3V2QA

Compcc in complex with fatty acids
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
45
structure length
45
Chain Sequence
MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Cartilage Oligomerization matrix protein (coiled-coil domain
publication title The pentameric channel of COMPcc in complex with different fatty acids.
pubmed doi rcsb
source organism Mus musculus
total genus 18
structure length 45
sequence length 45
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.10 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3v2qA00
1MZ9A 3V2NA 1FBMA 3V2QA 3V2RA 1VDFA 3V2PA 1DEBA
chains in the Genus database with same CATH superfamily
2B87A 3GMAA 2XV5A 2OYIC 2XKMA 2PRRA 2OQQA 1YQ3C 3HTKA 4H44B 2KUBA 1MKMA 2CPBA 3C1LA 2MKVA 1QVFO 1L0NE 1URQB 2KNCA 5KLVK 5APQA 1J1EB 3HD7C 2CPSA 4TT3H 3E1RA 2IBZG 2W27A 2YMYA 1ZN5A 1L4AD 1EZVE 3BVHA 2XU6A 1RQUA 3CCJP 2RMZA 2QJYB 3B5ND 1AVYA 2J59M 3CLQA 1NTZE 1IFMA 1Q2NA 1UIIA 1FZCB 4GOFA 3PRJA 1IK7A 3L72E 2IBZD 2IX7C 2Q7CA 2L5GB 2WSSH 5CCHA 3TGUG 1USEA 3KZIE 3L71G 3FWLA 1RF1B 3CD6P 2FYUE 3LW5J 2JWAA 3IAOA 3FGAD 4H13B 1N7SD 2OGUA 1M8OB 1W2BO 1OZHA 3VTPC 5B66H 2BEZF 5H2FH 2DW3A 1R8EA 3V4WA 3CL3D 5CCGD 2YO2A 1PGJA 3O6QA 3TGUD 1EXJA 3NXSA 4IL6X 3PHLA 5L8RJ 3AEGC 1VQ9P 1JM0A 1BGYJ 1NTMD 5AVYB 2LR2A 3CX5E 2YIUC 1ZXGA 2M5AA 2WMMA 1S1CX 2ZT9D 2WSFJ 4ZMDA 2JR8A 1JO5A 3A0HE 1L0NG 1ZOYC 4C7NA 1ZR4A 2WPSA 1LTJC 3I56P 3MGNA 3A0BH 1VQ7P 1VQNP 3AE1C 1SQXE 4GKGA 3CCLP 3MZWB 2E5YA 1GZLA 1EZVG 5EFWB 3MD0A 1KILA 2SPZA 1HUCA 1EXIA 3AEAC 2NPSC 1HH0A 2N9YB 1L0ND 1H88A 1NTZG 4U3FE 2ZAEB 3L72G 1LWUB 1JTHA 4PV1B 2W83C 5KLIC 1EZVD 1LTTC 2FYUG 4DT0A 5AVTB 4IFMA 1LGHB 1QL2A 1M1JC 1SQQJ 1E79H 1X22A 1NTZD 1XTCC 4N6JA 1NTKJ 1FAVA 3HUSA 3RL0D 3L72D 1EC5A 2BCCD 1YYCA 2PGDA 2G8YA 3RK2C 2N1TA 2QJPB 3AE8C 4HJGH 2WSFH 4JPZB 1AQ5A 3SSUA 1IK9A 1NVOA 2H8PD 3MUDA 4H44D 3L75E 5AVWB 3V2RA 1SQPD 4IFDK 5AVSB 1NWQA 3SWYA 3R2PA 1URQD 1LTIC 2O3JA 1NTMK 4WVZA 1IZNB 2RH0A 1YTZT 4OH8B 1GDTA 1SQVJ 4W7ZA 4IL6E 3WUUA 1VQPP 1KYOD 3EWKA 3GHGC 4PJ0E 1SQXG 2K1AA 3CX5D 1OVUA 3WU2H 1USDA 3L74E 4KT0J 1KQLA 2WSEJ 2IZ0A 3Q5SA 2AXTH 1L4AC 1AFOA 3JC22 1FC2C 1BDCA 1J1DB 2HLOA 3U1AA 2YKQA 2IYOA 1KV4A 3P8CE 1WRGA 3B5NC 4U3FG 4RESB 3H25A 2YMKA 4RJTA 3L70J 2IZ1A 3P7KA 1A02F 4DCKA 1A02J 1JY3N 4OWFA 3L4FA 3P32A 1K9MQ 5TISE 5GTHH 2FBWC 3HD7A 3H1HE 3AE4C 2K9YA 3P8MC 1NTKD 1N7SC 3U59A 4U3FD 1L0LD 5KLVJ 4DOJA 3RBZA 1BCCE 5CCGC 2HG5D 3GLMA 2HFED 1KB9H 1SVFA 4WWIA 1LT9B 5DJUB 2W90A 1GL2B 3LIDA 2OYHC 1SFCB 1EDJA 2FYZA 1PP9J 3L75G 5AW8B 3V6IA 3KYQA 3AE3C 3AEEC 4ZKPA 1DH3A 3RBXA 4C7RA 3JCUH 1KD1Q 1RE3C 1SQBJ 2R3CA 3M06A 2ZT9C 5KAFE 3OAKA 2WSEH 1FZFA 3HE4A 3CXHE 1FBMA 2WT7A 2RN0A 3O8ZA 1Y8AA 3L74G 1KB9I 3H1IG 2YKOA 4C46A 4PD4E 3TSIA 3CC4P 1KMIZ 2FYNB 4PV1D 5AVUB 5CBNA 2WSCJ 1ZMEC 4CPGA 1GMJA 1X0TA 3L35A 3L74D 5CMZA 1HWTC 1VF5B 3CCQP 1X9VA 3IFMA 1OW8A 3H1HG 3IF4A 3AEFC 4K35A 4I1LA 2LKMA 4JYBA 5C39A 2WITA 1BCCG 2YNYA 3RL0C 3VN0A 3EQ2A 1P84D 1NTKK 2NPSA 1HJ0A 3AE7C 1G2CA 5KAIH 1CI6A 4H44C 3H1KE 3O6QB 1R5LA 2H89C 1PGOA 5AVXB 1URQC 1JEKA 1OX3A 4B86A 1J1EC 2JO1A 1GK4A 2IPPA 1M1JA 2M5AB 1EQ7A 1K04A 1SQVK 2E74D 1RE4C 2JKVA 3L71E 4D6TE 3VMZA 2WSCH 3T97A 2HPCA 2QJYC 2Y9ZA 2OTJP 1FZCC 1LP1B 4M3LA 4U7JA 3MHVA 4EIJA 5AW1B 3WUTA 2Q3IA 3VMAA 3VP9A 2OTKE 1IFDA 1G1JA 1RF1C 1BSHA 5B66E 5APTA 5H2FE 3TGUJ 1BSNA 1GK6A 1AV1A 2D2CB 1NTMJ 1PL5A 1QX8A 3GHGA 1RQVA 4WY4B 1M57D 3A7OA 5APYA 1ZR2A 3SWKA 1GL2D 1YITP 5AW6B 1L4AA 1SFCD 3PH0A 2P67A 1PPJE 1ZRTE 3AEDC 3SFEC 1PFIA 5APSA 1JY2O 3B5NA 1BE3D 2W6AA 3M9QA 4TLFA 3V5BA 3A0BE 3H1KG 2K9JB 1GD2E 1JUNA 3RK3E 1IC2A 1JB0J 1LT1A 1KILE 1L0NJ 3JSVC 2YO3A 1SQBK 1NU1E 2QSIA 1MFTA 2IFMA 1KQSO 1N7SA 3H1LG 1QL1A 3BCCE 3E7KA 1H0TB 2NRGA 3II6A 4D6TG 3H1KD 1AJYA 2I1KA 5CCGA 1EDLA 5KJ7A 