1NO4A

Crystal structure of the pre-assembly scaffolding protein gp7 from the double-stranded dna bacteriophage phi29
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
77
structure length
77
Chain Sequence
PLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLTKSHEKLAAEKDDLIVSNSKLFRQIGLTEKQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords HEAD MORPHOGENESIS PROTEIN
publication title Bacteriophage f29 scaffolding protein gp7 before and after prohead assembly
pubmed doi rcsb
source organism Bacillus phage phi29
total genus 34
structure length 77
sequence length 77
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11418 Scaffolding_pro Phi29 scaffolding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.400 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1no4A00
4IFFA 1NO4A 1NOHA 3MTUE 3OA7A
chains in the Genus database with same CATH superfamily
1VL2A 4IL6X 3L72J 5AW0B 3M0AA 3TGUJ 4UB8H 1AVYA 4H13C 3QH9A 4N3YB 1G1JA 1XTGB 5CCHD 1KN7A 1LP1A 3D6YA 2E75C 2YIUC 2ZT9C 2RKLA 1LTTC 1NVOA 1SQXE 2OYHC 1BCCD 1SQQE 1VQNP 3VMAA 2IBZE 2BCCD 3BRTB 1JO5A 3BASA 3CL3D 4PD4I 1SQXJ 2KZIA 1OW6A 4WY4B 3CWBE 3TSIA 1PPJE 2JEEA 2KS1A 1N7SC 1SQQJ 2UWJE 3CCUP 3GF3A 1RQUA 1GK4A 3IF4A 2GUVA 2PP6A 1JMMA 1JCCA 3USSA 3S1KA 2P58A 3HRNA 3GLMA 1AFOA 3H32B 4PD4D 5KJ7A 2XDJA 1M1JC 1T2KD 1ZR4A 1EZVI 2ZAEB 1LTJB 1VQ7P 3HE5B 4HJGH 3AE1C 3L35A 3EWKA 1SQBD 2KNCA 1L0LJ 3WUTA 5CCHC 1IK9A 3PRJA 1ZRTE 1JEKA 2ZYAA 1L0LK 1L2PA 2KS1B 2YO3A 1A02J 2I1KA 1JUNA 1KYOE 4C7NA 5H2FE 3TGUD 2Z5HA 1KB9H 1HF9A 3GF7A 3ZDMA 3G6EP 2WSFJ 2IBZI 5KAIH 3UIAA 2HLOA 1YQ4C 1GMJA 2IDBA 1L0ND 2E76D 1NHLA 1GK6A 3SFDC 1RF1C 4ZKUA 1KZUB 1IJDB 1NTKD 3IN6A 4JBZA 1GD2E 1DD3A 1Y8AA 3U59A 4W80A 1T2KC 3D6ZA 3LIDA 1AA0A 1RE4C 2QJYC 4ASWA 5APUA 3NFQA 3O6QA 3H25A 3II6A 2IYPA 1JNMA 3CWBD 1PPJD 3P8CE 4GDOA 1GL2D 1Q7YQ 2OGUA 4IL6H 3GG2A 1CW5A 3P7KA 2LXCB 3TK1A 1NJIQ 2HR3A 4JQ0D 2V7QH 1N7LA 2W83C 5AW8B 3FXDA 3L73E 5C39A 5AVUB 2FKWB 3CXHH 4AYCA 2QSIA 1OFCX 1KYOI 2CPBA 3B4SA 3GHGA 1GTWA 3B5ND 1MFTA 4ZMDA 3E1RA 4Z1MH 3ITKA 2E76C 3C8VA 1GU5A 3V5BA 2ZYGA 1CI6A 1ZRTD 3RK3B 3L71G 2D2CB 1W5CE 2M8RA 3V2RA 2ZVNB 3SWKA 5CCGD 1FZAA 3H1IG 1SLQA 2K3RA 4H0LC 3N7NA 2CK3H 2YMKA 4YXWH 2ZVOB 3Q3DA 2CPSA 3V2PA 3CCQP 2JWAA 1ZN5A 1N73A 1WMKA 1KQLA 1IO4A 3LW5H 1GL2C 3M0DA 1RH5B 4U3FD 3WUUA 5E79H 4DOJA 1MFZA 5GTHE 1EQ7A 2WVRA 1H89A 1FBMA 5CJ0A 2WT7B 5CMZA 1LJ2A 3AEFC 1YJWP 1AQTA 2PGDA 3CLQA 1YTZT 3VMYA 1NTME 1S1CX 1NTZE 3AE4C 1Z56A 2HODB 4GOEA 3B5NC 1PGQA 1SQPE 1NGMB 1MKMA 1YJ9P 1W2BO 3A0BH 2FBWC 1VF5D 2YIUB 5AW9B 4XA4A 1E5WA 1NTMJ 2KSEA 5GTIE 1VQ6P 1NTZJ 4KHXA 1NU1E 2Y0DA 3CC7P 2KXPB 1QL2A 5CCGC 2K88A 3CPWO 3VN0A 1RE3A 1ZMEC 2C0XA 1NAFA 3L73D 1R5SA 3AEDC 1NU1J 4EOTA 5AW2B 1M90Q 2N1TA 2XNXA 3M9HA 3FXEA 2R5DA 1M57D 3A3YB 1PL5A 1J1EC 2OYOA 3W68A 2MJZA 1BCCG 1N86A 4DCKA 1BE3J 1KFMA 1FZCA 2BCCG 3VMXA 3E1IA 3V6IA 1ZOYC 1DIPA 1HVVA 3HD7A 1VQ9P 1Y47A 3I55P 2XU6A 3H1HD 1FAVA 1UIIA 3KZIH 2WITA 1RF1A 3SWFA 2L5GB 2MKVA 3G71P 1SP4A 2VRSA 4UB6E 3T97B 3M06A 2WPSA 5KTBA 1KQGB 3C1LA 1RHZB 3VYIA 2J59M 5APTA 5L8RJ 1GW3A 1SFCD 1HBWA 1OW7A 3H1LJ 2N1TB 4IFFA 3U1CA 3MP7B 1M8OB 2K1AA 3HE4A 1G2CB 1LWUC 3D71A 3CCLP 1QGKB 1X0TA 3BRVB 2FXOA 3K5BA 1Q90D 1NTMD 5CBNA 1SQBG 1H0TA 4NPEA 2I8DA 3HD7B 4DJGA 3BVHA 1EDLA 1SQPD 2E5YA 1PP9J 3AE9C 3M9BA 4B86A 4IOIH 2FFDC 2Z5IA 2RN0A 1RF1B 1HJBA 3L70E 1J1DC 1OWAA 3VTPC 2GM4A 3TGUG 3IAOA 2H88C 2XV5A 3BCCE 2W6AA 4H44B 2HFED 2QJYB 1OW8A 2FYUD 1ZP0C 1SQVD 2KLUA 2LXBA 3L75E 5KLIC 5AW4B 3H1JD 5KLVJ 4D6TD 1L0NG 3HE4B 5KLVK 2BEQD 1FDMA 3BCCJ 1YITP 1SFCC 1NTKG 1OVVA 2JO1A 1S5LX 1SQBK 3L75J 2Q6QA 3B71A 3H32A 5CJ4A 1H0TB 3Q5SA 4PD4H 1BGYE 3V2QA 1SQQG 3RK2D 3AEGC 2E42A 3B8EB 1LTJA 3HE5A 3OAKA 1URQD 4N78D 1BGYJ 3CWBG 1PPJG 1NKNA 5KAFE 1Y9BA 1JCDA 1FU1A 2A45I 1SVFA 5TISH 1KV4A 