3V2QA

Compcc in complex with fatty acids
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
45
structure length
45
Chain Sequence
MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cartilage Oligomerization matrix protein (coiled-coil domain
publication title The pentameric channel of COMPcc in complex with different fatty acids.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 18
structure length 45
sequence length 45
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.10 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3v2qA00
3V2QA 1DEBA 1VDFA 1FBMA 1MZ9A 3V2NA 3V2RA 3V2PA
chains in the Genus database with same CATH superfamily
5CCHD 1ZXGA 4K3AA 3PJSK 3VP8A 1KB9I 4ZNCA 1NTMG 1LP1A 2WSSH 3D70A 3H1LD 3BCCD 2QA4P 3CXHD 2QJYC 3MIWA 3V2RA 1L4AC 3H1HD 1TU3F 3C1LA 2I1KA 2FFDC 3CD6P 2M3BA 3H1JD 4C7NA 1T2KC 4OGQB 3VMXA 3L37A 1OZHA 1L0LE 1SFCC 5KKZB 2BCCJ 2SPZA 2R5DA 3P8MC 2XDJA 2ZAEB 1NAFA 3AE6C 3FWNA 3CMAP 3S4RA 1OVUA 4H13C 1X22A 1GL2B 1UIIA 1KFNA 1LWUA 3WU2H 3VN0A 2A06G 1GK6A 3HE5B 5GTHH 1YTZT 3TK1A 3RK2B 3CCSP 1L0LG 3K5BA 1NTKD 3SWKA 3RK3C 3B5ND 2E42A 4EI2A 3RK3E 2ZYGA 1AVYA 2P7JA 1NTKK 5B66H 2Y9YA 1VDFA 5KAFH 1Q90D 4WVZA 2QG4A 3L75E 2GUVA 1FZBA 2C0XA 1Y8AA 2E75D 3PRJA 3L73G 4XFJA 3PH0A 1SS1A 2K9JA 4KJMA 3GHGB 1SQXG 3VMZA 3A0HE 4PJ0E 1S9KD 3A2AA 3I56P 3KQGA 2LR2A 3LW5J 2WPSA 1RH5B 1FU1A 4L76A 2ZYAA 1RQVA 2IFNA 3L75G 4HB1A 1KC8Q 2E76C 3M0DA 3BCCE 3V2PA 4U3FJ 4OH8B 1FZEA 1IFIA 3H1HE 3FXEA 1K8AQ 3TGUD 3O6QA 1KQFB 1RF0C 3S1KA 3H1JE 1GD2E 1YBKA 5BU5A 4H0LB 2ZT9D 3GG2A 1LT9A 1S1CX 2Y0EA 2N1TD 4PV1D 1ZMEC 1FJKA 3H32A 1GDTA 3MD0A 3BCCG 1PPJD 5CCGD 1SQBE 3H1HG 1JMMA 3HTKA 3KPEA 1AJYA 2HODA 2NRGA 5APTA 1EZVD 1Q86Q 3H1JG 3II6A 1EDKA 4XE5B 1JY3O 3RBXA 1SVFA 2WQYC 1W2BO 2E74B 3B5NC 1JY2P 1NTKE 2OYOA 2P1JA 1ZOYC 3D6YA 1LTJC 2KYVA 2QJPB 4I6MC 1PGPA 5KLVD 1JTHB 5DJUB 1SQBG 2YIUC 2R3CA 1GZLA 2YKQA 1IFMA 2FBWC 1FZCA 2E75C 3JC22 5KLVK 4PD4D 4NPFX 3N4XA 1LTAC 3V2NA 3HUSA 3Q3DA 1VQPP 1L4AB 2J5UA 4GIFA 4W7YA 3B5NA 4Y28J 4GODA 4HH2A 1WMKA 3TNUA 3FX0A 4JF7A 1UIXA 1LNQA 1FBMA 4N78D 1VQ9P 1S9KE 2P10A 1SFCB 2IFMA 3RK2D 1NTMJ 1NGMB 3E7KA 1KILA 1T3UA 2KZIA 1AV1A 1PZQA 2Z5HA 3L72G 2QJKC 3C8VA 3CCQP 4D6TD 2AEJA 2FXMA 2WSEH 2VRSA 3TGUE 1KQSO 3CWBG 2YO3A 3E1RA 2ZT9C 4RKUJ 5K5GB 1NTZG 2FYUJ 4NPDA 3H1KD 1N7LA 2KB7P 2M3EA 3KZIE 1KV4A 1LGHB 3HE4B 2JKVA 1R5SA 5CCGC 1P84I 1MZ9A 1PPJE 2K37A 2OTKE 3Q5SA 3VTPC 4L73A 1HJBA 3A0HH 1ZLLA 2KSEA 3TGUG 1EZVE 3L70E 4WY4B 2HR3A 3Q2YA 3V2QA 1ZR2A 2M5AB 2DW3A 3CXHH 1JB0J 2CPBA 1JCCA 2XNXA 2FXPA 1URQA 4B86A 5AW1B 1SQQE 2Q7CA 5KLVE 5KKZC 3UIAA 1KYOI 2IYOA 1PP9J 4PD4E 2LKMA 2V4HA 1EZVG 3MHVA 3L70G 1VQKP 2RMZA 1NKNA 1LTBC 1GMJA 2ZVOB 4RESB 1OW7A 4BRYB 3QH9A 2AXTE 1SQPJ 3ABVC 3L73J 4N78E 3L71D 4JQ0D 1SQQG 2NPSB 5KLVG 3U1CA 3T97B 1BE3J 3RK2C 1SQXJ 5AVRB 3V4QA 2E74D 3VP9A 1QX8A 1NYHA 2JO1A 1RE3A 1FE6A 2WSCJ 3FGAD 3H1ID 3CCUP 3M9QA 2K9YA 3A5TA 4D6TE 5GTHE 1SQVD 4GDOA 2XNDH 2O3JA 1VQOP 1FAVA 1GL2A 1OX3A 3H1KE 2OQQA 2Q3IA 1NU1G 1FDMA 1SQVK 3RBZA 1J1EB 1OXZA 1S2EA 5B66E 1MUUA 2B88A 1JY3N 1G2CB 1IO4A 3EQ2A 3HRNA 2IPPA 4IFFA 2KS1B 4EDFA 2V7QH 1VQMP 4Y99B 3IFMA 1JY3P 4IOIH 4TLFA 2ZXEB 2KSJA 1KB9H 1RE4C 1X79B 2HPCB 1L0ND 1AQTA 3M0AA 1IK9A 3GHGA 4Z1MH 1N7SD 2YXRB 1L0NK 1YQ4C 1KQGB 1KORA 1YTZI 1X9VA 1EC5A 1EXIA 1SQBJ 5KJ7C 1OVRA 2G8YA 3KZIH 2O01H 2QJKB 2P67A 3H25A 3HD7B 2H7HA 5DJTB 3IF4A 2IYPA 3NFQA 2ZT9B 5AVTB 1X0TA 1M57D 2JJLA 4A7PA 2N1TB 1DX7A 4PV1B 2E74C 1BSHA 3C9IA 2Z5IA 3D6ZA 4GKGA 1J1DB 3V6IA 1XTCC 3H1IE 5M1BA 1FZFA 2KI7B 2QJPC 1USEA 5KJ7A 1SLQA 1ZN5A 1ZV8A 3MUDC 1VQNP 2JR8A 1SQVE 1PIXA 5CBOA 2IBZE 4XA4A 3L72J 1GW4A 3B8EB 3CWBJ 2XV5A 2J59M 2H89C 4PD4H 1NTZJ 2WT7A 1AVOA 1GW3A 1NVOA 2WPQA 1YJWP 3L74D 3H1IG 3S9OA 1JNMA 1JTHA 2AXTH 2NPSD 1SQVG 3LW5H 1K05A 1L2PA 