2Q9IA 2H43A 2HODA 2OYHA 3OJAB 1NTZJ 2C9LY 1LWUC 5AW9B 1VF5D 4PV1C 3L72J 2E75B 2A06E 2BCCJ 1RE3A 4NPDA 1S3JA 4W80A 3EFFK 5KJ7D 1FDIA 1Q90D 3L71D 4D6TD 1LTBC 2AEFA 1G1IA 1S72P 4DZOA 2OYIB 4R4LA 3M91A 1PGPA 1SQPJ 1JY2P 1L2PA 3V2QA 2QVAA 2V7QJ 2QJPC 1PPJG 1PGQA 2ZVOB 4O9BA 1W5CE 2OYOA 5KKZB 3RGUA 2W8ZA 1YI2P 1UIXA 1FU1A 3HE5B 3V4QA 4UB8H 3WU2E 1OW7A 2AXTE 5DJTB 1KORA 1PPJD 1Y9BA 2ZYAA 2KSEA 1NU1G 3LW5H 2I8DA 1T8ZA 2KZIA 2C0XA 2KSJA 3BCCG 5CJ0A 1SQXJ 1SS1A 3L73E 5CBOA 2KIKA 2E74C 1J1DC 3SWFA 2IFNA 1SQQE 4WBAA 1SLQA 3U1CA 2AEJA 4BWNA 4I7ZB 2WT7B 5GTHE 1FJPA 1FZEA 4LC1A 1FS0E 1OFCX 4U3FJ 1L0LJ 3G6EP 3F89A 1VQ4P 2E43A 3FXDA 2A06G 3BCCD 2D2CD 5AVVB 1URQA 2ZJSE 2FFDB 2V7QH 3N4XA 1OIPA 4UB6H 2FYUD 2PP6A 1HTLC 2R32A 4WY4D 2BEQD 4L76A 1KB9E 1VQ6P 1KYOH 3TYYA 1RE4A 1NH4A 2KXPB 2JJLA 1KC8Q 2KLVA 3VMYA 1DEBA 2QA4P 3M9BA 3QWOC 1LT9C 1RH5B 3JCUE 1LTJB 3KXDA 1GL2C 1PIXA 1RY3A 1SFCC 1FZCA 4YXWH 1NHLA 3CC2P 1KTMA 3V2PA 2P2UA 2ITAA 1N73C 1RHZB 3H1IE 1RF1A 1K8AQ 2Q3EA 4Y99B 3L70E 4IOIH 1KYOI 1M7LA 3IN6A 2WPRA 1SQXD 3L73G 1L0NK 5KLIB 5APVA 3AE6C 3L74J 4ZNCA 4H13D 4AUWA 1SQQG 2FYNC 2Y9YA 3VYIA 3Q1MA 1NKZB 5KLVE 3CCMP 3GF3A 2E75D 2K88A 3CPWO 2WPVB 2Q6QA 4NPFX 3VP8A 3OW2O 1BDDA 3UIAA 3L73D 1VF5C 1PP9E 3D6ZA 1NTZK 2V4HA 5KJ7C 2JEEA 1FZGA 2KS1B 4N3YB 2A45H 1HBWA 3G3ZA 4GT1A 1S9KE 1SQVG 3V2NA 1JMMA 5KAIE 4H0LB 3CWBE 5AW5B 2QJKB 3M9HA 1SQPK 1BCCJ 2H7HA 2ZXEB 4YTPC 2B87B 4I6MC 5TJHA 3HTKB 1KB9D 3I55P 3L75D 1LWUA 1DD4A 3K5BA 3M0DC 1IJDB 2A45I 1OWAA 3SFDC 2VRSA 3H1JE 2KNCB 3AE9C 3PP5A 3L70G 3KHUA 3BRVB 1IFJA 5BVZA 2IYPA 1KQFB 2ZXXA 2R5DA 3LIEA 1GW3A 4BXLA 3H1ID 3D6YA 1SQXK 5KLVG 5KTBA 1JNMA 1VQOP 2WTYA 1P84H 2HR3A 4GDOA 5K5GB 3P8CD 2O1JA 1PP9G 3G71P 3L36A 2D2CC 2WZ7A 2Y0DA 1L0LK 2HODB 2AEMA 1MFZA 3B8EB 5AVRB 1BE3J 2I1JA 1LJ2A 2FXPA 1K73Q 2FKWB 4WY4C 1S5LH 3H1HD 4EOTA 1NO4A 2MJZA 3CWBG 1KFNA 1P84I 2WVRA 2ZT9B 4DJGA 4OGQB 1BCCD 1CSBA 2BASA 4AQRD 1S2EA 3D71A 2B89A 4HKZH 3H1LE 1IFNA 4EDFA 4KJMA 1U7JA 1S9KD 3ABVC 2K37A 3H1KJ 4C7NB 2M3EA 3H1JG 3FWNA 2WWWA 5AW7B 4XFJA 2JP3A 1FOSE 3CCSP 2P10A 2PAJA 1E5WA 3RK3B 3CXHD 3OA7A 1NGMB 1KILB 1AVOA 1KFMA 2E5TA 3CCEP 1NTME 5GTIH 3L71J 4D6TJ 2OARA 4ASWA 1LT9A 3FX0A 2P58A 1GL2A 4PD4D 4H13C 3H1JD 4ZKUA 2LXBA 1SFCA 1FJKA 5APWA 5B5EH 2XNXA 4L75A 2CK3H 1SP4A 2E75C 5AW3B 1JTHB 2KP8A 1N73A 3G9RA 3GF7A 3TNUA 1KQGB 3CI9A 2M3BA 5CHXA 2QE7H 1T3JA 1VQMP 4H0LD 2O1KA 3HUSB 1YJNP 3W68A 1EDKA 2Z4EA 2XNDH 3A5TA 1QVGO 1XTGB 1PV3A 1LTGC 1CZQA 2N1TB 4YXDC 1YIJP 4UB8E 3H6PA 1U57A 2YXRB 1LTSC 4WB4A 4HH2A 3KPEA 3AEBC 3TK1A 2M8RA 5KKZC 4JBZA 3TF5A 2L91A 3WMM0 3A3YB 2FXOA 1VQKP 1VDFA 2KZJA 3HRNA 1FZBA 2E76B 2IDBA 1HJBA 2BCCE 1J2JB 3W67A 5AVQB 2IBZI 1NU1J 3CC7P 3B71A 2Y0CA 1JOCA 5AVZB 4XE5B 3BASA 3H1LD 1YHQP 1BGYE 1NTMG 3BCCJ 1JY3O 1SQPE 2B88A 5CCHD 5E79H 1IFIA 1X79B 2FYUJ 3AE5C 3MIWA 4I7ZC 3S1KA 5AW0B 2OTLP 2XZRA 4UB6E 2QRXA 3H32A 3C9IA 3VOPA 3L37A 3FXEA 2H88C 1DIPA 1KYOE 3M0DA 3Q5RA 2FFDC 1QEXA 3NFQA 3HD7B 2ZVNB 1AA0A 2J5UA 1OVVA 1H89A 1DEEG 4OGQD 2R44A 1DX7A 1LP1A 1R5SA 1ZRTD 5APXA 1Y47A 2ZFCA 3CCRP 2YXQB 2ZYGA 3N7NA 1AQTA 1PZQA 3GW6A 1HF9A 1T6AA 4BRYA 4Y99C 3M0AA 1M56D 3RK3D 2B9BA 1NTKE 3HE4B 1JY3P 1L0LE 3KZIH 3IR9A 1EDIA 3PLNA 1KILD 2BCCG 1T3UA 2UWJE 4GOEA 4WY4A 1NU1D 1S5LX 4HYTB 3CMEP 1BGYG 1EZVI 1N7LA 3L73J 1FE6A 4HB1A 4I2LC 4ASVA 4LLHA 4R4MA 1Q81Q 1U7MA 2QM7A 1SQPG 4EI2A 1KZUB 5APUA 2YIUB 2P1JA 4JF7A 4L74A 3AE2C 1VQLP 3KDPB 2Y0EA 1SQVE 2K9JA 4RO0A 1QLED 3S9OA 2QEXP 1Q7YQ 3CX5H 4MN4C 1BGYD 1YTZI 2A06D 1JY2N 2O01N 3E1IA 1D7MA 4QMAA 3Q5PA 3Q3DA 2GUSA 1DD3A 1YBKA 4N78E 1VQ5P 3A0HH 3S4RA 5M1BA 1H0TA 1RF0C 2N1TD 3L75J 4A7PA 2HYNA 4H0LC 1NJIQ 2YKPA 2QJKC 1ZW0A 1GW4A 2R3SA 2NPSB 2Z5IA 4JQ0D 1G2CB 1H8AA 1IO4A 1ZV8A 3MTUE 1CI6B 3CX5I 1T2KD 1WMKA 2QIWA 1WT6A 2E74B 2J58A 1KN7A 2E76D 3R4YA 