3HTKA 2K9YA 5AW6B 3AE2C 1DD4A 1T8ZA 2WSCH 1KILD 1L0NK 4BRYB 4W7YA 3EFGA 1Q81Q 2NPSC 3PTZA 4H0LB 3RL0D 1OX3A 1NTKK 1QL1A 3JCUH 2KUBA 2WPVB 1K04A 2QJKB 2KOGA 1KB9E 1P84E 3AEEC 1L0LE 4WWIA 3EQ2A 4ASVA 1ZR2A 5APWA 2OYIC 3FGAD 5KAIE 4WB4A 2E74D 2ZXXA 5APYA 2KK7A 2KP8A 2OARA 3CC2P 1U7MA 3RK2C 2R32A 4R4MA 3L70D 3EFFK 5AVXB 1DX7A 5AVSB 3HTKB 2WSEH 1IFPA 3WUVA 1URQC 1EZVD 1FDIA 3RGUA 3L72D 4HYTB 1L4AA 3B5NB 3C9IA 1M56D 4U3FG 1J2JB 1AV1A 2AXTH 1FZBA 1GU4A 4Y99C 4JYCA 3PJSK 1RF0C 1KILC 1K8AQ 1QVFO 2J5UA 3AE5C 3TF5A 2RMZA 1LT9C 3RL0C 2YMYA 4IL6E 2E5TA 3H6PA 1ZLLA 3MHVA 2Q1KA 1SQXD 4I7ZB 4XE5B 1FZFA 3CXHE 1GW4A 1SQQD 4RESB 2IBZD 2OTJP 1IFNA 4JYBA 1GDTA 2M3EA 4L73A 1J1EB 4WY4D 3MUDC 4JF7A 5M1BA 2B88A 2QG4A 1KB9I 1FS0E 2V7QJ 2AEFA 2YKQA 1P84I 1L4AB 1LTBC 3MGNA 1S72P 4MN4C 2XKMA 5H2FH 3TYYA 4KT0J 1R5LA 1IK7A 3L74E 2O01H 3L73G 3U1AA 4NPDA 1LTGC 1KQSO 5AVRB 2YKPA 3CMEP 1AJYA 1KMIZ 2IPPA 2KYVA 1S5LH 1FJPA 2WMMA 2FYNC 4Y28J 1OZHA 1P84D 1L0LD 3JC22 1VQ8P 3L74J 2Q3IA 4EI2A 2C9NY 3O8ZA 4M3LA 3AEAC 2B89A 2XNDH 1VQ4P 3RK3E 2WT7A 5E79E 1RQVA 3H1HG 2WPQA 3MTUE 1DEEG 4OGQB 3LW5J 1LT1A 2HODA 1YIJP 1JY3P 1NKZB 2E43A 2Z4EA 1VQLP 1KYOD 2PRRA 2Y9YA 4WY4C 5KJ7D 1QX8A 1JY3O 3WU2H 2FFDB 3VP9A 1EXIA 3MD0A 3AEBC 3HUSC 3A0BE 1HTLC 2KB7P 3AECC 3CXHI 2OYHA 2QJPC 2G8YA 1J1DB 2PFXA 4NPFX 1R8EA 1NTMG 2KIKA 3H1IE 2AXCA 1Q82Q 2K9JB 4R4LA 1EDJA 2W90A 1N7SA 4PJ0H 1HUCA 1SQPG 2XZRA 1K9MQ 3WMM0 2HYNA 4PV1B 2R44A 1NYHA 2QEXP 4BWNA 2H89C 3H1IJ 1SFCB 5B66H 1LTIC 3G4SP 2WWWA 2M0BA 3CCVP 1IFJA 2NRGA 1PGJA 4H13B 5CHXA 1OIPA 1ZXGA 2BASA 2E75B 2ZT9B 3P8CD 2WZ7A 1M1JA 1ZV8A 2FYUG 1LNQA 1XTCC 2Y0CA 5DJUB 2OYHB 1SQVG 1MV8A 3L74D 5AVVB 3H1JG 4D6TG 4LGDE 3KZIE 3T97A 5CCHA 4WVZA 2C9LY 3NTNA 5B5EE 3SFEC 2K37A 3BATA 3CD6P 4YXDC 1BE3E 2JKVA 1N7SB 1HGZA 1S3JA 1T3JA 1Q86Q 1VQPP 2NPSB 3A0HE 1U57A 3H1KE 4K35A 1G2CA 2FYZA 1U7JA 1W2EA 4N6JA 1VQMP 3CX5E 3OJAB 2FXMA 2JDIH 4RO0A 1RF0A 1EDKA 4LLHA 2RH0A 1M1JB 2FYUK 1PZQA 4C7RA 3H1KJ 2OYIB 1SQVK 3H1LE 1YI2P 1T3UA 3F5HA 1EXJA 2KSJA 2B87A 3MIWA 2W6BA 2M5AB 3RK2B 1VF5C 2JWDA 1JY2P 1YYCA 1BCCE 5K5GB 2LR2A 2KZJA 4IFDK 2QIWA 1RE4A 2BCCE 2QM8A 1M1KQ 1JY2O 3D70A 3ABVC 1H8AA 1BCCJ 4O9BA 1PP9E 2WQYC 5AVWB 5EFWB 1X22A 1OVRA 1IFMA 2BCCJ 1S2EA 1NTZD 2YXQB 3OW2O 1CZQA 2A06E 1KILB 3L70G 3RL0B 3A7OA 3P8MC 4UB8E 5BU5A 1EZVG 2IYOA 1YTZI 3L72G 2B87B 2H8PD 4DT0A 1BDDA 3FX0A 1S9KE 1NU1D 1N8RQ 5KLVE 1ZW0A 3VMZA 1JOCA 5AVTB 4L75A 3TNUA 5KKZC 4UB6H 1SQBE 3CCEP 3Q2YA 2OQQA 3KYQA 3CX5I 5AW3B 3Q5PA 2L91A 4I1LA 5TISE 1BE3D 4BRYA 3KXDA 3GHGC 1MUUA 1SQBJ 5BU8B 3KPEA 4KJMA 1JTHB 1X9VA 1SQXG 1NOHA 5AW1B 2SPZA 3H1KD 1KFNA 1MZ9A 3VP8A 3W67A 2IBZG 4ZKPA 3JCUE 3CX5D 1OVUA 3KQGA 2P1JA 1GL2A 2WSCJ 1IZNB 4AQRD 4JPZB 1PFIA 3V2NA 1L0NE 4OVNF 3H1LD 2R3SA 4OWFA 3TNUB 1NTKE 2IZ1A 2E76B 1FC2C 2N1TD 2YKOA 1FJKA 1N73C 3M0DC 1L0NJ 3IR9A 4EDFA 2ZFCA 3A5TA 1NTKJ 3B5NA 1L0LG 1VQKP 5AW5B 2P7JA 1BDCA 1LTAC 1G1IA 1SQXK 5APXA 2C0WA 1PP9D 2AEJA 4GT1A 3CCMP 1YQ3C 1SQQK 3HD7D 3HUSB 4WBAA 2V4HA 2WSEJ 3PH0A 1JY3N 2IFNA 2AXTE 5CCGA 2QJPB 2A06D 1GL2B 3V4WA 3CCSP 3CWBJ 4C46A 5APQA 3AE7C 3E7KA 2AEMA 5AVYB 1USEA 3R4YA 3VOPA 1LP1B 2J58A 1QLED 2ZXEB 1S9KD 3S9OA 4H44D 5KAFH 2OTLP 1YJNP 3AE3C 5KLVD 4U7JA 2IZ0A 3GW6A 3BCCD 3NMDA 2KLVA 3IFMA 1RE3C 3GMAA 1H88A 3L75D 1PIXA 1YHQP 1FDOA 3L36A 1IC2A 3NXSA 2N1TC 3CI9A 1JM0A 2Q7CA 1HWTC 2QE7H 1JB0J 2W6JH 3V4QA 1T6AA 1BGYD 2NZ2A 3I5CA 1P84H 2Q3EA 1AQ5A 2KI7B 1FZCC 1S5LE 3N4XA 2W27A 3HD7C 3TDKA 3KHUA 4U3FE 2WSSH 2O01J 3Q5RA 1Q2NA 4YPCA 3CC4P 3PHLA 3L37A 1X8YA 1HH0A 3SWYA 2E74C 3G3ZA 1NWQA 3L74G 2KNCB 1LWUA 1KD1Q 4U3FJ 4GKGA 2WSFH 4H0LD 1KYOH 4H44C 3R2PA 1M7LA 4C7NB 5APVA 2O1JA 2FFDA 2BEZF 1KB9D 5AVQB 1GZLA 1N2DC 1FZGA 1OMIA 1FOSF 2QA4P 3WU2E 2YNYA 2IFMA 1VF5B 2QM7A 4GODA 2K9JA 1EDIA 1JY2N 1X79B 2LKMA 1LWUB 3S4RA 4PJ0E 4W7ZA 1SFCA 2QVAA 