3LIEA 1YIJP 2W6JH 2IBZG 4IFDK 1FDIA 3N7NA 3JCUH 1FZGA 3SFEC 1L4AA 4IFMA 1L0NE 1DD3A 2FFDA 1BGYJ 1N7SC 2KZJA 3GLMA 1PL5A 1K73Q 1ZW0A 1SFCA 1PFIA 2RKLA 3SWFA 3WUVA 1IFJA 2D2CB 2KUBA 2W8ZA 3G9RA 4AQRD 1S72P 2IDBA 1A02J 2CPSA 3L70J 3LIDA 1L0NG 5AVYB 2BEQD 3BASA 3D71A 2XKMA 1MKMA 4GOEA 4ASWA 4WY4C 2Q9IA 1NHLA 2MJZA 5CCHC 1HWTC 1SQQJ 1H8AA 1NOHA 3HE4A 1N86A 2YNYA 1G1IA 4LC1A 3V4WA 3VMAA 2P2UA 4GT1A 2KNCB 2M0BA 2Q5UA 3L35A 2QSIA 1KB9D 3OAKA 3H1LE 3CXHE 3RL0B 1EDJA 1H0TB 4WY4A 2E5TA 3WUTA 3CC4P 1IFDA 1M7LA 2ZVNB 2WSFH 5CCHA 3JSVC 1Q82Q 4N6JA 1NU1J 2A45H 3CC2P 3HD7D 1FOSF 3G6EP 4WB4A 3L74E 2BCCD 4O9BA 4EIJA 2NPSC 3EFGA 1HTLC 4H44B 5AVZB 3H1LG 1U7JA 2MKVA 1M1JC 4C7RA 2OYIB 1CZQA 4BRYA 4EYYQ 5H2FE 1RF0A 3AE7C 3ZDMA 2HYNA 3CCMP 2FXOA 3T97A 4BXLA 1J1EC 3EFFK 1VQLP 3GF7A 2NZ2A 2IX7C 1OMIA 4TT3H 1NKZB 2C9LY 1JCDA 2LXBA 4UB8E 3BRVB 5KAIE 4CPGA 4Y99C 2XZRA 3P32A 5B5EH 3IR9A 3TSIA 1PV3A 2WTYA 1FS0E 1N73C 4L74A 1NTKG 2RN0A 1W5CE 1LTJA 1G2CA 2W6BA 1QEXA 4DCKA 3AEEC 5CMZA 1W2EA 4U3FD 3KHUA 5GTIH 1KB9E 3Q1MA 2WVRA 1JO5A 2R5BA 4R4MA 1LWUB 3AE2C 2D2CD 2K88A 1CSBA 5APSA 3HD7C 1NO4A 1YYCA 2HPCA 2FKWB 1E79H 3PHLA 1N7SB 4R4LA 2BCCE 5APYA 3IN6A 2KK7A 4MN4C 2N1TC 3AEGC 4PV1C 1KQLA 3M9BA 4L75A 1KN7A 1S5LH 3TYYA 3CL3D 1J1DC 3SSUA 1HVVA 3A0BE 1IJDB 3BVHA 1X8YA 2K9JB 3M91A 5CJ0A 1GU4A 1M90Q 2BCCG 4W7ZA 3RL0D 2N1TA 4YTPC 2I1JA 2QM8A 1HUCA 5AW6B 5AVSB 3CCLP 1L0LJ 5CCGA 2P58A 1PPJG 1HGZA 1U57A 5APVA 5TISE 1KTMA 1EQ7A 3CX5I 4ZKPA 4KHXA 5AVWB 2ZXXA 3O6QB 2KIKA 4H44D 1Q2NA 4AYCA 2N9BA 5AW0B 2FYNC 3TF5A 5CBNA 2R3SA 1IZNB 1KD1Q 2Y0CA 2R32A 3M9HA 1DIPA 1NTMD 1J2JB 2H88C 3JCUE 1VF5D 2YKOA 5H2FH 1IK7A 2QEXP 3HTKB 2WSEJ 1T6AA 3RL0g 2H43A 2HODB 1NTMK 2YMKA 2D2CC 3L36A 1M1JB 5AW7B 3L75J 3CLQA 2FYUD 1BDCA 4UB8H 1YI2P 3AEDC 5KAIH 3CPWO 2L91A 3HE5A 3AE3C 2FYUK 1DH3A 3NMDA 2M8RA 1N8RQ 1FZCB 1AQ5A 2GA1A 4I7ZC 4ZKUA 3AEBC 2IZ1A 5KTBA 4ZMDA 3CCJP 3HUSB 3VMYA 2I8DA 4JYBA 3H1LJ 4D6TG 3BCCJ 2L5GB 1A02F 4UB6E 3TNUB 1P84D 2WPVB 3H1HJ 3RL0C 4EOTA 1GTWA 3H1KG 3G4SP 2A06D 5L8RJ 1N73B 1LTSC 3H1JJ 1ZR4A 1RY3A 2KXPB 1ZP0C 5AW8B 1KILB 2E43A 4RJTA 2KNCA 1PP9D 5AW2B 1EDIA 1QVFO 2YKPA 3ITKA 4H44C 1RQUA 2AXCA 2AEMA 1R5LA 1DEEG 1M1KQ 1H0TA 1WT6A 1SQPD 3CX5D 2ZYDA 1RE4A 3L73D 2OYIC 1KYOD 3A3YB 5EFWB 5APWA 1BE3D 5E79H 1SQXD 1SQPK 3L71E 3RK3D 4WWIA 2BASA 1N2DC 4LLHA 1NTME 1NTKJ 3A0BH 1EDLA 1XTGB 1BCCD 1SQXK 2R44A 2OTLP 3I55P 2LXCB 3BRTB 4C46A 2A45G 2IZ0A 4I1LA 3MP7B 1MFTA 4DT0A 2FYUE 3AEFC 3KXDA 5AVXB 1CW5A 4YXDC 2HG5D 3L71G 1URQB 5TISH 4BWNA 3AECC 3O8ZA 2V7QJ 2WMMA 1DEBA 4ASVA 3VYIA 2QVAA 5AVQB 1K9MQ 3CCRP 4M3LA 5B5EE 2E76D 3MUDA 4N3YB 2PP6A 2FYUG 3AEAC 1VQ5P 1P84E 3U59A 1FOSE 2FYNB 1LWUC 2A06E 1MFZA 4I2LC 3TGUJ 1KMIZ 3P8CD 1NH4A 2WPRA 1AFOA 2B87B 3V5BA 5GTIE 2BEZF 4HJGH 2OARA 2PGDA 2W83C 1HJ0A 4DJGA 2O01J 1PP9E 1EZVI 1IFPA 1NAYA 1SQBD 1JOCA 2Y0DA 4IL6E 3CI9A 1IC2A 1FC2C 1LTTC 1LTIC 1ZRTD 5AW3B 1SQBK 1BSNA 1SQPE 3CX5E 2JP3A 3L73E 1VL2A 1KYOE 1D7MA 3AE4C 1BE3E 1N7SA 2HLOA 1SQXE 1S5LE 1HF9A 2O1KA 3PP5A 1CI6B 4PD4I 2ZJSE 1OW8A 1PP9G 2POHA 2RH0A 4UB6H 1BCCE 3MTUE 5KLVJ 4I7ZB 4HKZH 2PAJA 3M0DC 1YQ3C 1KILD 1SQPG 3L72D 3R4YA 2JWDA 2QIWA 1PGOA 3CWBD 1BE3G 3SWYA 1NTZD 3SFDC 1JMBA 1IFNA 2C9NY 1LT9C 3F89A 2QM7A 2M5AA 1BCCG 2G3AA 1E5WA 4YXWH 1NTZK 1Y47A 2WITA 5KLIC 2KLVA 3TDKA 3F5HA 1PGQA 5AW5B 3AE8C 1H89A 3CMEP 2KOGA 2B89A 3G3ZA 1R8EA 2KLUA 2QRXA 3VOPA 4D6TJ 1KZUB 1T8ZA 1SP4A 1BGYD 5BVZA 3L4FA 3P8CE 1QL2A 3H1KJ 4LGDE 1RF1B 2OYHB 4AUWA 3PLNA 4QMAA 3L74G 1VF5B 3GMAA 3WUUA 2NPSA 3Q5PA 1JY2N 1LP1B 1URQD 4JYCA 5AW4B 2GUSA 1QVGO 3EWKA 4WBAA 1OWAA 3B71A 1FZCC 1ZRTE 1FJPA 3L70D 1VQ4P 1M1JA 3HUSC 4OVNF 1YJ9P 2ITAA 3I5CA 2J58A 2WT7B 3CCEP 5BU8B 2QE7H 1U7MA 4C7NB 4RO0A 1SQQD 2JEEA 2PFXA 2Q1KA 4OGQD 2A45I 1P84H 4OWFA 1YITP 3R2PA 1G1JA 1Q7YQ 1WRGA 1SQQK 