3V2QA

Compcc in complex with fatty acids
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
45
structure length
45
Chain Sequence
MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The pentameric channel of COMPcc in complex with different fatty acids.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Cartilage Oligomerization matrix protein (coiled-coil domain
total genus 18
structure length 45
sequence length 45
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.10 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3v2qA00
3V2RA 1FBMA 1VDFA 1MZ9A 3V2NA 3V2PA 3V2QA 1DEBA
chains in the Genus database with same CATH superfamily
3P8CE 2XU6A 4XE5B 1N7LA 3AEBC 5CJ0A 3AE7C 3PLNA 3RBXA 1N86A 1PGQA 2K3RA 3B5NB 5APTA 3W68A 4HJGH 1NTKK 1YHQP 1KILE 2IBZD 3K5BA 1LWUB 1N7SD 1G1JA 5KKZB 4IFFA 2OYOA 2IYOA 3H1ID 5KLVK 3L37A 1NGMB 1ZMEC 2WT7B 3BVHA 3RK2B 3Q3DA 3M9HA 2WSFJ 4Z1MH 1HJ0A 4ZMDA 1JY2O 1JM0A 1L4AB 3VMXA 2WPQA 3V2NA 1PGJA 3H1HJ 2W90A 2JR8A 2V7QH 1JY3O 2PGDA 2WVRA 1USDA 3KHUA 2FYUG 2O01J 3TYYA 2YIUB 1RF1C 5CCGA 3B5ND 1BCCJ 4IL6X 3L74G 5APVA 2V7QJ 3AECC 3O6QB 4A7PA 2E76D 2QJPB 2N9BA 5AVVB 2M3BA 2FYUK 4NPEA 3BCCJ 3L4FA 4GDOA 4DJGA 3BRTB 1LP1A 3MZWB 4WVZA 3S1KA 2H88C 3EFFK 1IFDA 1YYCA 3H1KG 1NOHA 3KZIE 2LKMA 3MUDA 4O9BA 3RL0g 3ZDMA 1HJBA 1FOSE 3II6A 1N73B 3CMEP 4C7NB 3HE5A 2OYIA 2YO3A 3D6YA 1SQQE 1ZP0C 1SQBK 4IL6H 1IJDB 1HF9A 2JEEA 4BRYA 1UIIA 1GMJA 3FXEA 1IFIA 1S5LH 2OTJP 1BE3G 1VQLP 3PP5A 1J1DB 4C46A 2CPSA 2K37A 1KILC 5APYA 2FXPA 2IFNA 2R3SA 1TU3F 2ZXXA 4DT0A 2P67A 4PV1C 1VQ9P 5DJUB 1AJYA 3KZIH 1L0LD 3E7KA 4GIFA 3V4QA 4H13C 2K1AA 3GG2A 1NWQA 1SLQA 1M1JA 2HPCB 3RL0C 4CPGA 4I7ZB 2OYIB 1LTBC 3R4YA 1YITP 1M1KQ 2HFED 2N9YB 4D6TD 1L0NE 3RK3C 1SVFA 3OW2O 1VQ5P 1H0TA 3MHVA 4N6JA 3WUTA 1SFCC 2O01H 1QVGO 3L35A 4PV1B 2J58A 2FYZA 3P8MC 2KYVA 2OARA 5KJ7C 1KYOI 1NH4A 2OYIC 3HD7D 1J1DC 1KQFB 1OZHA 2IBZG 2A06G 1RF0A 2Y0CA 4C7RA 2I1JA 1P84D 2Y9ZA 2OYHA 5AW1B 1KB9D 1NTME 3H1IJ 2NPSB 1KQSO 1SQQK 2B88A 4LLHA 1LGHB 1RF1B 5BVZA 1A02J 1AVOA 1L0NG 1L0LE 2RMZA 4RO0A 5AVRB 1L0NJ 2AXCA 1JMMA 1ZN5A 2LXBA 4W80A 3P8CD 4R4LA 3L73G 3H1IG 2YMKA 3LW5J 2V4HA 2QEXP 2WPVB 3AEEC 2C9LY 3HE5B 4YXWH 5BU5A 5KAIH 2M5AB 3FWLA 1IFNA 2KP8A 1IK9A 1JY3P 1PP9G 2OGUA 4GT1A 4U3FD 2WTYA 3HE4B 3AE8C 2CPBA 1PL5A 2ZYAA 4HYTB 5GTIH 1JO5A 5K5GB 3JSVC 2A06D 2KNCB 1VQNP 4WY4B 1CZQA 3CWBG 1JNMA 5KTBA 1GD2E 2A45H 2E75D 2Q3EA 2W6BA 1DEBA 2FKWB 3AE1C 3L71J 1LTIC 3KYQA 2IDBA 2FBWC 2KZJA 1T3UA 3CCRP 1PP9E 3U59A 2Q5UA 1YJWP 3V2QA 1VQ4P 3PTZA 2BCCG 1JY2N 3O8ZA 4I6MC 1SQBE 3Q1MA 3HUSB 4N3YB 3D71A 3TF5A 2WSFH 3L71E 3V2PA 1LWUC 1OW8A 2M8RA 1SP4A 1BDDA 2IBZI 3CWBE 2Y0EA 3GLMA 1BE3D 5APQA 3G9RA 2ZT9C 1NU1J 3L75D 3ABVC 4H0LB 4ASWA 1JMBA 4R4MA 2K88A 2QM8A 4IL6E 1GK6A 3B4SA 1N7SA 4DCKA 1RE3A 1SQPK 1K04A 1HGZA 3L70J 1CSBA 1MFTA 3CXHD 3NTNA 2Q9IA 2YKPA 1QX8A 3L71G 1PV3A 2NPSD 5AVTB 1WRGA 3BCCG 3LW5H 3OAKA 4YXDC 2WMMA 3U1CA 1HWTC 2WPRA 3P32A 3CWBJ 2NPSA 1KILA 5H2FE 3V6IA 3CLQA 1LT9C 3L74J 1RF1A 1IC2A 1SQBD 3C8VA 4K35A 1BGYE 1AQTA 1NTMG 2LXCB 2POHA 4NPDA 4AUWA 2D2CC 3CMAP 3L75G 3BATA 1UIXA 2QJYB 2IFMA 3M9BA 1SFCB 1R5SA 1SQVJ 1YQ3C 2WSCJ 3WMM0 1OFCX 1NJIQ 1P84H 2NRGA 1E5WA 5EFWB 1L0ND 1H8AA 1Q82Q 5AVUB 3AEDC 2W6AA 1KFNA 1IK7A 4XA4A 1URQC 1GTWA 1M56D 1FZEA 1ZV8A 1ZXGA 1AFOA 2HLOA 2KSJA 3CX5I 3IFMA 1LT1A 4H13B 4LC1A 4WWIA 1M90Q 3CCUP 2SPZA 3FX0A 1Y8AA 1EZVG 2MKVA 3LIEA 1L0LK 2YO2A 2PP6A 3C1LA 1NTMD 5AVSB 3GMAA 1YBKA 1S5LE 1Q2NA 2D2CB 3C9IA 1R8EA 1EXJA 4EDFA 5CCGC 2PRRA 3G4SP 3WUUA 5B5EH 2XV5A 2HODB 2P10A 2RH0A 2K9YA 3A0BH 1N8RQ 1LT9B 4MN4C 1HVVA 2WZ7A 1OX3A 1GL2B 4BWNA 1KB9E 1PPJE 3H1LJ 3JC22 2JDIH 4GOFA 1H88A 1RH5B 1URQD 1H0TB 3H1HD 3TSIA 5KAFH 3CCMP 3QH9A 1KYOE 1ZRTD 3T97A 4WY4A 1U57A 4UB6E 5AW7B 3CD6P 3MD0A 2HR3A 3T97B 3D6ZA 1BCCD 