1IFMA

Two forms of pf1 inovirus: x-ray diffraction studies on a structural phase transition and a calculated libration normal mode of the asymmetric unit
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Forms of Pf1 Inovirus: X-Ray Diffraction Studies on a Structural Phase Transition and a Calculated Libration Normal Mode of the Asymmetric Unit
pubmed rcsb
source organism Pseudomonas phage pf1
molecule tags Virus
molecule keywords INOVIRUS
total genus 21
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 1994-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ifmA00
2IFNA 1IFNA 1QL2A 4IFMA 1ZN5A 2KLVA 1IFMA 2IFMA 2KSJA 1QL1A 2XKMA 1PFIA 3IFMA
chains in the Genus database with same CATH superfamily
2A45I 4L75A 5APYA 1RF1B 1GU5A 3AECC 4RJTA 1K8AQ 3CCJP 2P58A 4PV1C 1OZHA 2WPQA 1JEKA 2Y0DA 2E74C 2HODB 2KNCB 2Y0EA 1QGKB 3M9HA 3PP5A 4H0LD 1FDOA 5B5EE 3B5ND 3SWYA 1NTKG 1BGYG 2IBZI 3L71J 4UB8E 2E76D 1LJ2A 2FYUE 3I56P 1NO4A 1NTKK 3II6A 1KB9H 4GKGA 4DOJA 2K9JA 4N78E 1QL2A 4C7NB 1E79H 1KQFB 1SQVD 2QRXA 1AQTA 1BCCD 1IFJA 2AXTH 1OW7A 1S5LX 3AE2C 1SQQG 3B8EB 5KAFH 1FS0E 2FFDB 1S2EA 2BCCG 1BGYD 1NTZJ 5CJ4A 1FZAA 5TJHA 2KYVA 2FXOA 2KIKA 1Q90D 4DT0A 1JCDA 1QEXA 1SQBK 1HJBA 1XTCC 4IFDK 5BVZA 3FXEA 2IYOA 2FXMA 1X8YA 3M9BA 3P8MC 4JPZB 3TGUG 2JEEA 1SQBD 2XZRA 3A0HE 1LTIC 3L72E 2YIUC 3EFGA 1VPCA 1KILC 2KOGA 1GL2B 2W6AA 1NU1D 3H1IG 4GDOA 4IOIH 4KHXA 1S72P 1SQPD 1KTMA 1VDFA 2HR3A 1M1JB 2KSJA 3BCCD 5B66H 1D7MA 1YITP 4W7ZA 1DH3A 3CCUP 4JF7A 2JWDA 3CC7P 1KILE 1BCCJ 2IFNA 2VRSA 3AE9C 3KDPB 1FC2C 1EXIA 2O1KA 1NTMD 1CI6B 2IDBA 2JO1A 2XDJA 1JTHB 2YMKA 1LGHB 3CX5D 3MUDA 4WY4C 2O3JA 5K5GB 2WT7A 1LWUB 2AXCA 2LXCB 2QSIA 1J1EC 2E75C 4H0LB 4H44D 1L0LK 1J1DC 2JP3A 4NPFX 1SQPG 4OH8B 4U3FE 1SVFA 3N4XA 5APXA 1PGOA 4UB8H 3VN0A 