3V2QA

Compcc in complex with fatty acids
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
45
structure length
45
Chain Sequence
b'MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cartilage Oligomerization matrix protein (coiled-coil domain
publication title The pentameric channel of COMPcc in complex with different fatty acids.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 18
structure length 45
sequence length 45
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.10 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3v2qA00
1VDFA 3V2RA 1FBMA 1MZ9A 3V2PA 1DEBA 3V2QA 3V2NA
chains in the Genus database with same CATH superfamily
1URQB 4N6JA 3Q1MA 5AW8B 4OGQC 2FXPA 5APWA 1KN7A 4RO0A 4CPGA 2A45G 1YJWP 1SQPE 2WPQA 3OW2O 5APYA 1L0NG 4W7ZA 1FZGA 1D7MA 2OARA 1S72P 1VPCA 3GW6A 5KTBA 1S1CX 2FYUK 3I55P 2YO2A 1LWUB 1J1EC 2CPBA 1IC2A 5APUA 3AE1C 3G4SP 5TISH 2NPSC 3S1KA 2OYIA 2IYPA 1JY2O 2XDJA 2KB7P 1SQQE 1P84I 3KZIH 2YIUB 3L70E 1RF1A 3CCVP 1EDKA 1RQVA 1SS1A 3D71A 3O8ZA 1M1JC 1QL1A 2YMYA 2E76D 2KYVA 1JY3O 2WPVB 2QVAA 2H88C 2FXOA 5TISE 4RKUJ 1PP9D 3MGNA 1BGYG 1P84H 2WSSH 2FXMA 1JY3N 1U7JA 3KZIE 4EI2A 3PRJA 3VP8A 1KILB 1JB0J 3HD7D 5DJUB 3U1CA 1NWQA 1HJBA 3JC22 1T6AA 1FJKA 3FWNA 1KYOI 1L2PA 1EZVG 1FZCB 1URQC 3II6A 2QJPC 3L75D 1L0LJ 1LTJB 2FYNC 2WSCJ 3NTNA 1ZRTE 3H32A 1VQ7P 1P84E 1AQTA 2O1KA 2UWJE 1SLQA 1EXIA 1FOSE 3H1LD 3Q5PA 2QEXP 5AW6B 3H1HG 3V2RA 1KYOH 1GW4A 1EQ7A 2IPPA 4AQRD 2ZT9D 1ZR2A 3N7NA 1VQNP 3B71A 3ABVC 2M0BA 1OZHA 1M7LA 3LIDA 2Y9YA 4H44D 1IO4A 3V6IA 5CCGA 1NTMJ 1BE3G 3CCQP 1QVGO 1SQPD 2WMMA 2QRXA 1KYOE 4WY4A 2YIUC 3AEEC 2VRSA 1OXZA 3CWBG 2PFXA 1UIIA 3AE6C 2K9JB 2O01N 1L4AD 2AEMA 2ZXXA 1AFOA 4XE5B 1PPJG 3HE4B 2E74B 3V4WA 1A02F 1RE3A 3H1JJ 1JTHB 3RK2C 1NTMK 2IZ0A 1X8YA 4Y28J 1JUNA 2KXPB 4JQ0D 4IFMA 1RH5B 4NPEA 1QGKB 1KILC 4IFDK 2YKQA 2HODB 1SQQD 2YNYA 1YJ9P 3CC2P 1NAFA 3U59A 3Q2YA 2CPSA 1IFNA 3OAKA 2KS1B 1FZCC 1NH4A 2WSCH 3CCLP 2JDIH 3L70D 1LTJC 4BWNA 3EWKA 3I56P 1ZW0A 1SQVG 1R5LA 1EDLA 1JCCA 2R5DA 4IL6X 2M8RA 4PV1B 3I5CA 1T2KC 2OQQA 2W27A 1L0LE 3SFEC 1T3UA 1VQPP 5APTA 3BRVB 4JPZB 3G3ZA 1NTKK 3A3YB 3PP5A 1S5LH 1H88A 2IFMA 3G71P 1S2EA 1YJNP 1ZRTD 2FKWB 2P1JA 1P84D 1FOSF 5AW1B 4YTPC 4BRYB 1KMIZ 1LT9B 2K1AA 1R8EA 1FZBA 1N73B 1HUCA 1VL2A 2BEZF 1S5LE 3T97B 3VMZA 2E74C 3FXDA 1NTME 4YPCA 1BSNA 5AW7B 3MUDC 2Q9IA 1DEBA 3B5ND 4PD4I 2Q5UA 3HE5A 1XTGB 1YQ3C 2M5AB 3C1LA 5AVXB 4NPFX 1IFMA 1KYOD 1GD2E 3TF5A 2P67A 1AV1A 2RN0A 3H1JE 1FC2C 2Q3IA 3E1IA 3GLMA 1FDOA 3NXSA 3JSVC 4PD4H 1SFCD 1Y47A 2K9YA 4PV1C 2OTKE 2GM4A 1NTZG 2BEQD 1FE6A 2FFDA 3P32A 3AEGC 3PJSK 4HH2A 2W6AA 1GL2D 2IBZI 1JNMA 5KAIH 4KJMA 1SQXJ 4PD4E 3TGUG 4YXWH 2KSJA 1SQBG 1FAVA 5CCHA 1N86A 3FGAD 2G3AA 1Q82Q 5K5GB 2W83C 3RK3E 5KJ7C 3IF4A 3L74J 2ZYAA 3HUSA 2E76B 1Y9BA 2KLVA 2R3CA 5KAIE 2QJYB 3CI9A 3H1KJ 2AXTH 4IFFA 3VMXA 2JEEA 2J59M 3AEAC 2QM7A 1Q7YQ 3AEDC 2AEFA 3KQGA 1YIJP 2JWDA 3KYQA 4ZMDA 1NGMB 4MN4C 3SWKA 5GTIH 2IBZE 4DCKA 3V2NA 5AW5B 1EDJA 4JBZA 2AXTE 1PFIA 4C7NB 5AW2B 2IYOA 5KLVJ 1NTMD 3AECC 1RF0A 3RBZA 4L73A 3FXEA 5GTIE 1JY3P 3W68A 4LC1A 2N1TD 1N7SD 3TK1A 3RBXA 2L91A 1VDFA 5KLVK 1KV4A 2JJLA 3H1JD 2QJKB 2G8YA 2B87A 1X79B 2ZJSE 3L73G 2HLOA 3A5TA 3VN0A 5CBOA 2XZRA 2ZVOB 1SQXE 2E76C 5AW0B 3CC7P 2NPSA 2QJYC 1L0NJ 1LT1A 3VP9A 1Q86Q 1KZUB 3Q5RA 2QIWA 1OMIA 2Z4EA 1SVFA 4PD4D 2ZYGA 1R5SA 3L35A 2OYIB 3HD7C 3L74E 2MJZA 1M1JA 2K37A 2K88A 3B4SA 1CI6B 3H1KE 2ZFCA 1JM0A 2D2CD 3E7KA 1X9VA 3RK3D 1RF1B 1L0NK 1HWTC 2E43A 3KPEA 3OA7A 3G6EP 3L36A 3BRTB 3P8CD 1ZMEC 2YKOA 1YTZT 2FYUG 1KTMA 3C8VA 1MKMA 3RL0g 2O01J 3USSA 1URQA 2ZT9C 4I2LC 1FZFA 4C46A 1HH0A 5M1BA 2JKVA 2E5TA 5KLVE 2IBZD 2KSEA 2XNXA 2RH0A 5AVZB 4TT3H 2LXBA 2P58A 4H44C 5B5EH 2HPCB 1YQ4C 2A06E 4JYBA 2HG5D 4WWIA 3C9IA 4KHXA 2QJKC 2BCCG 2WWWA 1K8AQ 2K3RA 