1QGKB 3CX5E 1EC5A 3PJSK 1JY2P 3WU2E 1BE3J 2ZT9D 2QJKC 2FXOA 3NMDA 3TGUJ 1CW5A 1AV1A 5CCHC 1JTHA 3CCEP 1X79B 3RL0D 1SQPJ 4PD4D 1M1JB 5AVZB 2WSCH 3BCCE 3MIWA 4JPZB 3I56P 2P1JA 2DW3A 3H1JJ 2R3CA 1FOSF 5GTHE 5AW2B 2AEFA 1L4AC 1KILD 2IBZE 1NTKD 1VQMP 2L5GB 2KLUA 1M8OB 1KORA 2GM4A 1PIXA 3FXDA 2IZ1A 3L75E 1EZVI 2MJZA 4JF7A 1L0LG 2BEZF 3BCCD 1OVVA 4DZOA 5CHXA 2KOGA 2J5UA 2ZAEB 2E42A 1SQQG 2FY8A 1NYHA 1VL2A 2FYUJ 5APSA 1ZLLA 3M0AA 4H0LC 4PD4E 4QMAA 5CJ4A 2YXRB 2QSIA 1X8YA 1DD4A 1VPCA 1T2KC 1ZR2A 1URQA 2XNXA 3GW6A 1FZGA 1BDCA 3B8EB 1WMKA 3H1KD 4I1LA 1GL2A 2KK7A 3Q5SA 2HG5D 3USSA 3VMAA 4ZKUA 4OH8B 3RK2C 1AVYA 3B71A 1FDIA 3VMZA 2Q1KA 1FAVA 1VQPP 4KJMA 2OYHC 1PFIA 1RF0C 3L73D 1OW7A 1JCCA 2E5TA 1D7MA 2WSEH 3I55P 1N73A 1T6AA 1LTTC 3M9QA 2XNDH 1VQKP 2I1KA 1SQXE 2XZRA 4IFDK 3A0HH 1PP9D 2B89A 3RGUA 1EDJA 3L72D 1AQ5A 2JJLA 2CK3H 3M91A 4UB8H 1FU1A 2YMYA 2QE7H 3TNUB 1OMIA 3VOPA 2M0BA 2QJYC 4M3LA 1IZNB 2WWWA 2KXPB 1LTJC 1QLED 2N1TB 4UB8E 2G8YA 3BASA 1NAFA 2P2UA 2FXMA 4PV1D 5TISE 1P84I 1SQPD 3L70E 4OGQB 3VYIA 1USEA 2IZ0A 1LTJB 1RE4C 1IFJA 1DD3A 2AXTH 1SQQJ 2UWJE 2WITA 2YKQA 3AEFC 3JCUH 3N7NA 4NPFX 4OVNF 4W7YA 4B86A 1N73C 3HTKB 1X9VA 3A7OA 4AQRD 1NTKG 1BGYJ 1VF5D 3CX5D 3RK3D 4D6TE 5CCHA 3RK3B 1K9MQ 2B9BA 3A5TA 1L0LJ 3CC4P 1RQUA 3OJAB 1NTZD 4WBAA 1M7LA 1NTMK 3P7KA 3IF4A 3L70G 2KSEA 1R5LA 1HUCA 3GF7A 4LGDE 1SQXK 4K3AA 3VP8A 5KKZC 4D6TJ 1FZFA 3SFDC 3AE3C 1IFMA 2BCCE 4JYBA 1BSHA 3A3YB 4HB1A 3SWKA 2K9JA 1J1EC 4IFMA 1EZVE 3SWYA 2H43A 1OXZA 1EDKA 3WU2H 5AW0B 2Q7CA 1AA0A 3TGUG 4JQ0D 1S3JA 2YKOA 1W2BO 2BCCJ 2H7HA 2E43A 3HRNA 5APWA 2QM7A 1FS0E 5BU8B 1FZBA 5KJ7D 3V5BA 4WY4C 2Z5HA 3CXHE 5KAFE 2FFDB 3TNUA 2Z4EA 1NAYA 2HODA 3CCLP 1KB9H 2E76B 5KLIC 3CC7P 1S4XA 2QG4A 3CC2P 2KIKA 1SQXG 5L8RJ 5CCHD 3B5NC 3RBZA 1N7SC 3A0HE 2HPCA 1HBWA 1GU5A 3OA7A 2E76C 1VF5C 2H89C 1PPJD 1RQVA 2QJPC 2W8ZA 3ITKA 4U7JA 1Y47A 4H13D 1S9KE 1XTGB 1YQ4C 1EZVD 1PP9J 2KI7B 2Q3IA 2Q6QA 3CWBD 3FWNA 1YJ9P 1LTGC 5B66E 3WUVA 1S2EA 1Q86Q 4YTPC 3L72G 2E5YA 4GOEA 2C9NY 4PJ0H 3SFEC 2FFDA 1BCCE 3F89A 1KQGB 3MP7B 1FZCA 1WT6A 2AEMA 4N78E 4EIJA 1SFCD 2WQYC 3EQ2A 2BASA 3L71D 4U3FG 5AW3B 1FDMA 1SQVD 4H44D 1KMIZ 1YTZT 1K05A 1M1JC 2FYNC 1KV4A 3HD7A 3KPEA 4OGQD 2B87B 4AYCA 1DH3A 4XFJA 2PFXA 2QJKB 3G71P 1DIPA 2B87A 3S9OA 3L72E 1SQVG 3QWOC 1S9KD 1RY3A 5GTIE 3HE4A 1RE4A 1OWAA 4PJ0E 3M0DA 3L75J 3CCVP 2J59M 5B66H 4IOIH 3TDKA 5KLVG 2E74D 2W6JH 1FBMA 1IFPA 1NTMJ 2GA1A 4KHXA 1NTZJ 5E79E 1CI6B 1Z56A 1FZAA 2C0XA 2O1KA 3KQGA 1SQXJ 2R5DA 4PD4I 5AW8B 1QL2A 2RKLA 3H32A 1Y9BA 2WSSH 1PPJG 2WPSA 3L70D 1GL2C 3RK2D 3U1AA 3VTPC 2ZXEB 3MUDC 4ASVA 3CPWO 1Q81Q 1GU4A 3AE6C 1SQVE 4C7NA 1YI2P 4TLFA 1JY3N 3R2PA 1HH0A 1NU1K 1VQ6P 3TGUE 1SS1A 2GUVA 3AE2C 3L74D 1HTLC 1RHZB 3CXHH 4L76A 4GODA 5C39A 4EI2A 1T2KD 3GHGA 1OVRA 1JB0J 2C0WA 3H6PA 4RESB 1L2PA 3JCUE 5E79H 1VQOP 1NU1G 2AXTE 3CXHI 2HYNA 4JBZA 4PD4H 1OVUA 5APUA 1U7MA 2ITAA 3NFQA 3A2AA 1URQB 2P7JA 1BSNA 1M57D 2L91A 2ZJSE 4I7ZC 4WB4A 3TGUD 5TJHA 3G6EP 3GF3A 1EDIA 1LT9A 1PGOA 1H89A 4L75A 2ZVNB 1VDFA 2KB7P 3H1HE 1E79H 2VRSA 2IX7C 1KYOD 2KS1A 2QRXA 1YTZI 1JEKA 1L4AA 1LTSC 4L73A 1KILB 1NU1E 2D2CD 1VQ7P 2M5AA 2BEQD 2OTLP 1NKZB 1W2EA 1L4AD 1NTKJ 3MGNA 1SQVK 5CMZA 3V2RA 5GTHH 1VQ8P 1BCCG 3Q5RA 1DX7A 1NTZG 1YJNP 3GHGB 3F5HA 1ZR4A 4BRYB 1LWUA 3I5CA 4U3FE 5KLVJ 3NXSA 4RKUJ 1CI6A 3Q5PA 4HKZH 1NO4A 2JP3A 2ZYGA 2G3AA 3FGAD 2ZYDA 2A45G 2A06E 3H1HG 2W83C 1GDTA 1NU1D 3H1JE 1KN7A 5AVQB 4KT0J 3UIAA 1VF5B 2KS1B 2NZ2A 3N4XA 3H32B 5TISH 4H0LD 1QVFO 1LP1B 1MZ9A 1SQPE 1OIPA 3H1KE 1NTKE 1LTJA 2WSEJ 3L73J 3MTUE 5AW5B 3V4WA 1KD1Q 1NVOA 1JTHB 2ZT9B 2Y9YA 1ZW0A 3BRVB 3H1IE 4TT3H 4Y99C 5CBNA 5KLIB 4U3FJ 1JOCA 3G3ZA 2FFDC 4ZNCA 1QEXA 2R5BA 1A02F 4ZKPA 2FYNB 4W7ZA 2YIUC 3HUSC 2M3EA 4N78D 3L72J 1FJPA 1S1CX 1NTZK 3M0DC 2N1TD 3M06A 1FZCB 4JYCA 1EXIA 1BE3E 