1NO4A

Crystal structure of the pre-assembly scaffolding protein gp7 from the double-stranded dna bacteriophage phi29
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
77
structure length
77
Chain Sequence
PLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLTKSHEKLAAEKDDLIVSNSKLFRQIGLTEKQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAD MORPHOGENESIS PROTEIN
publication title Bacteriophage f29 scaffolding protein gp7 before and after prohead assembly
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Viral protein
total genus 34
structure length 77
sequence length 77
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11418 Scaffolding_pro Phi29 scaffolding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.400 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1no4A00
3OA7A 1NO4A 1NOHA 3MTUE 4IFFA
chains in the Genus database with same CATH superfamily
1SQVK 2W83C 4YXWH 2WZ7A 2A06E 4Y28J 1LNQA 4JF7A 1P84D 1G2CB 2D2CC 4HJGH 3TGUJ 1QVGO 3ITKA 3AE6C 3VMYA 3B4SA 1CW5A 3L71D 3C9IA 5KKZB 1AA0A 5GTIH 2OTJP 1PZQA 1KILA 3AE5C 3IAOA 1SQQK 4XFJA 2Z4EA 1PP9G 2C0XA 2W27A 4H0LB 1YYCA 2FXPA 5GTIE 1MZ9A 1PFIA 2E74D 1P84H 5K5GB 2R44A 3HD7B 5APQA 2FFDC 4C7NA 2AEMA 3V2RA 1PGJA 3R4YA 2L5GB 5DJTB 2FYUG 1ZW0A 5TJHA 1SQBG 4KT0J 1P84E 1QL2A 5AVXB 5AW3B 5KLVE 1FDOA 3AEDC 1LWUA 1SQXJ 2ITAA 2IFNA 1JY3N 3RK2D 3L71E 3PRJA 1CI6B 4IOIH 2QM7A 3OW2O 1SQPJ 5AVSB 2K37A 2FYNB 4JQ0D 4H44B 2QRXA 1BSNA 3CCVP 3M9QA 1N7SA 1S9KD 3AEGC 3CL3D 1SQVG 1JB0J 3M0DC 3H1HD 3L75D 1A02J 2R32A 2WPRA 1OIPA 2H43A 2KIKA 3WUTA 4JBZA 1VQ6P 2QG4A 2J5UA 1KILB 4TT3H 1L0LK 2O01J 4OH8B 3T97B 1NU1J 3MGNA 3CCQP 1VF5D 1K9MQ 1URQA 3AEBC 2JKVA 2FYZA 1SQQG 1L4AD 1USEA 4N78D 2G8YA 2JDIH 3B8EB 1JY2O 3JSVC 2FFDA 2B87A 3N4XA 4MN4C 2E43A 1S72P 1S9KE 3H1IE 4DCKA 1Q81Q 1BE3J 3L75E 2Y9YA 3L70G 4W80A 1Q90D 2V7QJ 3HTKA 2N1TD 3MTUE 1VQNP 5AW8B 4ZNCA 1JEKA 1YTZI 4C46A 2OGUA 2PAJA 5AVZB 3RK3B 1FJKA 3RL0D 2JWDA 1VQMP 1T8ZA 1MKMA 2ZAEB 2KS1A 2ZXEB 4Y99C 1W2EA 3CCUP 3H1KD 3L72J 2UWJE 3GG2A 3KZIH 4NPDA 1LGHB 1RF1C 2W6JH 1QX8A 2D2CD 2IZ0A 5KLIC 2WSCJ 4N78E 1LTGC 1SS1A 3VP9A 3HRNA 2PGDA 1ZLLA 2RN0A 1QLED 1OVVA 3CWBG 5APVA 2QJYC 1IZNB 5KJ7A 1LTJC 3F5HA 2RKLA 1AQTA 4UB6H 1KB9I 3TGUE 3KZIE 2GA1A 1GL2A 4IL6X 3PJSK 2OYOA 2RMZA 2Z5IA 2Q1KA 3U59A 1URQB 2IZ1A 1GD2E 4UB6E 3VYIA 1L0LG 5CJ4A 1NAYA 3I5CA 2NRGA 1SFCA 5TISE 2O01N 3CMEP 5CCGC 3ABVC 1Q2NA 1H0TB 2KZJA 2R3SA 4LC1A 2YIUC 2DW3A 3CXHD 3H1KE 3BATA 5KKZC 3D71A 5AVWB 1TU3F 3BCCD 1BSHA 2A45H 2FBWC 1BGYG 3GHGB 4I2LC 1M1KQ 3Q3DA 4LLHA 2K1AA 2WPQA 4H0LC 3VMZA 3WU2H 2E75C 1OX3A 1AFOA 1HBWA 1SQXE 2AEFA 2PRRA 2Y0EA 1IO4A 3HD7C 2M3BA 4EOTA 1E5WA 1LT9B 3V5BA 3WU2E 1FE6A 3NTNA 4U3FD 3TK1A 3CXHH 1AVYA 1KQGB 4N3YB 2JWAA 2Q7CA 1G1JA 1EQ7A 4XE5B 4YXDC 1PIXA 3L71J 1A02F 1RF1A 1LJ2A 1FOSF 4D6TD 2WMMA 3JC22 3CC4P 5AVRB 3V2PA 1X8YA 3CC2P 1VPCA 1JUNA 3CXHE 1YBKA 4YTPC 1JNMA 4L75A 5CJ0A 1PPJG 3LW5H 1SQQD 1FOSE 3BCCE 1KYOI 3BRTB 1EZVI 3RBZA 1S5LH 2WT7B 2FY8A 1GU4A 1IFMA 1M56D 4RKUJ 4HB1A 2YO2A 2FYNC 2QE7H 1BDCA 2OYIB 4B86A 3B5NB 1K05A 4H44C 2OQQA 2O3JA 1D7MA 2HODB 3H1LG 1RY3A 1G2CA 1S5LE 3CCJP 1K04A 1QL1A 2Q3EA 1J2JB 4JYBA 5CCGA 2HFED 3A3YB 3L74D 1MUUA 1LT1A 4U3FE 5AW4B 3L70D 1KILC 2CK3H 4JYCA 2XV5A 4M3LA 3G4SP 1J1DC 3I56P 1W2BO 1AJYA 4D6TE 2YNYA 5DJUB 5CCHC 3Q2YA 4EYYQ 3KXDA 5M1BA 3U1CA 1BCCD 4ZKUA 2K9JB 2E42A 3II6A 2WWWA 3CX5I 2H8PD 1GDTA 3CWBD 3H1HJ 3L75J 1N73B 2P1JA 3E1RA 2JEEA 1SQPK 4Z1MH 2K88A 2WSEH 4NPEA 2E5YA 1LWUC 1FZGA 5APYA 3AE8C 3UIAA 2BCCG 3L72E 2KB7P 4PD4E 3L74E 5AW6B 1GW3A 3D6ZA 1OW8A 1CI6A 4DOJA 3MZWB 2Q6QA 4R4MA 1VQ4P 2P58A 1OVRA 3H1JD 3WUUA 1BCCE 5CMZA 5AW2B 3CCMP 4HYTB 1NU1K 1UIXA 3AE2C 1N7SC 1KZUB 3BRVB 1JM0A 4BXLA 1GZLA 5CCGD 1Q7YQ 1BGYD 1M1JA 1KMIZ 3CLQA 3M91A 2I1JA 1LTSC 2LXBA 1SP4A 3T97A 5CCHA 1URQC 4H0LD 