1KILC 2WZ7A 3OJAB 2PRRA 5AVUB 1VQ6P 1KILE 1K04A 3L72E 2QJYB 2KS1A 1VQ8P 2WSFJ 2FFDB 3CWBE 1GU5A 1FDOA 1LJ2A 1NTZE 1USDA 2FY8A 1NU1D 1GL2D 2K3RA 4IL6H 1N73A 2W6AA 3L71J 3AE1C 1NU1K 2AEFA 4U7JA 1OIPA 3CX5H 1KYOH 2O1JA 2IBZI 3Q5RA 3NXSA 1Q81Q 1S4XA 3FXDA 1GK4A 3H1IJ 3H6PA 2YXQB 2B9BA 2HFED 4H13B 4JPZB 2WSCH 1SQVJ 5E79E 1BGYE 1EXJA 1QGKB 1S3JA 5CJ4A 3HD7A 2C0WA 1YHQP 1T3JA 1MV8A 3RK3B 4YPCA 4DOJA 1URQC 5C39A 1NJIQ 2N9YB 2Q3EA 1JUNA 4JBZA 4NPEA 3W67A 4PJ0H 4IL6X 2Z4EA 1BGYG 5CHXA 3MGNA 1M8OB 2O01N 4OGQC 1L0NJ 1LT9B 1S5LX 1M56D 5APQA 2ZFCA 4H0LD 2YO2A 3OA7A 1JM0A 5KLIB 2CK3H 3H32B 1NWQA 2E76B 1RE3C 1BDDA 1HBWA 1VQ7P 5KJ7D 5AVVB 4U3FE 3KDPB 2XU6A 1VPCA 3W68A 1GL2C 1OFCX 2W90A 4W80A 1NU1E 1RHZB 3E1IA 2OGUA 2B87A 3MZWB 1HGVA 1BCCJ 3PTZA 2W27A 3CXHI 3WU2E 3G71P 4U3FG 2OTJP 3BATA 3KYQA 1Z56A 3FWLA 2H8PD 2IBZD 1DD4A 4K35A 1KFMA 3CCVP 3AE5C 2E5YA 3GF3A 3CC7P 3P7KA 3B5NB 1LT1A 1L4AD 5KAFE 1YJNP 3GHGC 1LTJB 5APUA 3U1AA 1CI6A 1T2KD 3M06A 1L0LD 2YIUB 3L74J 3IAOA 5APXA 1SFCD 1OVVA 3B4SA 2E75B 2FYZA 3A7OA 1L0LK 4DZOA 5TJHA 1JEKA 2YMYA 3WMM0 1AA0A 1LTGC 4H13D 1FZAA 1QLED 3USSA 4H0LC 4GOFA 1JY2O 2Q6QA 1RF1C 2OYHC 2JDIH 1VF5C 2KP8A 1QL1A 2Y9ZA 4HYTB 3OW2O 3GW6A 2UWJE 1HH0A 3AE9C 3NTNA 1PGJA 2K1AA 3L75D 1Y9BA 2GM4A 3RGUA 2JWAA 2WWWA 5AW9B 2OYIA 4WY4D 4KT0J 1H88A 1RF1A 2OYHA 1OW6A 3QWOC
chains in the Genus database with same CATH topology
5CCHD 1JO5A 3SWYA 3VP8A 1RE3A 2R5BA 1LWUB 1IFNA 3M9QA 2C9NY 1LT9C 2QM7A 3A5TA 1CSBA 5APSA 3HD7C 1NO4A 1YYCA 2HPCA 1E5WA 1NTZK 2FKWB 2WITA 1FAVA 1N7SB 1GL2A 5APYA 2KLVA 2Q3IA 1FDMA 1SQVK 2N1TC 3MIWA 1J1EB 5AW5B 1KQLA 3V2RA 1OXZA 1L4AC 1H89A 3M9BA 3TYYA 2I1KA 2FFDC 3CL3D 2KOGA 1MUUA 3G3ZA 1J1DC 1JY3N 1G2CB 2M3BA 4C7NA 1T2KC 3VOPA 1KZUB 1IO4A 3EQ2A 1T8ZA 3HRNA 3VMXA 1SP4A 3L37A 2IPPA 5BVZA 3L4FA 3P8CE 4IFFA 1SFCC 1HVVA 1QL2A 1IJDB 3BVHA 4LGDE 1X8YA 1RF1B 2OYHB 3M91A 5CJ0A 2R5DA 3P8MC 4Y99B 1GU4A 3IFMA 4AUWA 2XDJA 1JY3P 2NPSA 4W7ZA 3RL0D 2N1TA 2ZXEB 1JY2N 1NAFA 2KSJA 1URQD 4JYCA 2I1JA 1RE4C 1X79B 5AW4B 2GUSA 2QM8A 1HUCA 5AW6B 4WBAA 2HPCB 1OWAA 3M0AA 5AVSB 1IK9A 3GHGA 1FZCC 1GL2B 1KFNA 1FJPA 1LWUA 5CCGA 1N7SD 1M1JA 3VN0A 1GK6A 3HE5B 3HUSC 1YTZT 3TK1A 1L0NK 1HGZA 3RK2B 3I5CA 5APVA 1EQ7A 4ZKPA 2J58A 2WT7B 3RK3C 3B5ND 2E42A 5BU8B 4KHXA 5AVWB 1YTZI 1X9VA 4AYCA 2N9BA 5AW0B 4C7NB 5KJ7C 2P7JA 2JEEA 2O01H 1NTKK 2A45I 1VDFA 2P67A 3HD7B 2H7HA 3R2PA 1G1JA 2GUVA 1FZBA 3NFQA 1WRGA 2C0XA 1SQQK 2R32A 3M9HA 1KILC 2WZ7A 3OJAB 5AVTB 5AVUB 2JJLA 2N1TB 1J2JB 1DX7A 2YKOA 3HTKB 3C9IA 2FFDB 2Z5IA 3GHGB 1GU5A 2H43A 4GKGA 1J1DB 2HODB 1NTMK 1XTCC 3VMZA 1FZFA 5KJ7A 1SLQA 1ZN5A 1ZV8A 3L36A 1M1JB 1GL2D 1S9KD 3A2AA 5AW7B 3KQGA 3CLQA 1N73A 2W6AA 2WPSA 1FU1A 1NU1K 2IFNA 4XA4A 1GW4A 3M0DA 3V2PA 3B8EB 4OH8B 1FZEA 2O1JA 3HE5A 2FYUK 3NXSA 1IFIA 1GK4A 2XV5A 2J59M 3H6PA 2WT7A 1DH3A 3NMDA 2M8RA 2HFED 1FZCB 1AQ5A 1RF0C 1GW3A 2WPQA 4ZKUA 2WSCH 1GD2E 5KTBA 5BU5A 3HUSB 1LT9A 1JNMA 3VMYA 1JTHA 5CJ4A 3HD7A 4JYBA 2NPSD 2C0WA 2N1TD 3LW5H 1T3JA 2L5GB 1MV8A 1FJKA 3RK3B 3TNUB 3LIEA 1A02F 3H32A 4DOJA 1GDTA 4IFDK 3MD0A 3RL0C 4EOTA 3N7NA 1FZGA 1GTWA 1URQC 5CCGD 1L4AA 1JUNA 4IFMA 1N73B 1JMMA 1LTSC 3HTKA 1ZR4A 2FFDA 1RY3A 3KPEA 2HODA 1N7SC 5APTA 5AW8B 1KILB 2E43A 3II6A 4XE5B 1JY3O 1SVFA 2Z4EA 5AW2B 1SFCA 1PFIA 5CHXA 3B5NC 3MGNA 1JY2P 3SWFA 2YKPA 2P1JA 1IFJA 1LTJC 2KYVA 4I6MC 1WT6A 1LT9B 4AQRD 5APQA 2ZFCA 1JTHB 1RE4A 2YO2A 2OYIC 1A02J 3A3YB 2CPSA 2R3CA 3OA7A 1GZLA 3LIDA 2YKQA 1IFMA 5AVYB 1FZCA 5APWA 3H32B 5KLVK 1NWQA 3BASA 1RE3C 1SQPK 2XKMA 3N4XA 3RK3D 1LTAC 2BASA 1N2DC 3V2NA 4LLHA 3HUSA 4WY4C 1HBWA 2Q9IA 1NHLA 2MJZA 5KJ7D 1L4AB 5AVVB 1XTGB 4GIFA 3KDPB 4W7YA 2XU6A 3B5NA 5CCHC 1SQXK 4HH2A 1HWTC 3TNUA 1VPCA 1H8AA 1NOHA 3HE4A 3BRTB 1N86A 1GL2C 4C46A 2YNYA 4JF7A 2A45G 1G1IA 1FBMA 4LC1A 4W80A 3V4WA 4N78D 1S9KE 4I1LA 2P2UA 4GT1A 3E1IA 1SFCB 2IFMA 2Q5UA 3L35A 3RK2D 3OAKA 5AVXB 1CW5A 1HGVA 1KILA 3RL0B 2HG5D 1T3UA 1URQB 4WY4A 2W27A 1IFDA 2Z5HA 1M7LA 3O8ZA 5CCHA 2WSFH 3BATA 1DEBA 2FXMA 4N6JA 2WSEH 2A45H 2VRSA 1Z56A 3KYQA 3HD7D 1FOSF 3VYIA 2H8PD 2YO3A 4WB4A 5AVQB 4O9BA 1KFMA 4M3LA 1N7LA 2KB7P 4EIJA 3MUDA 4N3YB 2NPSC 3EFGA 3P7KA 1HTLC 3B5NB 2PP6A 1L4AD 5AVZB 1LGHB 3GHGC 3HE4B 1LTJB 3U59A 5APUA 1FOSE 1LWUC 5CCGC 1MZ9A 1MFZA 1M1JC 3U1AA 1CI6A 4I2LC 4C7RA 1T2KD 3M06A 2OYIB 3P8CD 1NH4A 3VTPC 2WPRA 1CZQA 5APXA 1AFOA 1SFCD 1HJBA 1RF0A 1ZLLA 2FYZA 3V5BA 3A7OA 2OARA 2HYNA 4WY4B 1L0LK 4DZOA 3T97A 1J1EC 3V2QA 1ZR2A 2YMYA 3WMM0 1JOCA 2IX7C 3CI9A 2CPBA 1JCCA 2XNXA 1IC2A 1LTTC 1NKZB 2C9LY 1LTIC 1LTGC 1JCDA 1URQA 4B86A 1FZAA 5AW1B 5AW3B 1SQBK 2Q7CA 3BRVB 1JY2O 3UIAA 1RF1C 2OYHC 1N7SA 2HLOA 4Y99C 2XZRA 3P32A 3IR9A 3TSIA 2LKMA 2O1KA 3PP5A 2KP8A 2WTYA 1QL1A 4HYTB 1NKNA 1CI6B 1LTBC 2POHA 1HH0A 4RESB 1N73C 3NTNA 3MTUE 1LTJA 2GM4A 1G2CA 2W6BA 2PAJA 3M0DC 4N78E 1KILD 2WWWA 2NPSB 5AW9B 3U1CA 2OYIA 3RK2C 5CMZA 4WY4D 1W2EA 1H88A 5AVRB 3V4QA 1RF1A 2OYHA 3VP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V2Q A;  1DEB A;  1VDF A;  1FBM A;  1MZ9 A;  3V2N A;  3V2R A;  3V2P A; 
#chains in the Genus database with same CATH topology
 5CCH D;  1ZXG A;  4K3A A;  3PJS K;  3VP8 A;  1KB9 I;  4ZNC A;  1NTM G;  1LP1 A;  2WSS H;  3D70 A;  3H1L D;  3BCC D;  2QA4 P;  3CXH D;  2QJY C;  3MIW A;  3V2R A;  1L4A C;  3H1H D;  1TU3 F;  3C1L A;  2I1K A;  2FFD C;  3CD6 P;  2M3B A;  3H1J D;  4C7N A;  1T2K C;  4OGQ B;  3VMX A;  3L37 A;  1OZH A;  1L0L E;  1SFC C;  5KKZ B;  2BCC J;  2SPZ A;  2R5D A;  3P8M C;  2XDJ A;  2ZAE B;  1NAF A;  3AE6 C;  3FWN A;  3CMA P;  3S4R A;  1OVU A;  4H13 C;  1X22 A;  1GL2 B;  1UII A;  1KFN A;  1LWU A;  3WU2 H;  3VN0 A;  2A06 G;  1GK6 A;  3HE5 B;  5GTH H;  1YTZ T;  3TK1 A;  3RK2 B;  3CCS P;  1L0L G;  3K5B A;  1NTK D;  3SWK A;  3RK3 C;  3B5N D;  2E42 A;  4EI2 A;  3RK3 E;  2ZYG A;  1AVY A;  2P7J A;  1NTK K;  5B66 H;  2Y9Y A;  1VDF A;  5KAF H;  1Q90 D;  4WVZ A;  2QG4 A;  3L75 E;  2GUV A;  1FZB A;  2C0X A;  1Y8A A;  2E75 D;  3PRJ A;  3L73 G;  4XFJ A;  3PH0 A;  1SS1 A;  2K9J A;  4KJM A;  3GHG B;  1SQX G;  3VMZ A;  3A0H E;  4PJ0 E;  1S9K D;  3A2A A;  3I56 P;  3KQG A;  2LR2 A;  3LW5 J;  2WPS A;  1RH5 B;  1FU1 A;  4L76 A;  2ZYA A;  1RQV A;  2IFN A;  3L75 G;  4HB1 A;  1KC8 Q;  2E76 C;  3M0D A;  3BCC E;  3V2P A;  4U3F J;  4OH8 B;  1FZE A;  1IFI A;  3H1H E;  3FXE A;  1K8A Q;  3TGU D;  3O6Q A;  1KQF B;  1RF0 C;  3S1K A;  3H1J E;  1GD2 E;  1YBK A;  5BU5 A;  4H0L B;  2ZT9 D;  3GG2 A;  1LT9 A;  1S1C X;  2Y0E A;  2N1T D;  4PV1 D;  1ZME C;  1FJK A;  3H32 A;  1GDT A;  3MD0 A;  3BCC G;  1PPJ D;  5CCG D;  1SQB E;  3H1H G;  1JMM A;  3HTK A;  3KPE A;  1AJY A;  2HOD A;  2NRG A;  5APT A;  1EZV D;  1Q86 Q;  3H1J G;  3II6 A;  1EDK A;  4XE5 B;  1JY3 O;  3RBX A;  1SVF A;  2WQY C;  1W2B O;  2E74 B;  3B5N C;  1JY2 P;  1NTK E;  2OYO A;  2P1J A;  1ZOY C;  3D6Y A;  1LTJ C;  2KYV A;  2QJP B;  4I6M C;  1PGP A;  5KLV D;  1JTH B;  5DJU B;  1SQB G;  2YIU C;  2R3C A;  1GZL A;  2YKQ A;  1IFM A;  2FBW C;  1FZC A;  2E75 C;  3JC2 2;  5KLV K;  4PD4 D;  4NPF X;  3N4X A;  1LTA C;  3V2N A;  3HUS A;  3Q3D A;  1VQP P;  1L4A B;  2J5U A;  4GIF A;  4W7Y A;  3B5N A;  4Y28 J;  4GOD A;  4HH2 A;  1WMK A;  3TNU A;  3FX0 A;  4JF7 A;  1UIX A;  1LNQ A;  1FBM A;  4N78 D;  1VQ9 P;  1S9K E;  2P10 A;  1SFC B;  2IFM A;  3RK2 D;  1NTM J;  1NGM B;  3E7K A;  1KIL A;  1T3U A;  2KZI A;  1AV1 A;  1PZQ A;  2Z5H A;  3L72 G;  2QJK C;  3C8V A;  3CCQ P;  4D6T D;  2AEJ A;  2FXM A;  2WSE H;  2VRS A;  3TGU E;  1KQS O;  3CWB G;  2YO3 A;  3E1R A;  2ZT9 C;  4RKU J;  5K5G B;  1NTZ G;  2FYU J;  4NPD A;  3H1K D;  1N7L A;  2KB7 P;  2M3E A;  3KZI E;  1KV4 A;  1LGH B;  3HE4 B;  