1KB9I 1NHLA 3A0BE 4EOTA 5M1BA 3CCJP 1SQXD 3TK1A 1J2JB 1IO4A 2XDJA 2QA4P 2W27A 3CCQP 1GL2D 3E1IA 3H1JD 5AVYB 5H2FH 1JUNA 2Y0DA 3S4RA 1S5LX 4RJTA 3H25A 4BXLA 5AW4B 1KFMA 1GW4A 3SSUA 2WT7A 1LTAC 2JWDA 2P58A 3AE5C 1NKNA 1K8AQ 1T3JA 3KDPB 4I2LC 5AW6B 3EWKA 1FJKA 2JO1A 2JWAA 2ZFCA 4Y28J 1PZQA 4Y99B 5AW9B 1N7SB 3D70A 1SQBG 1EQ7A 1KZUB 3E1RA 1MKMA 3CCSP 1Q7YQ 1BGYD 2E74B 3CL3D 1KTMA 1SFCA 2A45I 2FYUD 2RN0A 2XKMA 1PGPA 2KUBA 5KJ7A 3AEGC 1KC8Q 1EDLA 1G2CA 1MV8A 2E75B 3HUSA 3IAOA 5APXA 2QIWA 1DEEG 1X22A 2H8PD 3CI9A 1Q90D 1G2CB 2O1JA 3CX5H 3GHGC 3HD7B 2NPSC 3L36A 3O6QA 2KZIA 4L74A 4WY4D 2O01N 2QVAA 3KXDA 1NTZE 4OWFA 1SQQD 4D6TG 3H1KJ 1GZLA 1X0TA 3L73E 2R32A 1J1EB 3HD7C 4H44B 2FYUE 1OW6A 2N1TC 1KYOH 2E75C 5CCGD 2OQQA 1MFZA 1RE3C 1XTCC 2YNYA 3L74E 3H1JG 3PH0A 1S72P 3EFGA 1FDOA 1T8ZA 2BCCD 1BGYG 2E74C 2KNCA 5KLVD 2LR2A 3LIDA 1K73Q 1GW3A 2KLVA 3Q2YA 1GK4A 1FC2C 1LNQA 1SQPG 2GUSA 1L0NK 1ZRTE 3VN0A 4DOJA 3H1LE 5B5EE 3RL0B 5KAIE 1FE6A 2AEJA 2ZVOB 2IYPA 1MUUA 2IPPA 1SQBJ 2JKVA 1W5CE 2R44A 5KLVE 1YIJP 2OYHB 1JCDA 5DJTB 3B5NA 2Z5IA 4H44C 4EYYQ 3HTKA 3SWFA 1N2DC 1ZOYC 1KQLA 4OGQC 2N1TA 4UB6H 3AE4C 2I8DA 3IN6A 3IR9A 3H1LG 4YPCA 5AVWB 3VP9A 3VMYA 1FZCC 1P84E 2OTKE 4GKGA 3RK3E 1LJ2A 3W67A 5CBOA 3AE9C 1QL1A 3AEAC 2K9JB 2PAJA 1HGVA 1U7JA 2YXQB 3PHLA 2O3JA 3PRJA 3H1LD 4HH2A 5AVXB 1G1IA
chains in the Genus database with same CATH topology
3P8CE 2XU6A 4XE5B 1N7LA 5CJ0A 1N86A 3B5NB 5APTA 1NTKK 1LWUB 1N7SD 1G1JA 4IFFA 5KLVK 3L37A 2WT7B 3BVHA 3RK2B 3M9HA 1JY2O 1L4AB 3VMXA 2WPQA 3V2NA 1JY3O 3TYYA 5CCGA 3B5ND 5APVA 5AVVB 2N9BA 2M3BA 2FYUK 3L4FA 3BRTB 4O9BA 1IFDA 1YYCA 3MUDA 1NOHA 2LKMA 1HJBA 1FOSE 3II6A 1N73B 4C7NB 3HE5A 2OYIA 2YO3A 1SQBK 1IJDB 2JEEA 1IFIA 3PP5A 1J1DB 4C46A 2CPSA 5APYA 1KILC 2IFNA 2P67A 4GIFA 3V4QA 1NWQA 1SLQA 1M1JA 2HPCB 3RL0C 2OYIB 1LTBC 2HFED 3RK3C 1SVFA 4N6JA 1SFCC 2O01H 3L35A 2J58A 2FYZA 3P8MC 2KYVA 2OARA 5KJ7C 1NH4A 3HD7D 1J1DC 5CCHA 2OYHA 1RF0A 4C7RA 2I1JA 5AW1B 2NPSB 1RF1B 1SQQK 4LLHA 1LGHB 5BVZA 5AVRB 1JMMA 1ZN5A 4W80A 3P8CD 2C9LY 3HE5B 5BU5A 1IFNA 2KP8A 1IK9A 1JY3P 4GT1A 2WTYA 3HE4B 2CPBA 4HYTB 1JO5A 4WY4B 1CZQA 1JNMA 5KTBA 1GD2E 2A45H 2W6BA 1DEBA 2FKWB 1LTIC 3KYQA 1T3UA 3U59A 2Q5UA 3V2QA 4I6MC 1JY2N 3O8ZA 3HUSB 4N3YB 2WSFH 3V2PA 1LWUC 2M8RA 1SP4A 5APQA 2QM8A 1GK6A 1N7SA 1RE3A 1SQPK 1HGZA 1CSBA 3NTNA 2YKPA 5AVTB 2NPSD 1WRGA 3U1CA 3LW5H 3OAKA 1HWTC 2WPRA 3P32A 2NPSA 1KILA 1RF1A 3CLQA 1LT9C 1IC2A 2POHA 4AUWA 3BATA 2IFMA 3M9BA 1SFCB 3WMM0 1E5WA 1H8AA 5AVUB 2W6AA 1KFNA 4XA4A 1URQC 1FZEA 1ZV8A 1AFOA 2HLOA 2KSJA 3IFMA 4LC1A 3LIEA 1L0LK 2YO2A 2PP6A 5AVSB 3C9IA 5CCGC 2XV5A 2HODB 1LT9B 1HVVA 2WZ7A 1GL2B 1H88A 1URQD 3TSIA 3T97A 4WY4A 5AW7B 3MD0A 1JY2P 3NMDA 1CW5A 5CCHC 1JTHA 1X79B 3RL0D 1M1JB 5AVZB 2WSCH 3MIWA 2P1JA 2R3CA 1FOSF 5AW2B 1L4AC 1KILD 2L5GB 2GM4A 2MJZA 4JF7A 4DZOA 5CHXA 2KOGA 2E42A 5CJ4A 1ZLLA 3M0AA 1X8YA 1VPCA 1T2KC 1ZR2A 1URQA 2XNXA 1FZGA 3B8EB 4I1LA 1GL2A 2HG5D 4ZKUA 4OH8B 3RK2C 3VMZA 1FAVA 1PFIA 2OYHC 1RF0C 1JCCA 2WSEH 1N73A 3M9QA 1LTTC 4IFDK 2I1KA 2XZRA 1AQ5A 2JJLA 3M91A 1FU1A 2YMYA 3TNUB 3VOPA 4M3LA 2WWWA 1LTJC 2N1TB 3BASA 1NAFA 2P2UA 2FXMA 1LTJB 1RE4C 1IFJA 2WITA 3N7NA 1A02J 2YKQA 1N73C 4B86A 4W7YA 3HTKB 1X9VA 3A7OA 4AQRD 3RK3D 3RK3B 3A5TA 3OJAB 4WBAA 1M7LA 1NTMK 3P7KA 4LGDE 1HUCA 1SQXK 3VP8A 1FZFA 4JYBA 1IFMA 3A3YB 1J1EC 4IFMA 3SWYA 2H43A 1OXZA 5AW0B 2Q7CA 2YKOA 2H7HA 2E43A 3HRNA 5APWA 2QM7A 5BU8B 1FZBA 5KJ7D 3V5BA 4WY4C 2Z5HA 2FFDB 3TNUA 2Z4EA 2HODA 5CCHD 3B5NC 1HBWA 1N7SC 1GU5A 3OA7A 1S9KE 1XTGB 2Q3IA 1LTGC 2C9NY 2FFDA 1FZCA 1WT6A 4N78E 4EIJA 1SFCD 3EQ2A 2BASA 5AW3B 1FDMA 1YTZT 1M1JC 3HD7A 3KPEA 4AYCA 1DH3A 1S9KD 1RY3A 3HE4A 1RE4A 1OWAA 3M0DA 2J59M 5APSA 4KHXA 1FBMA 1CI6B 1Z56A 1FZAA 2C0XA 2O1KA 3KQGA 2R5DA 5AW8B 2Q9IA 1GTWA 1QL2A 3H32A 3RK2D 3U1AA 2WPSA 