1IFMA

Two forms of pf1 inovirus: x-ray diffraction studies on a structural phase transition and a calculated libration normal mode of the asymmetric unit
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords INOVIRUS
publication title Two Forms of Pf1 Inovirus: X-Ray Diffraction Studies on a Structural Phase Transition and a Calculated Libration Normal Mode of the Asymmetric Unit
pubmed rcsb
source organism Pseudomonas phage pf1
total genus 21
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 1994-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ifmA00
1IFMA 1PFIA 1QL1A 2KSJA 2IFMA 4IFMA 1IFNA 1ZN5A 2XKMA 2IFNA 3IFMA 1QL2A 2KLVA
chains in the Genus database with same CATH superfamily
1SQVE 1L0LJ 4GOFA 2OYHA 3II6A 1M90Q 5AVUB 1JCCA 1QLED 2PGDA 3G4SP 2JWDA 2WVRA 2WT7B 1MUUA 1RF1A 2WSFJ 1NTZE 1HJ0A 2ZT9D 3FWNA 3H1HJ 4DOJA 1PP9J 1FZFA 2CPBA 3AEEC 3PTZA 1P84I 4HH2A 4I2LC 2IBZI 3CCEP 3I56P 5H2FH 3PHLA 1S72P 1BGYG 3VMAA 2V4HA 2OYIB 4OGQC 3A5TA 2RMZA 4EOTA 3CC4P 4GDOA 1NGMB 3EFGA 3L75D 3C8VA 1NTKK 4H44B 1JO5A 1X0TA 3CL3D 3TSIA 3I5CA 1NAFA 3V2PA 2NPSA 2D2CD 1GW4A 1JEKA 3MD0A 5TISH 4CPGA 1ZRTD 2R3CA 3A2AA 5CBOA 5CBNA 2OYIC 1M56D 1Q86Q 3NXSA 1LWUA 1D7MA 1G1JA 1NH4A 2J5UA 2E42A 4XE5B 2M3EA 1RQVA 2N1TB 4D6TD 5AVQB 5KLVD 4NPDA 1K8AQ 3FWLA 2Z4EA 3U1AA 4ZKUA 4ASVA 3AECC 3H1LD 5CCHD 1SQVK 1GK6A 2IZ0A 3L74E 1L0ND 2J58A 2ZJSE 3CC7P 1KFNA 1L4AB 1MZ9A 2GUVA 2MKVA 2QRXA 5GTIH 2M8RA 4NPEA 4JF7A 3TK1A 2IFMA 1DEEG 1IJDB 1KB9I 3H1IG 1OMIA 1DH3A 1USEA 4M3LA 2M5AA 3M9HA 1S9KE 3I55P 1FOSF 1OIPA 3P8CD 4BRYA 3CCVP 1RY3A 3CCSP 3HTKA 1OZHA 2L5GB 3L75J 1KYOD 1H89A 1CI6A 2UWJE 1P84D 4U3FE 2IX7C 3AE4C 1FE6A 3Q5SA 1KQSO 3L4FA 3CX5H 3S1KA 1AVYA 1ZOYC 3TGUE 5AW4B 5KTBA 3A0HH 5H2FE 1NTME 2P67A 1T3JA 4D6TJ 1N7SA 5KLVJ 1LP1B 4IL6E 2QEXP 3SWKA 3H1KG 2P10A 3AE3C 1VPCA 3CD6P 1SQQG 2HODA 3CC2P 1VQKP 2Q3EA 4HB1A 1LTTC 1QVGO 4N78D 1SQXD 3SWFA 1N73A 4YXDC 3HE4A 1KN7A 3HD7A 1GK4A 2ZXEB 4PV1D 3C1LA 2AXTH 4AUWA 5GTHH 4AQRD 4L75A 4PJ0E 1SQPD 2FYUG 1X22A 3RGUA 1RF1B 3U59A 3BVHA 3L71D 1LTJB 1BCCE 2ZVOB 2GA1A 2FYNB 2RN0A 3L72D 1FZGA 3PP5A 2JO1A 2C0WA 4HYTB 3GHGC 3C9IA 2E75C 1E5WA 4UB6H 1J1EC 2Q5UA 1JNMA 1LTJC 3H1JD 2YMKA 1NOHA 2KYVA 1EXJA 2YIUC 2KLUA 3BRTB 4C46A 2B88A 2WSCJ 3W68A 4WBAA 1A02J 4K3AA 2VRSA 4DJGA 1EDKA 1BGYJ 4GIFA 2Z5HA 1X9VA 1VDFA 2Q3IA 1KILB 2KSEA 1W2BO 1BE3D 2XNDH 5AVSB 1T2KD 2IBZE 1NTKD 2WT7A 2WPSA 4H0LC 1LTAC 2V7QH 3MUDC 5E79E 1ZW0A 5KLIC 3QH9A 3D6YA 5APWA 3R2PA 1KILC 2JEEA 5TJHA 1VQ8P 3SWYA 3F89A 1E79H 1FOSE 1M1JC 4ZKPA 3L71J 3ABVC 3WUUA 1NAYA 4YPCA 5AW2B 1N8RQ 3CXHD 1H88A 1SQBE 1WMKA 2OYOA 2OYIA 1EZVD 2YKOA 1M7LA 3V2RA 1M1KQ 2Y0DA 1NJIQ 5AW9B 4RO0A 2WPRA 4R4MA 4GOEA 2M5AB 4DZOA 3B4SA 4RESB 1SQVD 1YQ4C 3BCCE 3V4QA 3H1IJ 2BCCE 2OTKE 3KZIE 5KJ7D 4U3FG 4IOIH 2ZT9C 2N1TA 1URQD 2V7QJ 1H8AA 1TU3F 5APVA 1RHZB 3QWOC 4XA4A 1CZQA 2KP8A 5AW3B 5AVWB 1IFNA 2D2CB 4UB6E 1KB9E 1GU5A 1W2EA 1FDOA 1N7SB 4Z1MH 3CCUP 3RL0g 1KD1Q 4TT3H 5CJ4A 1X8YA 2WSSH 2QJPC 2D2CC 5B66E 3CMAP 3H1KJ 3B71A 3G3ZA 1SQQJ 3CI9A 5AW7B 2Y0CA 1K73Q 3U1CA 1J1DB 3L35A 3KXDA 4WY4B 1SQBK 4W7YA 3MGNA 2WMMA 3GW6A 1SQVJ 2H8PD 5KAIH 2QJYB 4ZNCA 3RL0D 2YO3A 3AE7C 4DCKA 2BASA 1SLQA 3L37A 2WPVB 2R32A 1Q2NA 1RQUA 4OH8B 5CCHC 3H1LG 2A45H 3KQGA 2BEZF 4MN4C 1R5SA 3NFQA 1L0NG 4PD4H 2C0XA 1LP1A 1GL2D 3IF4A 1CW5A 1T6AA 2XV5A 1SS1A 2OTJP 1U7JA 1SFCD 4I7ZC 2N9YB 1S9KD 1YQ3C 3G71P 2R3SA 1VF5D 3KPEA 2K1AA 4JQ0D 1JM0A 1GMJA 2P2UA 1FZAA 3GHGA 4U3FD 1Y9BA 3RK3E 1K05A 2IBZG 2DW3A 1K04A 4GKGA 4OGQB 1HWTC 1LTJA 1FS0E 3GG2A 2W90A 4BXLA 2K9JA 4W80A 4H13D 1OW6A 1EXIA 3MP7B 3TGUD 1WRGA 3BRVB 2KK7A 4EI2A 2B9BA 2O01J 5KAFE 2WTYA 3E1RA 1PIXA 1QX8A 3SSUA 4PV1B 2YNYA 3M0DC 5CCGD 3LW5H 2KXPB 1IFJA 1VQ4P 3WU2H 5APSA 1WT6A 4NPFX 3AEBC 4YXWH 4LLHA 1L2PA 1L0LE 3MUDA 1SQXG 3GF3A 