1NO4A

Crystal structure of the pre-assembly scaffolding protein gp7 from the double-stranded dna bacteriophage phi29
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
77
structure length
77
Chain Sequence
PLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLTKSHEKLAAEKDDLIVSNSKLFRQIGLTEKQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacteriophage f29 scaffolding protein gp7 before and after prohead assembly
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Viral protein
molecule keywords HEAD MORPHOGENESIS PROTEIN
total genus 34
structure length 77
sequence length 77
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11418 Scaffolding_pro Phi29 scaffolding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.400 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1no4A00
1NO4A 3MTUE 4IFFA 3OA7A 1NOHA
chains in the Genus database with same CATH superfamily
2M5AA 5B5EH 3ITKA 1OVVA 3L73D 3MD0A 4ASVA 3OW2O 1SQPE 1IFDA 2P58A 2N1TB 2JJLA 1OZHA 1X8YA 3FWNA 3II6A 3JSVC 1QGKB 3LW5J 4NPDA 3WUUA 2OYHC 2KIKA 4IFDK 3L70D 1UIXA 3R2PA 4U7JA 1WRGA 2NPSA 1Q90D 3L70G 2Z5HA 1XTCC 1PP9G 2GUSA 2YIUC 1Y47A 3H1JG 5B5EE 2WTYA 2IBZE 4GOEA 4GODA 3M0DA 3MIWA 3P7KA 3Q5PA 1R8EA 2H7HA 3CLQA 4O9BA 1FJPA 4B86A 1LNQA 3BCCD 3D6ZA 2N1TA 1TU3F 1NTMK 1NTZJ 1LP1B 1FJKA 1NU1G 3BVHA 1FZCC 4KJMA 4R4LA 1S9KD 2ZYGA 2FXPA 5KLVG 1EQ7A 3T97A 2N1TC 3IN6A 3P32A 4LLHA 1PFIA 1ZV8A 1SQVG 1ZRTE 1L4AD 2Z5IA 3GF3A 5KTBA 1M1JC 4D6TD 2PAJA 3L4FA 2JR8A 3MZWB 1K8AQ 1KQGB 1XTGB 1YBKA 1JY2N 4JF7A 1BDCA 4H13B 1PZQA 4H44D 1VF5B 1URQC 2G8YA 3H1LD 3P8CD 1KB9D 4H44C 5DJUB 1M1JA 1VDFA 3VOPA 3H1JD 3W67A 2P7JA 3H1LG 1OW7A 3D71A 4W7YA 4HB1A 3CXHE 2KSEA 3SWKA 1PIXA 2K9JB 4I6MC 1YTZI 2N9YB 3L71D 4WY4B 2KLUA 2CK3H 2FY8A 5AW6B 1Z56A 4MN4C 2JWDA 3GHGB 2OTJP 2DW3A 1IK9A 1NU1J 1SQQE 2UWJE 1NU1D 2V4HA 3PLNA 3RL0g 3S9OA 3L72J 4I7ZB 2WT7B 3CCUP 1GTWA 2YXQB 2KS1B 3AEAC 4K3AA 1IFIA 1USEA 1OMIA 4WY4D 1T2KD 1SQPD 1SQPK 3M0DC 1HWTC 1ZRTD 1PGJA 2FYUD 1RF0A 3CXHD 1VF5C 3G6EP 2JWAA 3CCLP 1MFTA 3BRTB 1JM0A 2N1TD 2ZFCA 4PD4D 2K9JA 4H44B 3CMEP 1N7SA 1FZGA 1ZOYC 1OX3A 2E74D 3L73J 1NTZK 2KSJA 3WUTA 3M9HA 2IFMA 3KHUA 3CWBJ 3L75D 3B71A 2KS1A 2WITA 4R4MA 2NZ2A 3BCCG 1ZR4A 1CW5A 2WPVB 1AJYA 2BCCE 2XU6A 1SQBG 1DIPA 3KPEA 1EC5A 3AEEC 2FYUE 1FZCB 1CI6A 1OWAA 1IFNA 4JYCA 1SQXK 2QG4A 1SP4A 1KORA 4L75A 1L2PA 2JP3A 3EFGA 1PPJE 2WSFJ 3L74E 1R5SA 1NTKJ 1PGPA 2YMYA 1NTMD 1U7MA 3L73E 1OW8A 1OVUA 1OW6A 3Q3DA 2R5DA 2ZYAA 2B87B 1Q86Q 1KTMA 1QX8A 1FZFA 2RKLA 1S1CX 3C1LA 4ZNCA 1RQUA 3L75G 5APTA 5AW2B 1IJDB 2KZJA 1RF0C 2ZT9B 3CWBD 3GMAA 1M57D 2ZXEB 4KT0J 4M3LA 1K04A 3L70E 3F89A 3WUVA 1GU4A 1M8OB 3KYQA 1GL2A 1SQBD 3HD7C 1G2CB 3G9RA 1HJ0A 3JC22 4IL6H 1AQ5A 2W27A 1NH4A 3H1IG 2O1KA 1YJWP 1BE3G 1JY2P 2HR3A 2FYUG 3CC7P 1KV4A 3RK3E 1AQTA 1BE3D 2KI7B 2B87A 1OIPA 1FZBA 2FYNB 3H32A 4TLFA 3TGUG 4HJGH 1YHQP 1KMIZ 2WSCH 3B5ND 4WWIA 5CBOA 1MZ9A 2B88A 1X9VA 4OGQB 3CC4P 1LP1A 3G4SP 1GK4A 3MUDC 3CXHI 4UB6E 2MJZA 1GU5A 1HTLC 5AVVB 4AYCA 3H1HG 1ZR2A 2ZT9C 2J59M 2BASA 3FWLA 1BSHA 2R32A 2E75C 4PV1D 1VQ8P 4OVNF 1LTGC 1G1IA 1T6AA 3M91A 5KKZC 1URQB 4IFFA 1EDJA 1URQD 4H0LC 5KAFH 4YXWH 3H1KJ 5KJ7C 1SQXJ 1FZEA 1M1JB 3Q2YA 2K9YA 1S5LE 2HODB 1LT1A 1RE3A 1SQQD 1NTKK 2OGUA 1DH3A 1HVVA 1OFCX 4I1LA 4EOTA 4IFMA 2PGDA 2W90A 1T3JA 1ZXGA 2XNDH 2AEMA 2HG5D 4WY4A 5CJ0A 3U59A 1E79H 2A45G 2I1JA 2WQYC 3BASA 3C8VA 1L0LK 2HLOA 2IBZI 2R3CA 2KZIA 4OGQD 3UIAA 1PPJD 3I55P 1PV3A 3ABVC 2JKVA 2Y0EA 4A7PA 3CCJP 3Q5SA 5TJHA 2H43A 1JY3P 1NAFA 3O6QA 1KFMA 3GHGC 3BATA 1Q81Q 2HYNA 2FFDA 1JEKA 2KB7P 4RJTA 3A2AA 5AW9B 2Q5UA 1L0ND 3QWOC 4JQ0D 3V5BA 4ZKUA 2ZT9D 2IX7C 3E7KA 5AVWB 5KLVK 3LIEA 3E1IA 3KZIE 2I1KA 2JO1A 2FBWC 4BXLA 3HE4A 1M56D 1BDDA 5C39A 3OAKA 1GW3A 2YKOA 1DD3A 5CMZA 3L37A 2E74C 1LTJC 1NTKD 4L73A 2P1JA 2LXBA 2OARA 1YI2P 