3OA7A 3L73J 2HPCA 3O6QB 2FXPA 1WRGA 3FWLA 5TJHA 5B66E 4IFMA 5AVZB 1EC5A 1D7MA 1TU3F 4L76A 1QEXA 3H1HE 3L71E 1CSBA 2DW3A 2P10A 2QJKC 5KKZB 5AW7B 2Y9ZA 3KDPB 2ZJSE 1NTZG 2P67A 2P2UA 3H1HJ 5KLIB 1LTJC 3L71J 1KC8Q 4EIJA 3QWOC 3CXHD 1A02F 1NAYA 3RBZA 2NPSA 3P32A 1OXZA 3GHGB 1L4AD 3CCRP 1NO4A 2O1KA 1NU1G 2JR8A 4I6MC 3AE8C 2HPCB 5APSA 1CI6B 3LIEA 5CBOA 1KTMA 4ZNCA 2Q5UA 2W8ZA 1PGOA 1K05A 4I2LC 1DH3A 2OYIA 1PGPA 1VDFA 4K3AA 2B9BA 1BE3G 2OTKE 3M9QA 2M5AA 1NH4A 4GOFA 1VQOP 5KJ7C 2M3BA 4HB1A 1NTMK 1LTSC 1LGHB 4TLFA 4DZOA 2O3JA 1NTZK 3A2AA 1N73B 3H1KG 1KQFB 5GTHH 1BSNA 1SQPJ 4GIFA 1URQA 1SQPK 1VQ5P 2FYUE 3RK3D 2D2CD 1SQVE 4OGQD 4YTPC 4I7ZC 1VPCA 3H1JE 4XFJA 3PP5A 2JJLA 4D6TE 2YO2A 1NU1K 3H1LG 2I1JA 2GA1A 2FYUJ 3SSUA 2WTYA 1KILA 4RKUJ 1SQVJ 4RJTA 4OH8B 2H43A 1LT9A 2Y0EA 3H1JJ 1L4AC 2ZYDA 4D6TJ 3PLNA 5GTIH 5DJTB 1DEBA 4QMAA 3JSVC 1E79H 2N9BA 1RY3A 2IX7C 4N78E 3L71D 1UIXA 2YXRB 1PP9G 4CPGA 3L4FA 2A45G 1BSHA 3MUDA 2PAJA 1URQB 5B5EH 5BVZA 3H1ID 3AE6C 4LC1A 4HH2A 4PV1D 1QVGO 3MZWB 4A7PA 2A06G 1IFIA 1HGVA 3Q1MA 2JP3A 3RL0g 3RBXA 1KILE 3A0HH 2R5BA 1JTHA 4EYYQ 4Y99B 4H13D 2GUSA 1FZEA 2E75D 3G9RA 2ZT9D 3CX5H 3RK3C 5KLVG 2D2CC 4OGQC 1SS1A 1LT9B 4PD4E 1WT6A 3BCCG 1K73Q 1FZCB 1S4XA 2R3CA 2QRXA 3I56P 3L75G 1HJ0A 2Q9IA 1USDA 1YBKA 3F89A 1FE6A 1IFDA 2N9YB 2O01N 1AVOA 2E74B 1N7SD 1PV3A 1JMBA 4HKZH 4AUWA 2G3AA 3CCJP 1BGYG 3FWNA 2NPSD 2POHA 1EZVE 3CMAP 2WPRA 3L72E 4TT3H 4WY4A 3L70J 3M91A 2A45H 3TGUE 4PV1C 1KORA 2FY8A 2H7HA 2HG5D 3HUSA 4L74A 2ITAA 4BXLA 2FYNB 1FOSE
chains in the Genus database with same CATH topology
1FZCA 3VMXA 5KJ7D 3V4QA 3E1IA 1JY3O 5AW0B 1HVVA 3M0AA 3VP9A 2FFDB 3I5CA 3HD7A 3MD0A 3HUSC 1HTLC 2KB7P 2OYHA 2XU6A 1AQ5A 4N3YB 1G1JA 1XTGB 1FAVA 5CCHD 1FZCC 1J1DB 3N4XA 2W27A 2WITA 1LTTC 1RF1A 3SWFA 2L5GB 3HD7C 2OYHC 1SP4A 2VRSA 3M06A 2WPSA 5KTBA 3VYIA 2J59M 5APTA 3L37A 1X8YA 1HH0A 3SWYA 1GW3A 1SFCD 1HBWA 3BRTB 1N7SA 2N1TB 4IFFA 1HUCA 3G3ZA 1JO5A 3BASA 1NWQA 2XZRA 3U1CA 3WMM0 1LWUA 2HYNA 3CL3D 4GKGA 2WSFH 4WY4B 3TSIA 2JEEA 1SFCB 1N7SC 3R2PA 1M7LA 3HE4A 1LTIC 1G2CB 1LWUC 2WWWA 1IFJA 1GK4A 3BRVB 2GUVA 2PP6A 4C7NB 5CHXA 1JMMA 1JCCA 2BASA 5APVA 2O1JA 3P8CD 2FFDA 2WZ7A 3HRNA 1M1JA 1ZV8A 1AFOA 1XTCC 3H32B 3HD7B 3BVHA 2OYHB 1MV8A 5AVQB 1GZLA 1N2DC 1FZGA 1FOSF 5AVVB 5KJ7A 2XDJA 2YNYA 2IFMA 2QM7A 3M9BA 4B86A 2FFDC 1M1JC 2Z5IA 1T2KD 1ZR4A 1RF1B 4LGDE 3T97A 1LTJB 5CCHA 1HJBA 2C9LY 3HE5B 1J1DC 1OWAA 3VTPC 2GM4A 3L35A 3NTNA 3BATA 2XV5A 1JY2N 1N7SB 1X79B 2W6AA 5CCHC 2HFED 2LKMA 1IK9A 1HGZA 1T3JA 1LWUB 1L0LK 4W7ZA 1SFCA 2NPSB 5AW4B 2YO3A 1A02J 1G2CA 3OA7A 2FYZA 3HE4B 2HPCA 1W2EA 5KLVK 2I1KA 1FDMA 4N6JA 1JUNA 4C7NA 1WRGA 3OJAB 2FXMA 1SFCC 4IFMA 5AVZB 2Z5HA 1RF0A 1SQBK 4LLHA 3H32A 1M1JB 5CJ4A 3V2QA 2FYUK 4C7RA 2OYIB 3RK2D 1SQVK 1T3UA 3UIAA 1CSBA 2E42A 2HLOA 3B8EB 2KSJA 3MIWA 1LTJA 2W6BA 3HE5A 5AW7B 3RK2B 3KDPB 3OAKA 1URQD 1NHLA 1GK6A 1JY2P 1YYCA 4N78D 1NKNA 2P67A 2P2UA 1RF1C 4ZKUA 1KZUB 1IJDB 1JCDA 1FU1A 4IFDK 1GD2E 1LTJC 1RE4A 2QM8A 4EIJA 2A45I 1JY2O 3U59A 1SVFA 1A02F 4W80A 1T2KC 2NPSA 3P32A 1OXZA 3GHGB 3HTKA 1L4AD 3LIDA 1H8AA 4O9BA 5AW6B 1RE4C 1NO4A 2O1KA 1T8ZA 5APUA 5AVWB 2WSCH 1KILD 3NFQA 1L0NK 4I6MC 2HPCB 1IFMA 5APSA 4W7YA 3EFGA 3II6A 1CI6B 3LIEA 2NPSC 2Q5UA 3RL0D 1JNMA 1NTKK 1CZQA 1QL1A 3P8CE 1KILB 4I2LC 1DH3A 1GL2D 2OYIA 2KOGA 1VDFA 3RL0B 3A7OA 3P8MC 5BU5A 3EQ2A 1ZR2A 3M9QA 5APWA 1CW5A 1YTZI 2OYIC 2H8PD 3P7KA 3TK1A 1NH4A 4WB4A 1S9KE 5KJ7C 2M3BA 1NTMK 1LTSC 1LGHB 4DZOA 3VMZA 1N7LA 1JOCA 5AW8B 5APYA 5AVTB 1NTZK 3A2AA 1N73B 2KP8A 3TNUA 2OARA 2FKWB 5AVUB 4AYCA 4GIFA 3RK2C 1URQA 2R32A 1SQPK 3KYQA 5AW3B 5AVXB 3RK3D 2CPBA 3GHGA 1GTWA 1DX7A 3B5ND 5AVSB 3HTKB 2WSEH 4I1LA 1VPCA 1URQC 3PP5A 2JJLA 3V5BA 1GU5A 2YO2A 1CI6A 1NU1K 3RK3B 3GHGC 2I1JA 4HYTB 1MUUA 1L4AA 3B5NB 5BU8B 3C9IA 3KPEA 2M8RA 1JTHB 1X9VA 1NOHA 2WTYA 5AW1B 