1FDIA 1FZGA 3RK3B 2J5UA 1PP9D 2Q5UA 3H1LE 4R4MA 5APSA 1HVVA 1AJYA 3RBZA 4HKZH 1RE4A 3AEBC 3HE4A 5KTBA 1IFPA 3HTKB 2KSEA 1YHQP 1YJ9P 3AE8C 1URQC 1M1JA 1NU1J 1NAYA 2KB7P 2R3SA 4WY4A 1NJIQ 3CCEP 5CJ0A 1H8AA 1LNQA 1EZVI 3L74D 5CCGA 3L4FA 2I1KA 2OYOA 2KLVA 1BDCA 2IBZE 1LT9A 2IPPA 3L71E 3AEGC 1P84H 1DEEG 4GIFA 2OYIC 1HH0A 1PP9G 3H1KJ 2WT7B 3CCRP 4U3FJ 1LWUA 1OXZA 1SQVG 1M57D 1NTMJ 1L0NJ 1SFCC 1SQQE 2PAJA 1VQ5P 2E76B 2FYUD 1KILB 3GHGA 4Z1MH 1GL2C 4EOTA 3C1LA 3L75G 1KYOD 5DJTB 1NHLA 2A06D 3BCCE 3KZIE 4ZKUA 1KD1Q 1SQPJ 2KS1B 2Q7CA 5CBOA 3I55P 4IL6E 1NU1E 2ZT9C 3MIWA 1EZVE 2QJPB 1DD3A 2GUVA 3AE6C 4EIJA 3Q3DA 5AVXB 1KYOH 2C0WA 2BASA 2ZJSE 1IJDB 1MFZA 1SQBG 3AEDC 4I7ZC 4XFJA 4PJ0H 1PGJA 4H13C 3A2AA 5AVVB 2HPCB 1S1CX 2W83C 2YKQA 1DX7A 2Z5IA 3RK3E 1ZP0C 2Q3EA 1H0TA 5CCGD 1PL5A 3JSVC 2QA4P 2RKLA 3FX0A 1GL2D 3CXHI 4U3FD 2G8YA 1VQOP 3QH9A 5CCHD 1PP9J 2A45H 2HPCA 1JM0A 1AA0A 1KB9E 2N9BA 3H32A 3M0AA 5AW0B 1ZR2A 3RL0g 4D6TG 1VQPP 1CW5A 1K05A 1MV8A 3A3YB 4DZOA 1K04A 2QM7A 5AW9B 1LTTC 4DCKA 1EZVD 3VMYA 3G6EP 5KJ7A 1JY2P 2FY8A 3P8CD 1IC2A 1PZQA 3L70D 2ZYGA 3HD7A 4PD4D 2Q1KA 4TT3H 2BEQD 2HODA 1SQXJ 2KNCA 3CXHE 4DJGA 2H7HA 3C8VA 3MP7B 3H1KD 1KYOE 4BRYA 4OGQC 2KK7A 5AVQB 1RF0A 1KQGB 1L0ND 1ZR4A 1BCCG 2W8ZA 1HGVA 1JMBA 2WZ7A 3ITKA 1NTKE 2AEFA 2CPSA 2IBZG 3NXSA 2FYUK 5M1BA 2N9YB 2ZVNB 3CPWO 1RE4C 1T8ZA 3L74J 5TISH 1Y47A 1OFCX 1RH5B 1SQXG 2K88A 3E1RA 5KKZB 4Y99C 1SFCA 3WUUA 2FYUG 4EYYQ 3B5NC 1GK6A 1LP1A 3H1IE 2E5YA 1U7JA 2JWAA 2QIWA 1LT9C 4WBAA 4EI2A 1VF5C 1PPJD 4PJ0E 3I5CA 5B66E 3Q5PA 2FYZA 1W2BO 2A45G 1GU4A 2C9NY 4AYCA 3G9RA 4YPCA 2N1TC 3L74G 1S9KD 1LTJB 1SQXD 2LKMA 1NTZG 2O01H 5APQA 2WTYA 1YJNP 1AQ5A 1GL2A 2WSEH 2C9LY 3KQGA 1ZXGA 2P7JA 3TDKA 3B71A 3GMAA 3BASA 3L37A 4YXDC 1NTMG 1SQVJ 1URQD 2H89C 2O01N 2RN0A 1PFIA 1HJ0A 2W27A 