2KNCA 1KN7A 2FFDC 1LJ2A 3HD7D 3H1HD 5KJ7A 1JTHB 3SWFA 2I8DA 5CJ4A 3H1JE 3CX5H 5TISE 3H1HJ 4Z1MH 2HPCA 2M8RA 1S4XA 2YNYA 1SVFA 1KILE 3L73G 3NTNA 4GOFA 3RK2B 3SFEC 1FZAA 4W80A 1SFCD 1L0NG 3USSA 1T2KC 2YIUB 4PV1C 2WT7A 1N73A 3CD6P 3VTPC 1KYOE 1PGOA 2D2CC 2XDJA 3AE4C 3R4YA 1J1DC 4C7RA 5CCGD 3TYYA 3IAOA 3V2QA 1FC2C 4UB8H 4DOJA 1NJIQ 1ZLLA 4U3FJ 5AVZB 3L35A 2OYIA 3P8MC 1IFMA 3HTKA 1PP9J 5E79E 2YKPA 3RL0B 4GT1A 3CCSP 1J1EB 1L0NJ 3NXSA 1PPJG 1NWQA 1Q2NA 2Q1KA 3A0BH 3RK3D 1VQ6P 3GG2A 2WSFH 1WT6A 3B5NA 1N73B 2NRGA 1HGZA 3RK2C 1ZMEC 3B4SA 5KLVD 1SFCC 1NHLA 3V6IA 1HF9A 2XNXA 3S4RA 3VMYA 2BCCJ 5KLVJ 2QSIA 1ZP0C 1WMKA 2P67A 2XZRA 2AEFA 2QJKC 1W5CE 3PRJA 1P84E 4XA4A 1VQ7P 1S2EA 3RL0C 1KQLA 1N86A 1SQBJ 3GW6A 1U57A 2R5BA 3WMM0 1A02J 1L0LD 3CCQP 2QJPB 2WMMA 2E75D 3HUSC 1EZVG 2R3SA 3CWBG 2OYHA 2ZYDA 3D6YA 1NTME 1YQ3C 4W7ZA 4CPGA 2A06G 1W2BO 1SLQA 1Y9BA 3HUSA 4OH8B 1FDIA 1Q82Q 2E75B 1NAYA 3RK2D 3V2PA 2Q3IA 2M0BA 2ZAEB 1EZVI 3H1HE 1KC8Q 1BSNA 2WPQA 3VP8A 1GL2B 2B9BA 1MUUA 2ITAA 1VQLP 3O8ZA 1SQBE 4N78D 3T97B 3AE5C 1NKZB 4YXDC 2E43A 3B5NC 3HD7B 2Q3EA 1PL5A 1YQ4C 4XE5B 5APSA 2G3AA 5KLIC 1AV1A 3O6QB 3TF5A 2WSEH 4BWNA 2ZJSE 1FU1A 3L71G 4D6TE 2W83C 1P84I 2E42A 3AECC 1KQFB 3SFDC 3VMZA 1BCCG 1RF1B 1YYCA 2C0WA 3H1IE 5CHXA 4DCKA 2Y9YA 1W2EA 1GMJA 2HFED 2L5GB 2C9LY 1S5LX 3MGNA 4H0LD 1SQVK 1H88A 5KAFE 1QVFO 1SQBK 2FYUJ 5E79H 2AXTH 4JBZA 2QM7A 3V4WA 3A0HE 1OVRA 2IYPA 1T8ZA 2IFNA 1ZW0A 1EZVE 2P10A 3NFQA 4C46A 1LTJB 4WBAA 5BU5A 1VL2A 3A5TA 3AE7C 3L75J 4K35A 1JOCA 3HRNA 3L71J 5CCHD 4AQRD 3TGUE 2FXOA 4DJGA 2HPCB 2FFDB 1BGYE 4JYBA 1IC2A 1ZN5A 5APYA 4PD4E 2D2CD 3H1JJ 1YJNP 1SQXD 3CXHH 1SQPG 2Y9ZA 1IFPA 1CSBA 4C7NB 4D6TG 1KYOI 2O01J 1VQ4P 4KHXA 4ASWA 1J1EC 1CZQA 1IZNB 1N8RQ 1FOSE 3L72G 1L0LJ 1VPCA 1M90Q 1CI6B 1RE4C 5KJ7D 3P8CE 2BEQD 3A3YB 1D7MA 2IBZG 2V7QJ 3KZIH 3JCUH 1SQPJ 1EZVD 3L71E 2IPPA 1NTZD 3M06A 2SPZA 1RE4A 4WVZA 1QEXA 2IBZD 3BCCJ 4Y28J 5APVA 4C7NA 4PJ0H 3MP7B 4GKGA 4TT3H 5KAIE 5KLIB 1SQXE 1KD1Q 3H1KG 2KUBA 3I5CA 2QIWA 2QJKB 3CX5D 2GM4A 3H6PA 3OJAB 1EDKA 2FYUK 3N4XA 5CCHC 5B66E 1JTHA 2C9NY 2O01N 2QRXA 4XFJA 1JO5A 2W6JH 1SQVJ 2QA4P 4QMAA 4ZMDA 3PHLA 5CCHA 3CX5I 1G2CA 1NTMG 1NU1K 1DX7A 1EDIA 2W6AA 1PP9D 1KZUB 2K88A 1L4AC 2WPSA 1GZLA 2A06E 1NTZE 5K5GB 1U7JA 3V2NA 3L75E 1GD2E 3H1LE 3TK1A 1NO4A 1L4AA 2B89A 2QJPC 3HUSB 4PV1B 1JY3O 2YKQA 5GTIE 5KLVE 1NGMB 1JMBA 2D2CB 3HTKB 3U1AA 4EDFA 1VQKP 2IYOA 1BE3E 2JEEA 1L0NE 2FYNC 5APUA 1SQVE 2QVAA 1SQXG 3A0HH 2KYVA 4U3FG 2ZVNB 3A0BE 1LWUB 1E5WA 1R5LA 3B5NB 2FKWB 1K73Q 1BCCE 1FBMA 3KQGA 5AVXB 5APQA 1GL2C 3HD7A 3TSIA 3VP9A 4EI2A 1DD4A 1IK7A 5AVRB 1LTAC 2V7QH 1DEEG 1DEBA 3K5BA 2WZ7A 5AVSB 5GTHH 1LTIC 2P2UA 5H2FH 1FDMA 1Q7YQ 1RF1C 5KKZB 1KYOH 1FAVA 1NTZG 1PGQA 2HODA 3F5HA 4EIJA 1P84D 2AXCA 1MFZA 1VQMP 4N6JA 2O01H 1VQOP 4EYYQ 3CCEP 1HJBA 2Z4EA 1RHZB 1LT9A 2MKVA 1FS0E 2VRSA 4IL6X 4L74A 3I56P 1H0TB 4IOIH 1HH0A 3VMXA 5AW7B 3MUDA 3H1ID 2OYHB 2R44A 4NPFX 1SQVD 3AEGC 3CMAP 2GUVA 3D70A 1JCCA 5AW0B 2BCCG 2WWWA 1BGYG 2IZ1A 4DZOA 4I2LC 4JPZB 3JCUE 3L72D 5APWA 2BCCD 2E5TA 2LR2A 4YPCA 2KXPB 3U1CA 3LIDA 1S72P 5AW5B 2J5UA 2KK7A 1N2DC 1OXZA 1RH5B 5AW1B 1NYHA 4DT0A 1KB9E 1JB0J 1IFJA 2E76C 3L74D 3ZDMA 3V4QA 3SWYA 4ZKPA 1LT9B 2J58A 2M5AB 3KXDA 1SQQJ 1Y8AA 5AW8B 1QVGO 4N78E 1N73C 4AUWA 3KDPB 1A02F 3PJSK 1JCDA 1PP9E 2PP6A 3H1KD 3AE3C 3H1LJ 1LTTC 5H2FE 5GTHE 1M7LA 2W6BA 2W8ZA 3LW5H 4Y99B 2NPSD 4PD4H 5AVQB 3RBZA 1HUCA 1N7SC 2NPSB 3RK3C 1VQ5P 1P84H 4U3FD 1MV8A 4D6TJ 1LGHB 2N9BA 2BEZF 3AE1C 1RF1A 1NU1E 1SQQG 3IR9A 4GDOA 4LC1A 5M1BA 3B8EB 2PFXA 1X79B 1NKNA 1LWUC 3EFFK 2WSEJ 2YMKA 3W68A 3AE9C 4UB8E 3CC2P 1FOSF 1LT9C 2IDBA 1BCCJ 2RMZA 3A7OA 1L0LE 2AEJA 1NTKG 4LGDE 2OTLP 1KFNA 1YIJP 1FDOA 2XKMA 1UIIA 4RESB 5GTIH 2H8PD 1X0TA 3FXEA 5L8RJ 3SSUA 5CCGA 2H88C 3CCVP 1HBWA 5AVYB 3G71P 2QEXP 1JNMA 2POHA 1LTJA 3CX5E 5TISH 2LKMA 