4PV1C 1KILA 3L73E 5AVTB 2E5TA 2FY8A 2KB7P 3BCCG 1MFZA 4WWIA 1SQPG 2QSIA 3B5ND 3WUVA 5B5EH 3H1HE 1VQ5P 1M1JA 3L71G 1Q81Q 1PP9E 2E76D 1DD4A 1BCCD 3P32A 2AEJA 2LKMA 3L72G 4IFMA 2FXOA 1YTZT 4U3FJ 1OX3A 2KS1B 2O01N 2QIWA 1KILE 1DEBA 2E43A 3H1JG 1NO4A 2K9YA 1ZR2A 3TF5A 1S5LE 3TGUJ 3LW5J 3CCLP 3GMAA 1GDTA 1DIPA 1NTZK 1X79B 4K35A 3V2QA 3JSVC 2Z5IA 4I1LA 2QG4A 3P8MC 5AVYB 1BE3G 1KV4A 1HGVA 2JP3A 1T2KC 1IZNB 2QA4P 1FC2C 1BSNA 2IBZD 1NTKG 1PZQA 4JBZA 3CWBG 3ITKA 1LT9B 3A7OA 5BVZA 1KYOH 2O1KA 3WUTA 1YJWP 1P84H 3HE5A 1LTSC 4JYCA 1NU1E 1JOCA 2CPSA 1JB0J 3MHVA 1NYHA 2K3RA 2A06E 1LT9C 2WSCH 5AW0B 1SQBD 4L73A 2R5BA 5DJUB 3MTUE 1EZVG 3KHUA 3IN6A 2Q6QA 3H1LJ 4AYCA 1S1CX 1URQB 1L0NJ 1SQVG 1OVUA 5TISE 2KSJA 3L75E 1HTLC 3JC22 1SP4A 1QEXA 2C9LY 3AE9C 3BCCD 3GHGB 2E75B 2QM8A 5KJ7C 3CLQA 5CCHA 2BCCD 1J1EB 4Y28J 1H0TA 2C9NY 1PV3A 3VP8A 1ZRTE 1OVRA 2YKQA 2M0BA 4WY4A 1URQC 1NTZG 3A0BH 2I8DA 2YIUB 2K9JB 2H88C 4H44D 1QL1A 3V2NA 2K88A 4D6TE 1KB9D 3F5HA 2OYHC 5KLVE 3UIAA 2XU6A 1JY3P 5CMZA 2QJKB 1AFOA 2YKPA 1AQTA 3IAOA 1VQLP 2HFED 5GTIE 1PPJE 2KZJA 5CJ0A 1N7LA 1JTHA 1ZP0C 3OJAB 2AXCA 3B8EB 4H0LB 1PGJA 2KZIA 5KLIB 1IC2A 1HJBA 2N1TD 5L8RJ 2ZYGA 1SQBJ 3RK2D 2OTLP 2GUSA 1NU1K 4C7RA 3L73G 4GODA 2QJKC 1YBKA 1NTMK 5AVRB 2H89C 1M1JB 1KZUB 3CWBD 1SQXJ 3AEFC 2POHA 1YYCA 5APYA 2ZXXA 1GL2B 2YO2A 1L4AD 3RL0C 2JJLA 3KDPB 3CX5E 3Q2YA 2W6JH 2LXBA 3S9OA 3GF7A 3BCCJ 4N6JA 2Y9ZA 3V4WA 1SQPJ 1SFCB 1IK9A 3A0HE 2BCCJ 1W5CE 3EWKA 1GD2E 1M57D 3SFEC 1N2DC 4UB8H 3L74G 1GL2C 5M1BA 1R5LA 3L72J 2JDIH 5K5GB 3M06A 3JCUH 2N9BA 1MKMA 2Q1KA 2ITAA 1BGYE 2IDBA 1KORA 1SFCC 3Q5RA 2A45I 4WB4A 4WVZA 3CXHH 1S3JA 2ZT9B 3H6PA 4JPZB 1VF5C 2GM4A 5AW8B 3H1JJ 1J2JB 2W6BA 1BDDA 3A3YB 4H13B 3O6QA 2AXTE 2P1JA 5GTHE 2B89A 5AW1B 1R8EA 1VQ6P 4N78E 2K37A 3RK3D 5AVXB 1NTZD 3RBZA 2HG5D 3FXEA 1KQFB 1BE3J 3HE5B 4H13C 1ZV8A 3TGUG 1NU1G 1AVOA 1JMMA 2QJPB 4N3YB 1NTKJ 3IFMA 3CWBJ 1NTMG 4OVNF 2KS1A 2LXCB 1IFDA 5CCGC 1YJNP 1JY3N 2IPPA 3B5NB 3SFDC 2H7HA 2ZYAA 1ZXGA 4A7PA 1AQ5A 4GT1A 1MV8A 3V6IA 3L73D 3AE5C 1USDA 1FAVA 2O1JA 3H1IE 5AW6B 3B5NC 1H0TB 3AE1C 3EQ2A 3H1HD 1FU1A 2E76C 5APUA 3CCJP 1Y47A 1PP9D 4OWFA 1LT9A 1BCCG 2KLVA 3AEGC 2XZRA 2O01H 1U7MA 2NPSD 4I7ZB 2JWAA 1HGZA 3FXDA 1NTZJ 1KILD 3ZDMA 3TDKA 2NRGA 3CCRP 3L74D 4HKZH 2Y9YA 3P7KA 2WSEJ 4DT0A 1QVFO 1IFMA 4TLFA 3TYYA 1YJ9P 3L70E 1JTHB 1S2EA 1IK7A 1KTMA 2FBWC 1GU4A 3MZWB 1M8OB 5KJ7A 3VMXA 1OWAA 3H1KE 3MIWA 1NHLA 1UIXA 4L74A 1URQA 1ZR4A 1SQQE 2HPCB 1T3UA 2B87A 1RE4C 2FFDC 3Q3DA 2NZ2A 1N86A 4QMAA 3EFFK 1GW3A 4ZMDA 1GTWA 1OVVA 2JKVA 5EFWB 3N4XA 2O3JA 3L73J 4JYBA 2FYUE 3HUSC 2SPZA 1NU1D 2E74D 2I1JA 3CCQP 1U57A 1NTMD 3TNUB 3G9RA 1LTIC 2PP6A 3OAKA 1VQ7P 1DX7A 1KYOI 2A06D 1SQBG 3CX5I 4EIJA 1JY2P 3VYIA 5AVZB 2OQQA 2IYOA 1LGHB 4XFJA 4IL6H 3Q5PA 3WMM0 1AA0A 4HJGH 3L74J 1UIIA 1S5LX 1BSHA 3O6QB 2W6AA 5KKZB 1FDMA 2MJZA 1OFCX 3M91A 3BATA 2BCCG 1Q82Q 1JUNA 1N7SD 1SVFA 5KAIE 1GL2A 1HUCA 5KKZC 4PJ0H 4H44C 2P7JA 3HRNA 4RKUJ 3AE8C 1SFCA 4C7NB 3HD7D 3USSA 2ZYDA 1VL2A 1SQQK 3RK2B 3E7KA 1FJPA 3T97B 3VMYA 4PD4E 3LIEA 2Q7CA 1NU1J 1PPJD 1JCDA 1YI2P 2IZ1A 4WY4D 1NTMJ 2N1TC 2YMYA 3RBXA 1PGPA 4IL6X 1EDJA 2YXQB 3BASA 3RK2C 1LT1A 2FYUK 1FZCB 2E5YA 1Q7YQ 1XTGB 1A02F 1VQ9P 2IYPA 1RE3C 2W8ZA 1L4AC 4W7ZA 3PLNA 5CCGA 1FZCC 2HYNA 2L91A 4KJMA 5BU8B 2XNXA 3CX5D 2PFXA 3PJSK 3VOPA 1NWQA 1JY3O 2G8YA 1Y8AA 1LNQA 5E79H 1L0LK 2FXMA 1YTZI 3W67A 1FZEA 3CMEP 1FBMA 3OA7A 2G3AA 2OGUA 1BCCJ 2W27A 2WZ7A 4KHXA 5DJTB 1T8ZA 1IFIA 4KT0J 1Q90D 4LGDE 1RH5B 1JY2N 3L70G 3WU2E 1BGYD 3B5NA 3RK3B 4EDFA 2OARA 3H32B 4OGQD 2WWWA 2B87B 4EYYQ 1VQOP 1G1IA 3CXHI 3RK3C 5B5EE 2OYHB 5C39A 2CK3H 3H25A 1EZVI 1MFTA 2HLOA 3PH0A 2KNCA 2I1KA 3N7NA 3PRJA 1YHQP 1G2CA 2XKMA 1IFPA 1XTCC 3KZIH 1RF0C 2QM7A 3AEAC 1PGQA 1EC5A 4O9BA 2BEQD 3M0AA 3V5BA 3AEDC 2PAJA 2R44A 2H43A 1LTGC 3H1LE 2J59M 2WPQA 