3V2RA 1KILA 1KFNA 5CCGD 1FZAA 1MZ9A 1J2JB 3VP8A 1SLQA 4OH8B 2H43A 1LT9A 4ZKPA 1L4AC 1FZBA 1GU4A 4Y99C 4JYCA 3N7NA 1RF0C 3KQGA 1KILC 2P1JA 1DEBA 1GL2A 2N9BA 2CPSA 1LT9C 1RY3A 2YMYA 3RL0C 3V2PA 4AQRD 2IX7C 1ZN5A 1PFIA 3V2NA 1N73A 4N78E 3H6PA 1ZLLA 1KQLA 1IO4A 3LW5H 1GL2C 3M0DA 3L4FA 3TNUB 2A45G 3MUDA 2PAJA 1URQB 4XE5B 5BVZA 2N1TD 4DOJA 2YKOA 1MFZA 1FZFA 1GW4A 1FJKA 4LC1A 1N73C 4RESB 1EQ7A 4HH2A 1IFNA 3M0DC 4JYBA 1GDTA 1H89A 1FBMA 5CJ0A 1J1EB 2WT7B 4WY4D 5CMZA 4JF7A 1IFIA 3IR9A 1HGVA 2ZFCA 3A5TA 3B5NA 2YKQA 3CLQA 1YTZT 1L4AB 2R5BA 1JTHA 3VMYA 1LTBC 4Y99B 5AW5B 2GUSA 2P7JA 3MGNA 1LTAC 1G1IA 1SQXK 1Z56A 5APXA 1FZEA 2C0WA 2XKMA 4GT1A 3RK3C 3TYYA 2HODB 3B5NC 1SQQK 3HD7D 1LT9B 3HUSB 4WBAA 2O01H 3U1AA 1LTGC 1WT6A 1JY3N 2IFNA 5AVRB 2YKPA 5CCGA 1FZCB 2R3CA 5AW9B 4XA4A 1GL2B 1E5WA 3V4WA 2IPPA 2KYVA 1FJPA 4C46A 5APQA 5AVYB 2Q9IA 4KHXA 1QL2A 3VOPA 5CCGC 2J58A 1IFDA 3VN0A 2Q3IA 2C9NY 1N7SD 3O8ZA 2ZXEB 1S9KD 4M3LA 1RE3A 4AUWA 2WT7A 2C0XA 1NAFA 4EOTA 5AW2B 2NPSD 2N1TA 3NMDA 2POHA 2XNXA 2KLVA 3IFMA 3M9HA 2WPQA 2R5DA 3A3YB 3MTUE 1RE3C 1H88A 2WPRA 1J1EC 4WY4A 3L36A 3M91A 2A45H 1IC2A 3NXSA 2N1TC 3CI9A 2HODA 2MJZA 1JY3P 1NKZB 1N86A 2E43A 2H7HA 2HG5D 2Z4EA 3HUSA 2Q7CA 1KFMA 4WY4C 1HWTC 1FOSE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFF A;  1NO4 A;  1NOH A;  3MTU E;  3OA7 A; 
#chains in the Genus database with same CATH topology
 1VL2 A;  4IL6 X;  3L72 J;  5AW0 B;  3M0A A;  3TGU J;  4UB8 H;  1AVY A;  4H13 C;  3QH9 A;  4N3Y B;  1G1J A;  1XTG B;  5CCH D;  1KN7 A;  1LP1 A;  3D6Y A;  2E75 C;  2YIU C;  2ZT9 C;  2RKL A;  1LTT C;  1NVO A;  1SQX E;  2OYH C;  1BCC D;  1SQQ E;  1VQN P;  3VMA A;  2IBZ E;  2BCC D;  3BRT B;  1JO5 A;  3BAS A;  3CL3 D;  4PD4 I;  1SQX J;  2KZI A;  1OW6 A;  4WY4 B;  3CWB E;  3TSI A;  1PPJ E;  2JEE A;  2KS1 A;  1N7S C;  1SQQ J;  2UWJ E;  3CCU P;  3GF3 A;  1RQU A;  1GK4 A;  3IF4 A;  2GUV A;  2PP6 A;  1JMM A;  1JCC A;  3USS A;  3S1K A;  2P58 A;  3HRN A;  3GLM A;  1AFO A;  3H32 B;  4PD4 D;  5KJ7 A;  2XDJ A;  1M1J C;  1T2K D;  1ZR4 A;  1EZV I;  2ZAE B;  1LTJ B;  1VQ7 P;  3HE5 B;  4HJG H;  3AE1 C;  3L35 A;  3EWK A;  1SQB D;  2KNC A;  1L0L J;  3WUT A;  5CCH C;  1IK9 A;  3PRJ A;  1ZRT E;  1JEK A;  2ZYA A;  1L0L K;  1L2P A;  2KS1 B;  2YO3 A;  1A02 J;  2I1K A;  1JUN A;  1KYO E;  4C7N A;  5H2F E;  3TGU D;  2Z5H A;  1KB9 H;  1HF9 A;  3GF7 A;  3ZDM A;  3G6E P;  2WSF J;  2IBZ I;  5KAI H;  3UIA A;  2HLO A;  1YQ4 C;  1GMJ A;  2IDB A;  1L0N D;  2E76 D;  1NHL A;  1GK6 A;  3SFD C;  1RF1 C;  4ZKU A;  1KZU B;  1IJD B;  1NTK D;  3IN6 A;  4JBZ A;  1GD2 E;  1DD3 A;  1Y8A A;  3U59 A;  4W80 A;  1T2K C;  3D6Z A;  3LID A;  1AA0 A;  1RE4 C;  2QJY C;  4ASW A;  5APU A;  3NFQ A;  3O6Q A;  3H25 A;  3II6 A;  2IYP A;  1JNM A;  3CWB D;  1PPJ D;  3P8C E;  4GDO A;  1GL2 D;  1Q7Y Q;  2OGU A;  4IL6 H;  3GG2 A;  1CW5 A;  3P7K A;  2LXC B;  3TK1 A;  1NJI Q;  2HR3 A;  4JQ0 D;  2V7Q H;  1N7L A;  2W83 C;  5AW8 B;  3FXD A;  3L73 E;  5C39 A;  5AVU B;  2FKW B;  3CXH H;  4AYC A;  2QSI A;  1OFC X;  1KYO I;  2CPB A;  3B4S A;  3GHG A;  1GTW A;  3B5N D;  1MFT A;  4ZMD A;  3E1R A;  4Z1M H;  3ITK A;  2E76 C;  3C8V A;  1GU5 A;  3V5B A;  2ZYG A;  1CI6 A;  1ZRT D;  3RK3 B;  3L71 G;  2D2C B;  1W5C E;  2M8R A;  3V2R A;  2ZVN B;  3SWK A;  5CCG D;  1FZA A;  3H1I G;  1SLQ A;  2K3R A;  4H0L C;  3N7N A;  2CK3 H;  2YMK A;  4YXW H;  2ZVO B;  3Q3D A;  2CPS A;  3V2P A;  3CCQ P;  2JWA A;  1ZN5 A;  1N73 A;  1WMK A;  1KQL A;  1IO4 A;  3LW5 H;  1GL2 C;  3M0D A;  1RH5 B;  4U3F D;  3WUU A;  5E79 H;  4DOJ A;  1MFZ A;  5GTH E;  1EQ7 A;  2WVR A;  1H89 A;  1FBM A;  5CJ0 A;  2WT7 B;  5CMZ A;  1LJ2 A;  3AEF C;  1YJW P;  1AQT A;  2PGD A;  3CLQ A;  1YTZ T;  3VMY A;  1NTM E;  1S1C X;  1NTZ E;  3AE4 C;  1Z56 A;  2HOD B;  4GOE A;  3B5N C;  1PGQ A;  1SQP E;  1NGM B;  