1MFZA 2A45H 3KDPB 3IAOA 1LGHB 1MFTA 1L4AC 5BU5A 2YXQB 1NU1G 2ZVNB 5B5EE 1X22A 1M1KQ 2C9LY 3P7KA 4I6MC 3B5NB 1PIXA 3L71D 3UIAA 4K3AA 1N8RQ 1AVYA 1H8AA 5B66H 2XKMA 2H89C 2IFNA 3N4XA 4U3FG 1L0NE 3CLQA 3L72G 3TSIA 1RF1C 4OH8B 3MHVA 1BCCG 1SQXD 1L0LK 1BE3J 1N7LA 1SFCB 1LWUC 1KILA 4EIJA 5CMZA 2GUVA 2O01H 5B66E 4PJ0H 1DD3A 4RESB 1FZCA 4N3YB 1FS0E 3B8EB 1PGQA 1LTJA 2OYHB 1Q81Q 1WRGA 2J58A 3L74D 1GL2B 2AXCA 1ZR4A 3H1KD 1YITP 1JMMA 1S5LX 2XNDH 1YBKA 3AE8C 1FJPA 4N78E 4PJ0E 3IR9A 3JCUH 3EQ2A 2DW3A 4ZKPA 1M8OB 1NTMG 1USEA 1GW3A 1VF5B 4L74A 3NFQA 4C7RA 3GHGB 3BCCG 1BDDA 3BVHA 4RJTA 1HJ0A 4D6TG 1NKZB 1OWAA 1LTTC 3A0BH 4GODA 5KLVD 3AE2C 3W67A 1OX3A 3JCUE 3B5NC 2A06D 3H1JG 1GU4A 2Z5IA 2K9JA 1M56D 5TJHA 1GDTA 1GK6A 3CCRP 3HE4A 2OYOA 1KFMA 3MUDA 2JP3A 3H1IG 1OVRA 2H7HA 3LW5J 3A0BE 1AVOA 3CMEP 1NTKG 4HB1A 2E75D 4H0LB 1SFCC 3TNUA 1IFJA 1PV3A 3MTUE 5AVVB 2KS1A 3M0DC 4HYTB 2N1TB 1VQ6P 1H89A 2OYHC 1N7SB 1GL2C 1BE3E 3CPWO 1KD1Q 4W7YA 1L0ND 5KLIB 1H0TB 2YXRB 1IFIA 2JWAA 1HF9A 2Q6QA 1ZV8A 3H6PA 1LTIC 1PPJE 2C0WA 3GMAA 2FY8A 2WT7B 2WITA 3R2PA 4DJGA 1JEKA 4I7ZB 3GHGC 5CCGD 1LTAC 2FFDB 3D70A 4WY4D 2YKPA 5AVWB 2LKMA 3VOPA 2JR8A 3U1AA 1EC5A 3P8MC 1NTZJ 3CCJP 5CHXA 2KUBA 5KJ7A 2I1JA 2E5YA 4N78D 2RKLA 4TLFA 1GU5A 1HVVA 5APVA 2W90A 2QE7H 3RL0D 2SPZA 2OGUA 3HRNA 3IN6A 2W6BA 2D2CB 1PP9G 1JOCA 1T3JA 3RK3B 3LW5H 1HGVA 2R44A 2B89A 2Q3EA 1MV8A 2Q7CA 3TGUJ 4KT0J 2O3JA 1SQBJ 1IZNB 2I1KA 3MP7B 3VTPC 4JYCA 2M5AA 2YMKA 3AEBC 3L4FA 3V2QA 1NTZK 3L75G 3VMAA 2N9YB 1KB9H 2Y0DA 2N1TC 3L71G 3GF3A 3EFGA 1N7SC 3H1LG 1LT9C 5C39A 3KHUA 1RE4C 2WPSA 3V5BA 4HKZH 1E5WA 4ZNCA 5AVYB 1VF5D 1N73C 1SQBK 2LR2A 2O1JA 1EDIA 1G1JA 5KLIC 1L0LD 2KI7B 3CCEP 4R4MA 5AVUB 3EFFK 1SQXK 1VQ5P 1Z56A 1KB9E 4I1LA 1RY3A 2ZAEB 3D6ZA 5EFWB 2WPRA 1JMBA 1DH3A 1J2JB 1IJDB 2KNCA 2WVRA 3WUUA 4I7ZC 1SQPG 4HJGH 2GA1A 3CD6P 1BE3D 1USDA 1LP1B 3O6QB 1XTCC 3WUTA 4Z1MH 3H1KG 3HTKB 3QWOC 3VYIA 5CBNA 1PGPA 3SWYA 2R5BA 3H25A 1KC8Q 2I8DA 4H0LD 4WB4A 3CCUP 2B87B 1PPJD 1IFPA 1OW6A 2D2CC 1LTGC 1ZN5A 1SP4A 3M9BA 3RK3C 1J1DB 1NTZE 1SQQG 3CX5I 1NO4A 3HD7A 1Y8AA 2Q1KA 1NVOA 2CK3H 3L73J 3L70G 5KLVG 1NHLA 4IOIH 3WMM0 1FU1A 2QG4A 2HFED 3ITKA 3TGUE 1AA0A 1GZLA 4H13D 4EDFA 1SQBE 2R32A 5BVZA 2XU6A 3CX5H 1HGZA 4LGDE 4JF7A 5GTHH 2PP6A 1G2CA 3GG2A 1KORA 1K9MQ 3AE7C 4L75A 3VMYA 3RGUA 3AEFC 3MZWB 1VQ8P 4OVNF 1S3JA 2Z5HA 4Y99B 1RF0C 2P2UA 4M3LA 3QH9A 2W8ZA 1M90Q 3CX5E 1VQ9P 2QJPB 4UB6H 3M0AA 5E79H 5GTHE 2R3SA 2FYNB 2HR3A 2FYUJ 5CCHD 3PHLA 1Q90D 2WSFJ 3BASA 1K73Q 1DIPA 5L8RJ 4GKGA 4YXDC 1L4AA 1HTLC 1BDCA 1NYHA 1KB9D 2KP8A 4GOFA 4UB6E 3AE3C 3MIWA 5E79E 2QSIA 3OJAB 2NRGA 1FDMA 2BASA 1GMJA 3FWLA 2BCCJ 2A45I 2E75B 1J1DC 3FX0A 1BGYJ 2KIKA 2E42A 3BATA 1YHQP 1CI6A 3M9HA 3H32B 1NU1J 1JY2N 1LTSC 1YTZI 2N9BA 2C9NY 5KKZB 3SWFA 1LWUA 4XA4A 3CMAP 2Y0CA 1OVUA 1FBMA 4GDOA 3L73E 3MD0A 3RK2B 4DOJA 4OGQD 3A7OA 1NTZD 3H1HJ 5APXA 3V4QA 3F5HA 4U3FJ 1OIPA 3L72J 1KQFB 1NU1K 2PGDA 3SFDC 4Y99C 2IDBA 5AW3B 2OYIC 1BCCJ 3R4YA 5CJ4A 2HPCA 1YYCA 3TGUD 4WY4B 2WZ7A 2KK7A 1SQBD 2WSFH 1WMKA 2B88A 5APQA 1TU3F 1KFNA 1L0LG 1N2DC 3RL0B 2NPSD 1QLED 3CWBJ 1LTBC 1KILE 2RMZA 2XV5A 1JO5A 2FYUE 1YI2P 1EZVI 3CC4P 4O9BA 2NZ2A 3CCMP 4A7PA 1ZOYC 1QVFO 1X0TA 3B5NA 2IX7C 3CX5D 2YO3A 2E75C 2WTYA 2H43A 1IK9A 5AVSB 3AE4C 1CSBA 1U57A 3BCCJ 1MZ9A 4QMAA 3CXHI 2ITAA 3A2AA 5KKZC 2BCCE 3V2PA 4D6TJ 2H8PD 5AVQB 2KOGA 2JO1A 1BGYE 1RQUA 1SFCA 1NAYA 4LLHA 1S9KE 1SQVJ 1U7MA 1URQD 4K35A 3M0DA 4WBAA 5APSA 4ASVA 1NU1E 5DJTB 2OYHA 1OVVA 3PH0A 1EZVE 2KZJA 3CXHH 1GL2A 3TNUB 1VQLP 3H1IJ 2WSEJ 5AVTB 3AE9C 3M91A 2POHA 3CL3D 1T8ZA 4ZKUA 1DX7A 5CCGC 1NTKJ 3A0HH 4GIFA 1W2BO 3LIEA 4WY4C 1SQVK 4AUWA 4DZOA 3H1HE 1VQKP 1JTHA 2FYZA 4U3FE 1NOHA 3L72E 3PTZA 4BXLA 2AEJA 3L73D 3CXHE 2W6JH 1BCCE 3RL0C 2HODA 3GHGA 3WU2H 1RE3C 3Q5SA 3KXDA 1AJYA 2C0XA 1UIXA 3A0HE 4DT0A 