3VTPC 1GL2C 2ZXEB 1GU4A 4C7NA 1JY3N 3R2PA 1HH0A 1NU1K 2GUVA 1HTLC 1T2KD 3GHGA 2C0WA 3H6PA 4RESB 2HYNA 5APUA 3NFQA 3A2AA 1URQB 2P7JA 2OYIC 4WB4A 1LT9A 1H89A 1VDFA 2KB7P 2VRSA 2IX7C 1YTZI 1L4AA 1LTSC 1KILB 1NKZB 1W2EA 3MGNA 1L4AD 3V2RA 1SQVK 5CMZA 1DX7A 3GHGB 1ZR4A 1LWUA 3I5CA 3NXSA 1CI6A 1NO4A 1GDTA 2A45G 5AVQB 3UIAA 3N4XA 3H32B 1MZ9A 3V4WA 1LTJA 3MTUE 5AW5B 1JTHB 3BRVB 4Y99C 1JOCA 3G3ZA 2FFDC 2R5BA 1A02F 4ZKPA 4W7ZA 3HUSC 4N78D 1FJPA 3M0DC 1NTZK 1FZCB 2N1TD 3M06A 4JYCA 1NHLA 4EOTA 3TK1A 1J2JB 1IO4A 2XDJA 2W27A 1JUNA 1GL2D 3E1IA 5AVYB 5AW4B 1KFMA 1GW4A 2WT7A 1LTAC 1NKNA 1T3JA 3KDPB 4I2LC 5AW6B 1FJKA 2ZFCA 4Y99B 5AW9B 1N7SB 1KZUB 1EQ7A 3CL3D 1SFCA 2A45I 2XKMA 5KJ7A 1G2CA 1MV8A 3HUSA 5APXA 3HD7B 2H8PD 3CI9A 2O1JA 1G2CB 3VYIA 3L36A 3GHGC 4WY4D 2NPSC 1RF1C 1GZLA 2R32A 1J1EB 3HD7C 5CCGD 2N1TC 1MFZA 1RE3C 1XTCC 2YNYA 2HPCA 3EFGA 1T8ZA 3LIDA 1GW3A 2KLVA 1GK4A 2GUSA 4DOJA 3VN0A 1L0NK 3RL0B 1MUUA 2IPPA 2OYHB 1JCDA 3B5NA 2Z5IA 3HTKA 3SWFA 1N2DC 1KQLA 2N1TA 3IR9A 5AVWB 3VP9A 3VMYA 1FZCC 4GKGA 1QL1A 2PAJA 1HGVA 4HH2A 5AVXB 1G1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V2R A;  1FBM A;  1VDF A;  1MZ9 A;  3V2N A;  3V2P A;  3V2Q A;  1DEB A; 
#chains in the Genus database with same CATH topology
 3P8C E;  2XU6 A;  4XE5 B;  1N7L A;  3AEB C;  5CJ0 A;  3AE7 C;  3PLN A;  3RBX A;  1N86 A;  1PGQ A;  2K3R A;  3B5N B;  5APT A;  3W68 A;  4HJG H;  1NTK K;  1YHQ P;  1KIL E;  2IBZ D;  3K5B A;  1LWU B;  1N7S D;  1G1J A;  5KKZ B;  4IFF A;  2OYO A;  2IYO A;  3H1I D;  5KLV K;  3L37 A;  1NGM B;  1ZME C;  2WT7 B;  3BVH A;  3RK2 B;  3Q3D A;  3M9H A;  2WSF J;  4Z1M H;  1HJ0 A;  4ZMD A;  1JY2 O;  1JM0 A;  1L4A B;  3VMX A;  2WPQ A;  3V2N A;  1PGJ A;  3H1H J;  2W90 A;  2JR8 A;  2V7Q H;  1JY3 O;  2PGD A;  2WVR A;  1USD A;  3KHU A;  2FYU G;  2O01 J;  3TYY A;  2YIU B;  1RF1 C;  5CCG A;  3B5N D;  1BCC J;  4IL6 X;  3L74 G;  5APV A;  2V7Q J;  3AEC C;  3O6Q B;  4A7P A;  2E76 D;  2QJP B;  2N9B A;  5AVV B;  2M3B A;  2FYU K;  4NPE A;  3BCC J;  3L4F A;  4GDO A;  4DJG A;  3BRT B;  1LP1 A;  3MZW B;  4WVZ A;  3S1K A;  2H88 C;  3EFF K;  1IFD A;  1YYC A;  3H1K G;  1NOH A;  3KZI E;  2LKM A;  3MUD A;  4O9B A;  3RL0 g;  3ZDM A;  1HJB A;  1FOS E;  3II6 A;  1N73 B;  3CME P;  4C7N B;  3HE5 A;  2OYI A;  2YO3 A;  3D6Y A;  1SQQ E;  1ZP0 C;  1SQB K;  4IL6 H;  1IJD B;  1HF9 A;  2JEE A;  4BRY A;  1UII A;  1GMJ A;  3FXE A;  1IFI A;  1S5L H;  2OTJ P;  1BE3 G;  1VQL P;  3PP5 A;  1J1D B;  4C46 A;  2CPS A;  2K37 A;  1KIL C;  5APY A;  2FXP A;  2IFN A;  2R3S A;  1TU3 F;  2ZXX A;  4DT0 A;  2P67 A;  4PV1 C;  1VQ9 P;  5DJU B;  1AJY A;  3KZI H;  1L0L D;  3E7K A;  4GIF A;  3V4Q A;  4H13 C;  2K1A A;  3GG2 A;  1NWQ A;  1SLQ A;  1M1J A;  2HPC B;  3RL0 C;  4CPG A;  4I7Z B;  2OYI B;  1LTB C;  3R4Y A;  1YIT P;  1M1K Q;  2HFE D;  2N9Y B;  4D6T D;  1L0N E;  3RK3 C;  1SVF A;  3OW2 O;  1VQ5 P;  1H0T A;  3MHV A;  4N6J A;  3WUT A;  1SFC C;  2O01 H;  1QVG O;  3L35 A;  4PV1 B;  2J58 A;  2FYZ A;  3P8M C;  2KYV A;  2OAR A;  5KJ7 C;  1KYO I;  1NH4 A;  2OYI C;  3HD7 D;  1J1D C;  1KQF B;  1OZH A;  2IBZ G;  2A06 G;  1RF0 A;  2Y0C A;  4C7R A;  2I1J A;  1P84 D;  2Y9Z A;  2OYH A;  5AW1 B;  1KB9 D;  1NTM E;  3H1I J;  2NPS B;  1KQS O;  1SQQ K;  2B88 A;  4LLH A;  1LGH B;  1RF1 B;  5BVZ A;  1A02 J;  1AVO A;  1L0N G;  1L0L E;  2RMZ A;  4RO0 A;  5AVR B;  1L0N J;  2AXC A;  1JMM A;  1ZN5 A;  2LXB A;  4W80 A;  3P8C D;  4R4L A;  3L73 G;  3H1I G;  2YMK A;  3LW5 J;  2V4H A;  2QEX P;  2WPV B;  3AEE C;  2C9L Y;  3HE5 B;  4YXW H;  5BU5 A;  5KAI H;  2M5A B;  3FWL A;  1IFN A;  2KP8 A;  1IK9 A;  1JY3 P;  1PP9 G;  2OGU A;  4GT1 A;  4U3F D;  2WTY A;  3HE4 B;  3AE8 C;  2CPB A;  1PL5 A;  2ZYA A;  4HYT B;  5GTI H;  1JO5 A;  5K5G B;  3JSV C;  2A06 D;  2KNC B;  1VQN P;  