1RE4A 2ZFCA 1KB9H 2FFDA 1RF1C 1Z56A 3M9QA 3D71A 1L0NE 4RJTA 1L0LG 2FYNC 3RL0B 3IR9A 4IFFA 3KYQA 1PGOA 2HPCA 3AE2C 3FX0A 4LC1A 2ZVNB 2ZAEB 3VP9A 3H1ID 1IO4A 3K5BA 1QGKB 3HUSA 2NPSB 3M9BA 5B66H 1HH0A 3AE6C 3P8CE 3H1HG 1PL5A 1LWUB 2XDJA 4YTPC 1PP9G 1GZLA 2IFNA 3NTNA 1KYOE 3M0DA 3CPWO 3D6ZA 1P84E 1LJ2A 1HVVA 2AEFA 2NPSC 4ASWA 2HR3A 1VF5B 3TNUA 2A45G 1ZMEC 4L76A 4IFDK 1LWUC 1AV1A 3CCMP 5AW5B 1YITP 1NKNA 3NMDA 3L70D 1OW7A 2KI7B 2LR2A 4U7JA 3GLMA 2KIKA 2RH0A 3H1KD 1FDIA 4PD4I 2FXPA 1SQQD 1LTBC 1KC8Q 1VQNP 2E74B 5BU5A 4B86A 2PRRA 2Q9IA 5KLVK 1SQXE 1AJYA 3VTPC 2P58A 1OW8A 3O8ZA 4BRYB 3HTKB 3A0BE 1ZN5A 1NKZB 1CI6B 2R5DA 2WQYC 1SQPE 3VN0A 2FYUD 2E74C 1L0NK 3L71E 4I6MC 2WITA 3OW2O 1EDLA 3S4RA 1HBWA 2QVAA 3D70A 4C7NA 2WSEH 1KMIZ 1EDIA 3L72E 2A06G 3T97A 2QE7H 2E75D 5KAFH 2AEMA 2FKWB 5APTA 2KUBA 1NVOA 5APXA 1KQLA 3H1JE 2E76B 1RE3A 4BWNA 1L0LD 1QL2A 3FGAD 5AVVB 1L4AA 2HODB 3Q1MA 3L75G 1FZCA 1ZLLA 4R4LA 1S4XA 3L70J 1DD3A 1N73B 3HE4B 3HD7B 3LIDA 1N7SC 2KNCB 1EQ7A 1BE3E 3R4YA 1G2CB 1K9MQ 1KQGB 2WSFH 3E1IA 1NTKE 1JY2O 3CWBE 1VQMP 1N73C 1PFIA 3HD7C 4H0LD 2Y0EA 2YXRB 3VMZA 4D6TG 1HF9A 5KLVG 2FYZA 1BDCA 1CSBA 5CHXA 1YIJP 4UB8E 2W83C 2KOGA 4PD4D 2JR8A 2FYUJ 2RKLA 1JMBA 2FFDB 3JCUE 5APQA 1SQXK 2M3BA 4Y99B 1FZBA 1PPJG 1J1DC 3L36A 1FJKA 4WY4C 3CXHE 1OXZA 2QJYC 3G6EP 1VQPP 1EZVE 1SQPK 1S5LH 3H32A 3HUSB 1KFMA 1RF0A 4Y99C
chains in the Genus database with same CATH topology
4WY4D 2N1TC 2YMYA 2OYHC 2N1TA 1URQD 3BASA 2OYHA 3RK2C 3UIAA 3II6A 2XU6A 1JY3P 2FYUK 1H8AA 5AVUB 5CMZA 1FZCB 5APVA 1AFOA 2YKPA 1JCCA 1XTGB 2HFED 4XA4A 1CZQA 2KP8A 5AW3B 5CJ0A 1N7LA 1JTHA 1A02F 2WT7B 5AVWB 1IFNA 3OJAB 3B8EB 1GU5A 1W2EA 1MUUA 1RF1A 1IC2A 1N7SB 1HJBA 2N1TD 1RE3C 4DOJA 1L4AC 3RK2D 2GUSA 4W7ZA 5CCGA 1NU1K 1FZFA 2CPBA 4C7RA 1FZCC 4HH2A 2HYNA 5BU8B 2XNXA 4I2LC 3VOPA 5CJ4A 1NWQA 1NTMK 1X8YA 1JY3O 5AVRB 1L0LK 1M1JB 1KZUB 2FXMA 1YTZI 1FZEA 2OYIB 1FBMA 3OA7A 2POHA 1YYCA 5APYA 1GL2B 2YO2A 1L4AD 3A5TA 3RL0C 2JJLA 3KDPB 2W27A 2WZ7A 4KHXA 3G3ZA 4EOTA 1T8ZA 1IFIA 3EFGA 1NTKK 4LGDE 3CI9A 5AW7B 1JO5A 4N6JA 1JY2N 3V4WA 1SFCB 1IK9A 3CL3D 3B5NA 1J1DB 3RK3B 3TSIA 3U1CA 3I5CA 3L35A 1NAFA 3V2PA 2NPSA 4WY4B 1SQBK 1GW4A 4W7YA 3MGNA 1GD2E 2OARA 3MD0A 2H8PD 3A2AA 2R3CA 2OYIC 3H32B 1N2DC 1GL2C 3RL0D 2YO3A 2WWWA 3NXSA 1LWUA 3M06A 1G1JA 1NH4A 2BASA 2N9BA 1SLQA 3L37A 2E42A 4XE5B 1G1IA 2R32A 4OH8B 5CCHC 1SFCC 2A45I 4WB4A 3RK3C 2A45H 2N1TB 3H6PA 3KQGA 2OYHB 5AVQB 2GM4A 3NFQA 2HLOA 5AW8B 1J2JB 2C0XA 2W6BA 1GL2D 2I1KA 3A3YB 1CW5A 3N7NA 2XV5A 2Z4EA 3U1AA 4ZKUA 1G2CA 2P1JA 2XKMA 1XTCC 1RF0C 5AW1B 2QM7A 5CCHD 1SFCD 4N78E 1SQVK 1GK6A 3RK3D 5AVXB 1S9KD 2J58A 4O9BA 1KFNA 1L4AB 1MZ9A 3M0AA 2HG5D 2GUVA 3V5BA 3KPEA 3HE5B 2PAJA 2M8RA 4JF7A 3TK1A 2IFMA 2P2UA 2H43A 1LTGC 1ZV8A 2J59M 1IJDB 2WPQA 1RE4A 2ZFCA 2FFDA 1DH3A 1FZAA 3GHGA 1JMMA 4N3YB 1RF1C 4M3LA 1Z56A 3IFMA 3M9QA 3M9HA 1S9KE 1FOSF 3P8CD 4GKGA 1IFDA 1HWTC 5CCGC 1LTJA 3RL0B 3IR9A 4IFFA 1RY3A 3KYQA 3HTKA 2L5GB 4W80A 1H89A 2HPCA 1JY3N 2IPPA 4LC1A 1CI6A 1WRGA 3B5NB 3BRVB 3VP9A 1IO4A 3HUSA 2NPSB 2H7HA 3M9BA 2IX7C 1HH0A 2WTYA 3P8CE 1AQ5A 4GT1A 1LWUB 2XDJA 1MV8A 2YNYA 3L4FA 3M0DC 5CCGD 3LW5H 1GZLA 2IFNA 3NTNA 2O1JA 1FAVA 3M0DA 5AW4B 1IFJA 5KTBA 5APSA 5AW6B 3B5NC 1WT6A 1HVVA 2NPSC 2P67A 4LLHA 1T3JA 3EQ2A 3MUDA 1FU1A 1N7SA 5APUA 3TNUA 2A45G 1KILA 1LT9A 4IFDK 1LWUC 2KLVA 5AVTB 1VPCA 5AW5B 2HODA 2XZRA 2KB7P 1NKNA 2O01H 3NMDA 1MFZA 3B5ND 1LTTC 2NPSD 1HGZA 4N78D 1M1JA 3SWFA 1N73A 3HE4A 3HD7A 1KILD 1GK4A 2ZXEB 3P32A 2LKMA 3P7KA 1IFMA 4AUWA 1LTBC 3TYYA 4IFMA 4AQRD 5BU5A 1JTHB 1YTZT 4B86A 1RF1B 1GU4A 3U59A 2Q9IA 5KJ7A 3BVHA 5KLVK 3VMXA 3VTPC 1OWAA 1LTJB 3MIWA 3O8ZA 1DEBA 1NHLA 2E43A 1URQA 1ZR4A 3HTKB 1NO4A 1ZN5A 2HPCB 1T3UA 1ZR2A 1NKZB 1CI6B 2R5DA 1FZGA 3PP5A 1RE4C 2C0WA 3VN0A 4HYTB 2FFDC 3GHGC 3C9IA 1GDTA 1E5WA 1N86A 1L0NK 