2LXCB 2PAJA 3GF7A 3HE5B 2WQYC 2FBWC 3E1RA 1LJ2A 2V7QJ 3PLNA 3D6YA 2ZXEB 1PZQA 2IZ1A 1ZLLA 2J5UA 1K05A 3CWBE 2OTLP 1OW7A 3ZDMA 1IFDA 3WU2E 3RK2D 4ASWA 3M9QA 4H13B 2GUSA 5AW9B 4WVZA 1S4XA 2Y0EA 1KILD 1FZEA 1ZXGA 1VF5C 2FYUD 2MKVA 5BU8B 1JCDA 3S4RA 2N1TA 1FZAA 1QL2A 2KLUA 3BCCE 1M57D 2IBZG 1PP9J 2M3EA 4BRYA 1KQGB 1N7SA 1LT9A 4IL6H 2WSEH 1RE4A 4D6TE 1N73A 1AQ5A 1H0TA 1T2KD 1VQMP 2L5GB 1SQVE 3T97A 1OW8A 1KB9I 1DD4A 2BCCD 1MUUA 3L75J 1BGYD 5KAFH 1S9KD 3HUSB 1NKNA 3L71J 3H1IE 4IL6E 2HYNA 1PGJA 4H0LC 2WT7A 1RHZB 3H1LJ 1GK4A 4GT1A 1NU1D 1NTKE 1EZVD 2PRRA 3WUVA 3SSUA 4U7JA 4OWFA 4B86A 2V7QH 3CCSP 2KNCB 4UB8H 1WT6A 5KAFE 1IK7A 4EOTA 1E79H 3H1HD 2E74D 3G9RA 2KZIA 4U3FD 3M06A 3L72D 2M3BA 1SQXG 2P10A 1SQPJ 3CXHD 4GOEA 4H13C 4W80A 1BCCD 1VQ4P 2OTJP 1PGOA 3P8CE 4UB8E 1Q2NA 2QM8A 5AW4B 4OGQB 3AE5C 5CJ0A 2FFDC 3L74G 3TDKA 1OFCX 3Q3DA 1LNQA 2P7JA 1NJIQ 1KQSO 1A02J 3HD7B 1EXJA 3CWBD 1SQPK 1KQLA 2ZYDA 1GTWA 4XFJA 4PV1D 5H2FH 1SQQJ 1JY2P 4NPDA 1ZP0C 1QX8A 5CCHC 1W5CE 3L37A 4L76A 1QEXA 3L70J 1PP9E 3S9OA 1J1EB 3K5BA 1G2CB 2B9BA 3HUSC 4EYYQ 2NPSB 1CZQA 1FDIA 2Y9ZA 3BCCD 2ZT9B 1W2EA 5H2FE 4D6TD 1SQQK 5AVRB 3L75E 1LP1A 3O6QA 2V4HA 2A06G 3IFMA 3NMDA 3HTKA 4C7NA 1K04A 5KJ7D 4H44B 1M1JB 1SQVD 3L71E 3TYYA 1DEEG 1G1IA 1HBWA 3H1LE 1PL5A 4AYCA 3H1ID 1VQOP 1L4AB 3F89A 4R4LA 1NTKD 1BSHA 1CW5A 2QA4P
chains in the Genus database with same CATH topology
1URQB 4N6JA 5APQA 1KFNA 5KJ7C 3MTUE 5AVVB 3M0DC 4HYTB 5APWA 5AW8B 2N1TB 3HUSA 2A45G 1N2DC 1H89A 2KLVA 3RL0B 2NPSD 2R3CA 2OYHC 1N7SB 3CI9A 2WPQA 1LTBC 4IFFA 5APYA 1GL2C 3VMXA 2JEEA 2XV5A 1JO5A 4W7YA 2J59M 4W7ZA 1FZGA 2QM7A 4O9BA 2OARA 1IFIA 3B5NA 2IX7C 3KQGA 1ZV8A 3H6PA 2YO3A 1LTIC 3KYQA 2WTYA 1VPCA 2C0WA 2H43A 5KTBA 2FYUK 3V2NA 2YO2A 1LWUB 1IK9A 5AW5B 1PFIA 1J1EC 2CPBA 2WT7B 1IC2A 5AVSB 5APUA 2WITA 1CSBA 3R2PA 1MZ9A 2NPSC 4C7NB 2OYIA 3GHGC 5CCGD 5AW2B 1JY2O 2XDJA 2KB7P 3A2AA 1LTAC 2FFDB 3V2PA 2H8PD 5AVQB 4WY4D 2KOGA 2YKPA 5AVWB 2LKMA 1RF0A 3VOPA 1SFCA 4LLHA 3U1AA 1S9KE 1RF1A 3P8MC 1JY3P 1URQD 5CHXA 4LC1A 5KJ7A 2I1JA 3O8ZA 4N78D 3M0DA 4WBAA 1M1JC 1QL1A 2N1TD 1GU5A 2YMYA 1HVVA 5APSA 5APVA 2KYVA 1JY3O 2OYHA 3RL0D 3HRNA 1N7SD 2W6BA 3TK1A 1JOCA 1GL2A 1VDFA 3TNUB 3MGNA 1T3JA 3LW5H 3RK3B 5AVTB 1HGVA 2FXMA 3M91A 1JY3N 5KLVK 1MV8A 2POHA 2Q7CA 3CL3D 1T8ZA 2JJLA 4ZKUA 1DX7A 5CCGC 3VP8A 4GIFA 2I1KA 1KILB 3LIEA 4WY4C 3HD7D 4JYCA 3VTPC 3U1CA 1NWQA 3L4FA 3V2QA 1SQVK 1HJBA 4DZOA 4AUWA 1FJKA 1NTZK 1X79B 1JTHA 2FYZA 1FZCB 2HLOA 3A5TA 1URQC 3II6A 1NOHA 1LTJB 3VN0A 2XZRA 3NTNA 2N1TC 3H32A 3EFGA 5AW0B 2NPSA 3RL0C 2HODA 3GHGA 2O1KA 1N7SC 1LT9C 1RE4C 2WPSA 1RE3C 3V5BA 3VP9A 1KZUB 1SLQA 1E5WA 1FOSE 5AVYB 5AW6B 2C0XA 1N73C 3V2RA 1SQBK 2O1JA 1G1JA 2PAJA 2Z4EA 1SVFA 3HE5B 1GW4A 1EQ7A 5AVUB 1SQXK 2IPPA 3L35A 4AQRD 2OYIB 3HD7C 1Z56A 2ZXEB 2MJZA 1ZR2A 1M1JA 3N7NA 4I1LA 1ZLLA 1RY3A 1CI6B 2ZFCA 2WPRA 1DH3A 1IFDA 1X9VA 1J2JB 3RK3D 1M7LA 3LIDA 3RK2D 1RF1B 1L0NK 1IJDB 1HWTC 3M9QA 2E43A 1IO4A 3KPEA 3OA7A 2GUSA 3L36A 3BRTB 5CCGA 5AW9B 3P8CD 2YKOA 1YTZT 1KILD 1FZEA 4WY4A 1XTCC 2VRSA 3HTKB 1OXZA 3VYIA 3SWYA 5BU8B 1JCDA 1URQA 2R5BA 1L4AD 1AFOA 4XE5B 4I2LC 2N1TA 4WB4A 1FZFA 3HE4B 1FZAA 1QL2A 4C46A 1HH0A 3V4WA 1N7SA 1LT9A 1A02F 2WSEH 1LTGC 1RE4A 1RE3A 2XNXA 1ZN5A 5AVZB 1SP4A 1JTHB 3M9BA 3RK3C 3RK2C 1NTMK 1N73A 1X8YA 1AQ5A 2HPCB 4JYBA 2HG5D 1T2KD 3C9IA 1JUNA 2L5GB 4KHXA 4IFMA 1J1DB 3T97A 2WWWA 1NO4A 1KILC 4IFDK 2YKQA 2HODB 3HD7A 2YNYA 1MUUA 1NAFA 3U59A 2CPSA 1IFNA 3OAKA 1FZCC 1NH4A 1NHLA 1MFZA 2A45H 2WSCH 3KDPB 1S9KD 3HUSB 3WMM0 1LGHB 1FU1A 1L4AC 1LTJC 1NKNA 2HYNA 2HFED 5BU5A 2WT7A 1GZLA 1GK4A 4GT1A 2R32A 1JCCA 5BVZA 2XU6A 2R5DA 1HGZA 4LGDE 4JF7A 2M8RA 4B86A 2PP6A 1G2CA 2C9LY 3P7KA 3I5CA 4I6MC 1T2KC 3B5NB 3UIAA 2W27A 3VMYA 1H8AA 1WT6A 1T3UA 5APTA 3BRVB 3G3ZA 2XKMA 4EOTA 1NTKK 2IFNA 3A3YB 