4WY4 B;  1CZQ A;  3CWB G;  1JNM A;  5KTB A;  1GD2 E;  2A45 H;  2E75 D;  2Q3E A;  2W6B A;  1DEB A;  2FKW B;  3AE1 C;  3L71 J;  1LTI C;  3KYQ A;  2IDB A;  2FBW C;  2KZJ A;  1T3U A;  3CCR P;  1PP9 E;  3U59 A;  2Q5U A;  1YJW P;  3V2Q A;  1VQ4 P;  3PTZ A;  2BCC G;  1JY2 N;  3O8Z A;  4I6M C;  1SQB E;  3Q1M A;  3HUS B;  4N3Y B;  3D71 A;  3TF5 A;  2WSF H;  3L71 E;  3V2P A;  1LWU C;  1OW8 A;  2M8R A;  1SP4 A;  1BDD A;  2IBZ I;  3CWB E;  2Y0E A;  3GLM A;  1BE3 D;  5APQ A;  3G9R A;  2ZT9 C;  1NU1 J;  3L75 D;  3ABV C;  4H0L B;  4ASW A;  1JMB A;  4R4M A;  2K88 A;  2QM8 A;  4IL6 E;  1GK6 A;  3B4S A;  1N7S A;  4DCK A;  1RE3 A;  1SQP K;  1K04 A;  1HGZ A;  3L70 J;  1CSB A;  1MFT A;  3CXH D;  3NTN A;  2Q9I A;  2YKP A;  1QX8 A;  3L71 G;  1PV3 A;  2NPS D;  5AVT B;  1WRG A;  3BCC G;  3LW5 H;  3OAK A;  4YXD C;  2WMM A;  3U1C A;  1HWT C;  2WPR A;  3P32 A;  3CWB J;  2NPS A;  1KIL A;  5H2F E;  3V6I A;  3CLQ A;  1LT9 C;  3L74 J;  1RF1 A;  1IC2 A;  1SQB D;  3C8V A;  4K35 A;  1BGY E;  1AQT A;  1NTM G;  2LXC B;  2POH A;  4NPD A;  4AUW A;  2D2C C;  3CMA P;  3L75 G;  3BAT A;  1UIX A;  2QJY B;  2IFM A;  3M9B A;  1SFC B;  1R5S A;  1SQV J;  1YQ3 C;  2WSC J;  3WMM 0;  1OFC X;  1NJI Q;  1P84 H;  2NRG A;  1E5W A;  5EFW B;  1L0N D;  1H8A A;  1Q82 Q;  5AVU B;  3AED C;  2W6A A;  1KFN A;  1IK7 A;  4XA4 A;  1URQ C;  1GTW A;  1M56 D;  1FZE A;  1ZV8 A;  1ZXG A;  1AFO A;  2HLO A;  2KSJ A;  3CX5 I;  3IFM A;  1LT1 A;  4H13 B;  4LC1 A;  4WWI A;  1M90 Q;  3CCU P;  2SPZ A;  3FX0 A;  1Y8A A;  1EZV G;  2MKV A;  3LIE A;  1L0L K;  2YO2 A;  2PP6 A;  3C1L A;  1NTM D;  5AVS B;  3GMA A;  1YBK A;  1S5L E;  1Q2N A;  2D2C B;  3C9I A;  1R8E A;  1EXJ A;  4EDF A;  5CCG C;  2PRR A;  3G4S P;  3WUU A;  5B5E H;  2XV5 A;  2HOD B;  2P10 A;  2RH0 A;  2K9Y A;  3A0B H;  1N8R Q;  1LT9 B;  4MN4 C;  1HVV A;  2WZ7 A;  1OX3 A;  1GL2 B;  4BWN A;  1KB9 E;  1PPJ E;  3H1L J;  3JC2 2;  2JDI H;  4GOF A;  1H88 A;  1RH5 B;  1URQ D;  1H0T B;  3H1H D;  3TSI A;  5KAF H;  3CCM P;  3QH9 A;  1KYO E;  1ZRT D;  3T97 A;  4WY4 A;  1U57 A;  4UB6 E;  5AW7 B;  3CD6 P;  3MD0 A;  2HR3 A;  3T97 B;  3D6Z A;  1BCC D;  1QGK B;  3CX5 E;  1EC5 A;  3PJS K;  1JY2 P;  3WU2 E;  1BE3 J;  2ZT9 D;  2QJK C;  2FXO A;  3NMD A;  3TGU J;  1CW5 A;  1AV1 A;  5CCH C;  1JTH A;  3CCE P;  1X79 B;  3RL0 D;  1SQP J;  4PD4 D;  1M1J B;  5AVZ B;  2WSC H;  3BCC E;  3MIW A;  4JPZ B;  3I56 P;  2P1J A;  2DW3 A;  3H1J J;  2R3C A;  1FOS F;  5GTH E;  5AW2 B;  2AEF A;  1L4A C;  1KIL D;  2IBZ E;  1NTK D;  1VQM P;  2L5G B;  2KLU A;  1M8O B;  1KOR A;  2GM4 A;  1PIX A;  3FXD A;  2IZ1 A;  3L75 E;  1EZV I;  2MJZ A;  4JF7 A;  1L0L G;  2BEZ F;  3BCC D;  1OVV A;  4DZO A;  5CHX A;  2KOG A;  2J5U A;  2ZAE B;  2E42 A;  1SQQ G;  2FY8 A;  1NYH A;  1VL2 A;  2FYU J;  5APS A;  1ZLL A;  3M0A A;  4H0L C;  4PD4 E;  4QMA A;  5CJ4 A;  2YXR B;  2QSI A;  1X8Y A;  1DD4 A;  1VPC A;  1T2K C;  1ZR2 A;  1URQ A;  2XNX A;  3GW6 A;  1FZG A;  1BDC A;  3B8E B;  1WMK A;  3H1K D;  4I1L A;  1GL2 A;  2KK7 A;  3Q5S A;  2HG5 D;  3USS A;  3VMA A;  4ZKU A;  4OH8 B;  3RK2 C;  1AVY A;  3B71 A;  1FDI A;  3VMZ A;  2Q1K A;  1FAV A;  1VQP P;  4KJM A;  2OYH C;  1PFI A;  1RF0 C;  3L73 D;  1OW7 A;  1JCC A;  2E5T A;  1D7M A;  2WSE H;  3I55 P;  1N73 A;  1T6A A;  1LTT C;  3M9Q A;  2XND H;  1VQK P;  2I1K A;  1SQX E;  2XZR A;  4IFD K;  3A0H H;  1PP9 D;  2B89 A;  3RGU A;  1EDJ A;  3L72 D;  1AQ5 A;  2JJL A;  2CK3 H;  3M91 A;  4UB8 H;  1FU1 A;  2YMY A;  2QE7 H;  3TNU B;  1OMI A;  3VOP A;  2M0B A;  2QJY C;  4M3L A;  1IZN B;  2WWW A;  2KXP B;  1LTJ C;  1QLE D;  2N1T B;  4UB8 E;  2G8Y A;  3BAS A;  1NAF A;  2P2U A;  2FXM A;  4PV1 D;  5TIS E;  1P84 I;  1SQP D;  3L70 E;  4OGQ B;  3VYI A;  1USE A;  2IZ0 A;  1LTJ B;  1RE4 C;  1IFJ A;  1DD3 A;  2AXT H;  1SQQ J;  