1MKM A;  1YJ9 P;  1W2B O;  3A0B H;  2FBW C;  1VF5 D;  2YIU B;  5AW9 B;  4XA4 A;  1E5W A;  1NTM J;  2KSE A;  5GTI E;  1VQ6 P;  1NTZ J;  4KHX A;  1NU1 E;  2Y0D A;  3CC7 P;  2KXP B;  1QL2 A;  5CCG C;  2K88 A;  3CPW O;  3VN0 A;  1RE3 A;  1ZME C;  2C0X A;  1NAF A;  3L73 D;  1R5S A;  3AED C;  1NU1 J;  4EOT A;  5AW2 B;  1M90 Q;  2N1T A;  2XNX A;  3M9H A;  3FXE A;  2R5D A;  1M57 D;  3A3Y B;  1PL5 A;  1J1E C;  2OYO A;  3W68 A;  2MJZ A;  1BCC G;  1N86 A;  4DCK A;  1BE3 J;  1KFM A;  1FZC A;  2BCC G;  3VMX A;  3E1I A;  3V6I A;  1ZOY C;  1DIP A;  1HVV A;  3HD7 A;  1VQ9 P;  1Y47 A;  3I55 P;  2XU6 A;  3H1H D;  1FAV A;  1UII A;  3KZI H;  2WIT A;  1RF1 A;  3SWF A;  2L5G B;  2MKV A;  3G71 P;  1SP4 A;  2VRS A;  4UB6 E;  3T97 B;  3M06 A;  2WPS A;  5KTB A;  1KQG B;  3C1L A;  1RHZ B;  3VYI A;  2J59 M;  5APT A;  5L8R J;  1GW3 A;  1SFC D;  1HBW A;  1OW7 A;  3H1L J;  2N1T B;  4IFF A;  3U1C A;  3MP7 B;  1M8O B;  2K1A A;  3HE4 A;  1G2C B;  1LWU C;  3D71 A;  3CCL P;  1QGK B;  1X0T A;  3BRV B;  2FXO A;  3K5B A;  1Q90 D;  1NTM D;  5CBN A;  1SQB G;  1H0T A;  4NPE A;  2I8D A;  3HD7 B;  4DJG A;  3BVH A;  1EDL A;  1SQP D;  2E5Y A;  1PP9 J;  3AE9 C;  3M9B A;  4B86 A;  4IOI H;  2FFD C;  2Z5I A;  2RN0 A;  1RF1 B;  1HJB A;  3L70 E;  1J1D C;  1OWA A;  3VTP C;  2GM4 A;  3TGU G;  3IAO A;  2H88 C;  2XV5 A;  3BCC E;  2W6A A;  4H44 B;  2HFE D;  2QJY B;  1OW8 A;  2FYU D;  1ZP0 C;  1SQV D;  2KLU A;  2LXB A;  3L75 E;  5KLI C;  5AW4 B;  3H1J D;  5KLV J;  4D6T D;  1L0N G;  3HE4 B;  5KLV K;  2BEQ D;  1FDM A;  3BCC J;  1YIT P;  1SFC C;  1NTK G;  1OVV A;  2JO1 A;  1S5L X;  1SQB K;  3L75 J;  2Q6Q A;  3B71 A;  3H32 A;  5CJ4 A;  1H0T B;  3Q5S A;  4PD4 H;  1BGY E;  3V2Q A;  1SQQ G;  3RK2 D;  3AEG C;  2E42 A;  3B8E B;  1LTJ A;  3HE5 A;  3OAK A;  1URQ D;  4N78 D;  1BGY J;  3CWB G;  1PPJ G;  1NKN A;  5KAF E;  1Y9B A;  1JCD A;  1FU1 A;  2A45 I;  1SVF A;  5TIS H;  1KV4 A;  3HTK A;  2K9Y A;  5AW6 B;  3AE2 C;  1DD4 A;  1T8Z A;  2WSC H;  1KIL D;  1L0N K;  4BRY B;  4W7Y A;  3EFG A;  1Q81 Q;  2NPS C;  3PTZ A;  4H0L B;  3RL0 D;  1OX3 A;  1NTK K;  1QL1 A;  3JCU H;  2KUB A;  2WPV B;  1K04 A;  2QJK B;  2KOG A;  1KB9 E;  1P84 E;  3AEE C;  1L0L E;  4WWI A;  3EQ2 A;  4ASV A;  1ZR2 A;  5APW A;  2OYI C;  3FGA D;  5KAI E;  4WB4 A;  2E74 D;  2ZXX A;  5APY A;  2KK7 A;  2KP8 A;  2OAR A;  3CC2 P;  1U7M A;  3RK2 C;  2R32 A;  4R4M A;  3L70 D;  3EFF K;  5AVX B;  1DX7 A;  5AVS B;  3HTK B;  2WSE H;  1IFP A;  3WUV A;  1URQ C;  1EZV D;  1FDI A;  3RGU A;  3L72 D;  4HYT B;  1L4A A;  3B5N B;  3C9I A;  1M56 D;  4U3F G;  1J2J B;  1AV1 A;  2AXT H;  1FZB A;  1GU4 A;  4Y99 C;  4JYC A;  3PJS K;  1RF0 C;  1KIL C;  1K8A Q;  1QVF O;  2J5U A;  3AE5 C;  3TF5 A;  2RMZ A;  1LT9 C;  3RL0 C;  2YMY A;  4IL6 E;  2E5T A;  3H6P A;  1ZLL A;  3MHV A;  2Q1K A;  1SQX D;  4I7Z B;  4XE5 B;  1FZF A;  3CXH E;  1GW4 A;  1SQQ D;  4RES B;  2IBZ D;  2OTJ P;  1IFN A;  4JYB A;  1GDT A;  2M3E A;  4L73 A;  1J1E B;  4WY4 D;  3MUD C;  4JF7 A;  5M1B A;  2B88 A;  2QG4 A;  1KB9 I;  1FS0 E;  2V7Q J;  2AEF A;  2YKQ A;  1P84 I;  1L4A B;  1LTB C;  3MGN A;  1S72 P;  4MN4 C;  2XKM A;  5H2F H;  3TYY A;  4KT0 J;  1R5L A;  1IK7 A;  3L74 E;  2O01 H;  3L73 G;  3U1A A;  4NPD A;  1LTG C;  1KQS O;  5AVR B;  2YKP A;  3CME P;  1AJY A;  1KMI Z;  2IPP A;  2KYV A;  1S5L H;  1FJP A;  2WMM A;  2FYN C;  4Y28 J;  1OZH A;  1P84 D;  1L0L D;  3JC2 2;  1VQ8 P;  3L74 J;  2Q3I A;  4EI2 A;  2C9N Y;  3O8Z A;  4M3L A;  3AEA C;  2B89 A;  2XND H;  1VQ4 P;  3RK3 E;  2WT7 A;  5E79 E;  1RQV A;  3H1H G;  2WPQ A;  3MTU E;  1DEE G;  4OGQ B;  3LW5 J;  1LT1 A;  2HOD A;  1YIJ P;  1JY3 P;  1NKZ B;  2E43 A;  2Z4E A;  1VQL P;  1KYO D;  2PRR A;  2Y9Y A;  4WY4 C;  5KJ7 D;  1QX8 A;  1JY3 O;  3WU2 H;  2FFD B;  3VP9 A;  1EXI A;  3MD0 A;  3AEB C;  3HUS C;  3A0B