2JKV A;  1R5S A;  5CCG C;  1P84 I;  1MZ9 A;  1PPJ E;  2K37 A;  2OTK E;  3Q5S A;  3VTP C;  4L73 A;  1HJB A;  3A0H H;  1ZLL A;  2KSE A;  3TGU G;  1EZV E;  3L70 E;  4WY4 B;  2HR3 A;  3Q2Y A;  3V2Q A;  1ZR2 A;  2M5A B;  2DW3 A;  3CXH H;  1JB0 J;  2CPB A;  1JCC A;  2XNX A;  2FXP A;  1URQ A;  4B86 A;  5AW1 B;  1SQQ E;  2Q7C A;  5KLV E;  5KKZ C;  3UIA A;  1KYO I;  2IYO A;  1PP9 J;  4PD4 E;  2LKM A;  2V4H A;  1EZV G;  3MHV A;  3L70 G;  1VQK P;  2RMZ A;  1NKN A;  1LTB C;  1GMJ A;  2ZVO B;  4RES B;  1OW7 A;  4BRY B;  3QH9 A;  2AXT E;  1SQP J;  3ABV C;  3L73 J;  4N78 E;  3L71 D;  4JQ0 D;  1SQQ G;  2NPS B;  5KLV G;  3U1C A;  3T97 B;  1BE3 J;  3RK2 C;  1SQX J;  5AVR B;  3V4Q A;  2E74 D;  3VP9 A;  1QX8 A;  1NYH A;  2JO1 A;  1RE3 A;  1FE6 A;  2WSC J;  3FGA D;  3H1I D;  3CCU P;  3M9Q A;  2K9Y A;  3A5T A;  4D6T E;  5GTH E;  1SQV D;  4GDO A;  2XND H;  2O3J A;  1VQO P;  1FAV A;  1GL2 A;  1OX3 A;  3H1K E;  2OQQ A;  2Q3I A;  1NU1 G;  1FDM A;  1SQV K;  3RBZ A;  1J1E B;  1OXZ A;  1S2E A;  5B66 E;  1MUU A;  2B88 A;  1JY3 N;  1G2C B;  1IO4 A;  3EQ2 A;  3HRN A;  2IPP A;  4IFF A;  2KS1 B;  4EDF A;  2V7Q H;  1VQM P;  4Y99 B;  3IFM A;  1JY3 P;  4IOI H;  4TLF A;  2ZXE B;  2KSJ A;  1KB9 H;  1RE4 C;  1X79 B;  2HPC B;  1L0N D;  1AQT A;  3M0A A;  1IK9 A;  3GHG A;  4Z1M H;  1N7S D;  2YXR B;  1L0N K;  1YQ4 C;  1KQG B;  1KOR A;  1YTZ I;  1X9V A;  1EC5 A;  1EXI A;  1SQB J;  5KJ7 C;  1OVR A;  2G8Y A;  3KZI H;  2O01 H;  2QJK B;  2P67 A;  3H25 A;  3HD7 B;  2H7H A;  5DJT B;  3IF4 A;  2IYP A;  3NFQ A;  2ZT9 B;  5AVT B;  1X0T A;  1M57 D;  2JJL A;  4A7P A;  2N1T B;  1DX7 A;  4PV1 B;  2E74 C;  1BSH A;  3C9I A;  2Z5I A;  3D6Z A;  4GKG A;  1J1D B;  3V6I A;  1XTC C;  3H1I E;  5M1B A;  1FZF A;  2KI7 B;  2QJP C;  1USE A;  5KJ7 A;  1SLQ A;  1ZN5 A;  1ZV8 A;  3MUD C;  1VQN P;  2JR8 A;  1SQV E;  1PIX A;  5CBO A;  2IBZ E;  4XA4 A;  3L72 J;  1GW4 A;  3B8E B;  3CWB J;  2XV5 A;  2J59 M;  2H89 C;  4PD4 H;  1NTZ J;  2WT7 A;  1AVO A;  1GW3 A;  1NVO A;  2WPQ A;  1YJW P;  3L74 D;  3H1I G;  3S9O A;  1JNM A;  1JTH A;  2AXT H;  2NPS D;  1SQV G;  3LW5 H;  1K05 A;  1L2P A;  3LIE A;  1YIJ P;  2W6J H;  2IBZ G;  4IFD K;  1FDI A;  3N7N A;  3JCU H;  1FZG A;  3SFE C;  1L4A A;  4IFM A;  1L0N E;  1DD3 A;  2FFD A;  1BGY J;  1N7S C;  2KZJ A;  3GLM A;  1PL5 A;  1K73 Q;  1ZW0 A;  1SFC A;  1PFI A;  2RKL A;  3SWF A;  3WUV A;  1IFJ A;  2D2C B;  2KUB A;  2W8Z A;  3G9R A;  4AQR D;  1S72 P;  2IDB A;  1A02 J;  2CPS A;  3L70 J;  3LID A;  1L0N G;  5AVY B;  2BEQ D;  3BAS A;  3D71 A;  2XKM A;  1MKM A;  4GOE A;  4ASW A;  4WY4 C;  2Q9I A;  1NHL A;  2MJZ A;  5CCH C;  1HWT C;  1SQQ J;  1H8A A;  1NOH A;  3HE4 A;  1N86 A;  2YNY A;  1G1I A;  4LC1 A;  3V4W A;  3VMA A;  2P2U A;  4GT1 A;  2KNC B;  2M0B A;  2Q5U A;  3L35 A;  2QSI A;  1KB9 D;  3OAK A;  3H1L E;  3CXH E;  3RL0 B;  1EDJ A;  1H0T B;  4WY4 A;  2E5T A;  3WUT A;  3CC4 P;  1IFD A;  1M7L A;  2ZVN B;  2WSF H;  5CCH A;  3JSV C;  1Q82 Q;  4N6J A;  1NU1 J;  2A45 H;  3CC2 P;  3HD7 D;  1FOS F;  3G6E P;  4WB4 A;  3L74 E;  2BCC D;  4O9B A;  4EIJ A;  2NPS C;  3EFG A;  1HTL C;  4H44 B;  5AVZ B;  3H1L G;  1U7J A;  2MKV A;  1M1J C;  4C7R A;  2OYI B;  1CZQ A;  4BRY A;  4EYY Q;  5H2F E;  1RF0 A;  3AE7 C;  3ZDM A;  2HYN A;  3CCM P;  2FXO A;  3T97 A;  4BXL A;  1J1E C;  3EFF K;  1VQL P;  3GF7 A;  2NZ2 A;  2IX7 C;  1OMI A;  4TT3 H;  1NKZ B;  2C9L Y;  1JCD A;  2LXB A;  4UB8 E;  3BRV B;  5KAI E;  4CPG A;  4Y99 C;  2XZR A;  3P32 A;  5B5E H;  3IR9 A;  3TSI A;  1PV3 A;  2WTY A;  1FS0 E;  1N73 C;  4L74 A;  1NTK G;  2RN0 A;  1W5C E;  1LTJ A;  1G2C A;  2W6B A;  1QEX A;  4DCK A;  3AEE C;  5CMZ A;  1W2E A;  4U3F D;  3KHU A;  5GTI H;  1KB9 E;  3Q1M A;  2WVR A;  1JO5 A;  2R5B A;  4R4M A;  1LWU B;  3AE2 C;  2D2C D;  2K88 A;  1CSB