3H1IJ 1CW5A 1NTKG 1Q82Q 1L0LG 2OYIA 1N8RQ 1M1JB 4JYCA 1NAYA 1Z56A 1P84E 1VPCA 2JDIH 2O01J 4K3AA 2POHA 3RK2B 3T97B 3I5CA 2HPCB 4NPEA 4IFFA 3WUVA 3BRTB 1FDOA 1HGVA 3GG2A 1NU1K 2NZ2A 4YPCA 3NMDA 1K05A 3AECC 1SQQD 3ZDMA 3RL0g 5CCHC 1SQBE 1ZP0C 2A45G 3H1HJ 3MP7B 3HE5A 2FYUK 3PTZA 2ZYDA 3EFGA 1S5LE 3HD7D 2KB7P 1JCDA 2C0WA 1GU5A 1JMBA 1X8YA 2M0BA 3CCVP 4LGDE 3GHGB 1YQ4C 2WQYC 1N73B 3A2AA 4IL6H 1FZAA 3PJSK 1L4AB 3TNUB 1SQVD 4OGQC 1NYHA 4KHXA 3C8VA 4PJ0H 3CWBJ 1NOHA 1HVVA 1TU3F 3F5HA 3G4SP 3BATA 5AW2B 2GA1A 3B5NB 1JCCA 2E42A 3CCUP 4N78D 1YJWP 1ZLLA 2FY8A 1OXZA 3QH9A 4W7YA 2JWDA 2FFDA 2O01H 2QM8A 3H1JJ 5GTIE 2W6BA 3RK3C 1W2EA 3L70D 4XA4A 1LTAC 1N7SB 1FDMA 1OMIA 1KILC 5B5EE 5TISH 1M90Q 2N9BA 2Q1KA 4OVNF 4Y28J 1IFPA 1GU4A 1LTJA 2GM4A 1BE3E 4RKUJ 1MZ9A 2KYVA 1MUUA 2W6JH 2OYHB 1N86A 3VMXA 2C9NY 5KLVD 1SQBG 2K3RA 2Z5HA 1NAFA 3CMAP 1YJ9P 5AW4B 1SQQK 4Z1MH 5BU5A 3ITKA 3TDKA 2QG4A 1HGZA 1VL2A 1PP9D 2IBZE 2XDJA 1S4XA 1QGKB 3HUSC 3H32B 1GTWA 2R5BA 1OW6A 5KAFH 3D70A 1Q86Q 2NPSD 1SQBD 1MV8A 3Q2YA 2N1TC 3CXHH 4EYYQ 3CWBD 2KK7A 3MUDC 1VQ8P 2GUVA 1N2DC 2G3AA 4GODA 3B4SA 4PD4H 3TGUE 1OVRA 2RKLA 5BU8B 2AXCA 1T2KC 3H1LJ 5CJ4A 3NTNA 2P7JA 2KS1A 2E76C 2LXCB 1NKNA 4L73A 1FOSF 3KQGA 2KLUA 4GIFA 2FXMA 2PFXA 3RK2D 3CXHI 5E79E 2Q5UA 1RF0A 2KOGA 2KI7B 1LNQA 3RL0B 4AYCA 4BRYB 3USSA 2WPQA 1M1KQ 1BE3G 4PD4I
chains in the Genus database with same CATH topology
1M7LA 3L35A 2XV5A 2OYIC 2XKMA 5CMZA 1HWTC 3HTKA 1DX7A 1X9VA 2WPRA 3IFMA 1L0NK 2CPBA 5APVA 5APXA 4AUWA 1URQB 4I1LA 5KLVK 2ZFCA 5APQA 3VYIA 1J1EB 3HD7C 2LKMA 4JYBA 2CPSA 3N7NA 1NKZB 2WITA 2YNYA 3RL0C 2W27A 3VN0A 2YMYA 3EQ2A 1ZN5A 1NTKK 2NPSA 4Y99C 1L4AD 3M0AA 3RK3D 3BVHA 3HE4B 2XU6A 1JY3P 3VP8A 3IR9A 3UIAA 1G2CA 1KILD 1NTZK 1T3UA 1CI6A 3B5ND 4WY4A 2J59M 3CLQA 5KJ7C 2JEEA 1IFMA 1FZGA 1FZCB 4N3YB 4HYTB 2A45H 5AVXB 1URQC 1HBWA 1N7LA 2IX7C 2Q7CA 3G3ZA 4B86A 2L5GB 4I2LC 1J1EC 5CCHA 4GT1A 4LLHA 1S9KE 2QM7A 3V2NA 1GK4A 1KZUB 1JMMA 2IPPA 5APUA 1RF1B 1M1JA 5AW5B 1EQ7A 2P1JA 3M9HA 4JF7A 1SQVK 1SQPK 2H7HA 3KDPB 1RE4C 2ZXEB 1N7SD 3VMZA 2WSCH 3T97A 3VTPC 2HPCA 4I6MC 3HTKB 1YTZI 3V4WA 3CL3D 5CCGD 1JY2N 1LWUA 2YO2A 1FZCC 3E1IA 4M3LA 3NXSA 3M0DC 1IJDB 4EIJA 2GUSA 5AW1B 2A45I 1OWAA 4N78E 2VRSA 2Q3IA 3PP5A 3VP9A 1RF0C 1IFDA 1G1JA 2N1TD 5AVYB 3BRVB 1RF1C 1IFJA 2HYNA 2YKPA 5APTA 5BVZA 1GW4A 1GK6A 2NPSB 2Z5IA 2R5DA 3LIEA 1GW3A 1JO5A 1G2CB 3GHGA 1H8AA 4C7NA 1IO4A 1ZV8A 3MTUE 1ZR4A 2WPSA 1CI6B 1LTJC 1T2KD 3MGNA 4WY4B 1SQXK 3A7OA 5KTBA 1JNMA 1WT6A 2WTYA 5APYA 1ZR2A 1GL2D 5AW6B 1L4AA 2J58A 1SFCD 4GKGA 2P67A 3P8CD 1GZLA 2O1JA 1CW5A 3MD0A 1KILA 1PFIA 5APSA 2OYIA 1HUCA 1JY2O 1M1JB 3B5NA 2W6AA 4JYCA 3M9QA 1Z56A 3V5BA 2NPSC 1HH0A 3L36A 2WZ7A 1L0LK 2HODB 1VPCA 1H88A 1MFZA 3B8EB 1GD2E 5AVRB 1JUNA 2POHA 3RK2B 1IC2A 3I5CA 2HPCB 2I1JA 4IFFA 3BRTB 2FKWB 4WY4C 1HGVA 1NU1K 1LWUB 4EOTA 1JTHA 2YO3A 3NMDA 1NO4A 1SQBK 2MJZA 1LTTC 1KFNA 2IFMA 5AVTB 5CCHC 1N7SA 4IFMA 1LGHB 1QL1A 1CSBA 1QL2A 2BASA 4AQRD 2A45G 3II6A 3HE5A 1M1JC 2FYUK 3EFGA 3HD7D 2I1KA 1XTCC 5CCGA 4N6JA 1FAVA 2KB7P 3HUSA 3RL0D 1JCDA 1IFNA 5KJ7A 2Q9IA 2H43A 2C0WA 2HODA 1YYCA 1GU5A 1X8YA 3RK2C 1S9KD 2OYHA 4LGDE 3GHGB 3OJAB 4C7NB 2N1TA 2WSFH 2C9LY 2WWWA 1LWUC 5AW7B 1AQ5A 5AW9B 1N73B 3A2AA 1FOSE 1IK9A 2PAJA 2H8PD 3MUDA 1E5WA 1FZAA 1RE3A 5AVWB 1L4AB 3V2RA 4W80A 5KJ7D 3TNUB 4IFDK 3RK3B 4KHXA 1LTBC 5AVSB 1NWQA 3OA7A 3SWYA 3R2PA 1URQD 1LTIC 1NOHA 1HVVA 1NTMK 1G1IA 1YTZT 1KILB 1KFMA 4DZOA 3BATA 5AW2B 2OYIB 4OH8B 3B5NB 3M91A 1JCCA 1GDTA 2E42A 4W7ZA 1JY2P 3V2QA 2OARA 1LT9A 1GL2A 4N78D 4ZKUA 1ZLLA 1SFCA 1FJKA 3GHGC 5APWA 1OXZA 2XNXA 4W7YA 2FFDA 2O01H 2QM8A 1SP4A 5AW3B 1JTHB 1KQLA 2KP8A 1N73A 1L4AC 2W6BA 1AFOA 4O9BA 3RK3C 1W2EA 4XA4A 1LTAC 3TNUA 3CI9A 1J1DB 1N7SB 2M3BA 1FDMA 5CHXA 1KILC 2HLOA 3U1AA 2YKQA 1FU1A 3HE5B 3P8CE 1WRGA 3B5NC 3V4QA 