E;  1HTL C;  2KB7 P;  3AEC C;  3CXH I;  2OYH A;  2QJP C;  2G8Y A;  1J1D B;  2PFX A;  4NPF X;  1R8E A;  1NTM G;  2KIK A;  3H1I E;  2AXC A;  1Q82 Q;  2K9J B;  4R4L A;  1EDJ A;  2W90 A;  1N7S A;  4PJ0 H;  1HUC A;  1SQP G;  2XZR A;  1K9M Q;  3WMM 0;  2HYN A;  4PV1 B;  2R44 A;  1NYH A;  2QEX P;  4BWN A;  2H89 C;  3H1I J;  1SFC B;  5B66 H;  1LTI C;  3G4S P;  2WWW A;  2M0B A;  3CCV P;  1IFJ A;  2NRG A;  1PGJ A;  4H13 B;  5CHX A;  1OIP A;  1ZXG A;  2BAS A;  2E75 B;  2ZT9 B;  3P8C D;  2WZ7 A;  1M1J A;  1ZV8 A;  2FYU G;  1LNQ A;  1XTC C;  2Y0C A;  5DJU B;  2OYH B;  1SQV G;  1MV8 A;  3L74 D;  5AVV B;  3H1J G;  4D6T G;  4LGD E;  3KZI E;  3T97 A;  5CCH A;  4WVZ A;  2C9L Y;  3NTN A;  5B5E E;  3SFE C;  2K37 A;  3BAT A;  3CD6 P;  4YXD C;  1BE3 E;  2JKV A;  1N7S B;  1HGZ A;  1S3J A;  1T3J A;  1Q86 Q;  1VQP P;  2NPS B;  3A0H E;  1U57 A;  3H1K E;  4K35 A;  1G2C A;  2FYZ A;  1U7J A;  1W2E A;  4N6J A;  1VQM P;  3CX5 E;  3OJA B;  2FXM A;  2JDI H;  4RO0 A;  1RF0 A;  1EDK A;  4LLH A;  2RH0 A;  1M1J B;  2FYU K;  1PZQ A;  4C7R A;  3H1K J;  2OYI B;  1SQV K;  3H1L E;  1YI2 P;  1T3U A;  3F5H A;  1EXJ A;  2KSJ A;  2B87 A;  3MIW A;  2W6B A;  2M5A B;  3RK2 B;  1VF5 C;  2JWD A;  1JY2 P;  1YYC A;  1BCC E;  5K5G B;  2LR2 A;  2KZJ A;  4IFD K;  2QIW A;  1RE4 A;  2BCC E;  2QM8 A;  1M1K Q;  1JY2 O;  3D70 A;  3ABV C;  1H8A A;  1BCC J;  4O9B A;  1PP9 E;  2WQY C;  5AVW B;  5EFW B;  1X22 A;  1OVR A;  1IFM A;  2BCC J;  1S2E A;  1NTZ D;  2YXQ B;  3OW2 O;  1CZQ A;  2A06 E;  1KIL B;  3L70 G;  3RL0 B;  3A7O A;  3P8M C;  4UB8 E;  5BU5 A;  1EZV G;  2IYO A;  1YTZ I;  3L72 G;  2B87 B;  2H8P D;  4DT0 A;  1BDD A;  3FX0 A;  1S9K E;  1NU1 D;  1N8R Q;  5KLV E;  1ZW0 A;  3VMZ A;  1JOC A;  5AVT B;  4L75 A;  3TNU A;  5KKZ C;  4UB6 H;  1SQB E;  3CCE P;  3Q2Y A;  2OQQ A;  3KYQ A;  3CX5 I;  5AW3 B;  3Q5P A;  2L91 A;  4I1L A;  5TIS E;  1BE3 D;  4BRY A;  3KXD A;  3GHG C;  1MUU A;  1SQB J;  5BU8 B;  3KPE A;  4KJM A;  1JTH B;  1X9V A;  1SQX G;  1NOH A;  5AW1 B;  2SPZ A;  3H1K D;  1KFN A;  1MZ9 A;  3VP8 A;  3W67 A;  2IBZ G;  4ZKP A;  3JCU E;  3CX5 D;  1OVU A;  3KQG A;  2P1J A;  1GL2 A;  2WSC J;  1IZN B;  4AQR D;  4JPZ B;  1PFI A;  3V2N A;  1L0N E;  4OVN F;  3H1L D;  2R3S A;  4OWF A;  3TNU B;  1NTK E;  2IZ1 A;  2E76 B;  1FC2 C;  2N1T D;  2YKO A;  1FJK A;  1N73 C;  3M0D C;  1L0N J;  3IR9 A;  4EDF A;  2ZFC A;  3A5T A;  1NTK J;  3B5N A;  1L0L G;  1VQK P;  5AW5 B;  2P7J A;  1BDC A;  1LTA C;  1G1I A;  1SQX K;  5APX A;  2C0W A;  1PP9 D;  2AEJ A;  4GT1 A;  3CCM P;  1YQ3 C;  1SQQ K;  3HD7 D;  3HUS B;  4WBA A;  2V4H A;  2WSE J;  3PH0 A;  1JY3 N;  2IFN A;  2AXT E;  5CCG A;  2QJP B;  2A06 D;  1GL2 B;  3V4W A;  3CCS P;  3CWB J;  4C46 A;  5APQ A;  3AE7 C;  3E7K A;  2AEM A;  5AVY B;  1USE A;  3R4Y A;  3VOP A;  1LP1 B;  2J58 A;  1QLE D;  2ZXE B;  1S9K D;  3S9O A;  4H44 D;  5KAF H;  2OTL P;  1YJN P;  3AE3 C;  5KLV D;  4U7J A;  2IZ0 A;  3GW6 A;  3BCC D;  3NMD A;  2KLV A;  3IFM A;  1RE3 C;  3GMA A;  1H88 A;  3L75 D;  1PIX A;  1YHQ P;  1FDO A;  3L36 A;  1IC2 A;  3NXS A;  2N1T C;  3CI9 A;  1JM0 A;  2Q7C A;  1HWT C;  2QE7 H;  1JB0 J;  2W6J H;  3V4Q A;  1T6A A;  1BGY D;  2NZ2 A;  3I5C A;  1P84 H;  2Q3E A;  1AQ5 A;  2KI7 B;  1FZC C;  1S5L E;  3N4X A;  2W27 A;  3HD7 C;  3TDK A;  3KHU A;  4U3F E;  2WSS H;  2O01 J;  3Q5R A;  1Q2N A;  4YPC A;  3CC4 P;  3PHL A;  3L37 A;  1X8Y A;  1HH0 A;  3SWY A;  2E74 C;  3G3Z A;  1NWQ A;  3L74 G;  2KNC B;  1LWU A;  1KD1 Q;  4U3F J;  4GKG A;  2WSF H;  4H0L D;  1KYO H;  4H44 C;  3R2P A;  1M7L A;  4C7N B;  5APV A;  2O1J A;  2FFD A;  2BEZ F;  1KB9 D;  5AVQ B;  1GZL A;  1N2D C;  1FZG A;  1OMI A;  1FOS F;  2QA4 P;  3WU2 E;  2YNY A;  2IFM A;  1VF5 B;  2QM7 A;  4GOD A;  2K9J A;  1EDI A;  1JY2 N;  1X79 B;  2LKM A;  1LWU B;  3S4R A;  4PJ0 E;  4W7Z A;  