1NTZK 1J1EC 4I6MC 2WITA 1GW3A 2Q5UA 1X79B 3V2QA 2Z5IA 1GTWA 1HBWA 1JNMA 1LTJC 4I1LA 4C7NA 2WSEH 1NOHA 2KYVA 3P8MC 5AVYB 3BRTB 4C46A 3N4XA 4JYBA 1HGVA 3T97A 4WBAA 1A02J 2VRSA 3HUSC 1T2KC 2I1JA 2FKWB 5APTA 4GIFA 2Z5HA 1X9VA 5APXA 3TNUB 1KQLA 1VDFA 2Q3IA 1KILB 1LT9B 1LTIC 1RE3A 3A7OA 2PP6A 1QL2A 3OAKA 1DX7A 5BVZA 5AVVB 1L4AA 4EIJA 1JY2P 2HODB 2O1KA 3VYIA 3HE5A 1LTSC 4JYCA 1FZCA 1JOCA 2CPSA 1ZLLA 5AVSB 5AVZB 1T2KD 1N73B 3HE4B 1LGHB 2WT7A 3HD7B 2WPSA 1LTAC 3LIDA 1N7SC 5APWA 3R2PA 3WMM0 1KILC 1LT9C 1EQ7A 2WSCH 5AW0B 2R5BA 2JEEA 2W6AA 3MTUE 1FDMA 1G2CB 2MJZA 3SWYA 3E1IA 2WSFH 1JY2O 4AYCA 1FOSE 1M1JC 1N73C 4ZKPA 3M91A 3BATA 1PFIA 3HD7C 1JUNA 1N7SD 5AW2B 1URQB 3VMZA 1H88A 1SVFA 2FYZA 2OYIA 2KSJA 1CSBA 1HTLC 5CHXA 1GL2A 1SP4A 2YKOA 1M7LA 1HUCA 3V2RA 2KOGA 2C9LY 5AW9B 2FFDB 3GHGB 5APQA 1SQXK 2WPRA 2QM8A 2M3BA 4Y99B 2P7JA 1FZBA 3CLQA 3HRNA 5KJ7C 1J1DC 5CCHA 3L36A 1J1EB 1SFCA 1FJKA 4DZOA 4WY4C 2C9NY 3VP8A 3HD7D 4C7NB 2YKQA 4RESB 4WY4A 1SQQK 1URQC 3RK2B 1OXZA 1FJPA 3VMYA 1SQPK 3H32A 3LIEA 3HUSB 2Q7CA 1KFMA 3V4QA 1JCDA 1QL1A 1RF0A 5KJ7D 4Y99C 3V2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IFM A;  1PFI A;  1QL1 A;  2KSJ A;  2IFM A;  4IFM A;  1IFN A;  1ZN5 A;  2XKM A;  2IFN A;  3IFM A;  1QL2 A;  2KLV A; 
#chains in the Genus database with same CATH topology
 1SQV E;  1L0L J;  4GOF A;  2OYH A;  3II6 A;  1M90 Q;  5AVU B;  1JCC A;  1QLE D;  2PGD A;  3G4S P;  2JWD A;  2WVR A;  2WT7 B;  1MUU A;  1RF1 A;  2WSF J;  1NTZ E;  1HJ0 A;  2ZT9 D;  3FWN A;  3H1H J;  4DOJ A;  1PP9 J;  1FZF A;  2CPB A;  3AEE C;  3PTZ A;  1P84 I;  4HH2 A;  4I2L C;  2IBZ I;  3CCE P;  3I56 P;  5H2F H;  3PHL A;  1S72 P;  1BGY G;  3VMA A;  2V4H A;  2OYI B;  4OGQ C;  3A5T A;  2RMZ A;  4EOT A;  3CC4 P;  4GDO A;  1NGM B;  3EFG A;  3L75 D;  3C8V A;  1NTK K;  4H44 B;  1JO5 A;  1X0T A;  3CL3 D;  3TSI A;  3I5C A;  1NAF A;  3V2P A;  2NPS A;  2D2C D;  1GW4 A;  1JEK A;  3MD0 A;  5TIS H;  4CPG A;  1ZRT D;  2R3C A;  3A2A A;  5CBO A;  5CBN A;  2OYI C;  1M56 D;  1Q86 Q;  3NXS A;  1LWU A;  1D7M A;  1G1J A;  1NH4 A;  2J5U A;  2E42 A;  4XE5 B;  2M3E A;  1RQV A;  2N1T B;  4D6T D;  5AVQ B;  5KLV D;  4NPD A;  1K8A Q;  3FWL A;  2Z4E A;  3U1A A;  4ZKU A;  4ASV A;  3AEC C;  3H1L D;  5CCH D;  1SQV K;  1GK6 A;  2IZ0 A;  3L74 E;  1L0N D;  2J58 A;  2ZJS E;  3CC7 P;  1KFN A;  1L4A B;  1MZ9 A;  2GUV A;  2MKV A;  2QRX A;  5GTI H;  2M8R A;  4NPE A;  4JF7 A;  3TK1 A;  2IFM A;  1DEE G;  1IJD B;  1KB9 I;  3H1I G;  1OMI A;  1DH3 A;  1USE A;  4M3L A;  2M5A A;  3M9H A;  1S9K E;  3I55 P;  1FOS F;  1OIP A;  3P8C D;  4BRY A;  3CCV P;  1RY3 A;  3CCS P;  3HTK A;  1OZH A;  2L5G B;  3L75 J;  1KYO D;  1H89 A;  1CI6 A;  2UWJ E;  1P84 D;  4U3F E;  2IX7 C;  3AE4 C;  1FE6 A;  3Q5S A;  1KQS O;  3L4F A;  3CX5 H;  3S1K A;  1AVY A;  1ZOY C;  3TGU E;  5AW4 B;  5KTB A;  3A0H H;  5H2F E;  1NTM E;  2P67 A;  1T3J A;  4D6T J;  1N7S A;  5KLV J;  1LP1 B;  4IL6 E;  2QEX P;  3SWK A;  3H1K G;  2P10 A;  3AE3 C;  1VPC A;  3CD6 P;  1SQQ G;  2HOD A;  3CC2 P;  1VQK P;  2Q3E A;  4HB1 A;  1LTT C;  1QVG O;  4N78 D;  1SQX D;  3SWF A;  1N73 A;  4YXD C;  3HE4 A;  1KN7 A;  3HD7 A;  1GK4 A;  2ZXE B;  4PV1 D;  3C1L A;  2AXT H;  4AUW A;  5GTH H;  4AQR D;  4L75 A;  4PJ0 E;  1SQP D;  2FYU G;  1X22 A;  3RGU A;  1RF1 B;  3U59 A;  3BVH A;  3L71 D;  1LTJ B;  1BCC E;  2ZVO B;  2GA1 A;  2FYN B;  2RN0 A;  3L72 D;  1FZG A;  3PP5 A;  2JO1 A;  2C0W A;  4HYT B;  3GHG C;  3C9I A;  2E75 C;  1E5W A;  4UB6 H;  1J1E C;  2Q5U A;  1JNM A;  1LTJ C;  3H1J D;  2YMK A;  1NOH A;  2KYV A;  1EXJ A;  2YIU C;  2KLU A;  3BRT B;  4C46 A;  2B88 A;  2WSC J;  3W68 A;  4WBA A;  1A02 J;  4K3A A;  2VRS A;  4DJG A;  1EDK A;  1BGY J;  4GIF A;  2Z5H A;  1X9V A;  1VDF A;  2Q3I A;  1KIL B;  2KSE A;  1W2B O;  1BE3 D;  2XND H;  5AVS