3N4XA 3CLQA 3PP5A 2Z5HA 4Y99B 1RF0C 2P2UA 4M3LA 3M06A 3TSIA 1H88A 2M3BA 2IFMA 1RF1C 4OH8B 2FKWB 3M0AA 1L0LK 2P1JA 4W80A 1N7LA 1FOSF 5CCHD 5AW1B 1SFCB 1LWUC 1KILA 4EIJA 5CMZA 2GUVA 2O01H 3P8CE 1LT9B 2QM8A 3BASA 5AW4B 1FZBA 4RESB 1FZCA 1N73B 4N3YB 1HUCA 4GKGA 3B8EB 5CJ0A 2FFDC 1L4AA 1HTLC 1LTJA 2OYHB 1WRGA 2J58A 3VMZA 1GL2B 2P7JA 2KP8A 1A02J 3HD7B 5AW7B 1ZR4A 2Q9IA 3MIWA 1SQPK 1KQLA 1DEBA 3OJAB 1GTWA 1JMMA 1FDMA 2BASA 1FJPA 3B5ND 4N78E 2Q5UA 1JY2P 2A45I 3HE5A 1XTGB 1J1DC 3IR9A 5CCHC 3L37A 5AVXB 3EQ2A 1IFMA 2E42A 1GD2E 4ZKPA 2P67A 3BATA 1GW3A 1CI6A 1J1EB 3M9HA 1G2CB 3H32B 3HUSC 3NFQA 4C7RA 2Q3IA 3E1IA 2NPSB 1JY2N 1LTSC 1CZQA 3GHGB 1YTZI 2N9BA 2C9NY 3BVHA 3NXSA 1W2EA 3SWFA 1NKZB 1OWAA 1LTTC 1SFCD 1LWUA 4XA4A 1SQQK 5AVRB 1FBMA 3IFMA 3NMDA 3B5NC 3HTKA 2GM4A 4C7NA 5KJ7D 3MD0A 3RK2B 4DOJA 1GU4A 1M1JB 2Z5IA 3A7OA 3TYYA 2FFDA 3P32A 5APXA 1G1IA 1GDTA 1HBWA 3V4QA 1GK6A 3HE4A 4HH2A 2W6AA 1GL2D 1NU1K 1KFMA 1JNMA 3MUDA 4Y99C 4AYCA 2H7HA 5AW3B 2OYIC 5CJ4A 2KSJA 2HPCA 1YYCA 1L4AB 4WY4B 1FAVA 2WZ7A 5CCHA 1N86A 2WSFH 1SFCC 3TNUA 1CW5A 1IFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VDF A;  3V2R A;  1FBM A;  1MZ9 A;  3V2P A;  1DEB A;  3V2Q A;  3V2N A; 
#chains in the Genus database with same CATH topology
 1URQ B;  4N6J A;  3Q1M A;  5AW8 B;  4OGQ C;  2FXP A;  5APW A;  1KN7 A;  4RO0 A;  4CPG A;  2A45 G;  1YJW P;  1SQP E;  2WPQ A;  3OW2 O;  5APY A;  1L0N G;  4W7Z A;  1FZG A;  1D7M A;  2OAR A;  1S72 P;  1VPC A;  3GW6 A;  5KTB A;  1S1C X;  2FYU K;  3I55 P;  2YO2 A;  1LWU B;  1J1E C;  2CPB A;  1IC2 A;  5APU A;  3AE1 C;  3G4S P;  5TIS H;  2NPS C;  3S1K A;  2OYI A;  2IYP A;  1JY2 O;  2XDJ A;  2KB7 P;  1SQQ E;  1P84 I;  3KZI H;  2YIU B;  3L70 E;  1RF1 A;  3CCV P;  1EDK A;  1RQV A;  1SS1 A;  3D71 A;  3O8Z A;  1M1J C;  1QL1 A;  2YMY A;  2E76 D;  2KYV A;  1JY3 O;  2WPV B;  2QVA A;  2H88 C;  2FXO A;  5TIS E;  4RKU J;  1PP9 D;  3MGN A;  1BGY G;  1P84 H;  2WSS H;  2FXM A;  1JY3 N;  1U7J A;  3KZI E;  4EI2 A;  3PRJ A;  3VP8 A;  1KIL B;  1JB0 J;  3HD7 D;  5DJU B;  3U1C A;  1NWQ A;  1HJB A;  3JC2 2;  1T6A A;  1FJK A;  3FWN A;  1KYO I;  1L2P A;  1EZV G;  1FZC B;  1URQ C;  3II6 A;  2QJP C;  3L75 D;  1L0L J;  1LTJ B;  2FYN C;  2WSC J;  3NTN A;  1ZRT E;  3H32 A;  1VQ7 P;  1P84 E;  1AQT A;  2O1K A;  2UWJ E;  1SLQ A;  1EXI A;  1FOS E;  3H1L D;  3Q5P A;  2QEX P;  5AW6 B;  3H1H G;  3V2R A;  1KYO H;  1GW4 A;  1EQ7 A;  2IPP A;  4AQR D;  2ZT9 D;  1ZR2 A;  3N7N A;  1VQN P;  3B71 A;  3ABV C;  2M0B A;  1OZH A;  1M7L A;  3LID A;  2Y9Y A;  4H44 D;  1IO4 A;  3V6I A;  5CCG A;  1NTM J;  1BE3 G;  3CCQ P;  1QVG O;  1SQP D;  2WMM A;  2QRX A;  1KYO E;  4WY4 A;  2YIU C;  3AEE C;  2VRS A;  1OXZ A;  3CWB G;  2PFX A;  1UII A;  3AE6 C;  2K9J B;  2O01 N;  1L4A D;  2AEM A;  2ZXX A;  1AFO A;  4XE5 B;  1PPJ G;  3HE4 B;  2E74 B;  3V4W A;  1A02 F;  1RE3 A;  3H1J J;  1JTH B;  3RK2 C;  1NTM K;  2IZ0 A;  1X8Y A;  4Y28 J;  1JUN A;  2KXP B;  4JQ0 D;  4IFM A;  1RH5 B;  4NPE A;  1QGK B;  1KIL C;  4IFD K;  2YKQ A;  2HOD B;  1SQQ D;  2YNY A;  1YJ9 P;  3CC2 P;  1NAF A;  3U59 A;  3Q2Y A;  2CPS A;  1IFN A;  3OAK A;  2KS1 B;  1FZC C;  1NH4 A;  2WSC H;  3CCL P;  2JDI H;  3L70 D;  1LTJ C;  4BWN A;  3EWK A;  3I56 P;  1ZW0 A;  1SQV G;  1R5L A;  1EDL A;  1JCC A;  2R5D A;  4IL6 X;  2M8R A;  4PV1 B;  3I5C A;  1T2K C;  2OQQ A;  2W27 A;  1L0L E;  3SFE C;  1T3U A;  1VQP P;  5APT A;  3BRV B;  4JPZ B;  3G3Z A;  1NTK K;  3A3Y B;  3PP5 A;  1S5L H;  1H88 A;  2IFM A;  3G71 P;  1S2E A;  1YJN P;  1ZRT D;  2FKW B;  2P1J A;  1P84 D;  1FOS F;  5AW1 B;  4YTP C;  4BRY B;  1KMI Z;  1LT9 B;  2K1A A;  1R8E A;  1FZB A;  1N73 B;  1HUC A;  1VL2 A;  2BEZ F;  1S5L E;  3T97 B;  3VMZ A;  2E74 C;  3FXD A;  1NTM E;  4YPC A;  1BSN A;  5AW7 B;  3MUD C;  2Q9I A;  1DEB