1SFC A;  2QVA A;  3OA7 A;  3L73 J;  2HPC A;  3O6Q B;  2FXP A;  1WRG A;  3FWL A;  5TJH A;  5B66 E;  4IFM A;  5AVZ B;  1EC5 A;  1D7M A;  1TU3 F;  4L76 A;  1QEX A;  3H1H E;  3L71 E;  1CSB A;  2DW3 A;  2P10 A;  2QJK C;  5KKZ B;  5AW7 B;  2Y9Z A;  3KDP B;  2ZJS E;  1NTZ G;  2P67 A;  2P2U A;  3H1H J;  5KLI B;  1LTJ C;  3L71 J;  1KC8 Q;  4EIJ A;  3QWO C;  3CXH D;  1A02 F;  1NAY A;  3RBZ A;  2NPS A;  3P32 A;  1OXZ A;  3GHG B;  1L4A D;  3CCR P;  1NO4 A;  2O1K A;  1NU1 G;  2JR8 A;  4I6M C;  3AE8 C;  2HPC B;  5APS A;  1CI6 B;  3LIE A;  5CBO A;  1KTM A;  4ZNC A;  2Q5U A;  2W8Z A;  1PGO A;  1K05 A;  4I2L C;  1DH3 A;  2OYI A;  1PGP A;  1VDF A;  4K3A A;  2B9B A;  1BE3 G;  2OTK E;  3M9Q A;  2M5A A;  1NH4 A;  4GOF A;  1VQO P;  5KJ7 C;  2M3B A;  4HB1 A;  1NTM K;  1LTS C;  1LGH B;  4TLF A;  4DZO A;  2O3J A;  1NTZ K;  3A2A A;  1N73 B;  3H1K G;  1KQF B;  5GTH H;  1BSN A;  1SQP J;  4GIF A;  1URQ A;  1SQP K;  1VQ5 P;  2FYU E;  3RK3 D;  2D2C D;  1SQV E;  4OGQ D;  4YTP C;  4I7Z C;  1VPC A;  3H1J E;  4XFJ A;  3PP5 A;  2JJL A;  4D6T E;  2YO2 A;  1NU1 K;  3H1L G;  2I1J A;  2GA1 A;  2FYU J;  3SSU A;  2WTY A;  1KIL A;  4RKU J;  1SQV J;  4RJT A;  4OH8 B;  2H43 A;  1LT9 A;  2Y0E A;  3H1J J;  1L4A C;  2ZYD A;  4D6T J;  3PLN A;  5GTI H;  5DJT B;  1DEB A;  4QMA A;  3JSV C;  1E79 H;  2N9B A;  1RY3 A;  2IX7 C;  4N78 E;  3L71 D;  1UIX A;  2YXR B;  1PP9 G;  4CPG A;  3L4F A;  2A45 G;  1BSH A;  3MUD A;  2PAJ A;  1URQ B;  5B5E H;  5BVZ A;  3H1I D;  3AE6 C;  4LC1 A;  4HH2 A;  4PV1 D;  1QVG O;  3MZW B;  4A7P A;  2A06 G;  1IFI A;  1HGV A;  3Q1M A;  2JP3 A;  3RL0 g;  3RBX A;  1KIL E;  3A0H H;  2R5B A;  1JTH A;  4EYY Q;  4Y99 B;  4H13 D;  2GUS A;  1FZE A;  2E75 D;  3G9R A;  2ZT9 D;  3CX5 H;  3RK3 C;  5KLV G;  2D2C C;  4OGQ C;  1SS1 A;  1LT9 B;  4PD4 E;  1WT6 A;  3BCC G;  1K73 Q;  1FZC B;  1S4X A;  2R3C A;  2QRX A;  3I56 P;  3L75 G;  1HJ0 A;  2Q9I A;  1USD A;  1YBK A;  3F89 A;  1FE6 A;  1IFD A;  2N9Y B;  2O01 N;  1AVO A;  2E74 B;  1N7S D;  1PV3 A;  1JMB A;  4HKZ H;  4AUW A;  2G3A A;  3CCJ P;  1BGY G;  3FWN A;  2NPS D;  2POH A;  1EZV E;  3CMA P;  2WPR A;  3L72 E;  4TT3 H;  4WY4 A;  3L70 J;  3M91 A;  2A45 H;  3TGU E;  4PV1 C;  1KOR A;  2FY8 A;  2H7H A;  2HG5 D;  3HUS A;  4L74 A;  2ITA A;  4BXL A;  2FYN B;  1FOS E; 
#chains in the Genus database with same CATH homology
 1FZC A;  3VMX A;  5KJ7 D;  3V4Q A;  3E1I A;  1JY3 O;  5AW0 B;  1HVV A;  3M0A A;  3VP9 A;  2FFD B;  3I5C A;  3HD7 A;  3MD0 A;  3HUS C;  1HTL C;  2KB7 P;  2OYH A;  2XU6 A;  1AQ5 A;  4N3Y B;  1G1J A;  1XTG B;  1FAV A;  5CCH D;  1FZC C;  1J1D B;  3N4X A;  2W27 A;  2WIT A;  1LTT C;  1RF1 A;  3SWF A;  2L5G B;  3HD7 C;  2OYH C;  1SP4 A;  2VRS A;  3M06 A;  2WPS A;  5KTB A;  3VYI A;  2J59 M;  5APT A;  3L37 A;  1X8Y A;  1HH0 A;  3SWY A;  1GW3 A;  1SFC D;  1HBW A;  3BRT B;  1N7S A;  2N1T B;  4IFF A;  1HUC A;  3G3Z A;  1JO5 A;  3BAS A;  1NWQ A;  2XZR A;  3U1C A;  3WMM 0;  1LWU A;  2HYN A;  3CL3 D;  4GKG A;  2WSF H;  4WY4 B;  3TSI A;  2JEE A;  1SFC B;  1N7S C;  3R2P A;  1M7L A;  3HE4 A;  1LTI C;  1G2C B;  1LWU C;  2WWW A;  1IFJ A;  1GK4 A;  3BRV B;  2GUV A;  2PP6 A;  4C7N B;  5CHX A;  1JMM A;  1JCC A;  2BAS A;  5APV A;  2O1J A;  3P8C D;  2FFD A;  2WZ7 A;  3HRN A;  1M1J A;  1ZV8 A;  1AFO A;  1XTC C;  3H32 B;  3HD7 B;  3BVH A;  2OYH B;  1MV8 A;  5AVQ B;  1GZL A;  1N2D C;  1FZG A;  1FOS F;  5AVV B;  5KJ7 A;  2XDJ A;  2YNY A;  2IFM A;  2QM7 A;  3M9B A;  4B86 A;  2FFD C;  1M1J C;  2Z5I A;  1T2K D;  1ZR4 A;  1RF1 B;  4LGD E;  3T97 A;  1LTJ B;  5CCH A;  1HJB A;  2C9L Y;  3HE5 B;  1J1D C;  1OWA A;  3VTP C;  2GM4 A;  3L35 A;  3NTN A;  3BAT A;  2XV5 A;  1JY2 N;  1N7S B;  1X79 B;  2W6A A;  5CCH C;  2HFE D;  2LKM A;  1IK9 A;  1HGZ A;  1T3J A;  1LWU B;  1L0L K;  4W7Z A;  1SFC A;  2NPS B;  5AW4 