B;  1T2K D;  2IBZ E;  1NTK D;  2WT7 A;  2WPS A;  4H0L C;  1LTA C;  2V7Q H;  3MUD C;  5E79 E;  1ZW0 A;  5KLI C;  3QH9 A;  3D6Y A;  5APW A;  3R2P A;  1KIL C;  2JEE A;  5TJH A;  1VQ8 P;  3SWY A;  3F89 A;  1E79 H;  1FOS E;  1M1J C;  4ZKP A;  3L71 J;  3ABV C;  3WUU A;  1NAY A;  4YPC A;  5AW2 B;  1N8R Q;  3CXH D;  1H88 A;  1SQB E;  1WMK A;  2OYO A;  2OYI A;  1EZV D;  2YKO A;  1M7L A;  3V2R A;  1M1K Q;  2Y0D A;  1NJI Q;  5AW9 B;  4RO0 A;  2WPR A;  4R4M A;  4GOE A;  2M5A B;  4DZO A;  3B4S A;  4RES B;  1SQV D;  1YQ4 C;  3BCC E;  3V4Q A;  3H1I J;  2BCC E;  2OTK E;  3KZI E;  5KJ7 D;  4U3F G;  4IOI H;  2ZT9 C;  2N1T A;  1URQ D;  2V7Q J;  1H8A A;  1TU3 F;  5APV A;  1RHZ B;  3QWO C;  4XA4 A;  1CZQ A;  2KP8 A;  5AW3 B;  5AVW B;  1IFN A;  2D2C B;  4UB6 E;  1KB9 E;  1GU5 A;  1W2E A;  1FDO A;  1N7S B;  4Z1M H;  3CCU P;  3RL0 g;  1KD1 Q;  4TT3 H;  5CJ4 A;  1X8Y A;  2WSS H;  2QJP C;  2D2C C;  5B66 E;  3CMA P;  3H1K J;  3B71 A;  3G3Z A;  1SQQ J;  3CI9 A;  5AW7 B;  2Y0C A;  1K73 Q;  3U1C A;  1J1D B;  3L35 A;  3KXD A;  4WY4 B;  1SQB K;  4W7Y A;  3MGN A;  2WMM A;  3GW6 A;  1SQV J;  2H8P D;  5KAI H;  2QJY B;  4ZNC A;  3RL0 D;  2YO3 A;  3AE7 C;  4DCK A;  2BAS A;  1SLQ A;  3L37 A;  2WPV B;  2R32 A;  1Q2N A;  1RQU A;  4OH8 B;  5CCH C;  3H1L G;  2A45 H;  3KQG A;  2BEZ F;  4MN4 C;  1R5S A;  3NFQ A;  1L0N G;  4PD4 H;  2C0X A;  1LP1 A;  1GL2 D;  3IF4 A;  1CW5 A;  1T6A A;  2XV5 A;  1SS1 A;  2OTJ P;  1U7J A;  1SFC D;  4I7Z C;  2N9Y B;  1S9K D;  1YQ3 C;  3G71 P;  2R3S A;  1VF5 D;  3KPE A;  2K1A A;  4JQ0 D;  1JM0 A;  1GMJ A;  2P2U A;  1FZA A;  3GHG A;  4U3F D;  1Y9B A;  3RK3 E;  1K05 A;  2IBZ G;  2DW3 A;  1K04 A;  4GKG A;  4OGQ B;  1HWT C;  1LTJ A;  1FS0 E;  3GG2 A;  2W90 A;  4BXL A;  2K9J A;  4W80 A;  4H13 D;  1OW6 A;  1EXI A;  3MP7 B;  3TGU D;  1WRG A;  3BRV B;  2KK7 A;  4EI2 A;  2B9B A;  2O01 J;  5KAF E;  2WTY A;  3E1R A;  1PIX A;  1QX8 A;  3SSU A;  4PV1 B;  2YNY A;  3M0D C;  5CCG D;  3LW5 H;  2KXP B;  1IFJ A;  1VQ4 P;  3WU2 H;  5APS A;  1WT6 A;  4NPF X;  3AEB C;  4YXW H;  4LLH A;  1L2P A;  1L0L E;  3MUD A;  1SQX G;  3GF3 A;  4PV1 C;  1KIL A;  3L73 E;  5AVT B;  2E5T A;  2FY8 A;  2KB7 P;  3BCC G;  1MFZ A;  4WWI A;  1SQP G;  2QSI A;  3B5N D;  3WUV A;  5B5E H;  3H1H E;  1VQ5 P;  1M1J A;  3L71 G;  1Q81 Q;  1PP9 E;  2E76 D;  1DD4 A;  1BCC D;  3P32 A;  2AEJ A;  2LKM A;  3L72 G;  4IFM A;  2FXO A;  1YTZ T;  4U3F J;  1OX3 A;  2KS1 B;  2O01 N;  2QIW A;  1KIL E;  1DEB A;  2E43 A;  3H1J G;  1NO4 A;  2K9Y A;  1ZR2 A;  3TF5 A;  1S5L E;  3TGU J;  3LW5 J;  3CCL P;  3GMA A;  1GDT A;  1DIP A;  1NTZ K;  1X79 B;  4K35 A;  3V2Q A;  3JSV C;  2Z5I A;  4I1L A;  2QG4 A;  3P8M C;  5AVY B;  1BE3 G;  1KV4 A;  1HGV A;  2JP3 A;  1T2K C;  1IZN B;  2QA4 P;  1FC2 C;  1BSN A;  2IBZ D;  1NTK G;  1PZQ A;  4JBZ A;  3CWB G;  3ITK A;  1LT9 B;  3A7O A;  5BVZ A;  1KYO H;  2O1K A;  3WUT A;  1YJW P;  1P84 H;  3HE5 A;  1LTS C;  4JYC A;  1NU1 E;  1JOC A;  2CPS A;  1JB0 J;  3MHV A;  1NYH A;  2K3R A;  2A06 E;  1LT9 C;  2WSC H;  5AW0 B;  1SQB D;  4L73 A;  2R5B A;  5DJU B;  3MTU E;  1EZV G;  3KHU A;  3IN6 A;  2Q6Q A;  3H1L J;  4AYC A;  1S1C X;  1URQ B;  1L0N J;  1SQV G;  1OVU A;  5TIS E;  2KSJ A;  3L75 E;  1HTL C;  3JC2 2;  1SP4 A;  1QEX A;  2C9L Y;  3AE9 C;  3BCC D;  3GHG B;  2E75 B;  2QM8 A;  5KJ7 C;  3CLQ A;  5CCH A;  2BCC D;  1J1E B;  4Y28 J;  1H0T A;  2C9N Y;  1PV3 A;  3VP8 A;  1ZRT E;  1OVR A;  2YKQ A;  2M0B A;  4WY4 A;  1URQ C;  1NTZ G;  3A0B H;  2I8D A;  2YIU B;  2K9J B;  2H88 C;  4H44 D;  1QL1 A;  3V2N A;  2K88 A;  4D6T E;  1KB9 D;  3F5H A;  2OYH C;  5KLV E;  3UIA A;  2XU6 A;  1JY3 P;  5CMZ A;  2QJK B;  1AFO A;  2YKP A;  1AQT A;  3IAO A;  1VQL P;  2HFE D;  5GTI E;  1PPJ E;  2KZJ A;  5CJ0 A;  1N7L A;  1JTH A;  1ZP0 C;  3OJA B;  2AXC A;  3B8E