4RESB 1T3JA 2N9BA 2O1KA 1GU4A 3P7KA 1A02F 1LTJA 3HUSB 2GM4A 1MZ9A 1A02J 2KYVA 2Z4EA 1MUUA 1JY3N 3LW5H 2OYHB 3L4FA 3P32A 3A5TA 1XTGB 1LTGC 1N86A 3VMXA 2C9NY 1CZQA 2N1TB 1T8ZA 2C0XA 2Z5HA 2KSJA 5CJ0A 1NAFA 3HD7A 3H6PA 5AW4B 1SQQK 1LTSC 4WB4A 4HH2A 3P8MC 3KPEA 1J1DC 3TK1A 5BU5A 1N7SC 2IFNA 2M8RA 3SWFA 3U59A 4WBAA 1SLQA 4DOJA 1HGZA 3U1CA 2XDJA 5CCGC 2WT7B 1FJPA 1FZEA 3WMM0 4LC1A 3HUSC 2HG5D 3H32B 2HFED 3A3YB 1SVFA 1GTWA 2R5BA 1LT9B 1GL2B 2NPSD 3LIDA 2E43A 1VDFA 2OYHC 1MV8A 1SFCB 2FYZA 3HRNA 1FZBA 5AW8B 5AVVB 1HJBA 2N1TC 1URQA 3KYQA 1J2JB 5AVQB 4ZKPA 2FFDB 3N4XA 1DH3A 1JOCA 4C7RA 2PP6A 5AVZB 2GUVA 1HTLC 1RE3C 2R32A 3BASA 4WY4D 4XE5B 2R3CA 1N2DC 3M06A 1JY3O 3OAKA 2WSEH 1FZFA 5BU8B 3TYYA 1RE4A 3HE4A 1NH4A 5CCHD 1IFIA 1X79B 3MIWA 2JJLA 1T2KC 1FBMA 5AW0B 2KLVA 3VMYA 2WT7A 2XZRA 1DEBA 3M9BA 3O8ZA 1LT9C 3H32A 1LTJB 5CJ4A 3C9IA 1GL2C 3NTNA 3VOPA 1RY3A 3L37A 1SFCC 2P7JA 2YKOA 1FZCA 1NKNA 1NHLA 4C46A 1FOSF 3M0DA 3TSIA 3KQGA 4GIFA 2FXMA 2FFDC 3RK2D 2Q5UA 3V2PA 2P2UA 1RF0A 2KOGA 3NFQA 3HD7B 1N73C 1RF1A 3RL0B 4AYCA 5AVUB 1H89A 2WPQA 4Y99B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MZ9 A;  3V2N A;  1FBM A;  3V2Q A;  3V2R A;  1VDF A;  3V2P A;  1DEB A; 
#chains in the Genus database with same CATH topology
 2B87 A;  3GMA A;  2XV5 A;  2OYI C;  2XKM A;  2PRR A;  2OQQ A;  1YQ3 C;  3HTK A;  4H44 B;  2KUB A;  1MKM A;  2CPB A;  3C1L A;  2MKV A;  1QVF O;  1L0N E;  1URQ B;  2KNC A;  5KLV K;  5APQ A;  1J1E B;  3HD7 C;  2CPS A;  4TT3 H;  3E1R A;  2IBZ G;  2W27 A;  2YMY A;  1ZN5 A;  1L4A D;  1EZV E;  3BVH A;  2XU6 A;  1RQU A;  3CCJ P;  2RMZ A;  2QJY B;  3B5N D;  1AVY A;  2J59 M;  3CLQ A;  1NTZ E;  1IFM A;  1Q2N A;  1UII A;  1FZC B;  4GOF A;  3PRJ A;  1IK7 A;  3L72 E;  2IBZ D;  2IX7 C;  2Q7C A;  2L5G B;  2WSS H;  5CCH A;  3TGU G;  1USE A;  3KZI E;  3L71 G;  3FWL A;  1RF1 B;  3CD6 P;  2FYU E;  3LW5 J;  2JWA A;  3IAO A;  3FGA D;  4H13 B;  1N7S D;  2OGU A;  1M8O B;  1W2B O;  1OZH A;  3VTP C;  5B66 H;  2BEZ F;  5H2F H;  2DW3 A;  1R8E A;  3V4W A;  3CL3 D;  5CCG D;  2YO2 A;  1PGJ A;  3O6Q A;  3TGU D;  1EXJ A;  3NXS A;  4IL6 X;  3PHL A;  5L8R J;  3AEG C;  1VQ9 P;  1JM0 A;  1BGY J;  1NTM D;  5AVY B;  2LR2 A;  3CX5 E;  2YIU C;  1ZXG A;  2M5A A;  2WMM A;  1S1C X;  2ZT9 D;  2WSF J;  4ZMD A;  2JR8 A;  1JO5 A;  3A0H E;  1L0N G;  1ZOY C;  4C7N A;  1ZR4 A;  2WPS A;  1LTJ C;  3I56 P;  3MGN A;  3A0B H;  1VQ7 P;  1VQN P;  3AE1 C;  1SQX E;  4GKG A;  3CCL P;  3MZW B;  2E5Y A;  1GZL A;  1EZV G;  5EFW B;  3MD0 A;  1KIL A;  2SPZ A;  1HUC A;  1EXI A;  3AEA C;  2NPS C;  1HH0 A;  2N9Y B;  1L0N D;  1H88 A;  1NTZ G;  4U3F E;  2ZAE B;  3L72 G;  1LWU B;  1JTH A;  4PV1 B;  2W83 C;  5KLI C;  1EZV D;  1LTT C;  2FYU G;  4DT0 A;  5AVT B;  4IFM A;  1LGH B;  1QL2 A;  1M1J C;  1SQQ J;  1E79 H;  1X22 A;  1NTZ D;  1XTC C;  4N6J A;  1NTK J;  1FAV A;  3HUS A;  3RL0 D;  3L72 D;  1EC5 A;  2BCC D;  1YYC A;  2PGD A;  2G8Y A;  3RK2 C;  2N1T A;  2QJP B;  3AE8 C;  4HJG H;  2WSF H;  4JPZ B;  1AQ5 A;  3SSU A;  1IK9 A;  1NVO A;  2H8P D;  3MUD A;  4H44 D;  3L75 E;  5AVW B;  3V2R A;  1SQP D;  4IFD K;  5AVS B;  1NWQ A;  3SWY A;  3R2P A;  1URQ D;  1LTI C;  2O3J A;  1NTM K;  4WVZ A;  1IZN B;  2RH0 A;  1YTZ T;  4OH8 B;  1GDT A;  1SQV J;  4W7Z A;  4IL6 E;  3WUU A;  1VQP P;  1KYO D;  3EWK A;  3GHG C;  4PJ0 E;  1SQX G;  2K1A A;  3CX5 D;  1OVU A;  3WU2 H;  1USD A;  3L74 E;  4KT0 J;  1KQL A;  2WSE J;  2IZ0 A;  3Q5S A;  2AXT H;  1L4A C;  1AFO A;  3JC2 2;  1FC2 C;  1BDC A;  1J1D B;  2HLO A;  3U1A A;  2YKQ A;  2IYO A;  1KV4 A;  3P8C E;  1WRG A;  3B5N C;  4U3F G;  4RES B;  3H25 A;  2YMK A;  4RJT A;  3L70 J;  2IZ1 A;  3P7K A;  1A02 F;  4DCK A;  1A02 J;  1JY3 N;  4OWF A;  3L4F A;  3P32 A;  1K9M Q;  5TIS E;  5GTH H;  2FBW C;  3HD7 A;  3H1H E;  3AE4 