4RO0A 1H8AA 3RK3B 1K05A 1G1JA 2KLVA 2YO3A 1QLED 4NPEA 4PJ0E 3TGUJ 3AEFC 3E1RA 1VQNP 4UB6H 3V2RA 2YO2A 1H89A 1BGYD 5AVUB 3RL0D 3IF4A 5KAIH 3H25A 1VF5D 3WU2E 4H13D 1S3JA 5B66H 3OA7A 3M9QA 1EXIA 1KB9H 3CCMP 3TGUD 3Q5RA 2FXMA 3TNUB 3MHVA 4RKUJ 1MKMA 1K9MQ 1L4AB 2KOGA 4HKZH 3WU2H 3GHGA 2ZVOB 3HE5B 1M1KQ 1SQQK 2A45H 3AE6C 3G3ZA 1SFCB 1AA0A 1NTKE 2WSCJ 3VN0A 1HGVA 3FX0A 2E5YA 2C0XA 2QE7H 3IFMA 4HH2A 1JUNA 1SS1A 2O1JA 4L76A 1KILC 1LWUA 3GF7A 1BCCD 2GA1A 5BVZA 1VQPP 3RGUA 2IZ0A 3CL3D 1JMMA 4HYTB 2K37A 3L36A 3TNUA 2L91A 4U3FE 3CCRP 1JY2O 1AVOA 2RH0A 1LTBC 3HE5A 4H13C 2K3RA 1KQSO 5CCGC 3GLMA 2M3EA 2RN0A 3CWBE 1SFCA 1S9KE 4GIFA 3L74G 2Q6QA 3EQ2A 1BGYJ 2AXTE 3C9IA 2QJYB 1VQ9P 1FE6A 3CI9A 3PH0A 3AEDC 1H0TA 2ZXXA 3BRVB 4WB4A 2Q7CA 3L72E 1N7LA 2A06D 1KILB 3AE8C 4OGQC 1QL1A 1RE3C 3M9BA 2OQQA 3PP5A 1USDA 2M3BA 4YTPC 2OYOA 2PRRA 5EFWB 5AW3B 5BU8B 2H89C 4OWFA 4WY4C 1EXJA 3FGAD 3HE4B 1S5LH 1NVOA 1YJ9P 3VYIA 1GDTA 1BE3J 2E76B 1L0NK 2OYIC 2WVRA 1KILD 2LXCB 2CPSA 4I7ZC 4BRYA 3M0AA 3BCCE 3N7NA 2KNCB 3EWKA 1RY3A 1RQVA 2JDIH 2QM8A 4H0LB 3NMDA 3H1KE 1KILA 2QJYC 4Y99C 4PD4I 2WPRA 1N7SB 1J2JB 2NPSC 3VMAA 1KYOD 1J1DB 2YXRB 4IL6E 2CPBA 3TDKA 5CBNA 5APXA 2XV5A 1GW4A 1LTSC 1NOHA 3AE2C 3FXDA 2OTKE 2Y0CA 2K1AA 3PTZA 4N3YB 1N7SD 4BRYB 1NTMJ 3H32B 1QL2A 3AEBC 3S1KA 2FYZA 3L74J 2OYIB 1X22A 1FZCA 1GL2D 1KB9I 2Y0DA 2E76D 1AFOA 2Q9IA 1AVYA 1T3UA 2O3JA 1EDLA 1IO4A 1GK6A 3Q1MA 1YITP 5AW4B 1JY3N 1L0LG 1YTZT 3H1IJ 3QH9A 5DJTB 3MTUE 5AVTB 3L70J 2A45I 1URQA 3RBXA 3CPWO 2WSSH 2KP8A 2E74B
chains in the Genus database with same CATH topology
3MD0A 1IFDA 2N1TB 2JJLA 1X8YA 3II6A 4IFDK 3R2PA 1WRGA 2NPSA 2Z5HA 1XTCC 2GUSA 2WTYA 3M0DA 3MIWA 3P7KA 2H7HA 3CLQA 4O9BA 1FJPA 4B86A 2N1TA 1NTMK 1FJKA 3BVHA 1FZCC 1S9KD 1EQ7A 3T97A 2N1TC 3P32A 4LLHA 1PFIA 1ZV8A 5KTBA 1L4AD 2Z5IA 1M1JC 2PAJA 3L4FA 1XTGB 4JF7A 1JY2N 3P8CD 1URQC 3VOPA 1M1JA 1VDFA 2P7JA 4W7YA 4ZKPA 4I6MC 1YTZI 4WY4B 5AW6B 1Z56A 3GHGB 1IK9A 2WT7B 1IFIA 4WY4D 1T2KD 1SQPK 3M0DC 1HWTC 1RF0A 3BRTB 2N1TD 2ZFCA 1N7SA 1FZGA 1NTZK 2KSJA 3M9HA 2IFMA 1CW5A 2WITA 1ZR4A 2XU6A 3KPEA 1FZCB 1CI6A 1OWAA 1IFNA 4JYCA 1SQXK 1SP4A 3EFGA 2YMYA 2R5DA 1FZFA 5APTA 5AW2B 1IJDB 1RF0C 4M3LA 2ZXEB 1GU4A 3KYQA 1GL2A 3HD7C 1G2CB 1AQ5A 2W27A 1NH4A 2O1KA 1JY2P 3H32A 1FZBA 2WSCH 3B5ND 1MZ9A 1X9VA 1GK4A 1GU5A 2MJZA 1HTLC 5AVVB 4AYCA 1ZR2A 2J59M 2BASA 2R32A 1LTGC 1G1IA 3M91A 1URQB 4IFFA 1URQD 5KJ7C 1FZEA 1M1JB 2HODB 1RE3A 1DH3A 1NTKK 1HVVA 4I1LA 4EOTA 4IFMA 1T3JA 5CJ0A 2HG5D 4WY4A 3U59A 2A45G 2I1JA 3BASA 1GTWA 1L0LK 2HLOA 2R3CA 3UIAA 1JY3P 1NAFA 1KFMA 3GHGC 3BATA 2HYNA 2KB7P 3A2AA 5AW9B 2Q5UA 3V5BA 4ZKUA 2IX7C 5AVWB 5KLVK 3LIEA 3E1IA 2I1KA 3HE4A 3OAKA 1GW3A 2YKOA 5CMZA 3L37A 1LTJC 2P1JA 2OARA 2FFDC 3HD7D 5KJ7A 1JTHB 3SWFA 5CJ4A 2HPCA 2M8RA 2YNYA 3NTNA 1SVFA 2FFDA 3RK2B 1T2KC 1FZAA 4W80A 1SFCD 2WT7A 1N73A 3VTPC 4C7RA 2XDJA 1J1DC 5CCGD 3TYYA 3V2QA 4DOJA 1ZLLA 5AVZB 3L35A 2OYIA 3P8MC 1IFMA 3HTKA 3RL0B 2YKPA 4GT1A 1J1EB 3NXSA 1NWQA 3RK3D 2WSFH 1WT6A 3B5NA 1N73B 1HGZA 3RK2C 1SFCC 1NHLA 2XNXA 3VMYA 2XZRA 2P67A 4XA4A 3RL0C 1KQLA 1N86A 3WMM0 2R5BA 1A02J 3HUSC 2OYHA 4W7ZA 1SLQA 3HUSA 4OH8B 3RK2D 3V2PA 2Q3IA 2WPQA 3VP8A 1GL2B 1MUUA 3O8ZA 4N78D 1NKZB 2E43A 3B5NC 3HD7B 4XE5B 5APSA 2WSEH 1FU1A 2E42A 3VMZA 1RF1B 1YYCA 2C0WA 5CHXA 1W2EA 2HFED 2L5GB 2C9LY 3MGNA 1SQVK 1SQBK 2QM7A 3V4WA 1T8ZA 2IFNA 3NFQA 4C46A 1LTJB 4WBAA 5BU5A 3A5TA 5CCHD 1JOCA 3HRNA 2HPCB 4AQRD 2FFDB 4JYBA 1IC2A 1ZN5A 5APYA 1CSBA 4C7NB 4KHXA 1J1EC 1CZQA 1FOSE 1VPCA 1CI6B 1RE4C 5KJ7D 3P8CE 3A3YB 2IPPA 3M06A 1RE4A 5APVA 4GKGA 3I5CA 2GM4A 3H6PA 3OJAB 2FYUK 3N4XA 5CCHC 1JTHA 2C9NY 1JO5A 5CCHA 1G2CA 1NU1K 1DX7A 2W6AA 2WPSA 1KZUB 1L4AC 1GZLA 3V2NA 1GD2E 3TK1A 1NO4A 1L4AA 3HUSB 1JY3O 2YKQA 3HTKB 3U1AA 2JEEA 5APUA 2KYVA 1LWUB 1E5WA 3B5NB 2FKWB 1FBMA 3KQGA 5AVXB 5APQA 1GL2C 