2UWJ E;  2WIT A;  2YKQ A;  3AEF C;  3JCU H;  3N7N A;  4NPF X;  4OVN F;  4W7Y A;  4B86 A;  1N73 C;  3HTK B;  1X9V A;  3A7O A;  4AQR D;  1NTK G;  1BGY J;  1VF5 D;  3CX5 D;  3RK3 D;  4D6T E;  5CCH A;  3RK3 B;  1K9M Q;  2B9B A;  3A5T A;  1L0L J;  3CC4 P;  1RQU A;  3OJA B;  1NTZ D;  4WBA A;  1M7L A;  1NTM K;  3P7K A;  3IF4 A;  3L70 G;  2KSE A;  1R5L A;  1HUC A;  3GF7 A;  4LGD E;  1SQX K;  4K3A A;  3VP8 A;  5KKZ C;  4D6T J;  1FZF A;  3SFD C;  3AE3 C;  1IFM A;  2BCC E;  4JYB A;  1BSH A;  3A3Y B;  4HB1 A;  3SWK A;  2K9J A;  1J1E C;  4IFM A;  1EZV E;  3SWY A;  2H43 A;  1OXZ A;  1EDK A;  3WU2 H;  5AW0 B;  2Q7C A;  1AA0 A;  3TGU G;  4JQ0 D;  1S3J A;  2YKO A;  1W2B O;  2BCC J;  2H7H A;  2E43 A;  3HRN A;  5APW A;  2QM7 A;  1FS0 E;  5BU8 B;  1FZB A;  5KJ7 D;  3V5B A;  4WY4 C;  2Z5H A;  3CXH E;  5KAF E;  2FFD B;  3TNU A;  2Z4E A;  1NAY A;  2HOD A;  3CCL P;  1KB9 H;  2E76 B;  5KLI C;  3CC7 P;  1S4X A;  2QG4 A;  3CC2 P;  2KIK A;  1SQX G;  5L8R J;  5CCH D;  3B5N C;  3RBZ A;  1N7S C;  3A0H E;  2HPC A;  1HBW A;  1GU5 A;  3OA7 A;  2E76 C;  1VF5 C;  2H89 C;  1PPJ D;  1RQV A;  2QJP C;  2W8Z A;  3ITK A;  4U7J A;  1Y47 A;  4H13 D;  1S9K E;  1XTG B;  1YQ4 C;  1EZV D;  1PP9 J;  2KI7 B;  2Q3I A;  2Q6Q A;  3CWB D;  3FWN A;  1YJ9 P;  1LTG C;  5B66 E;  3WUV A;  1S2E A;  1Q86 Q;  4YTP C;  3L72 G;  2E5Y A;  4GOE A;  2C9N Y;  4PJ0 H;  3SFE C;  2FFD A;  1BCC E;  3F89 A;  1KQG B;  3MP7 B;  1FZC A;  1WT6 A;  2AEM A;  4N78 E;  4EIJ A;  1SFC D;  2WQY C;  3EQ2 A;  2BAS A;  3L71 D;  4U3F G;  5AW3 B;  1FDM A;  1SQV D;  4H44 D;  1KMI Z;  1YTZ T;  1K05 A;  1M1J C;  2FYN C;  1KV4 A;  3HD7 A;  3KPE A;  4OGQ D;  2B87 B;  4AYC A;  1DH3 A;  4XFJ A;  2PFX A;  2QJK B;  3G71 P;  1DIP A;  2B87 A;  3S9O A;  3L72 E;  1SQV G;  3QWO C;  1S9K D;  1RY3 A;  5GTI E;  3HE4 A;  1RE4 A;  1OWA A;  4PJ0 E;  3M0D A;  3L75 J;  3CCV P;  2J59 M;  5B66 H;  4IOI H;  3TDK A;  5KLV G;  2E74 D;  2W6J H;  1FBM A;  1IFP A;  1NTM J;  2GA1 A;  4KHX A;  1NTZ J;  5E79 E;  1CI6 B;  1Z56 A;  1FZA A;  2C0X A;  2O1K A;  3KQG A;  1SQX J;  2R5D A;  4PD4 I;  5AW8 B;  1QL2 A;  2RKL A;  3H32 A;  1Y9B A;  2WSS H;  1PPJ G;  2WPS A;  3L70 D;  1GL2 C;  3RK2 D;  3U1A A;  3VTP C;  2ZXE B;  3MUD C;  4ASV A;  3CPW O;  1Q81 Q;  1GU4 A;  3AE6 C;  1SQV E;  4C7N A;  1YI2 P;  4TLF A;  1JY3 N;  3R2P A;  1HH0 A;  1NU1 K;  1VQ6 P;  3TGU E;  1SS1 A;  2GUV A;  3AE2 C;  3L74 D;  1HTL C;  1RHZ B;  3CXH H;  4L76 A;  4GOD A;  5C39 A;  4EI2 A;  1T2K D;  3GHG A;  1OVR A;  1JB0 J;  2C0W A;  3H6P A;  4RES B;  1L2P A;  3JCU E;  5E79 H;  1VQO P;  1NU1 G;  2AXT E;  3CXH I;  2HYN A;  4JBZ A;  4PD4 H;  1OVU A;  5APU A;  1U7M A;  2ITA A;  3NFQ A;  3A2A A;  1URQ B;  2P7J A;  1BSN A;  1M57 D;  2L91 A;  2ZJS E;  4I7Z C;  4WB4 A;  3TGU D;  5TJH A;  3G6E P;  3GF3 A;  1EDI A;  1LT9 A;  1PGO A;  1H89 A;  4L75 A;  2ZVN B;  1VDF A;  2KB7 P;  3H1H E;  1E79 H;  2VRS A;  2IX7 C;  1KYO D;  2KS1 A;  2QRX A;  1YTZ I;  1JEK A;  1L4A A;  1LTS C;  4L73 A;  1KIL B;  1NU1 E;  2D2C D;  1VQ7 P;  2M5A A;  2BEQ D;  2OTL P;  1NKZ B;  1W2E A;  1L4A D;  1NTK J;  3MGN A;  1SQV K;  5CMZ A;  3V2R A;  5GTH H;  1VQ8 P;  1BCC G;  3Q5R A;  1DX7 A;  1NTZ G;  1YJN P;  3GHG B;  3F5H A;  1ZR4 A;  4BRY B;  1LWU A;  3I5C A;  4U3F E;  5KLV J;  3NXS A;  4RKU J;  1CI6 A;  3Q5P A;  4HKZ H;  1NO4 A;  2JP3 A;  2ZYG A;  2G3A A;  3FGA D;  2ZYD A;  2A45 G;  2A06 E;  3H1H G;  2W83 C;  1GDT A;  1NU1 D;  3H1J E;  1KN7 A;  5AVQ B;  4KT0 J;  3UIA A;  1VF5 B;  2KS1 B;  2NZ2 A;  3N4X A;  3H32 B;  5TIS H;  4H0L D;  1QVF O;  1LP1 B;  1MZ9 A;  1SQP E;  1OIP A;  3H1K E;  1NTK E;  1LTJ A;  2WSE J;  3L73 J;  3MTU E;  5AW5 B;  3V4W A;  1KD1 Q;  1NVO A;  1JTH B;  2ZT9 B;  2Y9Y A;  1ZW0 A;  3BRV B;  3H1I E;  4TT3 H;  4Y99 C;  5CBN A;  5KLI