A;  3B5N D;  4PD4 I;  2Q5U A;  3HE5 A;  1XTG B;  1YQ3 C;  2M5A B;  3C1L A;  5AVX B;  4NPF X;  1IFM A;  1KYO D;  1GD2 E;  3TF5 A;  2P67 A;  1AV1 A;  2RN0 A;  3H1J E;  1FC2 C;  2Q3I A;  3E1I A;  3GLM A;  1FDO A;  3NXS A;  3JSV C;  4PD4 H;  1SFC D;  1Y47 A;  2K9Y A;  4PV1 C;  2OTK E;  2GM4 A;  1NTZ G;  2BEQ D;  1FE6 A;  2FFD A;  3P32 A;  3AEG C;  3PJS K;  4HH2 A;  2W6A A;  1GL2 D;  2IBZ I;  1JNM A;  5KAI H;  4KJM A;  1SQX J;  4PD4 E;  3TGU G;  4YXW H;  2KSJ A;  1SQB G;  1FAV A;  5CCH A;  1N86 A;  3FGA D;  2G3A A;  1Q82 Q;  5K5G B;  2W83 C;  3RK3 E;  5KJ7 C;  3IF4 A;  3L74 J;  2ZYA A;  3HUS A;  2E76 B;  1Y9B A;  2KLV A;  2R3C A;  5KAI E;  2QJY B;  3CI9 A;  3H1K J;  2AXT H;  4IFF A;  3VMX A;  2JEE A;  2J59 M;  3AEA C;  2QM7 A;  1Q7Y Q;  3AED C;  2AEF A;  3KQG A;  1YIJ P;  2JWD A;  3KYQ A;  4ZMD A;  1NGM B;  4MN4 C;  3SWK A;  5GTI H;  2IBZ E;  4DCK A;  3V2N A;  5AW5 B;  1EDJ A;  4JBZ A;  2AXT E;  1PFI A;  4C7N B;  5AW2 B;  2IYO A;  5KLV J;  1NTM D;  3AEC C;  1RF0 A;  3RBZ A;  4L73 A;  3FXE A;  5GTI E;  1JY3 P;  3W68 A;  4LC1 A;  2N1T D;  1N7S D;  3TK1 A;  3RBX A;  2L91 A;  1VDF A;  5KLV K;  1KV4 A;  2JJL A;  3H1J D;  2QJK B;  2G8Y A;  2B87 A;  1X79 B;  2ZJS E;  3L73 G;  2HLO A;  3A5T A;  3VN0 A;  5CBO A;  2XZR A;  2ZVO B;  1SQX E;  2E76 C;  5AW0 B;  3CC7 P;  2NPS A;  2QJY C;  1L0N J;  1LT1 A;  3VP9 A;  1Q86 Q;  1KZU B;  3Q5R A;  2QIW A;  1OMI A;  2Z4E A;  1SVF A;  4PD4 D;  2ZYG A;  1R5S A;  3L35 A;  2OYI B;  3HD7 C;  3L74 E;  2MJZ A;  1M1J A;  2K37 A;  2K88 A;  3B4S A;  1CI6 B;  3H1K E;  2ZFC A;  1JM0 A;  2D2C D;  3E7K A;  1X9V A;  3RK3 D;  1RF1 B;  1L0N K;  1HWT C;  2E43 A;  3KPE A;  3OA7 A;  3G6E P;  3L36 A;  3BRT B;  3P8C D;  1ZME C;  2YKO A;  1YTZ T;  2FYU G;  1KTM A;  3C8V A;  1MKM A;  3RL0 g;  2O01 J;  3USS A;  1URQ A;  2ZT9 C;  4I2L C;  1FZF A;  4C46 A;  1HH0 A;  5M1B A;  2JKV A;  2E5T A;  5KLV E;  2IBZ D;  2KSE A;  2XNX A;  2RH0 A;  5AVZ B;  4TT3 H;  2LXB A;  2P58 A;  4H44 C;  5B5E H;  2HPC B;  1YQ4 C;  2A06 E;  4JYB A;  2HG5 D;  4WWI A;  3C9I A;  4KHX A;  2QJK C;  2BCC G;  2WWW A;  1K8A Q;  2K3R A;  1MFZ A;  2A45 H;  3KDP B;  3IAO A;  1LGH B;  1MFT A;  1L4A C;  5BU5 A;  2YXQ B;  1NU1 G;  2ZVN B;  5B5E E;  1X22 A;  1M1K Q;  2C9L Y;  3P7K A;  4I6M C;  3B5N B;  1PIX A;  3L71 D;  3UIA A;  4K3A A;  1N8R Q;  1AVY A;  1H8A A;  5B66 H;  2XKM A;  2H89 C;  2IFN A;  3N4X A;  4U3F G;  1L0N E;  3CLQ A;  3L72 G;  3TSI A;  1RF1 C;  4OH8 B;  3MHV A;  1BCC G;  1SQX D;  1L0L K;  1BE3 J;  1N7L A;  1SFC B;  1LWU C;  1KIL A;  4EIJ A;  5CMZ A;  2GUV A;  2O01 H;  5B66 E;  4PJ0 H;  1DD3 A;  4RES B;  1FZC A;  4N3Y B;  1FS0 E;  3B8E B;  1PGQ A;  1LTJ A;  2OYH B;  1Q81 Q;  1WRG A;  2J58 A;  3L74 D;  1GL2 B;  2AXC A;  1ZR4 A;  3H1K D;  1YIT P;  1JMM A;  1S5L X;  2XND H;  1YBK A;  3AE8 C;  1FJP A;  4N78 E;  4PJ0 E;  3IR9 A;  3JCU H;  3EQ2 A;  2DW3 A;  4ZKP A;  1M8O B;  1NTM G;  1USE A;  1GW3 A;  1VF5 B;  4L74 A;  3NFQ A;  4C7R A;  3GHG B;  3BCC G;  1BDD A;  3BVH A;  4RJT A;  1HJ0 A;  4D6T G;  1NKZ B;  1OWA A;  1LTT C;  3A0B H;  4GOD A;  5KLV D;  3AE2 C;  3W67 A;  1OX3 A;  3JCU E;  3B5N C;  2A06 D;  3H1J G;  1GU4 A;  2Z5I A;  2K9J A;  1M56 D;  5TJH A;  1GDT A;  1GK6 A;  3CCR P;  3HE4 A;  2OYO A;  1KFM A;  3MUD A;  2JP3 A;  3H1I G;  1OVR A;  2H7H A;  3LW5 J;  3A0B E;  1AVO A;  3CME P;  1NTK G;  4HB1 A;  2E75 D;  4H0L B;  1SFC C;  3TNU A;  1IFJ A;  1PV3 A;  3MTU E;  5AVV B;  2KS1 A;  3M0D C;  4HYT B;  2N1T B;  1VQ6 P;  1H89 A;  2OYH C;  1N7S B;  1GL2 C;  1BE3 E;  3CPW O;  1KD1 Q;  4W7Y A;  1L0N D;  5KLI B;  1H0T B;  2YXR B;  1IFI A;  2JWA A;  1HF9 A;  2Q6Q A;  1ZV8 A;  3H6P A;  1LTI C;  1PPJ E;  2C0W A;  3GMA A;  2FY8 A;  2WT7 B;  2WIT A;  3R2P A;  4DJG A;  1JEK A;  4I7Z B;  3GHG C;  5CCG