C;  2K9Y A;  3P8M C;  1NTK D;  1N7S C;  3U59 A;  4U3F D;  1L0L D;  5KLV J;  4DOJ A;  3RBZ A;  1BCC E;  5CCG C;  2HG5 D;  3GLM A;  2HFE D;  1KB9 H;  1SVF A;  4WWI A;  1LT9 B;  5DJU B;  2W90 A;  1GL2 B;  3LID A;  2OYH C;  1SFC B;  1EDJ A;  2FYZ A;  1PP9 J;  3L75 G;  5AW8 B;  3V6I A;  3KYQ A;  3AE3 C;  3AEE C;  4ZKP A;  1DH3 A;  3RBX A;  4C7R A;  3JCU H;  1KD1 Q;  1RE3 C;  1SQB J;  2R3C A;  3M06 A;  2ZT9 C;  5KAF E;  3OAK A;  2WSE H;  1FZF A;  3HE4 A;  3CXH E;  1FBM A;  2WT7 A;  2RN0 A;  3O8Z A;  1Y8A A;  3L74 G;  1KB9 I;  3H1I G;  2YKO A;  4C46 A;  4PD4 E;  3TSI A;  3CC4 P;  1KMI Z;  2FYN B;  4PV1 D;  5AVU B;  5CBN A;  2WSC J;  1ZME C;  4CPG A;  1GMJ A;  1X0T A;  3L35 A;  3L74 D;  5CMZ A;  1HWT C;  1VF5 B;  3CCQ P;  1X9V A;  3IFM A;  1OW8 A;  3H1H G;  3IF4 A;  3AEF C;  4K35 A;  4I1L A;  2LKM A;  4JYB A;  5C39 A;  2WIT A;  1BCC G;  2YNY A;  3RL0 C;  3VN0 A;  3EQ2 A;  1P84 D;  1NTK K;  2NPS A;  1HJ0 A;  3AE7 C;  1G2C A;  5KAI H;  1CI6 A;  4H44 C;  3H1K E;  3O6Q B;  1R5L A;  2H89 C;  1PGO A;  5AVX B;  1URQ C;  1JEK A;  1OX3 A;  4B86 A;  1J1E C;  2JO1 A;  1GK4 A;  2IPP A;  1M1J A;  2M5A B;  1EQ7 A;  1K04 A;  1SQV K;  2E74 D;  1RE4 C;  2JKV A;  3L71 E;  4D6T E;  3VMZ A;  2WSC H;  3T97 A;  2HPC A;  2QJY C;  2Y9Z A;  2OTJ P;  1FZC C;  1LP1 B;  4M3L A;  4U7J A;  3MHV A;  4EIJ A;  5AW1 B;  3WUT A;  2Q3I A;  3VMA A;  3VP9 A;  2OTK E;  1IFD A;  1G1J A;  1RF1 C;  1BSH A;  5B66 E;  5APT A;  5H2F E;  3TGU J;  1BSN A;  1GK6 A;  1AV1 A;  2D2C B;  1NTM J;  1PL5 A;  1QX8 A;  3GHG A;  1RQV A;  4WY4 B;  1M57 D;  3A7O A;  5APY A;  1ZR2 A;  3SWK A;  1GL2 D;  1YIT P;  5AW6 B;  1L4A A;  1SFC D;  3PH0 A;  2P67 A;  1PPJ E;  1ZRT E;  3AED C;  3SFE C;  1PFI A;  5APS A;  1JY2 O;  3B5N A;  1BE3 D;  2W6A A;  3M9Q A;  4TLF A;  3V5B A;  3A0B E;  3H1K G;  2K9J B;  1GD2 E;  1JUN A;  3RK3 E;  1IC2 A;  1JB0 J;  1LT1 A;  1KIL E;  1L0N J;  3JSV C;  2YO3 A;  1SQB K;  1NU1 E;  2QSI A;  1MFT A;  2IFM A;  1KQS O;  1N7S A;  3H1L G;  1QL1 A;  3BCC E;  3E7K A;  1H0T B;  2NRG A;  3II6 A;  4D6T G;  3H1K D;  1AJY A;  2I1K A;  5CCG A;  1EDL A;  5KJ7 A;  2Q9I A;  2H43 A;  2HOD A;  2OYH A;  3OJA B;  1NTZ J;  2C9L Y;  1LWU C;  5AW9 B;  1VF5 D;  4PV1 C;  3L72 J;  2E75 B;  2A06 E;  2BCC J;  1RE3 A;  4NPD A;  1S3J A;  4W80 A;  3EFF K;  5KJ7 D;  1FDI A;  1Q90 D;  3L71 D;  4D6T D;  1LTB C;  2AEF A;  1G1I A;  1S72 P;  4DZO A;  2OYI B;  4R4L A;  3M91 A;  1PGP A;  1SQP J;  1JY2 P;  1L2P A;  3V2Q A;  2QVA A;  2V7Q J;  2QJP C;  1PPJ G;  1PGQ A;  2ZVO B;  4O9B A;  1W5C E;  2OYO A;  5KKZ B;  3RGU A;  2W8Z A;  1YI2 P;  1UIX A;  1FU1 A;  3HE5 B;  3V4Q A;  4UB8 H;  3WU2 E;  1OW7 A;  2AXT E;  5DJT B;  1KOR A;  1PPJ D;  1Y9B A;  2ZYA A;  2KSE A;  1NU1 G;  3LW5 H;  2I8D A;  1T8Z A;  2KZI A;  2C0X A;  2KSJ A;  3BCC G;  5CJ0 A;  1SQX J;  1SS1 A;  3L73 E;  5CBO A;  2KIK A;  2E74 C;  1J1D C;  3SWF A;  2IFN A;  1SQQ E;  4WBA A;  1SLQ A;  3U1C A;  2AEJ A;  4BWN A;  4I7Z B;  2WT7 B;  5GTH E;  1FJP A;  1FZE A;  4LC1 A;  1FS0 E;  1OFC X;  4U3F J;  1L0L J;  3G6E P;  3F89 A;  1VQ4 P;  2E43 A;  3FXD A;  2A06 G;  3BCC D;  2D2C D;  5AVV B;  1URQ A;  2ZJS E;  2FFD B;  2V7Q H;  3N4X A;  1OIP A;  4UB6 H;  2FYU D;  2PP6 A;  1HTL C;  2R32 A;  4WY4 D;  2BEQ D;  4L76 A;  1KB9 E;  1VQ6 P;  1KYO H;  3TYY A;  1RE4 A;  1NH4 A;  2KXP B;  2JJL A;  1KC8 Q;  2KLV A;  3VMY A;  1DEB A;  2QA4 P;  3M9B A;  3QWO C;  1LT9 C;  1RH5 B;  3JCU E;  1LTJ B;  3KXD A;  1GL2 C;  1PIX A;  1RY3 A;  1SFC C;  1FZC A;  4YXW H;  1NHL A;  3CC2 P;  1KTM A;  3V2P A;  2P2U A;  2ITA A;  1N73 C;  1RHZ B;  3H1I E;  1RF1 A;  1K8A Q;  2Q3E A;  4Y99 B;  3L70 E;  4IOI H;  1KYO I;  1M7L A;  3IN6 A;  2WPR A;  1SQX D;  3L73 G;  1L0N K;  5KLI B;  5APV A;  3AE6 C;  3L74 J;  4ZNC A;  4H13 D;  4AUW