1KV4A 4BWNA 2WPRA 4OVNF 1BSNA 1SQQK 1NYHA 1FAVA 3U1AA 3CWBD 3VYIA 2P67A 1BDDA 1HUCA 3AE7C 2L91A 1Q7YQ 5KLVG 2AXTE 3H1ID 5KJ7C 2W6BA 3L71G 1H0TB 4IFMA 2ZXEB 1BE3D 3O6QA 1Q82Q 3ZDMA 2O01J 1OIPA 2ZAEB 1FZFA 2RH0A 1NTZK 1Q81Q 1DD4A 4OGQD 1M1KQ 2B88A 1RE3A 3F89A 3D6YA 5H2FH 3RL0C 1VQLP 1NKNA 2IBZD 3S9OA 3QWOC 1L0LJ 2IZ1A 3A0BH 5APVA 4UB6H 3HUSA 5AW6B 4BRYB 4D6TE 3Q2YA 1EDLA 1SQVK 2H43A 2R5BA 2B87B 1SFCD 1JY2O 2OQQA 3A7OA 4PV1D 4JYCA 1PV3A 1FJPA 1NTKD 1ZLLA 2O1JA 2ZYAA 2OGUA 1JY3O 2Y0CA 5C39A 3G4SP 1BSHA 1JB0J 1JOCA 4W7YA 2JKVA 4CPGA 3PJSK 3L75J 2WPSA 2Z5HA 1PP9E 2OARA 1M1JC 4KJMA 4XE5B 3U59A 3H1IJ 3MD0A 3D6ZA 1SQQD 1BE3E 1L0NG 4TLFA 4ASWA 2QVAA 3M06A 3RK3C 2M8RA 1USEA 2E75D 1T6AA 2FYNB 5KJ7D 3FXDA 2YMYA 4QMAA 3D70A 2NPSA 2QJKC 3L70G 3ABVC 3CC2P 1GW4A 2R5DA 4HH2A 1QX8A 2J58A 5AW5B 1RY3A 5GTHH 3CL3D 3IN6A 1K9MQ 2OYIB 2V7QJ 1G1JA 1GD2E 3HE4B 2ZT9D 2PRRA 1SLQA 2FYUJ 2FFDA 1OVUA 1SQPE 2XU6A 3MUDC 4O9BA 5L8RJ 3A0BE 5E79H 3OJAB 1USDA 3RL0D 3CCMP 1NTKJ 2G3AA 1CZQA 3GLMA 1FZCB 1URQB 4GODA 4HJGH 1BE3J 2QE7H 5DJUB 3V2PA 1KC8Q 1ZRTD 3SWFA 4OWFA 1FZEA 1OMIA 2PFXA 1KQLA 5KLVE 5TISE 3H1JE 2YKPA 2YNYA 3CX5E 1LTAC 1YI2P 1JUNA 3HD7B 2QJYB 1KILA 3HE5B 3KYQA 3P7KA 1X79B 1MUUA 3TNUB 1N2DC 3CI9A 3LW5J 3FGAD 1L0LD 2QM8A 4PD4H 2GUSA 1SFCB 2Q6QA 3VMZA 4H13B 1JO5A 4M3LA 1S5LH 2SPZA 2Y9YA 4I7ZB 5AVWB 1YQ3C 2Y9ZA 1HWTC 1SP4A 3A5TA 1EC5A 3V2RA 1YTZI 1ZV8A 2GA1A 3L75D 3V6IA 2WITA 3H1KE 1JTHA 2QJPC 2WVRA 1CI6A 1SQQJ 3AE5C 3L36A 3M0DC 4MN4C 5AVTB 3T97B 4B86A 1SQXE 2FYNC 4K3AA 4LC1A 1IFIA 4H44B 2OYHB 1RQVA 1T2KC 1U57A 3HUSB 4EDFA 2BEZF 4PV1B 1LT1A 2XNDH 4C7NA 1RQUA 3GW6A 2K9JB 2MJZA 2NRGA 3IF4A 4RKUJ 3TGUJ 5GTIE 1Y9BA 3H1JD 3Q5RA 3FWLA 2OYHA 1H89A 1QVFO 4WY4D 2WQYC 1IFDA 1OW6A 1QLED 3EWKA 3L74E 3AEAC 3KPEA 1FJKA 4KT0J 2FKWB 1IK9A 1G2CB 