D;  1LTA C;  2FFD B;  3D70 A;  4WY4 D;  2YKP A;  5AVW B;  2LKM A;  3VOP A;  2JR8 A;  3U1A A;  1EC5 A;  3P8M C;  1NTZ J;  3CCJ P;  5CHX A;  2KUB A;  5KJ7 A;  2I1J A;  2E5Y A;  4N78 D;  2RKL A;  4TLF A;  1GU5 A;  1HVV A;  5APV A;  2W90 A;  2QE7 H;  3RL0 D;  2SPZ A;  2OGU A;  3HRN A;  3IN6 A;  2W6B A;  2D2C B;  1PP9 G;  1JOC A;  1T3J A;  3RK3 B;  3LW5 H;  1HGV A;  2R44 A;  2B89 A;  2Q3E A;  1MV8 A;  2Q7C A;  3TGU J;  4KT0 J;  2O3J A;  1SQB J;  1IZN B;  2I1K A;  3MP7 B;  3VTP C;  4JYC A;  2M5A A;  2YMK A;  3AEB C;  3L4F A;  3V2Q A;  1NTZ K;  3L75 G;  3VMA A;  2N9Y B;  1KB9 H;  2Y0D A;  2N1T C;  3L71 G;  3GF3 A;  3EFG A;  1N7S C;  3H1L G;  1LT9 C;  5C39 A;  3KHU A;  1RE4 C;  2WPS A;  3V5B A;  4HKZ H;  1E5W A;  4ZNC A;  5AVY B;  1VF5 D;  1N73 C;  1SQB K;  2LR2 A;  2O1J A;  1EDI A;  1G1J A;  5KLI C;  1L0L D;  2KI7 B;  3CCE P;  4R4M A;  5AVU B;  3EFF K;  1SQX K;  1VQ5 P;  1Z56 A;  1KB9 E;  4I1L A;  1RY3 A;  2ZAE B;  3D6Z A;  5EFW B;  2WPR A;  1JMB A;  1DH3 A;  1J2J B;  1IJD B;  2KNC A;  2WVR A;  3WUU A;  4I7Z C;  1SQP G;  4HJG H;  2GA1 A;  3CD6 P;  1BE3 D;  1USD A;  1LP1 B;  3O6Q B;  1XTC C;  3WUT A;  4Z1M H;  3H1K G;  3HTK B;  3QWO C;  3VYI A;  5CBN A;  1PGP A;  3SWY A;  2R5B A;  3H25 A;  1KC8 Q;  2I8D A;  4H0L D;  4WB4 A;  3CCU P;  2B87 B;  1PPJ D;  1IFP A;  1OW6 A;  2D2C C;  1LTG C;  1ZN5 A;  1SP4 A;  3M9B A;  3RK3 C;  1J1D B;  1NTZ E;  1SQQ G;  3CX5 I;  1NO4 A;  3HD7 A;  1Y8A A;  2Q1K A;  1NVO A;  2CK3 H;  3L73 J;  3L70 G;  5KLV G;  1NHL A;  4IOI H;  3WMM 0;  1FU1 A;  2QG4 A;  2HFE D;  3ITK A;  3TGU E;  1AA0 A;  1GZL A;  4H13 D;  4EDF A;  1SQB E;  2R32 A;  5BVZ A;  2XU6 A;  3CX5 H;  1HGZ A;  4LGD E;  4JF7 A;  5GTH H;  2PP6 A;  1G2C A;  3GG2 A;  1KOR A;  1K9M Q;  3AE7 C;  4L75 A;  3VMY A;  3RGU A;  3AEF C;  3MZW B;  1VQ8 P;  4OVN F;  1S3J A;  2Z5H A;  4Y99 B;  1RF0 C;  2P2U A;  4M3L A;  3QH9 A;  2W8Z A;  1M90 Q;  3CX5 E;  1VQ9 P;  2QJP B;  4UB6 H;  3M0A A;  5E79 H;  5GTH E;  2R3S A;  2FYN B;  2HR3 A;  2FYU J;  5CCH D;  3PHL A;  1Q90 D;  2WSF J;  3BAS A;  1K73 Q;  1DIP A;  5L8R J;  4GKG A;  4YXD C;  1L4A A;  1HTL C;  1BDC A;  1NYH A;  1KB9 D;  2KP8 A;  4GOF A;  4UB6 E;  3AE3 C;  3MIW A;  5E79 E;  2QSI A;  3OJA B;  2NRG A;  1FDM A;  2BAS A;  1GMJ A;  3FWL A;  2BCC J;  2A45 I;  2E75 B;  1J1D C;  3FX0 A;  1BGY J;  2KIK A;  2E42 A;  3BAT A;  1YHQ P;  1CI6 A;  3M9H A;  3H32 B;  1NU1 J;  1JY2 N;  1LTS C;  1YTZ I;  2N9B A;  2C9N Y;  5KKZ B;  3SWF A;  1LWU A;  4XA4 A;  3CMA P;  2Y0C A;  1OVU A;  1FBM A;  4GDO A;  3L73 E;  3MD0 A;  3RK2 B;  4DOJ A;  4OGQ D;  3A7O A;  1NTZ D;  3H1H J;  5APX A;  3V4Q A;  3F5H A;  4U3F J;  1OIP A;  3L72 J;  1KQF B;  1NU1 K;  2PGD A;  3SFD C;  4Y99 C;  2IDB A;  5AW3 B;  2OYI C;  1BCC J;  3R4Y A;  5CJ4 A;  2HPC A;  1YYC A;  3TGU D;  4WY4 B;  2WZ7 A;  2KK7 A;  1SQB D;  2WSF H;  1WMK A;  2B88 A;  5APQ A;  1TU3 F;  1KFN A;  1L0L G;  1N2D C;  3RL0 B;  2NPS D;  1QLE D;  3CWB J;  1LTB C;  1KIL E;  2RMZ A;  2XV5 A;  1JO5 A;  2FYU E;  1YI2 P;  1EZV I;  3CC4 P;  4O9B A;  2NZ2 A;  3CCM P;  4A7P A;  1ZOY C;  1QVF O;  1X0T A;  3B5N A;  2IX7 C;  3CX5 D;  2YO3 A;  2E75 C;  2WTY A;  2H43 A;  1IK9 A;  5AVS B;  3AE4 C;  1CSB A;  1U57 A;  3BCC J;  1MZ9 A;  4QMA A;  3CXH I;  2ITA A;  3A2A A;  5KKZ C;  2BCC E;  3V2P A;  4D6T J;  2H8P D;  5AVQ B;  2KOG A;  2JO1 A;  1BGY E;  1RQU A;  1SFC A;  1NAY A;  4LLH A;  1S9K E;  1SQV J;  1U7M A;  1URQ D;  4K35 A;  3M0D A;  4WBA A;  5APS A;  4ASV A;  1NU1 E;  5DJT B;  2OYH A;  1OVV A;  3PH0 A;  1EZV E;  2KZJ A;  3CXH H;  1GL2 A;  3TNU B;  1VQL P;  3H1I J;  2WSE J;  5AVT B;  3AE9 C;  3M91 A;  2POH A;  3CL3 D;  1T8Z A;  4ZKU A;  1DX7 A;  5CCG C;  1NTK J;  3A0H H;  4GIF A;  1W2B O;  3LIE A;  4WY4 C;  1SQV K;  4AUW A;  4DZO A;  