A;  1SQQ G;  2FYN C;  2Y9Y A;  3VYI A;  3Q1M A;  1NKZ B;  5KLV E;  3CCM P;  3GF3 A;  2E75 D;  2K88 A;  3CPW O;  2WPV B;  2Q6Q A;  4NPF X;  3VP8 A;  3OW2 O;  1BDD A;  3UIA A;  3L73 D;  1VF5 C;  1PP9 E;  3D6Z A;  1NTZ K;  2V4H A;  5KJ7 C;  2JEE A;  1FZG A;  2KS1 B;  4N3Y B;  2A45 H;  1HBW A;  3G3Z A;  4GT1 A;  1S9K E;  1SQV G;  3V2N A;  1JMM A;  5KAI E;  4H0L B;  3CWB E;  5AW5 B;  2QJK B;  3M9H A;  1SQP K;  1BCC J;  2H7H A;  2ZXE B;  4YTP C;  2B87 B;  4I6M C;  5TJH A;  3HTK B;  1KB9 D;  3I55 P;  3L75 D;  1LWU A;  1DD4 A;  3K5B A;  3M0D C;  1IJD B;  2A45 I;  1OWA A;  3SFD C;  2VRS A;  3H1J E;  2KNC B;  3AE9 C;  3PP5 A;  3L70 G;  3KHU A;  3BRV B;  1IFJ A;  5BVZ A;  2IYP A;  1KQF B;  2ZXX A;  2R5D A;  3LIE A;  1GW3 A;  4BXL A;  3H1I D;  3D6Y A;  1SQX K;  5KLV G;  5KTB A;  1JNM A;  1VQO P;  2WTY A;  1P84 H;  2HR3 A;  4GDO A;  5K5G B;  3P8C D;  2O1J A;  1PP9 G;  3G71 P;  3L36 A;  2D2C C;  2WZ7 A;  2Y0D A;  1L0L K;  2HOD B;  2AEM A;  1MFZ A;  3B8E B;  5AVR B;  1BE3 J;  2I1J A;  1LJ2 A;  2FXP A;  1K73 Q;  2FKW B;  4WY4 C;  1S5L H;  3H1H D;  4EOT A;  1NO4 A;  2MJZ A;  3CWB G;  1KFN A;  1P84 I;  2WVR A;  2ZT9 B;  4DJG A;  4OGQ B;  1BCC D;  1CSB A;  2BAS A;  4AQR D;  1S2E A;  3D71 A;  2B89 A;  4HKZ H;  3H1L E;  1IFN A;  4EDF A;  4KJM A;  1U7J A;  1S9K D;  3ABV C;  2K37 A;  3H1K J;  4C7N B;  2M3E A;  3H1J G;  3FWN A;  2WWW A;  5AW7 B;  4XFJ A;  2JP3 A;  1FOS E;  3CCS P;  2P10 A;  2PAJ A;  1E5W A;  3RK3 B;  3CXH D;  3OA7 A;  1NGM B;  1KIL B;  1AVO A;  1KFM A;  2E5T A;  3CCE P;  1NTM E;  5GTI H;  3L71 J;  4D6T J;  2OAR A;  4ASW A;  1LT9 A;  3FX0 A;  2P58 A;  1GL2 A;  4PD4 D;  4H13 C;  3H1J D;  4ZKU A;  2LXB A;  1SFC A;  1FJK A;  5APW A;  5B5E H;  2XNX A;  4L75 A;  2CK3 H;  1SP4 A;  2E75 C;  5AW3 B;  1JTH B;  2KP8 A;  1N73 A;  3G9R A;  3GF7 A;  3TNU A;  1KQG B;  3CI9 A;  2M3B A;  5CHX A;  2QE7 H;  1T3J A;  1VQM P;  4H0L D;  2O1K A;  3HUS B;  1YJN P;  3W68 A;  1EDK A;  2Z4E A;  2XND H;  3A5T A;  1QVG O;  1XTG B;  1PV3 A;  1LTG C;  1CZQ A;  2N1T B;  4YXD C;  1YIJ P;  4UB8 E;  3H6P A;  1U57 A;  2YXR B;  1LTS C;  4WB4 A;  4HH2 A;  3KPE A;  3AEB C;  3TK1 A;  2M8R A;  5KKZ C;  4JBZ A;  3TF5 A;  2L91 A;  3WMM 0;  3A3Y B;  2FXO A;  1VQK P;  1VDF A;  2KZJ A;  3HRN A;  1FZB A;  2E76 B;  2IDB A;  1HJB A;  2BCC E;  1J2J B;  3W67 A;  5AVQ B;  2IBZ I;  1NU1 J;  3CC7 P;  3B71 A;  2Y0C A;  1JOC A;  5AVZ B;  4XE5 B;  3BAS A;  3H1L D;  1YHQ P;  1BGY E;  1NTM G;  3BCC J;  1JY3 O;  1SQP E;  2B88 A;  5CCH D;  5E79 H;  1IFI A;  1X79 B;  2FYU J;  3AE5 C;  3MIW A;  4I7Z C;  3S1K A;  5AW0 B;  2OTL P;  2XZR A;  4UB6 E;  2QRX A;  3H32 A;  3C9I A;  3VOP A;  3L37 A;  3FXE A;  2H88 C;  1DIP A;  1KYO E;  3M0D A;  3Q5R A;  2FFD C;  1QEX A;  3NFQ A;  3HD7 B;  2ZVN B;  1AA0 A;  2J5U A;  1OVV A;  1H89 A;  1DEE G;  4OGQ D;  2R44 A;  1DX7 A;  1LP1 A;  1R5S A;  1ZRT D;  5APX A;  1Y47 A;  2ZFC A;  3CCR P;  2YXQ B;  2ZYG A;  3N7N A;  1AQT A;  1PZQ A;  3GW6 A;  1HF9 A;  1T6A A;  4BRY A;  4Y99 C;  3M0A A;  1M56 D;  3RK3 D;  2B9B A;  1NTK E;  3HE4 B;  1JY3 P;  1L0L E;  3KZI H;  3IR9 A;  1EDI A;  3PLN A;  1KIL D;  2BCC G;  1T3U A;  2UWJ E;  4GOE A;  4WY4 A;  1NU1 D;  1S5L X;  4HYT B;  3CME P;  1BGY G;  1EZV I;  1N7L A;  3L73 J;  1FE6 A;  4HB1 A;  4I2L C;  4ASV A;  4LLH A;  4R4M A;  1Q81 Q;  1U7M A;  2QM7 A;  1SQP G;  4EI2 A;  1KZU B;  5APU A;  2YIU B;  2P1J A;  4JF7 A;  4L74 A;  3AE2 C;  1VQL P;  3KDP B;  2Y0E A;  1SQV E;  2K9J A;  4RO0 A;  1QLE D;  3S9O A;  2QEX P;  1Q7Y Q;  3CX5 H;  4MN4 C;  1BGY D;  1YTZ I;  2A06 D;  1JY2 N;  2O01 N;  3E1I A;  1D7M A;  4QMA A;  3Q5P A;  3Q3D A;  2GUS A;  1DD3 A;  1YBK A;  4N78 E;  1VQ5 P;  3A0H H;  3S4R A;  5M1B A;  1H0T A;  1RF0 C;  2N1T D;  3L75 J;  4A7P A;  2HYN A;  4H0L C;  