2E75D 2YKQA 4CPGA 4IL6H 5AW5B 1KQFB 1OW6A 1HJ0A 4TLFA 2H89C 3AE9C 3IN6A 3H1KJ 5C39A 1ZP0C 3HD7D 5BU8B 3TDKA 3GW6A 1L0NK 2LR2A 2C0WA 2HYNA 1R5LA 4IL6E 1NTZD 3H1JE 4W7ZA 1HJBA 1KB9D 1EDKA 4ZKPA 4QMAA 1NTKD 3VMXA 3W68A 3FX0A 2RH0A 1IFPA 2IBZG 2C9NY 3M06A 1SQPG 1SLQA 4I6MC 1GTWA 4WY4B 1FDIA 2KSEA 2QJPC 3OJAB 2NPSB 3RGUA 1IC2A 2IYOA 1YJNP 1GMJA 2MKVA 2E5TA 4O9BA 4BRYB 2CPBA 1LTAC 2IYPA 1NKZB 1SVFA 1KB9H 3H32B 3A7OA 3EFGA 4OGQC 1IFIA 3SWKA 1M1JB 5KJ7C 3D6YA 3BCCJ 3L73D 1NTZE 5CBOA 3U1AA 1KB9E 4AQRD 3N7NA 3RBXA 1GL2C 1JMMA 1KILD 1OVUA 3KQGA 3C8VA 1NTKE 1JY3O 1NTMK 3LW5J 3NMDA 4DJGA 4R4LA 4DT0A 3B5NC 3BVHA 1SFCC 1KV4A 3A0HH 4U3FJ 1UIIA 2XKMA 1ZR4A 1VF5B 2HPCB 2FXOA 4D6TJ 5AVVB 1H0TA 2KUBA 1BE3G 4L76A 3G9RA 3P8CD 1MFTA 1R8EA 3A0HE 5KLVK 3MP7B 1EXJA 5B66H 1Y47A 1T3JA 1M7LA 1KYOD 4U7JA 1DEBA 1EZVD 1M57D 3AE3C 1L0NG 1LTTC 3H1HE 2KXPB 3GHGA 1SQQJ 3KPEA 4KJMA 5KTBA 3L73E 4PV1B 1FZEA 1J1EC 2IX7C 1KILE 5APTA 3NFQA 2WVRA 1P84I 3MUDA 1T2KD 1RE4C 2GUVA 1Y8AA 2MJZA 3GF3A 1VQOP 2ZYAA 1FDMA 2BEQD 1LT9A 1KQSO 1CZQA 4GKGA 5E79H 2E76C 3HE5B 1N7SD 3KDPB 3L74J 2K3RA 1K73Q 3L70J 4I7ZB 3CPWO 2GUSA 5AW1B 1HWTC 1E79H 1EDLA 2WSEJ 1KYOH 3VOPA 1RHZB 1PP9D 2A06G 4UB8H 1S4XA 3V2QA 4PJ0H 2OTLP 3HE4B 1GK6A 3P8CE 3L37A 5AW9B 1CSBA 1KD1Q 2D2CB 4H13C 1AV1A 1BCCJ 1KYOE 1AQ5A 1EZVE 3CX5D 4L74A 4UB8E 4PJ0E 3IR9A 1URQD 4AUWA 2WT7A 2YMYA 2XZRA 1RQVA 1LP1B 5APSA 1KC8Q 2FYUD 2POHA 2OYIA 3CWBJ 2Y0CA 3B5NA 1NTMG 1SQBD 1R5SA 2WQYC 2HODA 1HGZA 5AVYB 1DD3A 2KSJA 3NXSA 3CCLP 3Q5RA 3V4QA 1YQ3C 2SPZA 5KAFH 3H6PA 5B5EH 2H88C 1X79B 2P10A 2B88A 1PP9E 3CX5H 5KAFE 4OVNF 2FKWB 5B5EE 5KLVG 1DIPA 4OWFA 3H1JJ 3IFMA 2YXQB 1NYHA 2K9JA 2R3CA 1U57A 2N9YB 3MHVA 1RE4A 1SQVD 2O1KA 4K3AA 2W8ZA 1VQ9P 1N73A 1BGYJ 2FYUE 5H2FH 1IFDA 3CMAP 1SQBE 4OGQD 4DZOA 2P7JA 5KJ7D 3OAKA 1FS0E 3PLNA 1GL2D 3AEEC 1PGQA 4WY4C 2XNXA 5H2FE 2KNCB 1Y9BA 3FGAD 2NPSC 4GDOA 3F89A 1VQ8P 1NHLA 1NGMB 2HG5D 4EDFA 3FXDA 1HTLC 3A2AA 3B5ND 1SFCD 1NTZJ 3AEFC 1ZRTD 1YTZT 4YPCA 2ZVNB 5APUA 2Z5HA 2KLUA 1SQVE 1M1JC 1NOHA 1NTKJ 3M9BA 1L0ND 2FXMA 1USDA 1NVOA 1FAVA 2M8RA 3L35A 4GOEA 3BASA 1OWAA 1GK4A 1ZV8A 3MIWA 3SFEC 1Z56A 1EDIA 1SQXK 2J59M 2ZT9B 5APWA 3H1IG 2WITA 2W6BA 1NWQA 5AVUB 1YQ4C 5L8RJ 1SQQE 3KYQA 1FZCB 1EXIA 2V4HA 2E76D 5AW0B 3L73J 1FZFA 1HGVA 4W7YA 2XDJA 1N2DC 2ZYDA 4GIFA 1G1IA 1Q86Q 4Y99B 4C7RA 4PV1C 2IBZI 3L70E 1KFNA 3O6QB 1FZAA 1L0LD 1ZOYC 4WWIA 5KLIB 4WY4A 4H13D 1XTGB 2OYHB 3H25A 3RL0g 3RK3C 4I1LA 4LGDE 1DEEG 2NPSA 1NTMD 2QM8A 3G3ZA 1KFMA 3TGUG 3GMAA 3PHLA 1LTJB 1H8AA 1Q82Q 3SSUA 4BRYA 1IFJA 1VQ5P 2B89A 3H32A 1BDDA 4I7ZC 5AW7B 1JMBA 2XNDH 1XTCC 4XA4A 2WSFH 2Y0DA 3G71P 1N7LA 3CWBE 3E1IA 2YKPA 1FBMA 1ZN5A 5KLVD 1KQLA 2CPSA 4RESB 1JTHB 2AXCA 2GM4A 1S1CX 2P67A 3H1KG 2M3EA 2YIUB 3IF4A 3EFFK 1L0LE 1ZXGA 3TF5A 1MV8A 4A7PA 1NTME 3L4FA 2KI7B 3HUSB 2E75B 2HPCA 1SQXG 1M90Q 4ASWA 1S2EA 1PP9J 3I55P 2A45G 2E74B 4WVZA 3GLMA 2PFXA 1L4AA 2N9BA 2Y9ZA 3P7KA 1PPJD 3GHGC 4GT1A 2M5AA 1BGYE 3EWKA 2WTYA 1OFCX 4WY4D 3MUDC 2WPSA 1N86A 1YHQP 2NPSD 1VQ7P 1YJWP 1M8OB 2FYUJ 2JO1A 1HUCA 3H1LD 1LT9C 1X22A 1SQBJ 3AECC 4PD4I 1T6AA 1S5LX 3O8ZA 3WUVA 3RK2B 5CHXA 2R5BA 2N1TA 1VQKP 3PH0A 3A5TA 2W90A 3BCCG 1X0TA 4H44D 2XU6A 4L73A 3HE5A 4JPZB 1K8AQ 1YIJP 5KAIH 2L91A 2QVAA 1JY2N 1T3UA 1NU1G 1QVFO 1RE3C 3HE4A 3CD6P 1DD4A 3FXEA 3H1ID 1OMIA 2R5DA 5KAIE 1PPJE 5CCHD 4U3FG 1VL2A 5GTHH 1NJIQ 1SQVJ 1LP1A 3PTZA 2OYIC 4D6TG 1J1DB 3A0BH 3ZDMA 2OTKE 1JO5A 3VN0A 1RH5B 3H1LE 1JCDA 4IFMA 1S3JA 5GTHE 4IFFA 1IK9A 3G6EP 2BCCD 2Q9IA 1LTBC 4ASVA 3A0BE 1L4AB 2C9LY 4EIJA 4HKZH 2H7HA 2ZFCA 1L2PA 2I8DA 4C7NB 2NZ2A 2KK7A 3SFDC 5AVTB 2M5AB 1IK7A 2YKOA 4PV1D 3TGUD 3USSA 3QWOC 2ZT9C 3JCUH 2QJKB 5B66E 2ZVOB 1LWUB 1W5CE 2Q5UA 3L72G 3R2PA 3RK3D 2LXCB 3L74G 2HR3A 1FZCC 3PP5A 3D70A 2N1TB 3JCUE 4IFDK 1N73C 1L0NJ 2K9YA 3CC7P 2KLVA 1WMKA 2QA4P 2QIWA 3KHUA 