3H1H E;  1VQK P;  1JTH A;  2FYZ A;  4U3F E;  1NOH A;  3L72 E;  3PTZ A;  4BXL A;  2AEJ A;  3L73 D;  3CXH E;  2W6J H;  1BCC E;  3RL0 C;  2HOD A;  3GHG A;  3WU2 H;  1RE3 C;  3Q5S A;  3KXD A;  1AJY A;  2C0X A;  1UIX A;  3A0H E;  4DT0 A;  2LXC B;  2PAJ A;  3GF7 A;  3HE5 B;  2WQY C;  2FBW C;  3E1R A;  1LJ2 A;  2V7Q J;  3PLN A;  3D6Y A;  2ZXE B;  1PZQ A;  2IZ1 A;  1ZLL A;  2J5U A;  1K05 A;  3CWB E;  2OTL P;  1OW7 A;  3ZDM A;  1IFD A;  3WU2 E;  3RK2 D;  4ASW A;  3M9Q A;  4H13 B;  2GUS A;  5AW9 B;  4WVZ A;  1S4X A;  2Y0E A;  1KIL D;  1FZE A;  1ZXG A;  1VF5 C;  2FYU D;  2MKV A;  5BU8 B;  1JCD A;  3S4R A;  2N1T A;  1FZA A;  1QL2 A;  2KLU A;  3BCC E;  1M57 D;  2IBZ G;  1PP9 J;  2M3E A;  4BRY A;  1KQG B;  1N7S A;  1LT9 A;  4IL6 H;  2WSE H;  1RE4 A;  4D6T E;  1N73 A;  1AQ5 A;  1H0T A;  1T2K D;  1VQM P;  2L5G B;  1SQV E;  3T97 A;  1OW8 A;  1KB9 I;  1DD4 A;  2BCC D;  1MUU A;  3L75 J;  1BGY D;  5KAF H;  1S9K D;  3HUS B;  1NKN A;  3L71 J;  3H1I E;  4IL6 E;  2HYN A;  1PGJ A;  4H0L C;  2WT7 A;  1RHZ B;  3H1L J;  1GK4 A;  4GT1 A;  1NU1 D;  1NTK E;  1EZV D;  2PRR A;  3WUV A;  3SSU A;  4U7J A;  4OWF A;  4B86 A;  2V7Q H;  3CCS P;  2KNC B;  4UB8 H;  1WT6 A;  5KAF E;  1IK7 A;  4EOT A;  1E79 H;  3H1H D;  2E74 D;  3G9R A;  2KZI A;  4U3F D;  3M06 A;  3L72 D;  2M3B A;  1SQX G;  2P10 A;  1SQP J;  3CXH D;  4GOE A;  4H13 C;  4W80 A;  1BCC D;  1VQ4 P;  2OTJ P;  1PGO A;  3P8C E;  4UB8 E;  1Q2N A;  2QM8 A;  5AW4 B;  4OGQ B;  3AE5 C;  5CJ0 A;  2FFD C;  3L74 G;  3TDK A;  1OFC X;  3Q3D A;  1LNQ A;  2P7J A;  1NJI Q;  1KQS O;  1A02 J;  3HD7 B;  1EXJ A;  3CWB D;  1SQP K;  1KQL A;  2ZYD A;  1GTW A;  4XFJ A;  4PV1 D;  5H2F H;  1SQQ J;  1JY2 P;  4NPD A;  1ZP0 C;  1QX8 A;  5CCH C;  1W5C E;  3L37 A;  4L76 A;  1QEX A;  3L70 J;  1PP9 E;  3S9O A;  1J1E B;  3K5B A;  1G2C B;  2B9B A;  3HUS C;  4EYY Q;  2NPS B;  1CZQ A;  1FDI A;  2Y9Z A;  3BCC D;  2ZT9 B;  1W2E A;  5H2F E;  4D6T D;  1SQQ K;  5AVR B;  3L75 E;  1LP1 A;  3O6Q A;  2V4H A;  2A06 G;  3IFM A;  3NMD A;  3HTK A;  4C7N A;  1K04 A;  5KJ7 D;  4H44 B;  1M1J B;  1SQV D;  3L71 E;  3TYY A;  1DEE G;  1G1I A;  1HBW A;  3H1L E;  1PL5 A;  4AYC A;  3H1I D;  1VQO P;  1L4A B;  3F89 A;  4R4L A;  1NTK D;  1BSH A;  1CW5 A;  2QA4 P; 
#chains in the Genus database with same CATH homology
 1URQ B;  4N6J A;  5APQ A;  1KFN A;  5KJ7 C;  3MTU E;  5AVV B;  3M0D C;  4HYT B;  5APW A;  5AW8 B;  2N1T B;  3HUS A;  2A45 G;  1N2D C;  1H89 A;  2KLV A;  3RL0 B;  2NPS D;  2R3C A;  2OYH C;  1N7S B;  3CI9 A;  2WPQ A;  1LTB C;  4IFF A;  5APY A;  1GL2 C;  3VMX A;  2JEE A;  2XV5 A;  1JO5 A;  4W7Y A;  2J59 M;  4W7Z A;  1FZG A;  2QM7 A;  4O9B A;  2OAR A;  1IFI A;  3B5N A;  2IX7 C;  3KQG A;  1ZV8 A;  3H6P A;  2YO3 A;  1LTI C;  3KYQ A;  2WTY A;  1VPC A;  2C0W A;  2H43 A;  5KTB A;  2FYU K;  3V2N A;  2YO2 A;  1LWU B;  1IK9 A;  5AW5 B;  1PFI A;  1J1E C;  2CPB A;  2WT7 B;  1IC2 A;  5AVS B;  5APU A;  2WIT A;  1CSB A;  3R2P A;  1MZ9 A;  2NPS C;  4C7N B;  2OYI A;  3GHG C;  5CCG D;  5AW2 B;  1JY2 O;  2XDJ A;  2KB7 P;  3A2A A;  1LTA C;  2FFD B;  3V2P A;  2H8P D;  5AVQ B;  4WY4 D;  2KOG A;  2YKP A;  5AVW B;  2LKM A;  1RF0 A;  3VOP A;  1SFC A;  4LLH A;  3U1A A;  1S9K E;  1RF1 A;  3P8M C;  1JY3 P;  1URQ D;  5CHX A;  4LC1 A;  5KJ7 A;  2I1J A;  3O8Z A;  4N78 D;  3M0D A;  4WBA A;  1M1J C;  1QL1 A;  2N1T D;  1GU5 A;  2YMY A;  1HVV A;  5APS A;  5APV A;  2KYV A;  1JY3 O;  2OYH A;  3RL0 D;  3HRN A;  1N7S D;  2W6B A;  3TK1 A;  1JOC A;  1GL2 A;  1VDF A;  3TNU B;  3MGN A;  1T3J A;  3LW5 H;  3RK3 B;  5AVT B;  1HGV A;  2FXM A;  3M91 A;  1JY3 N;  5KLV K;  1MV8 A;  2POH A;  2Q7C A;  3CL3 D;  1T8Z A;  2JJL A;  4ZKU A;  1DX7 A;  5CCG C;  3VP8 A;  4GIF A;  2I1K A;  1KIL B;  3LIE A;  4WY4 C;  3HD7 D;  4JYC A;  3VTP C;  3U1C A;  