3HD7A 3TSIA 3VP9A 5AVRB 1LTAC 5AVSB 1DEBA 2WZ7A 1LTIC 2P2UA 1FDMA 1RF1C 1FAVA 2HODA 4EIJA 1MFZA 4N6JA 2O01H 1HJBA 2Z4EA 1LT9A 2VRSA 1HH0A 3VMXA 5AW7B 3MUDA 2OYHB 2GUVA 1JCCA 5AW0B 2WWWA 4DZOA 4I2LC 5APWA 3U1CA 3LIDA 5AW5B 1N2DC 1OXZA 5AW1B 1IFJA 3V4QA 3SWYA 1LT9B 2J58A 5AW8B 1N73C 4AUWA 4N78E 3KDPB 1A02F 1JCDA 2PP6A 1LTTC 1M7LA 2W6BA 3LW5H 5AVQB 4Y99B 2NPSD 4C7NA 1H88A 2H43A 1HUCA 1N7SC 2NPSB 3RK3C 1MV8A 1LGHB 2N9BA 1RF1A 3IR9A 4LC1A 3B8EB 1X79B 1NKNA 1LWUC 1FOSF 1LT9C 3A7OA 4LGDE 1KFNA 2XKMA 4RESB 2H8PD 5CCGA 1HBWA 5AVYB 1JNMA 2POHA 1LTJA 2LKMA 1H8AA 3RK3B 2YO3A 1G1JA 2KLVA 3V2RA 2YO2A 1H89A 3RL0D 5AVUB 2OYHC 3OA7A 3M9QA 2FXMA 3TNUB 1L4AB 2KOGA 3GHGA 3HE5B 1SQQK 2A45H 3G3ZA 1SFCB 3VN0A 1HGVA 2C0XA 3IFMA 4HH2A 1JUNA 2O1JA 1KILC 1LWUA 5BVZA 3CL3D 1JMMA 4HYTB 3L36A 3TNUA 1JY2O 1LTBC 3HE5A 5CCGC 1SFCA 1S9KE 4GIFA 3EQ2A 3C9IA 3CI9A 2Q7CA 3BRVB 4WB4A 1N7LA 1KILB 1QL1A 1RE3C 3M9BA 3PP5A 2M3BA 5AW3B 5BU8B 4WY4C 3HE4B 3VYIA 1GDTA 1L0NK 2OYIC 1KILD 2CPSA 3M0AA 3N7NA 1RY3A 2QM8A 3NMDA 1KILA 4Y99C 2WPRA 1N7SB 1J2JB 2NPSC 1J1DB 2CPBA 5APXA 2XV5A 1GW4A 1LTSC 1NOHA 4N3YB 1N7SD 3H32B 1QL2A 2FYZA 2OYIB 1FZCA 1GL2D 1AFOA 2Q9IA 1T3UA 1IO4A 1GK6A 5AW4B 1JY3N 1YTZT 3MTUE 5AVTB 2A45I 1URQA 2KP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NO4 A;  3MTU E;  4IFF A;  3OA7 A;  1NOH A; 
#chains in the Genus database with same CATH topology
 2M5A A;  5B5E H;  3ITK A;  1OVV A;  3L73 D;  3MD0 A;  4ASV A;  3OW2 O;  1SQP E;  1IFD A;  2P58 A;  2N1T B;  2JJL A;  1OZH A;  1X8Y A;  3FWN A;  3II6 A;  3JSV C;  1QGK B;  3LW5 J;  4NPD A;  3WUU A;  2OYH C;  2KIK A;  4IFD K;  3L70 D;  1UIX A;  3R2P A;  4U7J A;  1WRG A;  2NPS A;  1Q90 D;  3L70 G;  2Z5H A;  1XTC C;  1PP9 G;  2GUS A;  2YIU C;  1Y47 A;  3H1J G;  5B5E E;  2WTY A;  2IBZ E;  4GOE A;  4GOD A;  3M0D A;  3MIW A;  3P7K A;  3Q5P A;  1R8E A;  2H7H A;  3CLQ A;  4O9B A;  1FJP A;  4B86 A;  1LNQ A;  3BCC D;  3D6Z A;  2N1T A;  1TU3 F;  1NTM K;  1NTZ J;  1LP1 B;  1FJK A;  1NU1 G;  3BVH A;  1FZC C;  4KJM A;  4R4L A;  1S9K D;  2ZYG A;  2FXP A;  5KLV G;  1EQ7 A;  3T97 A;  2N1T C;  3IN6 A;  3P32 A;  4LLH A;  1PFI A;  1ZV8 A;  1SQV G;  1ZRT E;  1L4A D;  2Z5I A;  3GF3 A;  5KTB A;  1M1J C;  4D6T D;  2PAJ A;  3L4F A;  2JR8 A;  3MZW B;  1K8A Q;  1KQG B;  1XTG B;  1YBK A;  1JY2 N;  4JF7 A;  1BDC A;  4H13 B;  1PZQ A;  4H44 D;  1VF5 B;  1URQ C;  2G8Y A;  3H1L D;  3P8C D;  1KB9 D;  4H44 C;  5DJU B;  1M1J A;  1VDF A;  3VOP A;  3H1J D;  3W67 A;  2P7J A;  3H1L G;  1OW7 A;  3D71 A;  4W7Y A;  4HB1 A;  3CXH E;  2KSE A;  3SWK A;  1PIX A;  2K9J B;  4I6M C;  1YTZ I;  2N9Y B;  3L71 D;  4WY4 B;  2KLU A;  2CK3 H;  2FY8 A;  5AW6 B;  1Z56 A;  4MN4 C;  2JWD A;  3GHG B;  2OTJ P;  2DW3 A;  1IK9 A;  1NU1 J;  1SQQ E;  2UWJ E;  1NU1 D;  2V4H A;  3PLN A;  3RL0 g;  3S9O A;  3L72 J;  4I7Z B;  2WT7 B;  3CCU P;  1GTW A;  2YXQ B;  2KS1 B;  3AEA C;  4K3A A;  1IFI A;  1USE A;  1OMI A;  4WY4 D;  1T2K D;  1SQP D;  1SQP K;  3M0D C;  1HWT C;  1ZRT D;  1PGJ A;  2FYU D;  1RF0 A;  3CXH D;  1VF5 C;  3G6E P;  2JWA A;  3CCL P;  1MFT A;  3BRT B;  1JM0 A;  2N1T D;  2ZFC A;  4PD4 D;  2K9J A;  4H44 B;  3CME P;  1N7S A;  1FZG A;  1ZOY C;  1OX3 A;  2E74 D;  3L73 J;  1NTZ K;  2KSJ A;  3WUT A;  3M9H A;  2IFM A;  3KHU A;  3CWB J;  3L75 D;  3B71 A;  2KS1 A;  2WIT A;  4R4M A;  2NZ2 A;  3BCC G;  1ZR4 A;  1CW5 A;  2WPV B;  1AJY A;  2BCC E;  2XU6 A;  1SQB G;  1DIP A;  3KPE A;  1EC5 A;  3AEE C;  2FYU E;  1FZC B;  1CI6 A;  1OWA A;  1IFN A;  4JYC A;  1SQX K;  2QG4 A;  1SP4 A;  1KOR A;  4L75 A;  1L2P A;  2JP3 A;  3EFG A;  1PPJ E;  2WSF J;  3L74 E;  1R5S A;  1NTK J;  1PGP A;  2YMY A;  1NTM D;  1U7M A;  3L73 E;  1OW8 A;  1OVU A;  1OW6 A;  3Q3D A;  2R5D A;  2ZYA A;  2B87 B;  1Q86 Q;  1KTM A;  1QX8 A;  1FZF A;  2RKL A;  1S1C X;  3C1L A;  4ZNC