A;  5APS A;  3HD7 C;  1NO4 A;  1YYC A;  2HPC A;  2FKW B;  1E79 H;  3PHL A;  1N7S B;  4R4L A;  2BCC E;  5APY A;  3IN6 A;  2KK7 A;  4MN4 C;  2N1T C;  3AEG C;  4PV1 C;  1KQL A;  3M9B A;  4L75 A;  1KN7 A;  1S5L H;  3TYY A;  3CL3 D;  1J1D C;  3SSU A;  1HVV A;  3A0B E;  1IJD B;  3BVH A;  1X8Y A;  2K9J B;  3M91 A;  5CJ0 A;  1GU4 A;  1M90 Q;  2BCC G;  4W7Z A;  3RL0 D;  2N1T A;  4YTP C;  2I1J A;  2QM8 A;  1HUC A;  5AW6 B;  5AVS B;  3CCL P;  1L0L J;  5CCG A;  2P58 A;  1PPJ G;  1HGZ A;  1U57 A;  5APV A;  5TIS E;  1KTM A;  1EQ7 A;  3CX5 I;  4ZKP A;  4KHX A;  5AVW B;  2ZXX A;  3O6Q B;  2KIK A;  4H44 D;  1Q2N A;  4AYC A;  2N9B A;  5AW0 B;  2FYN C;  3TF5 A;  5CBN A;  2R3S A;  1IZN B;  1KD1 Q;  2Y0C A;  2R32 A;  3M9H A;  1DIP A;  1NTM D;  1J2J B;  2H88 C;  3JCU E;  1VF5 D;  2YKO A;  5H2F H;  1IK7 A;  2QEX P;  3HTK B;  2WSE J;  1T6A A;  3RL0 g;  2H43 A;  2HOD B;  1NTM K;  2YMK A;  2D2C C;  3L36 A;  1M1J B;  5AW7 B;  3L75 J;  3CLQ A;  2FYU D;  1BDC A;  4UB8 H;  1YI2 P;  3AED C;  5KAI H;  3CPW O;  2L91 A;  3HE5 A;  3AE3 C;  2FYU K;  1DH3 A;  3NMD A;  2M8R A;  1N8R Q;  1FZC B;  1AQ5 A;  2GA1 A;  4I7Z C;  4ZKU A;  3AEB C;  2IZ1 A;  5KTB A;  4ZMD A;  3CCJ P;  3HUS B;  3VMY A;  2I8D A;  4JYB A;  3H1L J;  4D6T G;  3BCC J;  2L5G B;  1A02 F;  4UB6 E;  3TNU B;  1P84 D;  2WPV B;  3H1H J;  3RL0 C;  4EOT A;  1GTW A;  3H1K G;  3G4S P;  2A06 D;  5L8R J;  1N73 B;  1LTS C;  3H1J J;  1ZR4 A;  1RY3 A;  2KXP B;  1ZP0 C;  5AW8 B;  1KIL B;  2E43 A;  4RJT A;  2KNC A;  1PP9 D;  5AW2 B;  1EDI A;  1QVF O;  2YKP A;  3ITK A;  4H44 C;  1RQU A;  2AXC A;  2AEM A;  1R5L A;  1DEE G;  1M1K Q;  1H0T A;  1WT6 A;  1SQP D;  3CX5 D;  2ZYD A;  1RE4 A;  3L73 D;  2OYI C;  1KYO D;  3A3Y B;  5EFW B;  5APW A;  1BE3 D;  5E79 H;  1SQX D;  1SQP K;  3L71 E;  3RK3 D;  4WWI A;  2BAS A;  1N2D C;  4LLH A;  1NTM E;  1NTK J;  3A0B H;  1EDL A;  1XTG B;  1BCC D;  1SQX K;  2R44 A;  2OTL P;  3I55 P;  2LXC B;  3BRT B;  4C46 A;  2A45 G;  2IZ0 A;  4I1L A;  3MP7 B;  1MFT A;  4DT0 A;  2FYU E;  3AEF C;  3KXD A;  5AVX B;  1CW5 A;  4YXD C;  2HG5 D;  3L71 G;  1URQ B;  5TIS H;  4BWN A;  3AEC C;  3O8Z A;  2V7Q J;  2WMM A;  1DEB A;  4ASV A;  3VYI A;  2QVA A;  5AVQ B;  1K9M Q;  3CCR P;  4M3L A;  5B5E E;  2E76 D;  3MUD A;  4N3Y B;  2PP6 A;  2FYU G;  3AEA C;  1VQ5 P;  1P84 E;  3U59 A;  1FOS E;  2FYN B;  1LWU C;  2A06 E;  1MFZ A;  4I2L C;  3TGU J;  1KMI Z;  3P8C D;  1NH4 A;  2WPR A;  1AFO A;  2B87 B;  3V5B A;  5GTI E;  2BEZ F;  4HJG H;  2OAR A;  2PGD A;  2W83 C;  1HJ0 A;  4DJG A;  2O01 J;  1PP9 E;  1EZV I;  1IFP A;  1NAY A;  1SQB D;  1JOC A;  2Y0D A;  4IL6 E;  3CI9 A;  1IC2 A;  1FC2 C;  1LTT C;  1LTI C;  1ZRT D;  5AW3 B;  1SQB K;  1BSN A;  1SQP E;  3CX5 E;  2JP3 A;  3L73 E;  1VL2 A;  1KYO E;  1D7M A;  3AE4 C;  1BE3 E;  1N7S A;  2HLO A;  1SQX E;  1S5L E;  1HF9 A;  2O1K A;  3PP5 A;  1CI6 B;  4PD4 I;  2ZJS E;  1OW8 A;  1PP9 G;  2POH A;  2RH0 A;  4UB6 H;  1BCC E;  3MTU E;  5KLV J;  4I7Z B;  4HKZ H;  2PAJ A;  3M0D C;  1YQ3 C;  1KIL D;  1SQP G;  3L72 D;  3R4Y A;  2JWD A;  2QIW A;  1PGO A;  3CWB D;  1BE3 G;  3SWY A;  1NTZ D;  3SFD C;  1JMB A;  1IFN A;  2C9N Y;  1LT9 C;  3F89 A;  2QM7 A;  2M5A A;  1BCC G;  2G3A A;  1E5W A;  4YXW H;  1NTZ K;  1Y47 A;  2WIT A;  5KLI C;  2KLV A;  3TDK A;  3F5H A;  1PGQ A;  5AW5 B;  3AE8 C;  1H89 A;  3CME P;  2KOG A;  2B89 A;  3G3Z A;  1R8E A;  2KLU A;  2QRX A;  3VOP A;  4D6T J;  1KZU B;  1T8Z A;  1SP4 A;  1BGY D;  5BVZ A;  3L4F A;  3P8C E;  1QL2 A;  3H1K J;  4LGD E;  1RF1 B;  2OYH B;  4AUW A;  3PLN A;  4QMA A;  3L74 G;  1VF5 B;  3GMA A;  3WUU A;  2NPS A;  3Q5P A;  1JY2 N;  1LP1 B;  1URQ D;  4JYC A;  5AW4 B;  2GUS A;  1QVG O;  3EWK A;  4WBA A;  1OWA A;  3B71 A;  1FZC C;  1ZRT E;  1FJP A;  3L70 D;  1VQ4 P;  1M1J A;  3HUS C;  