1NJI Q;  2YKP A;  2QJK C;  1ZW0 A;  1GW4 A;  2R3S A;  2NPS B;  2Z5I A;  4JQ0 D;  1G2C B;  1H8A A;  1IO4 A;  1ZV8 A;  3MTU E;  1CI6 B;  3CX5 I;  1T2K D;  1WMK A;  2QIW A;  1WT6 A;  2E74 B;  2J58 A;  1KN7 A;  2E76 D;  3R4Y A;  3H1I J;  1CW5 A;  1NTK G;  1Q82 Q;  1L0L G;  2OYI A;  1N8R Q;  1M1J B;  4JYC A;  1NAY A;  1Z56 A;  1P84 E;  1VPC A;  2JDI H;  2O01 J;  4K3A A;  2POH A;  3RK2 B;  3T97 B;  3I5C A;  2HPC B;  4NPE A;  4IFF A;  3WUV A;  3BRT B;  1FDO A;  1HGV A;  3GG2 A;  1NU1 K;  2NZ2 A;  4YPC A;  3NMD A;  1K05 A;  3AEC C;  1SQQ D;  3ZDM A;  3RL0 g;  5CCH C;  1SQB E;  1ZP0 C;  2A45 G;  3H1H J;  3MP7 B;  3HE5 A;  2FYU K;  3PTZ A;  2ZYD A;  3EFG A;  1S5L E;  3HD7 D;  2KB7 P;  1JCD A;  2C0W A;  1GU5 A;  1JMB A;  1X8Y A;  2M0B A;  3CCV P;  4LGD E;  3GHG B;  1YQ4 C;  2WQY C;  1N73 B;  3A2A A;  4IL6 H;  1FZA A;  3PJS K;  1L4A B;  3TNU B;  1SQV D;  4OGQ C;  1NYH A;  4KHX A;  3C8V A;  4PJ0 H;  3CWB J;  1NOH A;  1HVV A;  1TU3 F;  3F5H A;  3G4S P;  3BAT A;  5AW2 B;  2GA1 A;  3B5N B;  1JCC A;  2E42 A;  3CCU P;  4N78 D;  1YJW P;  1ZLL A;  2FY8 A;  1OXZ A;  3QH9 A;  4W7Y A;  2JWD A;  2FFD A;  2O01 H;  2QM8 A;  3H1J J;  5GTI E;  2W6B A;  3RK3 C;  1W2E A;  3L70 D;  4XA4 A;  1LTA C;  1N7S B;  1FDM A;  1OMI A;  1KIL C;  5B5E E;  5TIS H;  1M90 Q;  2N9B A;  2Q1K A;  4OVN F;  4Y28 J;  1IFP A;  1GU4 A;  1LTJ A;  2GM4 A;  1BE3 E;  4RKU J;  1MZ9 A;  2KYV A;  1MUU A;  2W6J H;  2OYH B;  1N86 A;  3VMX A;  2C9N Y;  5KLV D;  1SQB G;  2K3R A;  2Z5H A;  1NAF A;  3CMA P;  1YJ9 P;  5AW4 B;  1SQQ K;  4Z1M H;  5BU5 A;  3ITK A;  3TDK A;  2QG4 A;  1HGZ A;  1VL2 A;  1PP9 D;  2IBZ E;  2XDJ A;  1S4X A;  1QGK B;  3HUS C;  3H32 B;  1GTW A;  2R5B A;  1OW6 A;  5KAF H;  3D70 A;  1Q86 Q;  2NPS D;  1SQB D;  1MV8 A;  3Q2Y A;  2N1T C;  3CXH H;  4EYY Q;  3CWB D;  2KK7 A;  3MUD C;  1VQ8 P;  2GUV A;  1N2D C;  2G3A A;  4GOD A;  3B4S A;  4PD4 H;  3TGU E;  1OVR A;  2RKL A;  5BU8 B;  2AXC A;  1T2K C;  3H1L J;  5CJ4 A;  3NTN A;  2P7J A;  2KS1 A;  2E76 C;  2LXC B;  1NKN A;  4L73 A;  1FOS F;  3KQG A;  2KLU A;  4GIF A;  2FXM A;  2PFX A;  3RK2 D;  3CXH I;  5E79 E;  2Q5U A;  1RF0 A;  2KOG A;  2KI7 B;  1LNQ A;  3RL0 B;  4AYC A;  4BRY B;  3USS A;  2WPQ A;  1M1K Q;  1BE3 G;  4PD4 I; 
#chains in the Genus database with same CATH homology
 1M7L A;  3L35 A;  2XV5 A;  2OYI C;  2XKM A;  5CMZ A;  1HWT C;  3HTK A;  1DX7 A;  1X9V A;  2WPR A;  3IFM A;  1L0N K;  2CPB A;  5APV A;  5APX A;  4AUW A;  1URQ B;  4I1L A;  5KLV K;  2ZFC A;  5APQ A;  3VYI A;  1J1E B;  3HD7 C;  2LKM A;  4JYB A;  2CPS A;  3N7N A;  1NKZ B;  2WIT A;  2YNY A;  3RL0 C;  2W27 A;  3VN0 A;  2YMY A;  3EQ2 A;  1ZN5 A;  1NTK K;  2NPS A;  4Y99 C;  1L4A D;  3M0A A;  3RK3 D;  3BVH A;  3HE4 B;  2XU6 A;  1JY3 P;  3VP8 A;  3IR9 A;  3UIA A;  1G2C A;  1KIL D;  1NTZ K;  1T3U A;  1CI6 A;  3B5N D;  4WY4 A;  2J59 M;  3CLQ A;  5KJ7 C;  2JEE A;  1IFM A;  1FZG A;  1FZC B;  4N3Y B;  4HYT B;  2A45 H;  5AVX B;  1URQ C;  1HBW A;  1N7L A;  2IX7 C;  2Q7C A;  3G3Z A;  4B86 A;  2L5G B;  4I2L C;  1J1E C;  5CCH A;  4GT1 A;  4LLH A;  1S9K E;  2QM7 A;  3V2N A;  1GK4 A;  1KZU B;  1JMM A;  2IPP A;  5APU A;  1RF1 B;  1M1J A;  5AW5 B;  1EQ7 A;  2P1J A;  3M9H A;  4JF7 A;  1SQV K;  1SQP K;  2H7H A;  3KDP B;  1RE4 C;  2ZXE B;  1N7S D;  3VMZ A;  2WSC H;  3T97 A;  3VTP C;  2HPC A;  4I6M C;  3HTK B;  1YTZ I;  3V4W A;  3CL3 D;  5CCG D;  1JY2 N;  1LWU A;  2YO2 A;  1FZC C;  3E1I A;  4M3L A;  3NXS A;  3M0D C;  1IJD B;  4EIJ A;  2GUS A;  5AW1 B;  2A45 I;  1OWA A;  4N78 E;  2VRS A;  2Q3I A;  3PP5 A;  3VP9 A;  1RF0 C;  1IFD A;  1G1J A;  2N1T D;  5AVY B;  3BRV B;  1RF1 C;  1IFJ A;  2HYN A;  2YKP A;  5APT A;  5BVZ A;  1GW4 A;  1GK6 A;  2NPS B;  2Z5I A;  2R5D A;  3LIE A;  1GW3 A;  1JO5 A;  1G2C B;  3GHG A;  1H8A A;  