3K5BA 3RL0B 2O1JA 2BEZF 2JP3A 3CCSP 1NTZK 1BCCG 5E79E 2BCCE 2P2UA 2I1KA 4KHXA 1N7SB 2IDBA 4ZMDA 1RE3A 1N8RQ 1NTKK 1DH3A 2KNCA 2OYHC 4N6JA 3M0DA 1OW7A 2AXTH 3S9OA 1H89A 1NAFA 3Q5PA 2OARA 1SQXD 3V6IA 1YJ9P 2ZYGA 5TISH 2BASA 3LIEA 3RK3E 3FWLA 2KOGA 3MD0A 1FZBA 1WT6A 2AXTE 3CI9A 1EDJA 2ZXXA 2KP8A 2YO3A 2WSFJ 1RF0C 2IBZD 2M0BA 2W6AA 5CBNA 4WBAA 1SQPD 5BVZA 2G3AA 1KTMA 2B9BA 3FWNA 4GODA 1L0LJ 4RO0A 3H1JG 2FFDB 1IJDB 1AVOA 3AE4C 1OXZA 2B87B 4BWNA 1MFZA 2YMKA 1NTMJ 1ZR2A 1U7JA 4K35A 2KZIA 1H88A 3CX5E 3C1LA 2JJLA 1GW4A 1NO4A 3L71G 3HUSC 3HTKB 3V4WA 1FZCA 3TSIA 1VQPP 3CCEP 2PP6A 2E74C 5APXA 2KYVA 3SWFA 3TNUA 3VP8A 1NU1D 2QJPB 1U7MA 1JY3P 1YITP 4EI2A 5KLVJ 2KS1B 1FC2C 1PL5A 1WRGA 4HH2A 1KORA 2IBZE 3GF7A 1SQPE 3O6QA 3V2NA 3P32A 1X9VA 4OGQB 2OYHA 1NTZG 2QSIA 1JY2P 1FU1A 1OZHA 3EQ2A 4AYCA 3M0AA 2O01H 3RK2C 1LTJA 2IFMA 1GL2B 1JCCA 1NTKG 1BE3D 1IFNA 1FJPA 2VRSA 1HF9A 3Q5SA 3SWYA 5AVQB 3S1KA 3Q1MA 1PV3A 1VDFA 1RF0A 3E7KA 3L36A 2JR8A 1SFCB 3S4RA 1NU1E 3TYYA 1ZMEC 3WMM0 1YI2P 2QEXP 5EFWB 1KN7A 3B71A 2YXRB 2WSSH 3L72D 1JTHA 4PD4D 1JOCA 2Q3IA 3M9HA 1HVVA 3H1LJ 3AE1C 4NPFX 2AEJA 2ZT9D 1VQLP 1GU5A 2J58A 1EC5A 5BU5A 1NH4A 3H1HG 3L75G 3LIDA 4WB4A 3VMAA 1QGKB 4RJTA 3L73G 2V7QH 1VF5C 3HUSA 2A06D 1J1EB 2HLOA 1QEXA 3VTPC 2FYUK 3TNUB 1BE3E 2IPPA 1L4AC 3W67A 1SQBK 1PGPA 1ZRTE 3AE7C 1PGOA 2A45I 3HD7A 3CCRP 4GOFA 3H1IJ 1L0NE 2ZJSE 3QH9A 4PD4H 1RQUA 2E76B 2WSCH 2QJKC 3OA7A 1RF1B 1HH0A 3AEAC 1NKNA 2LKMA 2QJYB 3P8MC 2N1TC 1LTIC 3CXHI 2BCCJ 1EZVG 1DX7A 4H13B 1T2KC 2WPVB 3RL0C
chains in the Genus database with same CATH topology
1GK6A 3P8CE 3L37A 1SQVK 3LW5H 5AW9B 1FOSE 1CSBA 1JY2N 1T3UA 3BRTB 1RE3C 3HE4A 2WZ7A 2WT7B 1GU4A 1IFMA 1AQ5A 3IR9A 4JF7A 1URQD 2YO2A 2R5DA 1G2CB 4AUWA 2WT7A 2YMYA 2XZRA 5CCHD 2OYIB 4B86A 3B5NB 5APSA 2HODB 1RY3A 1G2CA 2POHA 3VMYA 2OYIA 3B5NA 1QL1A 2OYIC 1CW5A 1J1DB 2HODA 1J2JB 4JYBA 5CCGA 3C9IA 1HGZA 2HFED 3A3YB 5AVYB 1JO5A 1MUUA 2KSJA 1KILA 5AW4B 3NXSA 3VN0A 1KILC 1SQQK 3V4QA 4JYCA 2Z4EA 2XV5A 2C0XA 4M3LA 1JCDA 4IFMA 1J1DC 3H6PA 4IFFA 1IK9A 2Q9IA 2W27A 2YNYA 5CCHC 1YYCA 1LTBC 1X79B 1L4AB 2C9LY 1MZ9A 4EIJA 2H7HA 1PFIA 2ZFCA 3U1CA 4C7NB 4ZKUA 5AVTB 2FKWB 3HD7B 5APQA 2FFDC 2YKOA 4C7NA 3IFMA 2E42A 3II6A 3V2RA 2WWWA 2L5GB 2H8PD 2R3CA 1GDTA 1LWUB 1RE4A 2Q5UA 3R2PA 1N73B 2P1JA 1QL2A 5AVXB 3RK3D 5AW3B 2JEEA 2O1KA 1SQPK 1FZCC 3PP5A 1LWUA 2WSEH 1N73A 1LWUC 1FZGA 2N1TB 5APYA 4IFDK 1N73C 3UIAA 1IFDA 2IFNA 1JY3N 3RK2D 2KB7P 2KLVA 1CI6B 4DZOA 2P7JA 5AW6B 5KJ7D 3RL0B 3OAKA 2O1JA 1GW3A 2QM7A 1NTZK 1CI6A 1GL2D 4DOJA 4WY4C 2XNXA 2P2UA 2I1KA 4KHXA 5AVSB 1N7SB 2NPSC 1RE3A 1NTKK 1DH3A 2OYHC 1NHLA 3M9QA 4N6JA 1N7SA 2HG5D 5CMZA 1S9KD 5AW2B 4HYTB 3M0DA 1NU1K 1N7SC 3CL3D 3M0DC 1HTLC 1H89A 1KZUB 3BRVB 3A2AA 1A02J 3B5ND 1NAFA 1SFCD 2R32A 2WPRA 3RL0C 1GZLA 2H43A 2OARA 5CCGD 1YTZT 1KILB 1M1JA 1L0LK 2BASA 3LIEA 3CLQA 5APUA 2Z5HA 1M1JC 1NOHA 3M9BA 3M91A 4OH8B 2FXMA 2KOGA 3MD0A 1FZBA 1WT6A 3CI9A 2I1JA 2KP8A 2YO3A 1LTSC 1SP4A 1RF0C 3MGNA 1URQA 2W6AA 1FAVA 2M8RA 4WBAA 3T97A 5CCHA 1URQC 3L35A 3BASA 5BVZA 1OWAA 2YKQA 1GK4A 1ZV8A 3MIWA 2FYZA 5AW5B 1Z56A 1L4AD 2FFDB 4N78D 1IJDB 3B8EB 1OXZA 1SQXK 2J59M 1JY2O 5APWA 2WITA 1MFZA 2W6BA 1NWQA 2FFDA 3HD7D 5AVUB 5BU8B 1ZR2A 1L0NK 3KYQA 2C0WA 2HYNA 3N4XA 4W7ZA 2E43A 1FZCB 1HJBA 1S9KE 1H88A 2JJLA 1GW4A 1NO4A 3HUSC 3HTKB 3V4WA 1FZCA 4ZKPA 5AW0B 3TSIA 3VMXA 1FZFA 4W80A 2PP6A 3HTKA 2N1TD 3MTUE 2KYVA 5APXA 3TNUA 3SWFA 1HGVA 4W7YA 3VP8A 2XDJA 1N2DC 2C9NY 4GIFA 3M06A 1G1IA 5AW8B 1JY3P 4Y99B 1SLQA 1YTZI 4I6MC 4C7RA 4C46A 1GTWA 4WY4B 2PAJA 5AVZB 3RK3B 1FJKA 1WRGA 3RL0D 4HH2A 1KFNA 1T8ZA 3OJAB 2NPSB 1FZAA 2ZXEB 4WY4A 4Y99C 1W2EA 1IC2A 1XTGB 2OYHB 3RK3C 4I1LA 4LGDE 2NPSA 3V2NA 4O9BA 3P32A 1X9VA 2QM8A 2CPBA 3G3ZA 1LGHB 1RF1C 1LTAC 1KFMA 1NKZB 1SVFA 2OYHA 1LTJB 4N78E 1H8AA 1JY2P 1FU1A 3H32B 1LTGC 3EQ2A 