4OVN F;  1YJ9 P;  2ITA A;  3I5C A;  2J58 A;  2WT7 B;  3CCE P;  5BU8 B;  2QE7 H;  1U7M A;  4C7N B;  4RO0 A;  1SQQ D;  2JEE A;  2PFX A;  2Q1K A;  4OGQ D;  2A45 I;  1P84 H;  4OWF A;  1YIT P;  3R2P A;  1G1J A;  1Q7Y Q;  1WRG A;  1SQQ K;  1KIL C;  2WZ7 A;  3OJA B;  2PRR A;  5AVU B;  1VQ6 P;  1KIL E;  1K04 A;  3L72 E;  2QJY B;  2KS1 A;  1VQ8 P;  2WSF J;  2FFD B;  3CWB E;  1GU5 A;  1FDO A;  1LJ2 A;  1NTZ E;  1USD A;  2FY8 A;  1NU1 D;  1GL2 D;  2K3R A;  4IL6 H;  1N73 A;  2W6A A;  3L71 J;  3AE1 C;  1NU1 K;  2AEF A;  4U7J A;  1OIP A;  3CX5 H;  1KYO H;  2O1J A;  2IBZ I;  3Q5R A;  3NXS A;  1Q81 Q;  1S4X A;  3FXD A;  1GK4 A;  3H1I J;  3H6P A;  2YXQ B;  2B9B A;  2HFE D;  4H13 B;  4JPZ B;  2WSC H;  1SQV J;  5E79 E;  1BGY E;  1EXJ A;  1QGK B;  1S3J A;  5CJ4 A;  3HD7 A;  2C0W A;  1YHQ P;  1T3J A;  1MV8 A;  3RK3 B;  4YPC A;  4DOJ A;  1URQ C;  5C39 A;  1NJI Q;  2N9Y B;  2Q3E A;  1JUN A;  4JBZ A;  4NPE A;  3W67 A;  4PJ0 H;  4IL6 X;  2Z4E A;  1BGY G;  5CHX A;  3MGN A;  1M8O B;  2O01 N;  4OGQ C;  1L0N J;  1LT9 B;  1S5L X;  1M56 D;  5APQ A;  2ZFC A;  4H0L D;  2YO2 A;  3OA7 A;  1JM0 A;  5KLI B;  2CK3 H;  3H32 B;  1NWQ A;  2E76 B;  1RE3 C;  1BDD A;  1HBW A;  1VQ7 P;  5KJ7 D;  5AVV B;  4U3F E;  3KDP B;  2XU6 A;  1VPC A;  3W68 A;  1GL2 C;  1OFC X;  2W90 A;  4W80 A;  1NU1 E;  1RHZ B;  3E1I A;  2OGU A;  2B87 A;  3MZW B;  1HGV A;  1BCC J;  3PTZ A;  2W27 A;  3CXH I;  3WU2 E;  3G71 P;  4U3F G;  2OTJ P;  3BAT A;  3KYQ A;  1Z56 A;  3FWL A;  2H8P D;  2IBZ D;  1DD4 A;  4K35 A;  1KFM A;  3CCV P;  3AE5 C;  2E5Y A;  3GF3 A;  3CC7 P;  3P7K A;  3B5N B;  1LT1 A;  1L4A D;  5KAF E;  1YJN P;  3GHG C;  1LTJ B;  5APU A;  3U1A A;  1CI6 A;  1T2K D;  3M06 A;  1L0L D;  2YIU B;  3L74 J;  3IAO A;  5APX A;  1SFC D;  1OVV A;  3B4S A;  2E75 B;  2FYZ A;  3A7O A;  1L0L K;  4DZO A;  5TJH A;  1JEK A;  2YMY A;  3WMM 0;  1AA0 A;  1LTG C;  4H13 D;  1FZA A;  1QLE D;  3USS A;  4H0L C;  4GOF A;  1JY2 O;  2Q6Q A;  1RF1 C;  2OYH C;  2JDI H;  1VF5 C;  2KP8 A;  1QL1 A;  2Y9Z A;  4HYT B;  3OW2 O;  3GW6 A;  2UWJ E;  1HH0 A;  3AE9 C;  3NTN A;  1PGJ A;  2K1A A;  3L75 D;  1Y9B A;  2GM4 A;  3RGU A;  2JWA A;  2WWW A;  5AW9 B;  2OYI A;  4WY4 D;  4KT0 J;  1H88 A;  1RF1 A;  2OYH A;  1OW6 A;  3QWO C; 
#chains in the Genus database with same CATH homology
 5CCH D;  1JO5 A;  3SWY A;  3VP8 A;  1RE3 A;  2R5B A;  1LWU B;  1IFN A;  3M9Q A;  2C9N Y;  1LT9 C;  2QM7 A;  3A5T A;  1CSB A;  5APS A;  3HD7 C;  1NO4 A;  1YYC A;  2HPC A;  1E5W A;  1NTZ K;  2FKW B;  2WIT A;  1FAV A;  1N7S B;  1GL2 A;  5APY A;  2KLV A;  2Q3I A;  1FDM A;  1SQV K;  2N1T C;  3MIW A;  1J1E B;  5AW5 B;  1KQL A;  3V2R A;  1OXZ A;  1L4A C;  1H89 A;  3M9B A;  3TYY A;  2I1K A;  2FFD C;  3CL3 D;  2KOG A;  1MUU A;  3G3Z A;  1J1D C;  1JY3 N;  1G2C B;  2M3B A;  4C7N A;  1T2K C;  3VOP A;  1KZU B;  1IO4 A;  3EQ2 A;  1T8Z A;  3HRN A;  3VMX A;  1SP4 A;  3L37 A;  2IPP A;  5BVZ A;  3L4F A;  3P8C E;  4IFF A;  1SFC C;  1HVV A;  1QL2 A;  1IJD B;  3BVH A;  4LGD E;  1X8Y A;  1RF1 B;  2OYH B;  3M91 A;  5CJ0 A;  2R5D A;  3P8M C;  4Y99 B;  1GU4 A;  3IFM A;  4AUW A;  2XDJ A;  1JY3 P;  2NPS A;  4W7Z A;  3RL0 D;  2N1T A;  2ZXE B;  1JY2 N;  1NAF A;  2KSJ A;  1URQ D;  4JYC A;  2I1J A;  1RE4 C;  1X79 B;  5AW4 B;  2GUS A;  2QM8 A;  1HUC A;  5AW6 B;  4WBA A;  2HPC B;  1OWA A;  3M0A A;  5AVS B;  1IK9 A;  3GHG A;  1FZC C;  1GL2 B;  1KFN A;  1FJP A;  1LWU A;  5CCG A;  1N7S D;  1M1J A;  3VN0 A;  1GK6 A;  3HE5 B;  3HUS C;  1YTZ T;  3TK1 A;  1L0N K;  1HGZ A;  3RK2 B;  3I5C A;  5APV A;  1EQ7 A;  4ZKP A;  2J58 A;  2WT7 B;  3RK3 C;  3B5N D;  2E42 A;  5BU8 B;  4KHX A;  5AVW B;  1YTZ I;  1X9V A;  4AYC A;  2N9B A;  5AW0 B;  4C7N B;  5KJ7 C;  2P7J A;  2JEE A;  2O01 H;  1NTK K;  2A45 I;  1VDF A;  2P67 A;  3HD7 B;  2H7H A;  