B;  4U3F J;  1JOC A;  3G3Z A;  2FFD C;  4ZNC A;  1QEX A;  2R5B A;  1A02 F;  4ZKP A;  2FYN B;  4W7Z A;  2YIU C;  3HUS C;  2M3E A;  4N78 D;  3L72 J;  1FJP A;  1S1C X;  1NTZ K;  3M0D C;  2N1T D;  3M06 A;  1FZC B;  4JYC A;  1EXI A;  1BE3 E;  1KB9 I;  1NHL A;  3A0B E;  4EOT A;  5M1B A;  3CCJ P;  1SQX D;  3TK1 A;  1J2J B;  1IO4 A;  2XDJ A;  2QA4 P;  2W27 A;  3CCQ P;  1GL2 D;  3E1I A;  3H1J D;  5AVY B;  5H2F H;  1JUN A;  2Y0D A;  3S4R A;  1S5L X;  4RJT A;  3H25 A;  4BXL A;  5AW4 B;  1KFM A;  1GW4 A;  3SSU A;  2WT7 A;  1LTA C;  2JWD A;  2P58 A;  3AE5 C;  1NKN A;  1K8A Q;  1T3J A;  3KDP B;  4I2L C;  5AW6 B;  3EWK A;  1FJK A;  2JO1 A;  2JWA A;  2ZFC A;  4Y28 J;  1PZQ A;  4Y99 B;  5AW9 B;  1N7S B;  3D70 A;  1SQB G;  1EQ7 A;  1KZU B;  3E1R A;  1MKM A;  3CCS P;  1Q7Y Q;  1BGY D;  2E74 B;  3CL3 D;  1KTM A;  1SFC A;  2A45 I;  2FYU D;  2RN0 A;  2XKM A;  1PGP A;  2KUB A;  5KJ7 A;  3AEG C;  1KC8 Q;  1EDL A;  1G2C A;  1MV8 A;  2E75 B;  3HUS A;  3IAO A;  5APX A;  2QIW A;  1DEE G;  1X22 A;  2H8P D;  3CI9 A;  1Q90 D;  1G2C B;  2O1J A;  3CX5 H;  3GHG C;  3HD7 B;  2NPS C;  3L36 A;  3O6Q A;  2KZI A;  4L74 A;  4WY4 D;  2O01 N;  2QVA A;  3KXD A;  1NTZ E;  4OWF A;  1SQQ D;  4D6T G;  3H1K J;  1GZL A;  1X0T A;  3L73 E;  2R32 A;  1J1E B;  3HD7 C;  4H44 B;  2FYU E;  1OW6 A;  2N1T C;  1KYO H;  2E75 C;  5CCG D;  2OQQ A;  1MFZ A;  1RE3 C;  1XTC C;  2YNY A;  3L74 E;  3H1J G;  3PH0 A;  1S72 P;  3EFG A;  1FDO A;  1T8Z A;  2BCC D;  1BGY G;  2E74 C;  2KNC A;  5KLV D;  2LR2 A;  3LID A;  1K73 Q;  1GW3 A;  2KLV A;  3Q2Y A;  1GK4 A;  1FC2 C;  1LNQ A;  1SQP G;  2GUS A;  1L0N K;  1ZRT E;  3VN0 A;  4DOJ A;  3H1L E;  5B5E E;  3RL0 B;  5KAI E;  1FE6 A;  2AEJ A;  2ZVO B;  2IYP A;  1MUU A;  2IPP A;  1SQB J;  2JKV A;  1W5C E;  2R44 A;  5KLV E;  1YIJ P;  2OYH B;  1JCD A;  5DJT B;  3B5N A;  2Z5I A;  4H44 C;  4EYY Q;  3HTK A;  3SWF A;  1N2D C;  1ZOY C;  1KQL A;  4OGQ C;  2N1T A;  4UB6 H;  3AE4 C;  2I8D A;  3IN6 A;  3IR9 A;  3H1L G;  4YPC A;  5AVW B;  3VP9 A;  3VMY A;  1FZC C;  1P84 E;  2OTK E;  4GKG A;  3RK3 E;  1LJ2 A;  3W67 A;  5CBO A;  3AE9 C;  1QL1 A;  3AEA C;  2K9J B;  2PAJ A;  1HGV A;  1U7J A;  2YXQ B;  3PHL A;  2O3J A;  3PRJ A;  3H1L D;  4HH2 A;  5AVX B;  1G1I A; 
#chains in the Genus database with same CATH homology
 3P8C E;  2XU6 A;  4XE5 B;  1N7L A;  5CJ0 A;  1N86 A;  3B5N B;  5APT A;  1NTK K;  1LWU B;  1N7S D;  1G1J A;  4IFF A;  5KLV K;  3L37 A;  2WT7 B;  3BVH A;  3RK2 B;  3M9H A;  1JY2 O;  1L4A B;  3VMX A;  2WPQ A;  3V2N A;  1JY3 O;  3TYY A;  5CCG A;  3B5N D;  5APV A;  5AVV B;  2N9B A;  2M3B A;  2FYU K;  3L4F A;  3BRT B;  4O9B A;  1IFD A;  1YYC A;  3MUD A;  1NOH A;  2LKM A;  1HJB A;  1FOS E;  3II6 A;  1N73 B;  4C7N B;  3HE5 A;  2OYI A;  2YO3 A;  1SQB K;  1IJD B;  2JEE A;  1IFI A;  3PP5 A;  1J1D B;  4C46 A;  2CPS A;  5APY A;  1KIL C;  2IFN A;  2P67 A;  4GIF A;  3V4Q A;  1NWQ A;  1SLQ A;  1M1J A;  2HPC B;  3RL0 C;  2OYI B;  1LTB C;  2HFE D;  3RK3 C;  1SVF A;  4N6J A;  1SFC C;  2O01 H;  3L35 A;  2J58 A;  2FYZ A;  3P8M C;  2KYV A;  2OAR A;  5KJ7 C;  1NH4 A;  3HD7 D;  1J1D C;  5CCH A;  2OYH A;  1RF0 A;  4C7R A;  2I1J A;  5AW1 B;  2NPS B;  1RF1 B;  1SQQ K;  4LLH A;  1LGH B;  5BVZ A;  5AVR B;  1JMM A;  1ZN5 A;  4W80 A;  3P8C D;  2C9L Y;  3HE5 B;  5BU5 A;  1IFN A;  2KP8 A;  1IK9 A;  1JY3 P;  4GT1 A;  2WTY A;  3HE4 B;  2CPB A;  4HYT B;  1JO5 A;  4WY4 B;  1CZQ A;  1JNM A;  5KTB A;  1GD2 E;  2A45 H;  2W6B A;  1DEB A;  2FKW B;  1LTI C;  3KYQ A;  1T3U A;  3U59 A;  2Q5U A;  3V2Q A;  4I6M C;  1JY2 N;  3O8Z A;  3HUS B;  4N3Y B;  2WSF H;  3V2P A;  1LWU C;  2M8R A;  1SP4 A;  5APQ A;  2QM8 A;  1GK6 A;  1N7S A;  1RE3 A;  1SQP K;  1HGZ A;  1CSB A;  3NTN A;  2YKP A;  5AVT B;  2NPS D;  1WRG A;  3U1C A;  3LW5 H;  3OAK A;  