B;  2YO3 A;  1A02 J;  1G2C A;  3OA7 A;  2FYZ A;  3HE4 B;  2HPC A;  1W2E A;  5KLV K;  2I1K A;  1FDM A;  4N6J A;  1JUN A;  4C7N A;  1WRG A;  3OJA B;  2FXM A;  1SFC C;  4IFM A;  5AVZ B;  2Z5H A;  1RF0 A;  1SQB K;  4LLH A;  3H32 A;  1M1J B;  5CJ4 A;  3V2Q A;  2FYU K;  4C7R A;  2OYI B;  3RK2 D;  1SQV K;  1T3U A;  3UIA A;  1CSB A;  2E42 A;  2HLO A;  3B8E B;  2KSJ A;  3MIW A;  1LTJ A;  2W6B A;  3HE5 A;  5AW7 B;  3RK2 B;  3KDP B;  3OAK A;  1URQ D;  1NHL A;  1GK6 A;  1JY2 P;  1YYC A;  4N78 D;  1NKN A;  2P67 A;  2P2U A;  1RF1 C;  4ZKU A;  1KZU B;  1IJD B;  1JCD A;  1FU1 A;  4IFD K;  1GD2 E;  1LTJ C;  1RE4 A;  2QM8 A;  4EIJ A;  2A45 I;  1JY2 O;  3U59 A;  1SVF A;  1A02 F;  4W80 A;  1T2K C;  2NPS A;  3P32 A;  1OXZ A;  3GHG B;  3HTK A;  1L4A D;  3LID A;  1H8A A;  4O9B A;  5AW6 B;  1RE4 C;  1NO4 A;  2O1K A;  1T8Z A;  5APU A;  5AVW B;  2WSC H;  1KIL D;  3NFQ A;  1L0N K;  4I6M C;  2HPC B;  1IFM A;  5APS A;  4W7Y A;  3EFG A;  3II6 A;  1CI6 B;  3LIE A;  2NPS C;  2Q5U A;  3RL0 D;  1JNM A;  1NTK K;  1CZQ A;  1QL1 A;  3P8C E;  1KIL B;  4I2L C;  1DH3 A;  1GL2 D;  2OYI A;  2KOG A;  1VDF A;  3RL0 B;  3A7O A;  3P8M C;  5BU5 A;  3EQ2 A;  1ZR2 A;  3M9Q A;  5APW A;  1CW5 A;  1YTZ I;  2OYI C;  2H8P D;  3P7K A;  3TK1 A;  1NH4 A;  4WB4 A;  1S9K E;  5KJ7 C;  2M3B A;  1NTM K;  1LTS C;  1LGH B;  4DZO A;  3VMZ A;  1N7L A;  1JOC A;  5AW8 B;  5APY A;  5AVT B;  1NTZ K;  3A2A A;  1N73 B;  2KP8 A;  3TNU A;  2OAR A;  2FKW B;  5AVU B;  4AYC A;  4GIF A;  3RK2 C;  1URQ A;  2R32 A;  1SQP K;  3KYQ A;  5AW3 B;  5AVX B;  3RK3 D;  2CPB A;  3GHG A;  1GTW A;  1DX7 A;  3B5N D;  5AVS B;  3HTK B;  2WSE H;  4I1L A;  1VPC A;  1URQ C;  3PP5 A;  2JJL A;  3V5B A;  1GU5 A;  2YO2 A;  1CI6 A;  1NU1 K;  3RK3 B;  3GHG C;  2I1J A;  4HYT B;  1MUU A;  1L4A A;  3B5N B;  5BU8 B;  3C9I A;  3KPE A;  2M8R A;  1JTH B;  1X9V A;  1NOH A;  2WTY A;  5AW1 B;  3V2R A;  1KIL A;  1KFN A;  5CCG D;  1FZA A;  1MZ9 A;  1J2J B;  3VP8 A;  1SLQ A;  4OH8 B;  2H43 A;  1LT9 A;  4ZKP A;  1L4A C;  1FZB A;  1GU4 A;  4Y99 C;  4JYC A;  3N7N A;  1RF0 C;  3KQG A;  1KIL C;  2P1J A;  1DEB A;  1GL2 A;  2N9B A;  2CPS A;  1LT9 C;  1RY3 A;  2YMY A;  3RL0 C;  3V2P A;  4AQR D;  2IX7 C;  1ZN5 A;  1PFI A;  3V2N A;  1N73 A;  4N78 E;  3H6P A;  1ZLL A;  1KQL A;  1IO4 A;  3LW5 H;  1GL2 C;  3M0D A;  3L4F A;  3TNU B;  2A45 G;  3MUD A;  2PAJ A;  1URQ B;  4XE5 B;  5BVZ A;  2N1T D;  4DOJ A;  2YKO A;  1MFZ A;  1FZF A;  1GW4 A;  1FJK A;  4LC1 A;  1N73 C;  4RES B;  1EQ7 A;  4HH2 A;  1IFN A;  3M0D C;  4JYB A;  1GDT A;  1H89 A;  1FBM A;  5CJ0 A;  1J1E B;  2WT7 B;  4WY4 D;  5CMZ A;  4JF7 A;  1IFI A;  3IR9 A;  1HGV A;  2ZFC A;  3A5T A;  3B5N A;  2YKQ A;  3CLQ A;  1YTZ T;  1L4A B;  2R5B A;  1JTH A;  3VMY A;  1LTB C;  4Y99 B;  5AW5 B;  2GUS A;  2P7J A;  3MGN A;  1LTA C;  1G1I A;  1SQX K;  1Z56 A;  5APX A;  1FZE A;  2C0W A;  2XKM A;  4GT1 A;  3RK3 C;  3TYY A;  2HOD B;  3B5N C;  1SQQ K;  3HD7 D;  1LT9 B;  3HUS B;  4WBA A;  2O01 H;  3U1A A;  1LTG C;  1WT6 A;  1JY3 N;  2IFN A;  5AVR B;  2YKP A;  5CCG A;  1FZC B;  2R3C A;  5AW9 B;  4XA4 A;  1GL2 B;  1E5W A;  3V4W A;  2IPP A;  2KYV A;  1FJP A;  4C46 A;  5APQ A;  5AVY B;  2Q9I A;  4KHX A;  1QL2 A;  3VOP A;  5CCG C;  2J58 A;  1IFD A;  3VN0 A;  2Q3I A;  2C9N Y;  1N7S D;  3O8Z A;  2ZXE B;  1S9K D;  4M3L A;  1RE3 A;  4AUW A;  2WT7 A;  2C0X A;  1NAF A;  4EOT A;  5AW2 B;  2NPS D;  2N1T A;  3NMD A;  2POH A;  2XNX A;  2KLV A;  3IFM A;  3M9H A;  2WPQ A;  2R5D A;  3A3Y B;  3MTU E;  1RE3 C;  1H88 A;  2WPR A;  1J1E C;  4WY4 A;  3L36 A;  3M91 A;  2A45 H;  1IC2 A;  3NXS A;  2N1T C;  3CI9 A;  2HOD A;  2MJZ A;  1JY3 P;  1NKZ B;  1N86 A;  2E43 A;  2H7H A;  2HG5 D;  2Z4E A;  3HUS A;  2Q7C A;  1KFM A;  4WY4 C;  1HWT C;  1FOS E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...