1NWQ A;  3L4F A;  3V2Q A;  1SQV K;  1HJB A;  4DZO A;  4AUW A;  1FJK A;  1NTZ K;  1X79 B;  1JTH A;  2FYZ A;  1FZC B;  2HLO A;  3A5T A;  1URQ C;  3II6 A;  1NOH A;  1LTJ B;  3VN0 A;  2XZR A;  3NTN A;  2N1T C;  3H32 A;  3EFG A;  5AW0 B;  2NPS A;  3RL0 C;  2HOD A;  3GHG A;  2O1K A;  1N7S C;  1LT9 C;  1RE4 C;  2WPS A;  1RE3 C;  3V5B A;  3VP9 A;  1KZU B;  1SLQ A;  1E5W A;  1FOS E;  5AVY B;  5AW6 B;  2C0X A;  1N73 C;  3V2R A;  1SQB K;  2O1J A;  1G1J A;  2PAJ A;  2Z4E A;  1SVF A;  3HE5 B;  1GW4 A;  1EQ7 A;  5AVU B;  1SQX K;  2IPP A;  3L35 A;  4AQR D;  2OYI B;  3HD7 C;  1Z56 A;  2ZXE B;  2MJZ A;  1ZR2 A;  1M1J A;  3N7N A;  4I1L A;  1ZLL A;  1RY3 A;  1CI6 B;  2ZFC A;  2WPR A;  1DH3 A;  1IFD A;  1X9V A;  1J2J B;  3RK3 D;  1M7L A;  3LID A;  3RK2 D;  1RF1 B;  1L0N K;  1IJD B;  1HWT C;  3M9Q A;  2E43 A;  1IO4 A;  3KPE A;  3OA7 A;  2GUS A;  3L36 A;  3BRT B;  5CCG A;  5AW9 B;  3P8C D;  2YKO A;  1YTZ T;  1KIL D;  1FZE A;  4WY4 A;  1XTC C;  2VRS A;  3HTK B;  1OXZ A;  3VYI A;  3SWY A;  5BU8 B;  1JCD A;  1URQ A;  2R5B A;  1L4A D;  1AFO A;  4XE5 B;  4I2L C;  2N1T A;  4WB4 A;  1FZF A;  3HE4 B;  1FZA A;  1QL2 A;  4C46 A;  1HH0 A;  3V4W A;  1N7S A;  1LT9 A;  1A02 F;  2WSE H;  1LTG C;  1RE4 A;  1RE3 A;  2XNX A;  1ZN5 A;  5AVZ B;  1SP4 A;  1JTH B;  3M9B A;  3RK3 C;  3RK2 C;  1NTM K;  1N73 A;  1X8Y A;  1AQ5 A;  2HPC B;  4JYB A;  2HG5 D;  1T2K D;  3C9I A;  1JUN A;  2L5G B;  4KHX A;  4IFM A;  1J1D B;  3T97 A;  2WWW A;  1NO4 A;  1KIL C;  4IFD K;  2YKQ A;  2HOD B;  3HD7 A;  2YNY A;  1MUU A;  1NAF A;  3U59 A;  2CPS A;  1IFN A;  3OAK A;  1FZC C;  1NH4 A;  1NHL A;  1MFZ A;  2A45 H;  2WSC H;  3KDP B;  1S9K D;  3HUS B;  3WMM 0;  1LGH B;  1FU1 A;  1L4A C;  1LTJ C;  1NKN A;  2HYN A;  2HFE D;  5BU5 A;  2WT7 A;  1GZL A;  1GK4 A;  4GT1 A;  2R32 A;  1JCC A;  5BVZ A;  2XU6 A;  2R5D A;  1HGZ A;  4LGD E;  4JF7 A;  2M8R A;  4B86 A;  2PP6 A;  1G2C A;  2C9L Y;  3P7K A;  3I5C A;  4I6M C;  1T2K C;  3B5N B;  3UIA A;  2W27 A;  3VMY A;  1H8A A;  1WT6 A;  1T3U A;  5APT A;  3BRV B;  3G3Z A;  2XKM A;  4EOT A;  1NTK K;  2IFN A;  3A3Y B;  3N4X A;  3CLQ A;  3PP5 A;  2Z5H A;  4Y99 B;  1RF0 C;  2P2U A;  4M3L A;  3M06 A;  3TSI A;  1H88 A;  2M3B A;  2IFM A;  1RF1 C;  4OH8 B;  2FKW B;  3M0A A;  1L0L K;  2P1J A;  4W80 A;  1N7L A;  1FOS F;  5CCH D;  5AW1 B;  1SFC B;  1LWU C;  1KIL A;  4EIJ A;  5CMZ A;  2GUV A;  2O01 H;  3P8C E;  1LT9 B;  2QM8 A;  3BAS A;  5AW4 B;  1FZB A;  4RES B;  1FZC A;  1N73 B;  4N3Y B;  1HUC A;  4GKG A;  3B8E B;  5CJ0 A;  2FFD C;  1L4A A;  1HTL C;  1LTJ A;  2OYH B;  1WRG A;  2J58 A;  3VMZ A;  1GL2 B;  2P7J A;  2KP8 A;  1A02 J;  3HD7 B;  5AW7 B;  1ZR4 A;  2Q9I A;  3MIW A;  1SQP K;  1KQL A;  1DEB A;  3OJA B;  1GTW A;  1JMM A;  1FDM A;  2BAS A;  1FJP A;  3B5N D;  4N78 E;  2Q5U A;  1JY2 P;  2A45 I;  3HE5 A;  1XTG B;  1J1D C;  3IR9 A;  5CCH C;  3L37 A;  5AVX B;  3EQ2 A;  1IFM A;  2E42 A;  1GD2 E;  4ZKP A;  2P67 A;  3BAT A;  1GW3 A;  1CI6 A;  1J1E B;  3M9H A;  1G2C B;  3H32 B;  3HUS C;  3NFQ A;  4C7R A;  2Q3I A;  3E1I A;  2NPS B;  1JY2 N;  1LTS C;  1CZQ A;  3GHG B;  1YTZ I;  2N9B A;  2C9N Y;  3BVH A;  3NXS A;  1W2E A;  3SWF A;  1NKZ B;  1OWA A;  1LTT C;  1SFC D;  1LWU A;  4XA4 A;  1SQQ K;  5AVR B;  1FBM A;  3IFM A;  3NMD A;  3B5N C;  3HTK A;  2GM4 A;  4C7N A;  5KJ7 D;  3MD0 A;  3RK2 B;  4DOJ A;  1GU4 A;  1M1J B;  2Z5I A;  3A7O A;  3TYY A;  2FFD A;  3P32 A;  5APX A;  1G1I A;  1GDT A;  1HBW A;  3V4Q A;  1GK6 A;  3HE4 A;  4HH2 A;  2W6A A;  1GL2 D;  1NU1 K;  1KFM A;  1JNM A;  3MUD A;  4Y99 C;  4AYC A;  2H7H A;  5AW3 B;  2OYI C;  5CJ4 A;  2KSJ A;  2HPC A;  1YYC A;  1L4A B;  4WY4 B;  1FAV A;  2WZ7 A;  5CCH A;  1N86 A;  2WSF H;  1SFC C;  3TNU A;  1CW5 A;  1IFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...