A;  1RQU A;  3L75 G;  5APT A;  5AW2 B;  1IJD B;  2KZJ A;  1RF0 C;  2ZT9 B;  3CWB D;  3GMA A;  1M57 D;  2ZXE B;  4KT0 J;  4M3L A;  1K04 A;  3L70 E;  3F89 A;  3WUV A;  1GU4 A;  1M8O B;  3KYQ A;  1GL2 A;  1SQB D;  3HD7 C;  1G2C B;  3G9R A;  1HJ0 A;  3JC2 2;  4IL6 H;  1AQ5 A;  2W27 A;  1NH4 A;  3H1I G;  2O1K A;  1YJW P;  1BE3 G;  1JY2 P;  2HR3 A;  2FYU G;  3CC7 P;  1KV4 A;  3RK3 E;  1AQT A;  1BE3 D;  2KI7 B;  2B87 A;  1OIP A;  1FZB A;  2FYN B;  3H32 A;  4TLF A;  3TGU G;  4HJG H;  1YHQ P;  1KMI Z;  2WSC H;  3B5N D;  4WWI A;  5CBO A;  1MZ9 A;  2B88 A;  1X9V A;  4OGQ B;  3CC4 P;  1LP1 A;  3G4S P;  1GK4 A;  3MUD C;  3CXH I;  4UB6 E;  2MJZ A;  1GU5 A;  1HTL C;  5AVV B;  4AYC A;  3H1H G;  1ZR2 A;  2ZT9 C;  2J59 M;  2BAS A;  3FWL A;  1BSH A;  2R32 A;  2E75 C;  4PV1 D;  1VQ8 P;  4OVN F;  1LTG C;  1G1I A;  1T6A A;  3M91 A;  5KKZ C;  1URQ B;  4IFF A;  1EDJ A;  1URQ D;  4H0L C;  5KAF H;  4YXW H;  3H1K J;  5KJ7 C;  1SQX J;  1FZE A;  1M1J B;  3Q2Y A;  2K9Y A;  1S5L E;  2HOD B;  1LT1 A;  1RE3 A;  1SQQ D;  1NTK K;  2OGU A;  1DH3 A;  1HVV A;  1OFC X;  4I1L A;  4EOT A;  4IFM A;  2PGD A;  2W90 A;  1T3J A;  1ZXG A;  2XND H;  2AEM A;  2HG5 D;  4WY4 A;  5CJ0 A;  3U59 A;  1E79 H;  2A45 G;  2I1J A;  2WQY C;  3BAS A;  3C8V A;  1L0L K;  2HLO A;  2IBZ I;  2R3C A;  2KZI A;  4OGQ D;  3UIA A;  1PPJ D;  3I55 P;  1PV3 A;  3ABV C;  2JKV A;  2Y0E A;  4A7P A;  3CCJ P;  3Q5S A;  5TJH A;  2H43 A;  1JY3 P;  1NAF A;  3O6Q A;  1KFM A;  3GHG C;  3BAT A;  1Q81 Q;  2HYN A;  2FFD A;  1JEK A;  2KB7 P;  4RJT A;  3A2A A;  5AW9 B;  2Q5U A;  1L0N D;  3QWO C;  4JQ0 D;  3V5B A;  4ZKU A;  2ZT9 D;  2IX7 C;  3E7K A;  5AVW B;  5KLV K;  3LIE A;  3E1I A;  3KZI E;  2I1K A;  2JO1 A;  2FBW C;  4BXL A;  3HE4 A;  1M56 D;  1BDD A;  5C39 A;  3OAK A;  1GW3 A;  2YKO A;  1DD3 A;  5CMZ A;  3L37 A;  2E74 C;  1LTJ C;  1NTK D;  4L73 A;  2P1J A;  2LXB A;  2OAR A;  1YI2 P;  2KNC A;  1KN7 A;  2FFD C;  1LJ2 A;  3HD7 D;  3H1H D;  5KJ7 A;  1JTH B;  3SWF A;  2I8D A;  5CJ4 A;  3H1J E;  3CX5 H;  5TIS E;  3H1H J;  4Z1M H;  2HPC A;  2M8R A;  1S4X A;  2YNY A;  1SVF A;  1KIL E;  3L73 G;  3NTN A;  4GOF A;  3RK2 B;  3SFE C;  1FZA A;  4W80 A;  1SFC D;  1L0N G;  3USS A;  1T2K C;  2YIU B;  4PV1 C;  2WT7 A;  1N73 A;  3CD6 P;  3VTP C;  1KYO E;  1PGO A;  2D2C C;  2XDJ A;  3AE4 C;  3R4Y A;  1J1D C;  4C7R A;  5CCG D;  3TYY A;  3IAO A;  3V2Q A;  1FC2 C;  4UB8 H;  4DOJ A;  1NJI Q;  1ZLL A;  4U3F J;  5AVZ B;  3L35 A;  2OYI A;  3P8M C;  1IFM A;  3HTK A;  1PP9 J;  5E79 E;  2YKP A;  3RL0 B;  4GT1 A;  3CCS P;  1J1E B;  1L0N J;  3NXS A;  1PPJ G;  1NWQ A;  1Q2N A;  2Q1K A;  3A0B H;  3RK3 D;  1VQ6 P;  3GG2 A;  2WSF H;  1WT6 A;  3B5N A;  1N73 B;  2NRG A;  1HGZ A;  3RK2 C;  1ZME C;  3B4S A;  5KLV D;  1SFC C;  1NHL A;  3V6I A;  1HF9 A;  2XNX A;  3S4R A;  3VMY A;  2BCC J;  5KLV J;  2QSI A;  1ZP0 C;  1WMK A;  2P67 A;  2XZR A;  2AEF A;  2QJK C;  1W5C E;  3PRJ A;  1P84 E;  4XA4 A;  1VQ7 P;  1S2E A;  3RL0 C;  1KQL A;  1N86 A;  1SQB J;  3GW6 A;  1U57 A;  2R5B A;  3WMM 0;  1A02 J;  1L0L D;  3CCQ P;  2QJP B;  2WMM A;  2E75 D;  3HUS C;  1EZV G;  2R3S A;  3CWB G;  2OYH A;  2ZYD A;  3D6Y A;  1NTM E;  1YQ3 C;  4W7Z A;  4CPG A;  2A06 G;  1W2B O;  1SLQ A;  1Y9B A;  3HUS A;  4OH8 B;  1FDI A;  1Q82 Q;  2E75 B;  1NAY A;  3RK2 D;  3V2P A;  2Q3I A;  2M0B A;  2ZAE B;  1EZV I;  3H1H E;  1KC8 Q;  1BSN A;  2WPQ A;  3VP8 A;  1GL2 B;  2B9B A;  1MUU A;  2ITA A;  1VQL P;  3O8Z A;  1SQB E;  4N78 D;  3T97 B;  3AE5 C;  1NKZ B;  4YXD C;  2E43 A;  3B5N C;  3HD7 B;  2Q3E A;  1PL5 A;  1YQ4 C;  4XE5 B;  5APS A;  2G3A A;  5KLI C;  1AV1 A;  3O6Q B;  3TF5 A;  2WSE H;  4BWN A;  2ZJS E;  1FU1 A;  3L71 G;  4D6T E;  2W83 C;  1P84 I;  2E42 A;  3AEC C;  1KQF B;  3SFD C;  3VMZ A;  1BCC G;  1RF1 B;  1YYC A;  2C0W A;  3H1I E;  5CHX A;  