3VP9A 3HRNA 1IFJA 1ZLLA 4AYCA 3M0AA 3A7OA 2O01H 5APVA 3EFGA 3RK2C 1LTJA 2IFMA 1GL2B 1JCCA 3H32A 5KJ7A 1IFIA 1LTJC 5AW7B 1M1JB 5KJ7C 1IFNA 1XTCC 4XA4A 2WSFH 1FJPA 2VRSA 1GL2A 3U1AA 4AQRD 3N7NA 1N7LA 1GL2C 1JMMA 1KILD 3SWYA 5AVQB 3E1IA 3KQGA 2YKPA 2Z5IA 1FBMA 1ZN5A 3U59A 1URQB 1JY3O 1GD2E 1VDFA 1NTMK 1RF0A 1KQLA 3L36A 3NMDA 1SFCB 2CPSA 3VYIA 4RESB 1JTHB 3TYYA 2GM4A 5CJ4A 3I5CA 3WMM0 2P67A 1SFCA 3B5NC 3BVHA 1SFCC 1JTHA 1JOCA 2Q3IA 5CCGC 3M9HA 2XKMA 1HVVA 1ZR4A 4LC1A 1MV8A 1GU5A 2J58A 2HPCB 5BU5A 3BATA 1NH4A 5AVVB 3L4FA 3LIDA 5AVWB 4WB4A 3HUSB 3P8CD 2HPCA 5KLVK 2A45H 4I2LC 3GHGB 1T3JA 1M7LA 3HUSA 2A45G 1J1EB 4LLHA 2HLOA 2WPQA 3VMZA 1DEBA 3VTPC 1L4AA 1LTTC 2FYUK 2N9BA 3TNUB 3GHGA 3P7KA 2IPPA 1AFOA 1L4AC 3KPEA 5KTBA 1SQBK 1HBWA 3GHGC 4GT1A 1FZEA 1J1EC 2A45I 2IX7C 5APTA 3HD7A 1IO4A 3NFQA 2WTYA 3HD7C 2M3BA 3MUDA 4EOTA 1T2KD 1E5WA 1LT9B 4WY4D 1RE4C 2GUVA 3V5BA 2WPSA 2MJZA 1N86A 2WSCH 3NTNA 1FDMA 2NPSD 3OA7A 1RF1B 3TK1A 1LT9A 1CZQA 1HUCA 4N3YB 2Q7CA 4GKGA 1LT9C 1G1JA 1EQ7A 1HH0A 4XE5B 1A02F 1RF1A 3HE5B 3O8ZA 1N7SD 3KDPB 3RK2B 1NKNA 1FOSF 2LKMA 2R5BA 5CHXA 2N1TA 3P8MC 5AVRB 3A5TA 3V2PA 2GUSA 1LTIC 2N1TC 5AW1B 1HWTC 1X8YA 2XU6A 3HE5A 3VOPA 1VPCA 1JUNA 3V2QA 1DX7A 1T2KC 1JNMA 5CJ0A 3HE4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OA7 A;  1NO4 A;  1NOH A;  3MTU E;  4IFF A; 
#chains in the Genus database with same CATH topology
 1SQV K;  2W83 C;  4YXW H;  2WZ7 A;  2A06 E;  4Y28 J;  1LNQ A;  4JF7 A;  1P84 D;  1G2C B;  2D2C C;  4HJG H;  3TGU J;  1QVG O;  3ITK A;  3AE6 C;  3VMY A;  3B4S A;  1CW5 A;  3L71 D;  3C9I A;  5KKZ B;  1AA0 A;  5GTI H;  2OTJ P;  1PZQ A;  1KIL A;  3AE5 C;  3IAO A;  1SQQ K;  4XFJ A;  2Z4E A;  1PP9 G;  2C0X A;  2W27 A;  4H0L B;  1YYC A;  2FXP A;  5GTI E;  1MZ9 A;  1PFI A;  2E74 D;  1P84 H;  5K5G B;  2R44 A;  3HD7 B;  5APQ A;  2FFD C;  4C7N A;  2AEM A;  3V2R A;  1PGJ A;  3R4Y A;  2L5G B;  5DJT B;  2FYU G;  1ZW0 A;  5TJH A;  1SQB G;  4KT0 J;  1P84 E;  1QL2 A;  5AVX B;  5AW3 B;  5KLV E;  1FDO A;  3AED C;  1LWU A;  1SQX J;  2ITA A;  2IFN A;  1JY3 N;  3RK2 D;  3L71 E;  3PRJ A;  1CI6 B;  4IOI H;  2QM7 A;  3OW2 O;  1SQP J;  5AVS B;  2K37 A;  2FYN B;  4JQ0 D;  4H44 B;  2QRX A;  1BSN A;  3CCV P;  3M9Q A;  1N7S A;  1S9K D;  3AEG C;  3CL3 D;  1SQV G;  1JB0 J;  3M0D C;  3H1H D;  3L75 D;  1A02 J;  2R32 A;  2WPR A;  1OIP A;  2H43 A;  2KIK A;  3WUT A;  4JBZ A;  1VQ6 P;  2QG4 A;  2J5U A;  1KIL B;  4TT3 H;  1L0L K;  2O01 J;  4OH8 B;  3T97 B;  1NU1 J;  3MGN A;  3CCQ P;  1VF5 D;  1K9M Q;  1URQ A;  3AEB C;  2JKV A;  2FYZ A;  1SQQ G;  1L4A D;  1USE A;  4N78 D;  2G8Y A;  2JDI H;  3B8E B;  1JY2 O;  3JSV C;  2FFD A;  2B87 A;  3N4X A;  4MN4 C;  2E43 A;  1S72 P;  1S9K E;  3H1I E;  4DCK A;  1Q81 Q;  1BE3 J;  3L75 E;  2Y9Y A;  3L70 G;  4W80 A;  1Q90 D;  2V7Q J;  3HTK A;  2N1T D;  3MTU E;  1VQN P;  5AW8 B;  4ZNC A;  1JEK A;  1YTZ I;  4C46 A;  2OGU A;  2PAJ A;  5AVZ B;  3RK3 B;  1FJK A;  3RL0 D;  2JWD A;  1VQM P;  1T8Z A;  1MKM A;  2ZAE B;  2KS1 A;  2ZXE B;  4Y99 C;  1W2E A;  3CCU P;  3H1K D;  3L72 J;  2UWJ E;  3GG2 A;  3KZI H;  4NPD A;  1LGH B;  1RF1 C;  2W6J H;  1QX8 A;  2D2C D;  2IZ0 A;  5KLI C;  2WSC J;  4N78 E;  1LTG C;  1SS1 A;  3VP9 A;  3HRN A;  2PGD A;  1ZLL A;  2RN0 A;  1QLE D;  1OVV A;  3CWB G;  5APV A;  2QJY C;  1IZN B;  5KJ7 A;  1LTJ C;  3F5H A;  2RKL A;  1AQT A;  4UB6 H;  1KB9 I;  3TGU E;  3KZI E;  2GA1 A;  1GL2 A;  4IL6 X;  3PJS K;  2OYO A;  2RMZ A;  2Z5I A;  2Q1K A;  3U59 A;  1URQ B;  2IZ1 A;  1GD2 E;  4UB6 E;  3VYI A;  1L0L G;  5CJ4 A;  1NAY A;  3I5C A;  2NRG A;  1SFC A;  5TIS E;  2O01 N;  3CME P;  5CCG C;  3ABV C;  1Q2N A;  1H0T B;  2KZJ A;  2R3S A;  4LC1 A;  2YIU C;  2DW3 A;  3CXH D;  3H1K E;  3BAT A;  5KKZ C;  3D71 A;  5AVW B;  1TU3 F;  3BCC D;  1BSH A;  2A45 H;  2FBW C;  1BGY G;  3GHG