1HWT C;  2WPR A;  3P32 A;  2NPS A;  1KIL A;  1RF1 A;  3CLQ A;  1LT9 C;  1IC2 A;  2POH A;  4AUW A;  3BAT A;  2IFM A;  3M9B A;  1SFC B;  3WMM 0;  1E5W A;  1H8A A;  5AVU B;  2W6A A;  1KFN A;  4XA4 A;  1URQ C;  1FZE A;  1ZV8 A;  1AFO A;  2HLO A;  2KSJ A;  3IFM A;  4LC1 A;  3LIE A;  1L0L K;  2YO2 A;  2PP6 A;  5AVS B;  3C9I A;  5CCG C;  2XV5 A;  2HOD B;  1LT9 B;  1HVV A;  2WZ7 A;  1GL2 B;  1H88 A;  1URQ D;  3TSI A;  3T97 A;  4WY4 A;  5AW7 B;  3MD0 A;  1JY2 P;  3NMD A;  1CW5 A;  5CCH C;  1JTH A;  1X79 B;  3RL0 D;  1M1J B;  5AVZ B;  2WSC H;  3MIW A;  2P1J A;  2R3C A;  1FOS F;  5AW2 B;  1L4A C;  1KIL D;  2L5G B;  2GM4 A;  2MJZ A;  4JF7 A;  4DZO A;  5CHX A;  2KOG A;  2E42 A;  5CJ4 A;  1ZLL A;  3M0A A;  1X8Y A;  1VPC A;  1T2K C;  1ZR2 A;  1URQ A;  2XNX A;  1FZG A;  3B8E B;  4I1L A;  1GL2 A;  2HG5 D;  4ZKU A;  4OH8 B;  3RK2 C;  3VMZ A;  1FAV A;  1PFI A;  2OYH C;  1RF0 C;  1JCC A;  2WSE H;  1N73 A;  3M9Q A;  1LTT C;  4IFD K;  2I1K A;  2XZR A;  1AQ5 A;  2JJL A;  3M91 A;  1FU1 A;  2YMY A;  3TNU B;  3VOP A;  4M3L A;  2WWW A;  1LTJ C;  2N1T B;  3BAS A;  1NAF A;  2P2U A;  2FXM A;  1LTJ B;  1RE4 C;  1IFJ A;  2WIT A;  3N7N A;  1A02 J;  2YKQ A;  1N73 C;  4B86 A;  4W7Y A;  3HTK B;  1X9V A;  3A7O A;  4AQR D;  3RK3 D;  3RK3 B;  3A5T A;  3OJA B;  4WBA A;  1M7L A;  1NTM K;  3P7K A;  4LGD E;  1HUC A;  1SQX K;  3VP8 A;  1FZF A;  4JYB A;  1IFM A;  3A3Y B;  1J1E C;  4IFM A;  3SWY A;  2H43 A;  1OXZ A;  5AW0 B;  2Q7C A;  2YKO A;  2H7H A;  2E43 A;  3HRN A;  5APW A;  2QM7 A;  5BU8 B;  1FZB A;  5KJ7 D;  3V5B A;  4WY4 C;  2Z5H A;  2FFD B;  3TNU A;  2Z4E A;  2HOD A;  5CCH D;  3B5N C;  1HBW A;  1N7S C;  1GU5 A;  3OA7 A;  1S9K E;  1XTG B;  2Q3I A;  1LTG C;  2C9N Y;  2FFD A;  1FZC A;  1WT6 A;  4N78 E;  4EIJ A;  1SFC D;  3EQ2 A;  2BAS A;  5AW3 B;  1FDM A;  1YTZ T;  1M1J C;  3HD7 A;  3KPE A;  4AYC A;  1DH3 A;  1S9K D;  1RY3 A;  3HE4 A;  1RE4 A;  1OWA A;  3M0D A;  2J59 M;  5APS A;  4KHX A;  1FBM A;  1CI6 B;  1Z56 A;  1FZA A;  2C0X A;  2O1K A;  3KQG A;  2R5D A;  5AW8 B;  2Q9I A;  1GTW A;  1QL2 A;  3H32 A;  3RK2 D;  3U1A A;  2WPS A;  3VTP C;  1GL2 C;  2ZXE B;  1GU4 A;  4C7N A;  1JY3 N;  3R2P A;  1HH0 A;  1NU1 K;  2GUV A;  1HTL C;  1T2K D;  3GHG A;  2C0W A;  3H6P A;  4RES B;  2HYN A;  5APU A;  3NFQ A;  3A2A A;  1URQ B;  2P7J A;  2OYI C;  4WB4 A;  1LT9 A;  1H89 A;  1VDF A;  2KB7 P;  2VRS A;  2IX7 C;  1YTZ I;  1L4A A;  1LTS C;  1KIL B;  1NKZ B;  1W2E A;  3MGN A;  1L4A D;  3V2R A;  1SQV K;  5CMZ A;  1DX7 A;  3GHG B;  1ZR4 A;  1LWU A;  3I5C A;  3NXS A;  1CI6 A;  1NO4 A;  1GDT A;  2A45 G;  5AVQ B;  3UIA A;  3N4X A;  3H32 B;  1MZ9 A;  3V4W A;  1LTJ A;  3MTU E;  5AW5 B;  1JTH B;  3BRV B;  4Y99 C;  1JOC A;  3G3Z A;  2FFD C;  2R5B A;  1A02 F;  4ZKP A;  4W7Z A;  3HUS C;  4N78 D;  1FJP A;  3M0D C;  1NTZ K;  1FZC B;  2N1T D;  3M06 A;  4JYC A;  1NHL A;  4EOT A;  3TK1 A;  1J2J B;  1IO4 A;  2XDJ A;  2W27 A;  1JUN A;  1GL2 D;  3E1I A;  5AVY B;  5AW4 B;  1KFM A;  1GW4 A;  2WT7 A;  1LTA C;  1NKN A;  1T3J A;  3KDP B;  4I2L C;  5AW6 B;  1FJK A;  2ZFC A;  4Y99 B;  5AW9 B;  1N7S B;  1KZU B;  1EQ7 A;  3CL3 D;  1SFC A;  2A45 I;  2XKM A;  5KJ7 A;  1G2C A;  1MV8 A;  3HUS A;  5APX A;  3HD7 B;  2H8P D;  3CI9 A;  2O1J A;  1G2C B;  3VYI A;  3L36 A;  3GHG C;  4WY4 D;  2NPS C;  1RF1 C;  1GZL A;  2R32 A;  1J1E B;  3HD7 C;  5CCG D;  2N1T C;  1MFZ A;  1RE3 C;  1XTC C;  2YNY A;  2HPC A;  3EFG A;  1T8Z A;  3LID A;  1GW3 A;  2KLV A;  1GK4 A;  2GUS A;  4DOJ A;  3VN0 A;  1L0N K;  3RL0 B;  1MUU A;  2IPP A;  2OYH B;  1JCD A;  3B5N A;  2Z5I A;  3HTK A;  3SWF A;  1N2D C;  1KQL A;  2N1T A;  3IR9 A;  5AVW B;  3VP9 A;  3VMY A;  1FZC C;  4GKG A;  1QL1 A;  2PAJ A;  1HGV A;  4HH2 A;  5AVX B;  1G1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...