4DCK A;  2Y9Y A;  1W2E A;  1GMJ A;  2HFE D;  2L5G B;  2C9L Y;  1S5L X;  3MGN A;  4H0L D;  1SQV K;  1H88 A;  5KAF E;  1QVF O;  1SQB K;  2FYU J;  5E79 H;  2AXT H;  4JBZ A;  2QM7 A;  3V4W A;  3A0H E;  1OVR A;  2IYP A;  1T8Z A;  2IFN A;  1ZW0 A;  1EZV E;  2P10 A;  3NFQ A;  4C46 A;  1LTJ B;  4WBA A;  5BU5 A;  1VL2 A;  3A5T A;  3AE7 C;  3L75 J;  4K35 A;  1JOC A;  3HRN A;  3L71 J;  5CCH D;  4AQR D;  3TGU E;  2FXO A;  4DJG A;  2HPC B;  2FFD B;  1BGY E;  4JYB A;  1IC2 A;  1ZN5 A;  5APY A;  4PD4 E;  2D2C D;  3H1J J;  1YJN P;  1SQX D;  3CXH H;  1SQP G;  2Y9Z A;  1IFP A;  1CSB A;  4C7N B;  4D6T G;  1KYO I;  2O01 J;  1VQ4 P;  4KHX A;  4ASW A;  1J1E C;  1CZQ A;  1IZN B;  1N8R Q;  1FOS E;  3L72 G;  1L0L J;  1VPC A;  1M90 Q;  1CI6 B;  1RE4 C;  5KJ7 D;  3P8C E;  2BEQ D;  3A3Y B;  1D7M A;  2IBZ G;  2V7Q J;  3KZI H;  3JCU H;  1SQP J;  1EZV D;  3L71 E;  2IPP A;  1NTZ D;  3M06 A;  2SPZ A;  1RE4 A;  4WVZ A;  1QEX A;  2IBZ D;  3BCC J;  4Y28 J;  5APV A;  4C7N A;  4PJ0 H;  3MP7 B;  4GKG A;  4TT3 H;  5KAI E;  5KLI B;  1SQX E;  1KD1 Q;  3H1K G;  2KUB A;  3I5C A;  2QIW A;  2QJK B;  3CX5 D;  2GM4 A;  3H6P A;  3OJA B;  1EDK A;  2FYU K;  3N4X A;  5CCH C;  5B66 E;  1JTH A;  2C9N Y;  2O01 N;  2QRX A;  4XFJ A;  1JO5 A;  2W6J H;  1SQV J;  2QA4 P;  4QMA A;  4ZMD A;  3PHL A;  5CCH A;  3CX5 I;  1G2C A;  1NTM G;  1NU1 K;  1DX7 A;  1EDI A;  2W6A A;  1PP9 D;  1KZU B;  2K88 A;  1L4A C;  2WPS A;  1GZL A;  2A06 E;  1NTZ E;  5K5G B;  1U7J A;  3V2N A;  3L75 E;  1GD2 E;  3H1L E;  3TK1 A;  1NO4 A;  1L4A A;  2B89 A;  2QJP C;  3HUS B;  4PV1 B;  1JY3 O;  2YKQ A;  5GTI E;  5KLV E;  1NGM B;  1JMB A;  2D2C B;  3HTK B;  3U1A A;  4EDF A;  1VQK P;  2IYO A;  1BE3 E;  2JEE A;  1L0N E;  2FYN C;  5APU A;  1SQV E;  2QVA A;  1SQX G;  3A0H H;  2KYV A;  4U3F G;  2ZVN B;  3A0B E;  1LWU B;  1E5W A;  1R5L A;  3B5N B;  2FKW B;  1K73 Q;  1BCC E;  1FBM A;  3KQG A;  5AVX B;  5APQ A;  1GL2 C;  3HD7 A;  3TSI A;  3VP9 A;  4EI2 A;  1DD4 A;  1IK7 A;  5AVR B;  1LTA C;  2V7Q H;  1DEE G;  1DEB A;  3K5B A;  2WZ7 A;  5AVS B;  5GTH H;  1LTI C;  2P2U A;  5H2F H;  1FDM A;  1Q7Y Q;  1RF1 C;  5KKZ B;  1KYO H;  1FAV A;  1NTZ G;  1PGQ A;  2HOD A;  3F5H A;  4EIJ A;  1P84 D;  2AXC A;  1MFZ A;  1VQM P;  4N6J A;  2O01 H;  1VQO P;  4EYY Q;  3CCE P;  1HJB A;  2Z4E A;  1RHZ B;  1LT9 A;  2MKV A;  1FS0 E;  2VRS A;  4IL6 X;  4L74 A;  3I56 P;  1H0T B;  4IOI H;  1HH0 A;  3VMX A;  5AW7 B;  3MUD A;  3H1I D;  2OYH B;  2R44 A;  4NPF X;  1SQV D;  3AEG C;  3CMA P;  2GUV A;  3D70 A;  1JCC A;  5AW0 B;  2BCC G;  2WWW A;  1BGY G;  2IZ1 A;  4DZO A;  4I2L C;  4JPZ B;  3JCU E;  3L72 D;  5APW A;  2BCC D;  2E5T A;  2LR2 A;  4YPC A;  2KXP B;  3U1C A;  3LID A;  1S72 P;  5AW5 B;  2J5U A;  2KK7 A;  1N2D C;  1OXZ A;  1RH5 B;  5AW1 B;  1NYH A;  4DT0 A;  1KB9 E;  1JB0 J;  1IFJ A;  2E76 C;  3L74 D;  3ZDM A;  3V4Q A;  3SWY A;  4ZKP A;  1LT9 B;  2J58 A;  2M5A B;  3KXD A;  1SQQ J;  1Y8A A;  5AW8 B;  1QVG O;  4N78 E;  1N73 C;  4AUW A;  3KDP B;  1A02 F;  3PJS K;  1JCD A;  1PP9 E;  2PP6 A;  3H1K D;  3AE3 C;  3H1L J;  1LTT C;  5H2F E;  5GTH E;  1M7L A;  2W6B A;  2W8Z A;  3LW5 H;  4Y99 B;  2NPS D;  4PD4 H;  5AVQ B;  3RBZ A;  1HUC A;  1N7S C;  2NPS B;  3RK3 C;  1VQ5 P;  1P84 H;  4U3F D;  1MV8 A;  4D6T J;  1LGH B;  2N9B A;  2BEZ F;  3AE1 C;  1RF1 A;  1NU1 E;  1SQQ G;  3IR9 A;  4GDO A;  4LC1 A;  5M1B A;  3B8E B;  2PFX A;  1X79 B;  1NKN A;  1LWU C;  3EFF K;  2WSE J;  2YMK A;  3W68 A;  3AE9 C;  4UB8 E;  3CC2 P;  1FOS F;  1LT9 C;  2IDB A;  1BCC J;  2RMZ A;  3A7O A;  1L0L E;  2AEJ A;  1NTK G;  4LGD E;  2OTL P;  1KFN A;  1YIJ P;  1FDO A;  2XKM A;  1UII A;  4RES B;  5GTI H;  2H8P D;  1X0T A;  3FXE A;  5L8R J;  3SSU A;  5CCG A;  2H88 C;  3CCV P;  1HBW A;  5AVY B;  3G71 P;  2QEX P;  1JNM A;  2POH A;  1LTJ A;  3CX5 E;  5TIS