B;  4H0L B;  1PGJ A;  2KZI A;  5KLI B;  1IC2 A;  1HJB A;  2N1T D;  5L8R J;  2ZYG A;  1SQB J;  3RK2 D;  2OTL P;  2GUS A;  1NU1 K;  4C7R A;  3L73 G;  4GOD A;  2QJK C;  1YBK A;  1NTM K;  5AVR B;  2H89 C;  1M1J B;  1KZU B;  3CWB D;  1SQX J;  3AEF C;  2POH A;  1YYC A;  5APY A;  2ZXX A;  1GL2 B;  2YO2 A;  1L4A D;  3RL0 C;  2JJL A;  3KDP B;  3CX5 E;  3Q2Y A;  2W6J H;  2LXB A;  3S9O A;  3GF7 A;  3BCC J;  4N6J A;  2Y9Z A;  3V4W A;  1SQP J;  1SFC B;  1IK9 A;  3A0H E;  2BCC J;  1W5C E;  3EWK A;  1GD2 E;  1M57 D;  3SFE C;  1N2D C;  4UB8 H;  3L74 G;  1GL2 C;  5M1B A;  1R5L A;  3L72 J;  2JDI H;  5K5G B;  3M06 A;  3JCU H;  2N9B A;  1MKM A;  2Q1K A;  2ITA A;  1BGY E;  2IDB A;  1KOR A;  1SFC C;  3Q5R A;  2A45 I;  4WB4 A;  4WVZ A;  3CXH H;  1S3J A;  2ZT9 B;  3H6P A;  4JPZ B;  1VF5 C;  2GM4 A;  5AW8 B;  3H1J J;  1J2J B;  2W6B A;  1BDD A;  3A3Y B;  4H13 B;  3O6Q A;  2AXT E;  2P1J A;  5GTH E;  2B89 A;  5AW1 B;  1R8E A;  1VQ6 P;  4N78 E;  2K37 A;  3RK3 D;  5AVX B;  1NTZ D;  3RBZ A;  2HG5 D;  3FXE A;  1KQF B;  1BE3 J;  3HE5 B;  4H13 C;  1ZV8 A;  3TGU G;  1NU1 G;  1AVO A;  1JMM A;  2QJP B;  4N3Y B;  1NTK J;  3IFM A;  3CWB J;  1NTM G;  4OVN F;  2KS1 A;  2LXC B;  1IFD A;  5CCG C;  1YJN P;  1JY3 N;  2IPP A;  3B5N B;  3SFD C;  2H7H A;  2ZYA A;  1ZXG A;  4A7P A;  1AQ5 A;  4GT1 A;  1MV8 A;  3V6I A;  3L73 D;  3AE5 C;  1USD A;  1FAV A;  2O1J A;  3H1I E;  5AW6 B;  3B5N C;  1H0T B;  3AE1 C;  3EQ2 A;  3H1H D;  1FU1 A;  2E76 C;  5APU A;  3CCJ P;  1Y47 A;  1PP9 D;  4OWF A;  1LT9 A;  1BCC G;  2KLV A;  3AEG C;  2XZR A;  2O01 H;  1U7M A;  2NPS D;  4I7Z B;  2JWA A;  1HGZ A;  3FXD A;  1NTZ J;  1KIL D;  3ZDM A;  3TDK A;  2NRG A;  3CCR P;  3L74 D;  4HKZ H;  2Y9Y A;  3P7K A;  2WSE J;  4DT0 A;  1QVF O;  1IFM A;  4TLF A;  3TYY A;  1YJ9 P;  3L70 E;  1JTH B;  1S2E A;  1IK7 A;  1KTM A;  2FBW C;  1GU4 A;  3MZW B;  1M8O B;  5KJ7 A;  3VMX A;  1OWA A;  3H1K E;  3MIW A;  1NHL A;  1UIX A;  4L74 A;  1URQ A;  1ZR4 A;  1SQQ E;  2HPC B;  1T3U A;  2B87 A;  1RE4 C;  2FFD C;  3Q3D A;  2NZ2 A;  1N86 A;  4QMA A;  3EFF K;  1GW3 A;  4ZMD A;  1GTW A;  1OVV A;  2JKV A;  5EFW B;  3N4X A;  2O3J A;  3L73 J;  4JYB A;  2FYU E;  3HUS C;  2SPZ A;  1NU1 D;  2E74 D;  2I1J A;  3CCQ P;  1U57 A;  1NTM D;  3TNU B;  3G9R A;  1LTI C;  2PP6 A;  3OAK A;  1VQ7 P;  1DX7 A;  1KYO I;  2A06 D;  1SQB G;  3CX5 I;  4EIJ A;  1JY2 P;  3VYI A;  5AVZ B;  2OQQ A;  2IYO A;  1LGH B;  4XFJ A;  4IL6 H;  3Q5P A;  3WMM 0;  1AA0 A;  4HJG H;  3L74 J;  1UII A;  1S5L X;  1BSH A;  3O6Q B;  2W6A A;  5KKZ B;  1FDM A;  2MJZ A;  1OFC X;  3M91 A;  3BAT A;  2BCC G;  1Q82 Q;  1JUN A;  1N7S D;  1SVF A;  5KAI E;  1GL2 A;  1HUC A;  5KKZ C;  4PJ0 H;  4H44 C;  2P7J A;  3HRN A;  4RKU J;  3AE8 C;  1SFC A;  4C7N B;  3HD7 D;  3USS A;  2ZYD A;  1VL2 A;  1SQQ K;  3RK2 B;  3E7K A;  1FJP A;  3T97 B;  3VMY A;  4PD4 E;  3LIE A;  2Q7C A;  1NU1 J;  1PPJ D;  1JCD A;  1YI2 P;  2IZ1 A;  4WY4 D;  1NTM J;  2N1T C;  2YMY A;  3RBX A;  1PGP A;  4IL6 X;  1EDJ A;  2YXQ B;  3BAS A;  3RK2 C;  1LT1 A;  2FYU K;  1FZC B;  2E5Y A;  1Q7Y Q;  1XTG B;  1A02 F;  1VQ9 P;  2IYP A;  1RE3 C;  2W8Z A;  1L4A C;  4W7Z A;  3PLN A;  5CCG A;  1FZC C;  2HYN A;  2L91 A;  4KJM A;  5BU8 B;  2XNX A;  3CX5 D;  2PFX A;  3PJS K;  3VOP A;  1NWQ A;  1JY3 O;  2G8Y A;  1Y8A A;  1LNQ A;  5E79 H;  1L0L K;  2FXM A;  1YTZ I;  3W67 A;  1FZE A;  3CME P;  1FBM A;  3OA7 A;  2G3A A;  2OGU A;  1BCC J;  2W27 A;  2WZ7 A;  4KHX A;  5DJT B;  1T8Z A;  1IFI A;  4KT0 J;  1Q90 D;  4LGD E;  1RH5 B;  1JY2 N;  3L70 G;  3WU2 E;  1BGY D;  3B5N A;  3RK3 B;  4EDF A;  2OAR A;  3H32 B;  4OGQ D;  2WWW A;  2B87 B;  4EYY Q;  1VQO P;  1G1I A;  3CXH I;  3RK3 C;  5B5E E;  2OYH B;  5C39 A;  2CK3 H;  3H25 A;  1EZV I;  1MFT A;  2HLO A;  3PH0 A;  2KNC A;  2I1K A;  3N7N A;  3PRJ A;  1YHQ P;  1G2C A;  2XKM A;  1IFP A;  1XTC C;  3KZI H;  1RF0 C;  2QM7 A;  3AEA C;  1PGQ A;  1EC5 A;  4O9B A;  2BEQ D;  3M0A A;  3V5B A;  3AED C;  2PAJ A;  2R44 A;  2H43 A;  1LTG C;  3H1L E;  2J59 M;  2WPQ A;  1RE4 A;  2ZFC A;  1KB9 H;  2FFD A;  1RF1 C;  1Z56 A;  3M9Q A;  3D71 A;  1L0N E;  4RJT A;  1L0L G;  2FYN C;  3RL0 B;  3IR9 A;  4IFF A;  3KYQ A;  1PGO A;  2HPC A;  3AE2 C;  3FX0 A;  4LC1 A;  2ZVN B;  2ZAE B;  3VP9 A;  3H1I D;  1IO4 A;  3K5B A;  1QGK B;  3HUS A;  2NPS B;  3M9B A;  5B66 H;  1HH0 A;  3AE6 C;  3P8C E;  3H1H G;  1PL5 A;  1LWU B;  2XDJ A;  4YTP C;  1PP9 G;  1GZL A;  2IFN A;  3NTN A;  1KYO E;  3M0D A;  3CPW O;  3D6Z A;  1P84 E;  1LJ2 A;  1HVV A;  2AEF A;  2NPS C;  4ASW A;  2HR3 A;  1VF5 B;  3TNU A;  2A45 G;  1ZME C;  4L76 A;  4IFD K;  1LWU C;  1AV1 A;  3CCM P;  5AW5 B;  1YIT P;  1NKN A;  3NMD A;  3L70 D;  1OW7 A;  2KI7 B;  2LR2 A;  4U7J A;  3GLM A;  2KIK A;  2RH0 A;  3H1K D;  1FDI A;  4PD4 I;  2FXP A;  1SQQ D;  1LTB C;  1KC8 Q;  1VQN P;  2E74 B;  5BU5 A;  4B86 A;  2PRR A;  2Q9I A;  5KLV K;  1SQX E;  1AJY A;  3VTP C;  2P58 A;  1OW8 A;  3O8Z A;  4BRY B;  3HTK B;  3A0B E;  1ZN5 A;  1NKZ B;  1CI6 B;  2R5D A;  2WQY C;  1SQP E;  3VN0 A;  2FYU D;  2E74 C;  1L0N K;  3L71 E;  4I6M C;  2WIT A;  3OW2 O;  1EDL A;  3S4R A;  1HBW A;  2QVA A;  3D70 A;  4C7N A;  2WSE H;  1KMI Z;  1EDI A;  3L72 E;  2A06 G;  3T97 A;  2QE7 H;  2E75 D;  5KAF H;  2AEM A;  2FKW B;  5APT A;  2KUB A;  1NVO A;  5APX A;  1KQL A;  3H1J E;  2E76 B;  1RE3 A;  4BWN A;  1L0L D;  1QL2 A;  3FGA D;  5AVV B;  1L4A A;  2HOD B;  3Q1M A;  3L75 G;  1FZC A;  1ZLL A;  4R4L A;  1S4X A;  3L70 J;  1DD3 A;  1N73 B;  3HE4 B;  3HD7 B;  3LID A;  1N7S C;  2KNC B;  1EQ7 A;  1BE3 E;  3R4Y A;  1G2C B;  1K9M Q;  1KQG B;  2WSF H;  3E1I A;  1NTK E;  1JY2 O;  3CWB E;  1VQM P;  1N73 C;  1PFI A;  3HD7 C;  4H0L D;  2Y0E A;  2YXR B;  3VMZ A;  4D6T G;  1HF9 A;  5KLV G;  2FYZ A;  1BDC A;  1CSB A;  5CHX A;  1YIJ P;  4UB8 E;  2W83 C;  2KOG A;  4PD4 D;  2JR8 A;  2FYU J;  2RKL A;  1JMB A;  2FFD B;  3JCU E;  5APQ A;  1SQX K;  2M3B A;  4Y99 B;  1FZB A;  1PPJ G;  1J1D C;  3L36 A;  1FJK A;  4WY4 C;  3CXH E;  1OXZ A;  2QJY C;  3G6E P;  1VQP P;  1EZV E;  1SQP K;  1S5L H;  3H32 A;  3HUS B;  1KFM A;  1RF0 A;  4Y99 C; 
#chains in the Genus database with same CATH homology
 4WY4 D;  2N1T C;  2YMY A;  2OYH C;  2N1T A;  1URQ D;  3BAS A;  2OYH A;  3RK2 C;  3UIA A;  3II6 A;  2XU6 A;  1JY3 P;  2FYU K;  1H8A A;  5AVU B;  5CMZ A;  1FZC B;  5APV A;  1AFO A;  2YKP A;  1JCC A;  1XTG B;  2HFE D;  4XA4 A;  1CZQ A;  2KP8 A;  5AW3 B;  5CJ0 A;  1N7L A;  1JTH A;  1A02 F;  2WT7 B;  5AVW B;  1IFN A;  3OJA B;  3B8E B;  1GU5 A;  1W2E A;  1MUU A;  1RF1 A;  1IC2 A;  1N7S B;  1HJB A;  2N1T D;  1RE3 C;  4DOJ A;  1L4A C;  3RK2 D;  2GUS A;  4W7Z A;  5CCG A;  1NU1 K;  1FZF A;  2CPB A;  4C7R A;  1FZC C;  4HH2 A;  2HYN A;  5BU8 B;  2XNX A;  4I2L C;  3VOP A;  5CJ4 A;  1NWQ A;  1NTM K;  1X8Y A;  1JY3 O;  5AVR B;  1L0L K;  1M1J B;  1KZU B;  2FXM A;  1YTZ I;  1FZE A;  2OYI B;  1FBM A;  3OA7 A;  2POH A;  1YYC A;  5APY A;  1GL2 B;  2YO2 A;  1L4A D;  3A5T A;  3RL0 C;  2JJL A;  3KDP B;  2W27 A;  2WZ7 A;  4KHX A;  3G3Z A;  4EOT A;  1T8Z A;  1IFI A;  3EFG A;  1NTK K;  4LGD E;  3CI9 A;  5AW7 B;  1JO5 A;  4N6J A;  1JY2 N;  3V4W A;  1SFC B;  1IK9 A;  3CL3 D;  3B5N A;  1J1D B;  3RK3 B;  3TSI A;  3U1C A;  3I5C A;  3L35 A;  1NAF A;  3V2P A;  2NPS A;  4WY4 B;  1SQB K;  1GW4 A;  4W7Y A;  3MGN A;  1GD2 E;  2OAR A;  3MD0 A;  2H8P D;  3A2A A;  2R3C A;  2OYI C;  3H32 B;  1N2D C;  1GL2 C;  3RL0 D;  2YO3 A;  2WWW A;  3NXS A;  1LWU A;  3M06 A;  1G1J A;  1NH4 A;  2BAS A;  2N9B A;  1SLQ A;  3L37 A;  2E42 A;  4XE5 B;  1G1I A;  2R32 A;  4OH8 B;  5CCH C;  1SFC C;  2A45 I;  4WB4 A;  3RK3 C;  2A45 H;  2N1T