B;  4I2L C;  1M1K Q;  3Q3D A;  4LLH A;  2K1A A;  2WPQ A;  4H0L C;  3VMZ A;  3WU2 H;  2E75 C;  1OX3 A;  1AFO A;  1HBW A;  1SQX E;  2AEF A;  2PRR A;  2Y0E A;  1IO4 A;  3HD7 C;  2M3B A;  4EOT A;  1E5W A;  1LT9 B;  3V5B A;  3WU2 E;  1FE6 A;  3NTN A;  4U3F D;  3TK1 A;  3CXH H;  1AVY A;  1KQG B;  4N3Y B;  2JWA A;  2Q7C A;  1G1J A;  1EQ7 A;  4XE5 B;  4YXD C;  1PIX A;  3L71 J;  1A02 F;  1RF1 A;  1LJ2 A;  1FOS F;  4D6T D;  2WMM A;  3JC2 2;  3CC4 P;  5AVR B;  3V2P A;  1X8Y A;  3CC2 P;  1VPC A;  1JUN A;  3CXH E;  1YBK A;  4YTP C;  1JNM A;  4L75 A;  5CJ0 A;  1PPJ G;  3LW5 H;  1SQQ D;  1FOS E;  3BCC E;  1KYO I;  3BRT B;  1EZV I;  3RBZ A;  1S5L H;  2WT7 B;  2FY8 A;  1GU4 A;  1IFM A;  1M56 D;  4RKU J;  4HB1 A;  2YO2 A;  2FYN C;  2QE7 H;  1BDC A;  2OYI B;  4B86 A;  3B5N B;  1K05 A;  4H44 C;  2OQQ A;  2O3J A;  1D7M A;  2HOD B;  3H1L G;  1RY3 A;  1G2C A;  1S5L E;  3CCJ P;  1K04 A;  1QL1 A;  2Q3E A;  1J2J B;  4JYB A;  5CCG A;  2HFE D;  3A3Y B;  3L74 D;  1MUU A;  1LT1 A;  4U3F E;  5AW4 B;  3L70 D;  1KIL C;  2CK3 H;  4JYC A;  2XV5 A;  4M3L A;  3G4S P;  1J1D C;  3I56 P;  1W2B O;  1AJY A;  4D6T E;  2YNY A;  5DJU B;  5CCH C;  3Q2Y A;  4EYY Q;  3KXD A;  5M1B A;  3U1C A;  1BCC D;  4ZKU A;  2K9J B;  2E42 A;  3II6 A;  2WWW A;  3CX5 I;  2H8P D;  1GDT A;  3CWB D;  3H1H J;  3L75 J;  1N73 B;  2P1J A;  3E1R A;  2JEE A;  1SQP K;  4Z1M H;  2K88 A;  2WSE H;  4NPE A;  2E5Y A;  1LWU C;  1FZG A;  5APY A;  3AE8 C;  3UIA A;  2BCC G;  3L72 E;  2KB7 P;  4PD4 E;  3L74 E;  5AW6 B;  1GW3 A;  3D6Z A;  1OW8 A;  1CI6 A;  4DOJ A;  3MZW B;  2Q6Q A;  4R4M A;  1VQ4 P;  2P58 A;  1OVR A;  3H1J D;  3WUU A;  1BCC E;  5CMZ A;  5AW2 B;  3CCM P;  4HYT B;  1NU1 K;  1UIX A;  3AE2 C;  1N7S C;  1KZU B;  3BRV B;  1JM0 A;  4BXL A;  1GZL A;  5CCG D;  1Q7Y Q;  1BGY D;  1M1J A;  1KMI Z;  3CLQ A;  3M91 A;  2I1J A;  1LTS C;  2LXB A;  1SP4 A;  3T97 A;  5CCH A;  1URQ C;  4H0L D;  2E75 D;  2YKQ A;  4CPG A;  4IL6 H;  5AW5 B;  1KQF B;  1OW6 A;  1HJ0 A;  4TLF A;  2H89 C;  3AE9 C;  3IN6 A;  3H1K J;  5C39 A;  1ZP0 C;  3HD7 D;  5BU8 B;  3TDK A;  3GW6 A;  1L0N K;  2LR2 A;  2C0W A;  2HYN A;  1R5L A;  4IL6 E;  1NTZ D;  3H1J E;  4W7Z A;  1HJB A;  1KB9 D;  1EDK A;  4ZKP A;  4QMA A;  1NTK D;  3VMX A;  3W68 A;  3FX0 A;  2RH0 A;  1IFP A;  2IBZ G;  2C9N Y;  3M06 A;  1SQP G;  1SLQ A;  4I6M C;  1GTW A;  4WY4 B;  1FDI A;  2KSE A;  2QJP C;  3OJA B;  2NPS B;  3RGU A;  1IC2 A;  2IYO A;  1YJN P;  1GMJ A;  2MKV A;  2E5T A;  4O9B A;  4BRY B;  2CPB A;  1LTA C;  2IYP A;  1NKZ B;  1SVF A;  1KB9 H;  3H32 B;  3A7O A;  3EFG A;  4OGQ C;  1IFI A;  3SWK A;  1M1J B;  5KJ7 C;  3D6Y A;  3BCC J;  3L73 D;  1NTZ E;  5CBO A;  3U1A A;  1KB9 E;  4AQR D;  3N7N A;  3RBX A;  1GL2 C;  1JMM A;  1KIL D;  1OVU A;  3KQG A;  3C8V A;  1NTK E;  1JY3 O;  1NTM K;  3LW5 J;  3NMD A;  4DJG A;  4R4L A;  4DT0 A;  3B5N C;  3BVH A;  1SFC C;  1KV4 A;  3A0H H;  4U3F J;  1UII A;  2XKM A;  1ZR4 A;  1VF5 B;  2HPC B;  2FXO A;  4D6T J;  5AVV B;  1H0T A;  2KUB A;  1BE3 G;  4L76 A;  3G9R A;  3P8C D;  1MFT A;  1R8E A;  3A0H E;  5KLV K;  3MP7 B;  1EXJ A;  5B66 H;  1Y47 A;  1T3J A;  1M7L A;  1KYO D;  4U7J A;  1DEB A;  1EZV D;  1M57 D;  3AE3 C;  1L0N G;  1LTT C;  3H1H E;  2KXP B;  3GHG A;  1SQQ J;  3KPE A;  4KJM A;  5KTB A;  3L73 E;  4PV1 B;  1FZE A;  1J1E C;  2IX7 C;  1KIL E;  5APT A;  3NFQ A;  2WVR A;  1P84 I;  3MUD A;  1T2K D;  1RE4 C;  2GUV A;  1Y8A A;  2MJZ A;  3GF3 A;  1VQO P;  2ZYA A;  1FDM A;  2BEQ D;  1LT9 A;  1KQS O;  1CZQ A;  4GKG A;  5E79 H;  2E76 C;  3HE5 B;  1N7S D;  3KDP B;  3L74 J;  2K3R A;  1K73 Q;  3L70 J;  4I7Z B;  3CPW O;  2GUS A;  5AW1 B;  1HWT C;  1E79 H;  1EDL A;  2WSE J;  1KYO H;  3VOP A;  1RHZ B;  1PP9 D;  2A06 G;  4UB8 H;  1S4X A;  3V2Q A;  4PJ0 H;  2OTL P;  3HE4 B;  1GK6 A;  3P8C E;  3L37 A;  5AW9 B;  