H;  2LKM A;  4RO0 A;  1H8A A;  3RK3 B;  1K05 A;  1G1J A;  2KLV A;  2YO3 A;  1QLE D;  4NPE A;  4PJ0 E;  3TGU J;  3AEF C;  3E1R A;  1VQN P;  4UB6 H;  3V2R A;  2YO2 A;  1H89 A;  1BGY D;  5AVU B;  3RL0 D;  3IF4 A;  5KAI H;  3H25 A;  1VF5 D;  3WU2 E;  4H13 D;  1S3J A;  5B66 H;  3OA7 A;  3M9Q A;  1EXI A;  1KB9 H;  3CCM P;  3TGU D;  3Q5R A;  2FXM A;  3TNU B;  3MHV A;  4RKU J;  1MKM A;  1K9M Q;  1L4A B;  2KOG A;  4HKZ H;  3WU2 H;  3GHG A;  2ZVO B;  3HE5 B;  1M1K Q;  1SQQ K;  2A45 H;  3AE6 C;  3G3Z A;  1SFC B;  1AA0 A;  1NTK E;  2WSC J;  3VN0 A;  1HGV A;  3FX0 A;  2E5Y A;  2C0X A;  2QE7 H;  3IFM A;  4HH2 A;  1JUN A;  1SS1 A;  2O1J A;  4L76 A;  1KIL C;  1LWU A;  3GF7 A;  1BCC D;  2GA1 A;  5BVZ A;  1VQP P;  3RGU A;  2IZ0 A;  3CL3 D;  1JMM A;  4HYT B;  2K37 A;  3L36 A;  3TNU A;  2L91 A;  4U3F E;  3CCR P;  1JY2 O;  1AVO A;  2RH0 A;  1LTB C;  3HE5 A;  4H13 C;  2K3R A;  1KQS O;  5CCG C;  3GLM A;  2M3E A;  2RN0 A;  3CWB E;  1SFC A;  1S9K E;  4GIF A;  3L74 G;  2Q6Q A;  3EQ2 A;  1BGY J;  2AXT E;  3C9I A;  2QJY B;  1VQ9 P;  1FE6 A;  3CI9 A;  3PH0 A;  3AED C;  1H0T A;  2ZXX A;  3BRV B;  4WB4 A;  2Q7C A;  3L72 E;  1N7L A;  2A06 D;  1KIL B;  3AE8 C;  4OGQ C;  1QL1 A;  1RE3 C;  3M9B A;  2OQQ A;  3PP5 A;  1USD A;  2M3B A;  4YTP C;  2OYO A;  2PRR A;  5EFW B;  5AW3 B;  5BU8 B;  2H89 C;  4OWF A;  4WY4 C;  1EXJ A;  3FGA D;  3HE4 B;  1S5L H;  1NVO A;  1YJ9 P;  3VYI A;  1GDT A;  1BE3 J;  2E76 B;  1L0N K;  2OYI C;  2WVR A;  1KIL D;  2LXC B;  2CPS A;  4I7Z C;  4BRY A;  3M0A A;  3BCC E;  3N7N A;  2KNC B;  3EWK A;  1RY3 A;  1RQV A;  2JDI H;  2QM8 A;  4H0L B;  3NMD A;  3H1K E;  1KIL A;  2QJY C;  4Y99 C;  4PD4 I;  2WPR A;  1N7S B;  1J2J B;  2NPS C;  3VMA A;  1KYO D;  1J1D B;  2YXR B;  4IL6 E;  2CPB A;  3TDK A;  5CBN A;  5APX A;  2XV5 A;  1GW4 A;  1LTS C;  1NOH A;  3AE2 C;  3FXD A;  2OTK E;  2Y0C A;  2K1A A;  3PTZ A;  4N3Y B;  1N7S D;  4BRY B;  1NTM J;  3H32 B;  1QL2 A;  3AEB C;  3S1K A;  2FYZ A;  3L74 J;  2OYI B;  1X22 A;  1FZC A;  1GL2 D;  1KB9 I;  2Y0D A;  2E76 D;  1AFO A;  2Q9I A;  1AVY A;  1T3U A;  2O3J A;  1EDL A;  1IO4 A;  1GK6 A;  3Q1M A;  1YIT P;  5AW4 B;  1JY3 N;  1L0L G;  1YTZ T;  3H1I J;  3QH9 A;  5DJT B;  3MTU E;  5AVT B;  3L70 J;  2A45 I;  1URQ A;  3RBX A;  3CPW O;  2WSS H;  2KP8 A;  2E74 B; 
#chains in the Genus database with same CATH homology
 3MD0 A;  1IFD A;  2N1T B;  2JJL A;  1X8Y A;  3II6 A;  4IFD K;  3R2P A;  1WRG A;  2NPS A;  2Z5H A;  1XTC C;  2GUS A;  2WTY A;  3M0D A;  3MIW A;  3P7K A;  2H7H A;  3CLQ A;  4O9B A;  1FJP A;  4B86 A;  2N1T A;  1NTM K;  1FJK A;  3BVH A;  1FZC C;  1S9K D;  1EQ7 A;  3T97 A;  2N1T C;  3P32 A;  4LLH A;  1PFI A;  1ZV8 A;  5KTB A;  1L4A D;  2Z5I A;  1M1J C;  2PAJ A;  3L4F A;  1XTG B;  4JF7 A;  1JY2 N;  3P8C D;  1URQ C;  3VOP A;  1M1J A;  1VDF A;  2P7J A;  4W7Y A;  4ZKP A;  4I6M C;  1YTZ I;  4WY4 B;  5AW6 B;  1Z56 A;  3GHG B;  1IK9 A;  2WT7 B;  1IFI A;  4WY4 D;  1T2K D;  1SQP K;  3M0D C;  1HWT C;  1RF0 A;  3BRT B;  2N1T D;  2ZFC A;  1N7S A;  1FZG A;  1NTZ K;  2KSJ A;  3M9H A;  2IFM A;  1CW5 A;  2WIT A;  1ZR4 A;  2XU6 A;  3KPE A;  1FZC B;  1CI6 A;  1OWA A;  1IFN A;  4JYC A;  1SQX K;  1SP4 A;  3EFG A;  2YMY A;  2R5D A;  1FZF A;  5APT A;  5AW2 B;  1IJD B;  1RF0 C;  4M3L A;  2ZXE B;  1GU4 A;  3KYQ A;  1GL2 A;  3HD7 C;  1G2C B;  1AQ5 A;  2W27 A;  1NH4 A;  2O1K A;  1JY2 P;  3H32 A;  1FZB A;  2WSC H;  3B5N D;  1MZ9 A;  1X9V A;  1GK4 A;  1GU5 A;  2MJZ A;  1HTL C;  5AVV B;  4AYC A;  1ZR2 A;  2J59 M;  2BAS A;  2R32 A;  1LTG C;  1G1I A;  3M91 A;  1URQ B;  4IFF A;  1URQ D;  5KJ7 C;  1FZE A;  1M1J B;  2HOD B;  1RE3 A;  1DH3 A;  1NTK K;  1HVV A;  4I1L A;  4EOT A;  4IFM A;  1T3J A;  5CJ0 A;  2HG5 D;  4WY4 A;  3U59 A;  2A45 G;  2I1J A;  3BAS A;  1GTW A;  1L0L K;  2HLO A;  2R3C A;  3UIA A;  