3R2P A;  1G1J A;  2GUV A;  1FZB A;  3NFQ A;  1WRG A;  2C0X A;  1SQQ K;  2R32 A;  3M9H A;  1KIL C;  2WZ7 A;  3OJA B;  5AVT B;  5AVU B;  2JJL A;  2N1T B;  1J2J B;  1DX7 A;  2YKO A;  3HTK B;  3C9I A;  2FFD B;  2Z5I A;  3GHG B;  1GU5 A;  2H43 A;  4GKG A;  1J1D B;  2HOD B;  1NTM K;  1XTC C;  3VMZ A;  1FZF A;  5KJ7 A;  1SLQ A;  1ZN5 A;  1ZV8 A;  3L36 A;  1M1J B;  1GL2 D;  1S9K D;  3A2A A;  5AW7 B;  3KQG A;  3CLQ A;  1N73 A;  2W6A A;  2WPS A;  1FU1 A;  1NU1 K;  2IFN A;  4XA4 A;  1GW4 A;  3M0D A;  3V2P A;  3B8E B;  4OH8 B;  1FZE A;  2O1J A;  3HE5 A;  2FYU K;  3NXS A;  1IFI A;  1GK4 A;  2XV5 A;  2J59 M;  3H6P A;  2WT7 A;  1DH3 A;  3NMD A;  2M8R A;  2HFE D;  1FZC B;  1AQ5 A;  1RF0 C;  1GW3 A;  2WPQ A;  4ZKU A;  2WSC H;  1GD2 E;  5KTB A;  5BU5 A;  3HUS B;  1LT9 A;  1JNM A;  3VMY A;  1JTH A;  5CJ4 A;  3HD7 A;  4JYB A;  2NPS D;  2C0W A;  2N1T D;  3LW5 H;  1T3J A;  2L5G B;  1MV8 A;  1FJK A;  3RK3 B;  3TNU B;  3LIE A;  1A02 F;  3H32 A;  4DOJ A;  1GDT A;  4IFD K;  3MD0 A;  3RL0 C;  4EOT A;  3N7N A;  1FZG A;  1GTW A;  1URQ C;  5CCG D;  1L4A A;  1JUN A;  4IFM A;  1N73 B;  1JMM A;  1LTS C;  3HTK A;  1ZR4 A;  2FFD A;  1RY3 A;  3KPE A;  2HOD A;  1N7S C;  5APT A;  5AW8 B;  1KIL B;  2E43 A;  3II6 A;  4XE5 B;  1JY3 O;  1SVF A;  2Z4E A;  5AW2 B;  1SFC A;  1PFI A;  5CHX A;  3B5N C;  3MGN A;  1JY2 P;  3SWF A;  2YKP A;  2P1J A;  1IFJ A;  1LTJ C;  2KYV A;  4I6M C;  1WT6 A;  1LT9 B;  4AQR D;  5APQ A;  2ZFC A;  1JTH B;  1RE4 A;  2YO2 A;  2OYI C;  1A02 J;  3A3Y B;  2CPS A;  2R3C A;  3OA7 A;  1GZL A;  3LID A;  2YKQ A;  1IFM A;  5AVY B;  1FZC A;  5APW A;  3H32 B;  5KLV K;  1NWQ A;  3BAS A;  1RE3 C;  1SQP K;  2XKM A;  3N4X A;  3RK3 D;  1LTA C;  2BAS A;  1N2D C;  3V2N A;  4LLH A;  3HUS A;  4WY4 C;  1HBW A;  2Q9I A;  1NHL A;  2MJZ A;  5KJ7 D;  1L4A B;  5AVV B;  1XTG B;  4GIF A;  3KDP B;  4W7Y A;  2XU6 A;  3B5N A;  5CCH C;  1SQX K;  4HH2 A;  1HWT C;  3TNU A;  1VPC A;  1H8A A;  1NOH A;  3HE4 A;  3BRT B;  1N86 A;  1GL2 C;  4C46 A;  2YNY A;  4JF7 A;  2A45 G;  1G1I A;  1FBM A;  4LC1 A;  4W80 A;  3V4W A;  4N78 D;  1S9K E;  4I1L A;  2P2U A;  4GT1 A;  3E1I A;  1SFC B;  2IFM A;  2Q5U A;  3L35 A;  3RK2 D;  3OAK A;  5AVX B;  1CW5 A;  1HGV A;  1KIL A;  3RL0 B;  2HG5 D;  1T3U A;  1URQ B;  4WY4 A;  2W27 A;  1IFD A;  2Z5H A;  1M7L A;  3O8Z A;  5CCH A;  2WSF H;  3BAT A;  1DEB A;  2FXM A;  4N6J A;  2WSE H;  2A45 H;  2VRS A;  1Z56 A;  3KYQ A;  3HD7 D;  1FOS F;  3VYI A;  2H8P D;  2YO3 A;  4WB4 A;  5AVQ B;  4O9B A;  1KFM A;  4M3L A;  1N7L A;  2KB7 P;  4EIJ A;  3MUD A;  4N3Y B;  2NPS C;  3EFG A;  3P7K A;  1HTL C;  3B5N B;  2PP6 A;  1L4A D;  5AVZ B;  1LGH B;  3GHG C;  3HE4 B;  1LTJ B;  3U59 A;  5APU A;  1FOS E;  1LWU C;  5CCG C;  1MZ9 A;  1MFZ A;  1M1J C;  3U1A A;  1CI6 A;  4I2L C;  4C7R A;  1T2K D;  3M06 A;  2OYI B;  3P8C D;  1NH4 A;  3VTP C;  2WPR A;  1CZQ A;  5APX A;  1AFO A;  1SFC D;  1HJB A;  1RF0 A;  1ZLL A;  2FYZ A;  3V5B A;  3A7O A;  2OAR A;  2HYN A;  4WY4 B;  1L0L K;  4DZO A;  3T97 A;  1J1E C;  3V2Q A;  1ZR2 A;  2YMY A;  3WMM 0;  1JOC A;  2IX7 C;  3CI9 A;  2CPB A;  1JCC A;  2XNX A;  1IC2 A;  1LTT C;  1NKZ B;  2C9L Y;  1LTI C;  1LTG C;  1JCD A;  1URQ A;  4B86 A;  1FZA A;  5AW1 B;  5AW3 B;  1SQB K;  2Q7C A;  3BRV B;  1JY2 O;  3UIA A;  1RF1 C;  2OYH C;  1N7S A;  2HLO A;  4Y99 C;  2XZR A;  3P32 A;  3IR9 A;  3TSI A;  2LKM A;  2O1K A;  3PP5 A;  2KP8 A;  2WTY A;  1QL1 A;  4HYT B;  1NKN A;  1CI6 B;  1LTB C;  2POH A;  1HH0 A;  4RES B;  1N73 C;  3NTN A;  3MTU E;  1LTJ A;  2GM4 A;  1G2C A;  2W6B A;  2PAJ A;  3M0D C;  4N78 E;  1KIL D;  2WWW A;  2NPS B;  5AW9 B;  3U1C A;  2OYI A;  3RK2 C;  5CMZ A;  4WY4 D;  1W2E A;  1H88 A;  5AVR B;  3V4Q A;  1RF1 A;  2OYH A;  3VP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...