1CSB A;  1KD1 Q;  2D2C B;  4H13 C;  1AV1 A;  1BCC J;  1KYO E;  1AQ5 A;  1EZV E;  3CX5 D;  4L74 A;  4UB8 E;  4PJ0 E;  3IR9 A;  1URQ D;  4AUW A;  2WT7 A;  2YMY A;  2XZR A;  1RQV A;  1LP1 B;  5APS A;  1KC8 Q;  2FYU D;  2POH A;  2OYI A;  3CWB J;  2Y0C A;  3B5N A;  1NTM G;  1SQB D;  1R5S A;  2WQY C;  2HOD A;  1HGZ A;  5AVY B;  1DD3 A;  2KSJ A;  3NXS A;  3CCL P;  3Q5R A;  3V4Q A;  1YQ3 C;  2SPZ A;  5KAF H;  3H6P A;  5B5E H;  2H88 C;  1X79 B;  2P10 A;  2B88 A;  1PP9 E;  3CX5 H;  5KAF E;  4OVN F;  2FKW B;  5B5E E;  5KLV G;  1DIP A;  4OWF A;  3H1J J;  3IFM A;  2YXQ B;  1NYH A;  2K9J A;  2R3C A;  1U57 A;  2N9Y B;  3MHV A;  1RE4 A;  1SQV D;  2O1K A;  4K3A A;  2W8Z A;  1VQ9 P;  1N73 A;  1BGY J;  2FYU E;  5H2F H;  1IFD A;  3CMA P;  1SQB E;  4OGQ D;  4DZO A;  2P7J A;  5KJ7 D;  3OAK A;  1FS0 E;  3PLN A;  1GL2 D;  3AEE C;  1PGQ A;  4WY4 C;  2XNX A;  5H2F E;  2KNC B;  1Y9B A;  3FGA D;  2NPS C;  4GDO A;  3F89 A;  1VQ8 P;  1NHL A;  1NGM B;  2HG5 D;  4EDF A;  3FXD A;  1HTL C;  3A2A A;  3B5N D;  1SFC D;  1NTZ J;  3AEF C;  1ZRT D;  1YTZ T;  4YPC A;  2ZVN B;  5APU A;  2Z5H A;  2KLU A;  1SQV E;  1M1J C;  1NOH A;  1NTK J;  3M9B A;  1L0N D;  2FXM A;  1USD A;  1NVO A;  1FAV A;  2M8R A;  3L35 A;  4GOE A;  3BAS A;  1OWA A;  1GK4 A;  1ZV8 A;  3MIW A;  3SFE C;  1Z56 A;  1EDI A;  1SQX K;  2J59 M;  2ZT9 B;  5APW A;  3H1I G;  2WIT A;  2W6B A;  1NWQ A;  5AVU B;  1YQ4 C;  5L8R J;  1SQQ E;  3KYQ A;  1FZC B;  1EXI A;  2V4H A;  2E76 D;  5AW0 B;  3L73 J;  1FZF A;  1HGV A;  4W7Y A;  2XDJ A;  1N2D C;  2ZYD A;  4GIF A;  1G1I A;  1Q86 Q;  4Y99 B;  4C7R A;  4PV1 C;  2IBZ I;  3L70 E;  1KFN A;  3O6Q B;  1FZA A;  1L0L D;  1ZOY C;  4WWI A;  5KLI B;  4WY4 A;  4H13 D;  1XTG B;  2OYH B;  3H25 A;  3RL0 g;  3RK3 C;  4I1L A;  4LGD E;  1DEE G;  2NPS A;  1NTM D;  2QM8 A;  3G3Z A;  1KFM A;  3TGU G;  3GMA A;  3PHL A;  1LTJ B;  1H8A A;  1Q82 Q;  3SSU A;  4BRY A;  1IFJ A;  1VQ5 P;  2B89 A;  3H32 A;  1BDD A;  4I7Z C;  5AW7 B;  1JMB A;  2XND H;  1XTC C;  4XA4 A;  2WSF H;  2Y0D A;  3G71 P;  1N7L A;  3CWB E;  3E1I A;  2YKP A;  1FBM A;  1ZN5 A;  5KLV D;  1KQL A;  2CPS A;  4RES B;  1JTH B;  2AXC A;  2GM4 A;  1S1C X;  2P67 A;  3H1K G;  2M3E A;  2YIU B;  3IF4 A;  3EFF K;  1L0L E;  1ZXG A;  3TF5 A;  1MV8 A;  4A7P A;  1NTM E;  3L4F A;  2KI7 B;  3HUS B;  2E75 B;  2HPC A;  1SQX G;  1M90 Q;  4ASW A;  1S2E A;  1PP9 J;  3I55 P;  2A45 G;  2E74 B;  4WVZ A;  3GLM A;  2PFX A;  1L4A A;  2N9B A;  2Y9Z A;  3P7K A;  1PPJ D;  3GHG C;  4GT1 A;  2M5A A;  1BGY E;  3EWK A;  2WTY A;  1OFC X;  4WY4 D;  3MUD C;  2WPS A;  1N86 A;  1YHQ P;  2NPS D;  1VQ7 P;  1YJW P;  1M8O B;  2FYU J;  2JO1 A;  1HUC A;  3H1L D;  1LT9 C;  1X22 A;  1SQB J;  3AEC C;  4PD4 I;  1T6A A;  1S5L X;  3O8Z A;  3WUV A;  3RK2 B;  5CHX A;  2R5B A;  2N1T A;  1VQK P;  3PH0 A;  3A5T A;  2W90 A;  3BCC G;  1X0T A;  4H44 D;  2XU6 A;  4L73 A;  3HE5 A;  4JPZ B;  1K8A Q;  1YIJ P;  5KAI H;  2L91 A;  2QVA A;  1JY2 N;  1T3U A;  1NU1 G;  1QVF O;  1RE3 C;  3HE4 A;  3CD6 P;  1DD4 A;  3FXE A;  3H1I D;  1OMI A;  2R5D A;  5KAI E;  1PPJ E;  5CCH D;  4U3F G;  1VL2 A;  5GTH H;  1NJI Q;  1SQV J;  1LP1 A;  3PTZ A;  2OYI C;  4D6T G;  1J1D B;  3A0B H;  3ZDM A;  2OTK E;  1JO5 A;  3VN0 A;  1RH5 B;  3H1L E;  1JCD A;  4IFM A;  1S3J A;  5GTH E;  4IFF A;  1IK9 A;  3G6E P;  2BCC D;  2Q9I A;  1LTB C;  4ASV A;  3A0B E;  1L4A B;  2C9L Y;  4EIJ A;  4HKZ H;  2H7H A;  2ZFC A;  1L2P A;  2I8D A;  4C7N B;  2NZ2 A;  2KK7 A;  3SFD C;  5AVT B;  2M5A B;  1IK7 A;  2YKO A;  4PV1 D;  3TGU D;  3USS A;  3QWO C;  2ZT9 C;  3JCU H;  2QJK B;  5B66 E;  2ZVO B;  1LWU B;  1W5C E;  2Q5U A;  3L72 G;  3R2P A;  3RK3 D;  2LXC B;  3L74 G;  2HR3 A;  1FZC C;  3PP5 A;  3D70 A;  2N1T B;  3JCU E;  4IFD K;  1N73 C;  1L0N J;  2K9Y A;  3CC7 P;  2KLV A;  1WMK A;  2QA4 P;  2QIW