1JY3 P;  1NAF A;  1KFM A;  3GHG C;  3BAT A;  2HYN A;  2KB7 P;  3A2A A;  5AW9 B;  2Q5U A;  3V5B A;  4ZKU A;  2IX7 C;  5AVW B;  5KLV K;  3LIE A;  3E1I A;  2I1K A;  3HE4 A;  3OAK A;  1GW3 A;  2YKO A;  5CMZ A;  3L37 A;  1LTJ C;  2P1J A;  2OAR A;  2FFD C;  3HD7 D;  5KJ7 A;  1JTH B;  3SWF A;  5CJ4 A;  2HPC A;  2M8R A;  2YNY A;  3NTN A;  1SVF A;  2FFD A;  3RK2 B;  1T2K C;  1FZA A;  4W80 A;  1SFC D;  2WT7 A;  1N73 A;  3VTP C;  4C7R A;  2XDJ A;  1J1D C;  5CCG D;  3TYY A;  3V2Q A;  4DOJ A;  1ZLL A;  5AVZ B;  3L35 A;  2OYI A;  3P8M C;  1IFM A;  3HTK A;  3RL0 B;  2YKP A;  4GT1 A;  1J1E B;  3NXS A;  1NWQ A;  3RK3 D;  2WSF H;  1WT6 A;  3B5N A;  1N73 B;  1HGZ A;  3RK2 C;  1SFC C;  1NHL A;  2XNX A;  3VMY A;  2XZR A;  2P67 A;  4XA4 A;  3RL0 C;  1KQL A;  1N86 A;  3WMM 0;  2R5B A;  1A02 J;  3HUS C;  2OYH A;  4W7Z A;  1SLQ A;  3HUS A;  4OH8 B;  3RK2 D;  3V2P A;  2Q3I A;  2WPQ A;  3VP8 A;  1GL2 B;  1MUU A;  3O8Z A;  4N78 D;  1NKZ B;  2E43 A;  3B5N C;  3HD7 B;  4XE5 B;  5APS A;  2WSE H;  1FU1 A;  2E42 A;  3VMZ A;  1RF1 B;  1YYC A;  2C0W A;  5CHX A;  1W2E A;  2HFE D;  2L5G B;  2C9L Y;  3MGN A;  1SQV K;  1SQB K;  2QM7 A;  3V4W A;  1T8Z A;  2IFN A;  3NFQ A;  4C46 A;  1LTJ B;  4WBA A;  5BU5 A;  3A5T A;  5CCH D;  1JOC A;  3HRN A;  2HPC B;  4AQR D;  2FFD B;  4JYB A;  1IC2 A;  1ZN5 A;  5APY A;  1CSB A;  4C7N B;  4KHX A;  1J1E C;  1CZQ A;  1FOS E;  1VPC A;  1CI6 B;  1RE4 C;  5KJ7 D;  3P8C E;  3A3Y B;  2IPP A;  3M06 A;  1RE4 A;  5APV A;  4GKG A;  3I5C A;  2GM4 A;  3H6P A;  3OJA B;  2FYU K;  3N4X A;  5CCH C;  1JTH A;  2C9N Y;  1JO5 A;  5CCH A;  1G2C A;  1NU1 K;  1DX7 A;  2W6A A;  2WPS A;  1KZU B;  1L4A C;  1GZL A;  3V2N A;  1GD2 E;  3TK1 A;  1NO4 A;  1L4A A;  3HUS B;  1JY3 O;  2YKQ A;  3HTK B;  3U1A A;  2JEE A;  5APU A;  2KYV A;  1LWU B;  1E5W A;  3B5N B;  2FKW B;  1FBM A;  3KQG A;  5AVX B;  5APQ A;  1GL2 C;  3HD7 A;  3TSI A;  3VP9 A;  5AVR B;  1LTA C;  5AVS B;  1DEB A;  2WZ7 A;  1LTI C;  2P2U A;  1FDM A;  1RF1 C;  1FAV A;  2HOD A;  4EIJ A;  1MFZ A;  4N6J A;  2O01 H;  1HJB A;  2Z4E A;  1LT9 A;  2VRS A;  1HH0 A;  3VMX A;  5AW7 B;  3MUD A;  2OYH B;  2GUV A;  1JCC A;  5AW0 B;  2WWW A;  4DZO A;  4I2L C;  5APW A;  3U1C A;  3LID A;  5AW5 B;  1N2D C;  1OXZ A;  5AW1 B;  1IFJ A;  3V4Q A;  3SWY A;  1LT9 B;  2J58 A;  5AW8 B;  1N73 C;  4AUW A;  4N78 E;  3KDP B;  1A02 F;  1JCD A;  2PP6 A;  1LTT C;  1M7L A;  2W6B A;  3LW5 H;  5AVQ B;  4Y99 B;  2NPS D;  4C7N A;  1H88 A;  2H43 A;  1HUC A;  1N7S C;  2NPS B;  3RK3 C;  1MV8 A;  1LGH B;  2N9B A;  1RF1 A;  3IR9 A;  4LC1 A;  3B8E B;  1X79 B;  1NKN A;  1LWU C;  1FOS F;  1LT9 C;  3A7O A;  4LGD E;  1KFN A;  2XKM A;  4RES B;  2H8P D;  5CCG A;  1HBW A;  5AVY B;  1JNM A;  2POH A;  1LTJ A;  2LKM A;  1H8A A;  3RK3 B;  2YO3 A;  1G1J A;  2KLV A;  3V2R A;  2YO2 A;  1H89 A;  3RL0 D;  5AVU B;  2OYH C;  3OA7 A;  3M9Q A;  2FXM A;  3TNU B;  1L4A B;  2KOG A;  3GHG A;  3HE5 B;  1SQQ K;  2A45 H;  3G3Z A;  1SFC B;  3VN0 A;  1HGV A;  2C0X A;  3IFM A;  4HH2 A;  1JUN A;  2O1J A;  1KIL C;  1LWU A;  5BVZ A;  3CL3 D;  1JMM A;  4HYT B;  3L36 A;  3TNU A;  1JY2 O;  1LTB C;  3HE5 A;  5CCG C;  1SFC A;  1S9K E;  4GIF A;  3EQ2 A;  3C9I A;  3CI9 A;  2Q7C A;  3BRV B;  4WB4 A;  1N7L A;  1KIL B;  1QL1 A;  1RE3 C;  3M9B A;  3PP5 A;  2M3B A;  5AW3 B;  5BU8 B;  4WY4 C;  3HE4 B;  3VYI A;  1GDT A;  1L0N K;  2OYI C;  1KIL D;  2CPS A;  3M0A A;  3N7N A;  1RY3 A;  2QM8 A;  3NMD A;  1KIL A;  4Y99 C;  2WPR A;  1N7S B;  1J2J B;  2NPS C;  1J1D B;  2CPB A;  5APX A;  2XV5 A;  1GW4 A;  1LTS C;  1NOH A;  4N3Y B;  1N7S D;  3H32 B;  1QL2 A;  2FYZ A;  2OYI B;  1FZC A;  1GL2 D;  1AFO A;  2Q9I A;  1T3U A;  1IO4 A;  1GK6 A;  5AW4 B;  1JY3 N;  1YTZ T;  3MTU E;  5AVT B;  2A45 I;  1URQ A;  2KP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...