4C7N A;  1IO4 A;  1ZV8 A;  3MTU E;  1ZR4 A;  2WPS A;  1CI6 B;  1LTJ C;  1T2K D;  3MGN A;  4WY4 B;  1SQX K;  3A7O A;  5KTB A;  1JNM A;  1WT6 A;  2WTY A;  5APY A;  1ZR2 A;  1GL2 D;  5AW6 B;  1L4A A;  2J58 A;  1SFC D;  4GKG A;  2P67 A;  3P8C D;  1GZL A;  2O1J A;  1CW5 A;  3MD0 A;  1KIL A;  1PFI A;  5APS A;  2OYI A;  1HUC A;  1JY2 O;  1M1J B;  3B5N A;  2W6A A;  4JYC A;  3M9Q A;  1Z56 A;  3V5B A;  2NPS C;  1HH0 A;  3L36 A;  2WZ7 A;  1L0L K;  2HOD B;  1VPC A;  1H88 A;  1MFZ A;  3B8E B;  1GD2 E;  5AVR B;  1JUN A;  2POH A;  3RK2 B;  1IC2 A;  3I5C A;  2HPC B;  2I1J A;  4IFF A;  3BRT B;  2FKW B;  4WY4 C;  1HGV A;  1NU1 K;  1LWU B;  4EOT A;  1JTH A;  2YO3 A;  3NMD A;  1NO4 A;  1SQB K;  2MJZ A;  1LTT C;  1KFN A;  2IFM A;  5AVT B;  5CCH C;  1N7S A;  4IFM A;  1LGH B;  1QL1 A;  1CSB A;  1QL2 A;  2BAS A;  4AQR D;  2A45 G;  3II6 A;  3HE5 A;  1M1J C;  2FYU K;  3EFG A;  3HD7 D;  2I1K A;  1XTC C;  5CCG A;  4N6J A;  1FAV A;  2KB7 P;  3HUS A;  3RL0 D;  1JCD A;  1IFN A;  5KJ7 A;  2Q9I A;  2H43 A;  2C0W A;  2HOD A;  1YYC A;  1GU5 A;  1X8Y A;  3RK2 C;  1S9K D;  2OYH A;  4LGD E;  3GHG B;  3OJA B;  4C7N B;  2N1T A;  2WSF H;  2C9L Y;  2WWW A;  1LWU C;  5AW7 B;  1AQ5 A;  5AW9 B;  1N73 B;  3A2A A;  1FOS E;  1IK9 A;  2PAJ A;  2H8P D;  3MUD A;  1E5W A;  1FZA A;  1RE3 A;  5AVW B;  1L4A B;  3V2R A;  4W80 A;  5KJ7 D;  3TNU B;  4IFD K;  3RK3 B;  4KHX A;  1LTB C;  5AVS B;  1NWQ A;  3OA7 A;  3SWY A;  3R2P A;  1URQ D;  1LTI C;  1NOH A;  1HVV A;  1NTM K;  1G1I A;  1YTZ T;  1KIL B;  1KFM A;  4DZO A;  3BAT A;  5AW2 B;  2OYI B;  4OH8 B;  3B5N B;  3M91 A;  1JCC A;  1GDT A;  2E42 A;  4W7Z A;  1JY2 P;  3V2Q A;  2OAR A;  1LT9 A;  1GL2 A;  4N78 D;  4ZKU A;  1ZLL A;  1SFC A;  1FJK A;  3GHG C;  5APW A;  1OXZ A;  2XNX A;  4W7Y A;  2FFD A;  2O01 H;  2QM8 A;  1SP4 A;  5AW3 B;  1JTH B;  1KQL A;  2KP8 A;  1N73 A;  1L4A C;  2W6B A;  1AFO A;  4O9B A;  3RK3 C;  1W2E A;  4XA4 A;  1LTA C;  3TNU A;  3CI9 A;  1J1D B;  1N7S B;  2M3B A;  1FDM A;  5CHX A;  1KIL C;  2HLO A;  3U1A A;  2YKQ A;  1FU1 A;  3HE5 B;  3P8C E;  1WRG A;  3B5N C;  3V4Q A;  4RES B;  1T3J A;  2N9B A;  2O1K A;  1GU4 A;  3P7K A;  1A02 F;  1LTJ A;  3HUS B;  2GM4 A;  1MZ9 A;  1A02 J;  2KYV A;  2Z4E A;  1MUU A;  1JY3 N;  3LW5 H;  2OYH B;  3L4F A;  3P32 A;  3A5T A;  1XTG B;  1LTG C;  1N86 A;  3VMX A;  2C9N Y;  1CZQ A;  2N1T B;  1T8Z A;  2C0X A;  2Z5H A;  2KSJ A;  5CJ0 A;  1NAF A;  3HD7 A;  3H6P A;  5AW4 B;  1SQQ K;  1LTS C;  4WB4 A;  4HH2 A;  3P8M C;  3KPE A;  1J1D C;  3TK1 A;  5BU5 A;  1N7S C;  2IFN A;  2M8R A;  3SWF A;  3U59 A;  4WBA A;  1SLQ A;  4DOJ A;  1HGZ A;  3U1C A;  2XDJ A;  5CCG C;  2WT7 B;  1FJP A;  1FZE A;  3WMM 0;  4LC1 A;  3HUS C;  2HG5 D;  3H32 B;  2HFE D;  3A3Y B;  1SVF A;  1GTW A;  2R5B A;  1LT9 B;  1GL2 B;  2NPS D;  3LID A;  2E43 A;  1VDF A;  2OYH C;  1MV8 A;  1SFC B;  2FYZ A;  3HRN A;  1FZB A;  5AW8 B;  5AVV B;  1HJB A;  2N1T C;  1URQ A;  3KYQ A;  1J2J B;  5AVQ B;  4ZKP A;  2FFD B;  3N4X A;  1DH3 A;  1JOC A;  4C7R A;  2PP6 A;  5AVZ B;  2GUV A;  1HTL C;  1RE3 C;  2R32 A;  3BAS A;  4WY4 D;  4XE5 B;  2R3C A;  1N2D C;  3M06 A;  1JY3 O;  3OAK A;  2WSE H;  1FZF A;  5BU8 B;  3TYY A;  1RE4 A;  3HE4 A;  1NH4 A;  5CCH D;  1IFI A;  1X79 B;  3MIW A;  2JJL A;  1T2K C;  1FBM A;  5AW0 B;  2KLV A;  3VMY A;  2WT7 A;  2XZR A;  1DEB A;  3M9B A;  3O8Z A;  1LT9 C;  3H32 A;  1LTJ B;  5CJ4 A;  3C9I A;  1GL2 C;  3NTN A;  3VOP A;  1RY3 A;  3L37 A;  1SFC C;  2P7J A;  2YKO A;  1FZC A;  1NKN A;  1NHL A;  4C46 A;  1FOS F;  3M0D A;  3TSI A;  3KQG A;  4GIF A;  2FXM A;  2FFD C;  3RK2 D;  2Q5U A;  3V2P A;  2P2U A;  1RF0 A;  2KOG A;  3NFQ A;  3HD7 B;  1N73 C;  1RF1 A;  3RL0 B;  4AYC A;  5AVU B;  1H89 A;  2WPQ A;  4Y99 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...