A;  3KHU A;  3K5B A;  3RL0 B;  2O1J A;  2BEZ F;  2JP3 A;  3CCS P;  1NTZ K;  1BCC G;  5E79 E;  2BCC E;  2P2U A;  2I1K A;  4KHX A;  1N7S B;  2IDB A;  4ZMD A;  1RE3 A;  1N8R Q;  1NTK K;  1DH3 A;  2KNC A;  2OYH C;  4N6J A;  3M0D A;  1OW7 A;  2AXT H;  3S9O A;  1H89 A;  1NAF A;  3Q5P A;  2OAR A;  1SQX D;  3V6I A;  1YJ9 P;  2ZYG A;  5TIS H;  2BAS A;  3LIE A;  3RK3 E;  3FWL A;  2KOG A;  3MD0 A;  1FZB A;  1WT6 A;  2AXT E;  3CI9 A;  1EDJ A;  2ZXX A;  2KP8 A;  2YO3 A;  2WSF J;  1RF0 C;  2IBZ D;  2M0B A;  2W6A A;  5CBN A;  4WBA A;  1SQP D;  5BVZ A;  2G3A A;  1KTM A;  2B9B A;  3FWN A;  4GOD A;  1L0L J;  4RO0 A;  3H1J G;  2FFD B;  1IJD B;  1AVO A;  3AE4 C;  1OXZ A;  2B87 B;  4BWN A;  1MFZ A;  2YMK A;  1NTM J;  1ZR2 A;  1U7J A;  4K35 A;  2KZI A;  1H88 A;  3CX5 E;  3C1L A;  2JJL A;  1GW4 A;  1NO4 A;  3L71 G;  3HUS C;  3HTK B;  3V4W A;  1FZC A;  3TSI A;  1VQP P;  3CCE P;  2PP6 A;  2E74 C;  5APX A;  2KYV A;  3SWF A;  3TNU A;  3VP8 A;  1NU1 D;  2QJP B;  1U7M A;  1JY3 P;  1YIT P;  4EI2 A;  5KLV J;  2KS1 B;  1FC2 C;  1PL5 A;  1WRG A;  4HH2 A;  1KOR A;  2IBZ E;  3GF7 A;  1SQP E;  3O6Q A;  3V2N A;  3P32 A;  1X9V A;  4OGQ B;  2OYH A;  1NTZ G;  2QSI A;  1JY2 P;  1FU1 A;  1OZH A;  3EQ2 A;  4AYC A;  3M0A A;  2O01 H;  3RK2 C;  1LTJ A;  2IFM A;  1GL2 B;  1JCC A;  1NTK G;  1BE3 D;  1IFN A;  1FJP A;  2VRS A;  1HF9 A;  3Q5S A;  3SWY A;  5AVQ B;  3S1K A;  3Q1M A;  1PV3 A;  1VDF A;  1RF0 A;  3E7K A;  3L36 A;  2JR8 A;  1SFC B;  3S4R A;  1NU1 E;  3TYY A;  1ZME C;  3WMM 0;  1YI2 P;  2QEX P;  5EFW B;  1KN7 A;  3B71 A;  2YXR B;  2WSS H;  3L72 D;  1JTH A;  4PD4 D;  1JOC A;  2Q3I A;  3M9H A;  1HVV A;  3H1L J;  3AE1 C;  4NPF X;  2AEJ A;  2ZT9 D;  1VQL P;  1GU5 A;  2J58 A;  1EC5 A;  5BU5 A;  1NH4 A;  3H1H G;  3L75 G;  3LID A;  4WB4 A;  3VMA A;  1QGK B;  4RJT A;  3L73 G;  2V7Q H;  1VF5 C;  3HUS A;  2A06 D;  1J1E B;  2HLO A;  1QEX A;  3VTP C;  2FYU K;  3TNU B;  1BE3 E;  2IPP A;  1L4A C;  3W67 A;  1SQB K;  1PGP A;  1ZRT E;  3AE7 C;  1PGO A;  2A45 I;  3HD7 A;  3CCR P;  4GOF A;  3H1I J;  1L0N E;  2ZJS E;  3QH9 A;  4PD4 H;  1RQU A;  2E76 B;  2WSC H;  2QJK C;  3OA7 A;  1RF1 B;  1HH0 A;  3AEA C;  1NKN A;  2LKM A;  2QJY B;  3P8M C;  2N1T C;  1LTI C;  3CXH I;  2BCC J;  1EZV G;  1DX7 A;  4H13 B;  1T2K C;  2WPV B;  3RL0 C; 
#chains in the Genus database with same CATH homology
 1GK6 A;  3P8C E;  3L37 A;  1SQV K;  3LW5 H;  5AW9 B;  1FOS E;  1CSB A;  1JY2 N;  1T3U A;  3BRT B;  1RE3 C;  3HE4 A;  2WZ7 A;  2WT7 B;  1GU4 A;  1IFM A;  1AQ5 A;  3IR9 A;  4JF7 A;  1URQ D;  2YO2 A;  2R5D A;  1G2C B;  4AUW A;  2WT7 A;  2YMY A;  2XZR A;  5CCH D;  2OYI B;  4B86 A;  3B5N B;  5APS A;  2HOD B;  1RY3 A;  1G2C A;  2POH A;  3VMY A;  2OYI A;  3B5N A;  1QL1 A;  2OYI C;  1CW5 A;  1J1D B;  2HOD A;  1J2J B;  4JYB A;  5CCG A;  3C9I A;  1HGZ A;  2HFE D;  3A3Y B;  5AVY B;  1JO5 A;  1MUU A;  2KSJ A;  1KIL A;  5AW4 B;  3NXS A;  3VN0 A;  1KIL C;  1SQQ K;  3V4Q A;  4JYC A;  2Z4E A;  2XV5 A;  2C0X A;  4M3L A;  1JCD A;  4IFM A;  1J1D C;  3H6P A;  4IFF A;  1IK9 A;  2Q9I A;  2W27 A;  2YNY A;  5CCH C;  1YYC A;  1LTB C;  1X79 B;  1L4A B;  2C9L Y;  1MZ9 A;  4EIJ A;  2H7H A;  1PFI A;  2ZFC A;  3U1C A;  4C7N B;  4ZKU A;  5AVT B;  2FKW B;  3HD7 B;  5APQ A;  2FFD C;  2YKO A;  4C7N A;  3IFM A;  2E42 A;  3II6 A;  3V2R A;  2WWW A;  2L5G B;  2H8P D;  2R3C A;  1GDT A;  1LWU B;  1RE4 A;  2Q5U A;  3R2P A;  1N73 B;  2P1J A;  1QL2 A;  5AVX B;  3RK3 D;  5AW3 B;  2JEE A;  2O1K A;  1SQP K;  1FZC C;  3PP5 A;  1LWU A;  2WSE H;  1N73 A;  1LWU C;  1FZG A;  2N1T B;  5APY A;  4IFD K;  1N73 C;  3UIA A;  1IFD A;  2IFN A;  1JY3 N;  3RK2 D;  2KB7 P;  2KLV A;  1CI6 B;  4DZO A;  2P7J A;  5AW6 B;  5KJ7 D;  3RL0 B;  3OAK A;  2O1J A;  1GW3 A;  2QM7 A;  1NTZ K;  1CI6 A;  1GL2 D;  4DOJ A;  4WY4 C;  2XNX A;  