4C7N A;  1OXZ A;  2OYI A;  2WSE H;  3M91 A;  1LTJ C;  2IX7 C;  1JCC A;  1L0N K;  2KB7 P;  5APU A;  1DX7 A;  2JJL A;  3A7O A;  3HE4 A;  3N7N A;  3NMD A;  3L4F A;  4C7R A;  3HTK A;  3P8M C;  1CZQ A;  3HD7 D;  1CSB A;  4WB4 A;  3HRN A;  1HTL C;  1JY2 N;  1N2D C;  2E43 A;  4AQR D;  1N73 A;  4Y99 C;  3P8C E;  2Z5I A;  1KIL C;  1JY2 P;  4EOT A;  2Q7C A;  5AVS B;  3RL0 B;  1HGV A;  3M9B A;  1W2E A;  1NTZ K;  3HD7 A;  2O1K A;  1IJD B;  5AVY B;  1G1J A;  3TNU B;  5BU5 A;  3GHG C;  2GUS A;  2Z4E A;  1GU5 A;  1CI6 A;  1VPC A;  5APY A;  2I1K A;  1L4A D;  1LWU A;  2C9N Y;  5AW7 B;  1GW4 A;  3V2P A;  2W6B A;  1FBM A;  5CCH C;  2OYI C;  1NWQ A;  5AVR B;  1ZLL A;  2OYH A;  1KQL A;  2YKO A;  4LLH A;  4ZKU A;  2XDJ A;  5APT A;  1G1I A;  3RK2 C;  5CJ4 A;  1G2C A;  5APQ A;  1JMM A;  2WWW A;  1L4A A;  1FU1 A;  1H88 A;  2HLO A;  3U59 A;  1KIL D;  2H7H A;  5BVZ A;  3SWF A;  1EQ7 A;  2IFN A;  2JEE A;  2FKW B;  2XNX A;  1LT9 C;  2HOD A;  2M3B A;  4RES B;  1MUU A;  4ZKP A;  5AVW B;  3CL3 D;  3VP8 A;  4JYC A;  3H6P A;  4B86 A;  5CCG A;  1JTH B;  2POH A;  1RF1 A;  1T3J A;  2Q5U A;  1CW5 A;  2J58 A;  3B5N A;  1LTJ B;  2QM7 A;  3B8E B;  1GU4 A;  2MJZ A;  1M1J B;  1IO4 A;  4W7Z A;  1KIL A;  1JO5 A;  1XTC C;  4LGD E;  3A5T A;  5CCH D;  2VRS A;  1JNM A;  1HVV A;  3NFQ A;  2Q9I A;  2J59 M;  1VDF A;  1SQV K;  1URQ D;  1MFZ A;  2XV5 A;  4DOJ A;  1LWU C;  2P67 A;  3H32 B;  1S9K E;  2E42 A;  3VMY A;  3RK2 D;  5AW6 B;  2KSJ A;  1GK6 A;  1N86 A;  1NTM K;  3LID A;  1RE4 C;  2OYH C;  1YTZ I;  1LTG C;  2FYU K;  4Y99 B;  4GT1 A;  1GK4 A;  1FZA A;  5CCH A;  3MUD A;  2WT7 B;  5AW0 B;  1AFO A;  1J1D B;  1URQ A;  2I1J A;  3VMX A;  3V4Q A;  1L4A C;  2NPS C;  1ZR4 A;  1RE3 A;  1T2K C;  1N7S C;  2FYZ A;  1N7L A;  1DH3 A;  3HUS A;  5AW2 B;  1YTZ T;  1M7L A;  2IFM A;  2KLV A;  3M9H A;  3OA7 A;  3BRV B;  3HE5 B;  1H8A A;  5CCG C;  4C7N B;  1T8Z A;  1RF1 C;  2OYI B;  1LT9 A;  1SQQ K;  4OH8 B;  3P8C D;  3B5N C;  3TK1 A;  2FFD C;  1KZU B;  3L37 A;  3C9I A;  2YO2 A;  4IFM A;  1HUC A;  1FZC A;  3MTU E;  1KFM A;  2ZFC A;  3OJA B;  3HE4 B;  2HG5 D;  2P1J A;  1L0L K;  3RK3 C;  2P2U A;  3MGN A;  1NKZ B;  4KHX A;  3EFG A;  4JF7 A;  1SFC C;  1A02 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...