B;  3H6P A;  3KQG A;  2OYH B;  5AVQ B;  2GM4 A;  3NFQ A;  2HLO A;  5AW8 B;  1J2J B;  2C0X A;  2W6B A;  1GL2 D;  2I1K A;  3A3Y B;  1CW5 A;  3N7N A;  2XV5 A;  2Z4E A;  3U1A A;  4ZKU A;  1G2C A;  2P1J A;  2XKM A;  1XTC C;  1RF0 C;  5AW1 B;  2QM7 A;  5CCH D;  1SFC D;  4N78 E;  1SQV K;  1GK6 A;  3RK3 D;  5AVX B;  1S9K D;  2J58 A;  4O9B A;  1KFN A;  1L4A B;  1MZ9 A;  3M0A A;  2HG5 D;  2GUV A;  3V5B A;  3KPE A;  3HE5 B;  2PAJ A;  2M8R A;  4JF7 A;  3TK1 A;  2IFM A;  2P2U A;  2H43 A;  1LTG C;  1ZV8 A;  2J59 M;  1IJD B;  2WPQ A;  1RE4 A;  2ZFC A;  2FFD A;  1DH3 A;  1FZA A;  3GHG A;  1JMM A;  4N3Y B;  1RF1 C;  4M3L A;  1Z56 A;  3IFM A;  3M9Q A;  3M9H A;  1S9K E;  1FOS F;  3P8C D;  4GKG A;  1IFD A;  1HWT C;  5CCG C;  1LTJ A;  3RL0 B;  3IR9 A;  4IFF A;  1RY3 A;  3KYQ A;  3HTK A;  2L5G B;  4W80 A;  1H89 A;  2HPC A;  1JY3 N;  2IPP A;  4LC1 A;  1CI6 A;  1WRG A;  3B5N B;  3BRV B;  3VP9 A;  1IO4 A;  3HUS A;  2NPS B;  2H7H A;  3M9B A;  2IX7 C;  1HH0 A;  2WTY A;  3P8C E;  1AQ5 A;  4GT1 A;  1LWU B;  2XDJ A;  1MV8 A;  2YNY A;  3L4F A;  3M0D C;  5CCG D;  3LW5 H;  1GZL A;  2IFN A;  3NTN A;  2O1J A;  1FAV A;  3M0D A;  5AW4 B;  1IFJ A;  5KTB A;  5APS A;  5AW6 B;  3B5N C;  1WT6 A;  1HVV A;  2NPS C;  2P67 A;  4LLH A;  1T3J A;  3EQ2 A;  3MUD A;  1FU1 A;  1N7S A;  5APU A;  3TNU A;  2A45 G;  1KIL A;  1LT9 A;  4IFD K;  1LWU C;  2KLV A;  5AVT B;  1VPC A;  5AW5 B;  2HOD A;  2XZR A;  2KB7 P;  1NKN A;  2O01 H;  3NMD A;  1MFZ A;  3B5N D;  1LTT C;  2NPS D;  1HGZ A;  4N78 D;  1M1J A;  3SWF A;  1N73 A;  3HE4 A;  3HD7 A;  1KIL D;  1GK4 A;  2ZXE B;  3P32 A;  2LKM A;  3P7K A;  1IFM A;  4AUW A;  1LTB C;  3TYY A;  4IFM A;  4AQR D;  5BU5 A;  1JTH B;  1YTZ T;  4B86 A;  1RF1 B;  1GU4 A;  3U59 A;  2Q9I A;  5KJ7 A;  3BVH A;  5KLV K;  3VMX A;  3VTP C;  1OWA A;  1LTJ B;  3MIW A;  3O8Z A;  1DEB A;  1NHL A;  2E43 A;  1URQ A;  1ZR4 A;  3HTK B;  1NO4 A;  1ZN5 A;  2HPC B;  1T3U A;  1ZR2 A;  1NKZ B;  1CI6 B;  2R5D A;  1FZG A;  3PP5 A;  1RE4 C;  2C0W A;  3VN0 A;  4HYT B;  2FFD C;  3GHG C;  3C9I A;  1GDT A;  1E5W A;  1N86 A;  1L0N K;  1NTZ K;  1J1E C;  4I6M C;  2WIT A;  1GW3 A;  2Q5U A;  1X79 B;  3V2Q A;  2Z5I A;  1GTW A;  1HBW A;  1JNM A;  1LTJ C;  4I1L A;  4C7N A;  2WSE H;  1NOH A;  2KYV A;  3P8M C;  5AVY B;  3BRT B;  4C46 A;  3N4X A;  4JYB A;  1HGV A;  3T97 A;  4WBA A;  1A02 J;  2VRS A;  3HUS C;  1T2K C;  2I1J A;  2FKW B;  5APT A;  4GIF A;  2Z5H A;  1X9V A;  5APX A;  3TNU B;  1KQL A;  1VDF A;  2Q3I A;  1KIL B;  1LT9 B;  1LTI C;  1RE3 A;  3A7O A;  2PP6 A;  1QL2 A;  3OAK A;  1DX7 A;  5BVZ A;  5AVV B;  1L4A A;  4EIJ A;  1JY2 P;  2HOD B;  2O1K A;  3VYI A;  3HE5 A;  1LTS C;  4JYC A;  1FZC A;  1JOC A;  2CPS A;  1ZLL A;  5AVS B;  5AVZ B;  1T2K D;  1N73 B;  3HE4 B;  1LGH B;  2WT7 A;  3HD7 B;  2WPS A;  1LTA C;  3LID A;  1N7S C;  5APW A;  3R2P A;  3WMM 0;  1KIL C;  1LT9 C;  1EQ7 A;  2WSC H;  5AW0 B;  2R5B A;  2JEE A;  2W6A A;  3MTU E;  1FDM A;  1G2C B;  2MJZ A;  3SWY A;  3E1I A;  2WSF H;  1JY2 O;  4AYC A;  1FOS E;  1M1J C;  1N73 C;  4ZKP A;  3M91 A;  3BAT A;  1PFI A;  3HD7 C;  1JUN A;  1N7S D;  5AW2 B;  1URQ B;  3VMZ A;  1H88 A;  1SVF A;  2FYZ A;  2OYI A;  2KSJ A;  1CSB A;  1HTL C;  5CHX A;  1GL2 A;  1SP4 A;  2YKO A;  1M7L A;  1HUC A;  3V2R A;  2KOG A;  2C9L Y;  5AW9 B;  2FFD B;  3GHG B;  5APQ A;  1SQX K;  2WPR A;  2QM8 A;  2M3B A;  4Y99 B;  2P7J A;  1FZB A;  3CLQ A;  3HRN A;  5KJ7 C;  1J1D C;  5CCH A;  3L36 A;  1J1E B;  1SFC A;  1FJK A;  4DZO A;  4WY4 C;  2C9N Y;  3VP8 A;  3HD7 D;  4C7N B;  2YKQ A;  4RES B;  4WY4 A;  1SQQ K;  1URQ C;  3RK2 B;  1OXZ A;  1FJP A;  3VMY A;  1SQP K;  3H32 A;  3LIE A;  3HUS B;  2Q7C A;  1KFM A;  3V4Q A;  1JCD A;  1QL1 A;  1RF0 A;  5KJ7 D;  4Y99 C;  3V2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...