2P2U A;  2I1K A;  4KHX A;  5AVS B;  1N7S B;  2NPS C;  1RE3 A;  1NTK K;  1DH3 A;  2OYH C;  1NHL A;  3M9Q A;  4N6J A;  1N7S A;  2HG5 D;  5CMZ A;  1S9K D;  5AW2 B;  4HYT B;  3M0D A;  1NU1 K;  1N7S C;  3CL3 D;  3M0D C;  1HTL C;  1H89 A;  1KZU B;  3BRV B;  3A2A A;  1A02 J;  3B5N D;  1NAF A;  1SFC D;  2R32 A;  2WPR A;  3RL0 C;  1GZL A;  2H43 A;  2OAR A;  5CCG D;  1YTZ T;  1KIL B;  1M1J A;  1L0L K;  2BAS A;  3LIE A;  3CLQ A;  5APU A;  2Z5H A;  1M1J C;  1NOH A;  3M9B A;  3M91 A;  4OH8 B;  2FXM A;  2KOG A;  3MD0 A;  1FZB A;  1WT6 A;  3CI9 A;  2I1J A;  2KP8 A;  2YO3 A;  1LTS C;  1SP4 A;  1RF0 C;  3MGN A;  1URQ A;  2W6A A;  1FAV A;  2M8R A;  4WBA A;  3T97 A;  5CCH A;  1URQ C;  3L35 A;  3BAS A;  5BVZ A;  1OWA A;  2YKQ A;  1GK4 A;  1ZV8 A;  3MIW A;  2FYZ A;  5AW5 B;  1Z56 A;  1L4A D;  2FFD B;  4N78 D;  1IJD B;  3B8E B;  1OXZ A;  1SQX K;  2J59 M;  1JY2 O;  5APW A;  2WIT A;  1MFZ A;  2W6B A;  1NWQ A;  2FFD A;  3HD7 D;  5AVU B;  5BU8 B;  1ZR2 A;  1L0N K;  3KYQ A;  2C0W A;  2HYN A;  3N4X A;  4W7Z A;  2E43 A;  1FZC B;  1HJB A;  1S9K E;  1H88 A;  2JJL A;  1GW4 A;  1NO4 A;  3HUS C;  3HTK B;  3V4W A;  1FZC A;  4ZKP A;  5AW0 B;  3TSI A;  3VMX A;  1FZF A;  4W80 A;  2PP6 A;  3HTK A;  2N1T D;  3MTU E;  2KYV A;  5APX A;  3TNU A;  3SWF A;  1HGV A;  4W7Y A;  3VP8 A;  2XDJ A;  1N2D C;  2C9N Y;  4GIF A;  3M06 A;  1G1I A;  5AW8 B;  1JY3 P;  4Y99 B;  1SLQ A;  1YTZ I;  4I6M C;  4C7R A;  4C46 A;  1GTW A;  4WY4 B;  2PAJ A;  5AVZ B;  3RK3 B;  1FJK A;  1WRG A;  3RL0 D;  4HH2 A;  1KFN A;  1T8Z A;  3OJA B;  2NPS B;  1FZA A;  2ZXE B;  4WY4 A;  4Y99 C;  1W2E A;  1IC2 A;  1XTG B;  2OYH B;  3RK3 C;  4I1L A;  4LGD E;  2NPS A;  3V2N A;  4O9B A;  3P32 A;  1X9V A;  2QM8 A;  2CPB A;  3G3Z A;  1LGH B;  1RF1 C;  1LTA C;  1KFM A;  1NKZ B;  1SVF A;  2OYH A;  1LTJ B;  4N78 E;  1H8A A;  1JY2 P;  1FU1 A;  3H32 B;  1LTG C;  3EQ2 A;  3VP9 A;  3HRN A;  1IFJ A;  1ZLL A;  4AYC A;  3M0A A;  3A7O A;  2O01 H;  5APV A;  3EFG A;  3RK2 C;  1LTJ A;  2IFM A;  1GL2 B;  1JCC A;  3H32 A;  5KJ7 A;  1IFI A;  1LTJ C;  5AW7 B;  1M1J B;  5KJ7 C;  1IFN A;  1XTC C;  4XA4 A;  2WSF H;  1FJP A;  2VRS A;  1GL2 A;  3U1A A;  4AQR D;  3N7N A;  1N7L A;  1GL2 C;  1JMM A;  1KIL D;  3SWY A;  5AVQ B;  3E1I A;  3KQG A;  2YKP A;  2Z5I A;  1FBM A;  1ZN5 A;  3U59 A;  1URQ B;  1JY3 O;  1GD2 E;  1VDF A;  1NTM K;  1RF0 A;  1KQL A;  3L36 A;  3NMD A;  1SFC B;  2CPS A;  3VYI A;  4RES B;  1JTH B;  3TYY A;  2GM4 A;  5CJ4 A;  3I5C A;  3WMM 0;  2P67 A;  1SFC A;  3B5N C;  3BVH A;  1SFC C;  1JTH A;  1JOC A;  2Q3I A;  5CCG C;  3M9H A;  2XKM A;  1HVV A;  1ZR4 A;  4LC1 A;  1MV8 A;  1GU5 A;  2J58 A;  2HPC B;  5BU5 A;  3BAT A;  1NH4 A;  5AVV B;  3L4F A;  3LID A;  5AVW B;  4WB4 A;  3HUS B;  3P8C D;  2HPC A;  5KLV K;  2A45 H;  4I2L C;  3GHG B;  1T3J A;  1M7L A;  3HUS A;  2A45 G;  1J1E B;  4LLH A;  2HLO A;  2WPQ A;  3VMZ A;  1DEB A;  3VTP C;  1L4A A;  1LTT C;  2FYU K;  2N9B A;  3TNU B;  3GHG A;  3P7K A;  2IPP A;  1AFO A;  1L4A C;  3KPE A;  5KTB A;  1SQB K;  1HBW A;  3GHG C;  4GT1 A;  1FZE A;  1J1E C;  2A45 I;  2IX7 C;  5APT A;  3HD7 A;  1IO4 A;  3NFQ A;  2WTY A;  3HD7 C;  2M3B A;  3MUD A;  4EOT A;  1T2K D;  1E5W A;  1LT9 B;  4WY4 D;  1RE4 C;  2GUV A;  3V5B A;  2WPS A;  2MJZ A;  1N86 A;  2WSC H;  3NTN A;  1FDM A;  2NPS D;  3OA7 A;  1RF1 B;  3TK1 A;  1LT9 A;  1CZQ A;  1HUC A;  4N3Y B;  2Q7C A;  4GKG A;  1LT9 C;  1G1J A;  1EQ7 A;  1HH0 A;  4XE5 B;  1A02 F;  1RF1 A;  3HE5 B;  3O8Z A;  1N7S D;  3KDP B;  3RK2 B;  1NKN A;  1FOS F;  2LKM A;  2R5B A;  5CHX A;  2N1T A;  3P8M C;  5AVR B;  3A5T A;  3V2P A;  2GUS A;  1LTI C;  2N1T C;  5AW1 B;  1HWT C;  1X8Y A;  2XU6 A;  3HE5 A;  3VOP A;  1VPC A;  1JUN A;  3V2Q A;  1DX7 A;  1T2K C;  1JNM A;  5CJ0 A;  3HE4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...