2JDIH 3B4SA 3CXHH 3PH0A 3TSIA 3H25A 2XV5A 5AVSB 2N1TA 5AW7B 1Q2NA 1IK7A 3L73D 3CCSP 4ZMDA 4GOEA 3RBXA 3V4WA 3P8CE 3PRJA 3CCQP 1VQ8P 4WWIA 4LGDE 3HD7D 1ZRTE 1L0LE 4I2LC 1L4AB 4AUWA 1KILD 1WRGA 3RK2C 2IZ0A 3RK2D 1HGZA 3CWBE 4H13D 2WSSH 3OW2O 4I1LA 3F5HA 3VTPC 4ZKPA 1N7SA 2B9BA 1LWUC 2M3EA 1SS1A 4IFFA 3TYYA 5AW8B 2OYHC 3HE5A 1YTZT 1ZOYC 4N3YB 3LW5H 1IZNB 3L72D 3OA7A 3SSUA 3TGUD 3H1JJ 1UIIA 3BRTB 1PIXA 3GHGB 4XA4A 1LP1B 3OAKA 1S4XA 2KLUA 2MKVA 2WSCJ 3C9IA 5EFWB 3USSA 5KKZC 1VQMP 1A02F 4PD4I 2P1JA 3L73E 1HTLC 3B5NB 3JCUE 4H44C 5AVUB 1HF9A 1NOHA 4IL6X 3HD7C 2PGDA 2YXQB 3CLQA 3R2PA 5KAIH 1FOSF 1X22A 3CWBJ 3H1KG 3H32B 1J1DB 4GOFA 2H88C 3P32A 3GG2A 1J2JB 1KFNA 4N78D 4WY4B 5AVZB 1L0NK 1NTMK 4HB1A 5KAFE 1A02J 2A06G 4L73A 1BGYE 4Y28J 5BU5A 5KLVK 2R44A 4U7JA 1X9VA 5E79E 1JMMA 2JJLA 4C7RA 3H1HE 1IO4A 2ZYDA 1IFMA 4RESB 2QEXP 5KLIC 3L72J 4WVZA 1LTSC 2K9YA 3B5NA 1SQPK 2ZFCA 3L73J 1NTME 3N7NA 3GF7A 1L0NE 4A7PA 1NU1K 4ZNCA 4NPEA 2WPVB 2YO3A 1NH4A 2AEJA 2YO2A 1GTWA 3AEFC 3CCVP 3JCUH 1UIXA 2OTJP 1RF0C 1LTGC 1NKZB 2M5AB 1VL2A 2OTKE 5APWA 1WMKA 1Q86Q 3SWKA 2E74B 3MZWB 3VMXA 1IFNA 3CC4P 4UB6E 3CX5I 3EFFK 1M8OB 2HFED 5AW4B 2H8PD 1KB9D 1FDMA 3AE1C 2KZJA 2XKMA 1RF1C 5H2FE 1W2EA 3WU2H 3HRNA 1BE3G 2IX7C 3O6QB 2POHA 3RK2B 2E42A 3GF3A 2K1AA 2QG4A 2L5GB 1OVVA 5CCHC 1R5SA 3Q1MA 2K37A 5KLVD 2LR2A 1L4AA 2I8DA 3S1KA 1R5LA 1NVOA 3TGUE 1GW3A 2UWJE 3GHGC 3EQ2A 1PPJE 4OGQB 2IYPA 1EDIA 3MHVA 3TF5A 1VQKP 1P84E 1AVOA 1Z56A 3PTZA 2B89A 2FBWC 3T97A 1S9KE 1RE3C 3M9QA 3VP9A 3E7KA 1M7LA 1KYOI 3H1JG 3G71P 1KORA 2KP8A 1E5WA 1OX3A 2QJYC 4IL6H 3L70E 1N7LA 3FWNA 3CMEP 2WSFH 4N6JA 1GDTA 1VQ9P 1FU1A 2KS1A 3UIAA 1FZBA 3AE4C 1ZW0A 3RGUA 3V5BA 3MTUE 3WUVA 3VMAA 1EQ7A 2R32A 4H0LC 1NGMB 2OYIA 1J1EB 2E75B 3CD6P 2I1JA 1AFOA 1KB9I 5KLIB 1EDKA 2N1TB 1LTJC 1VQ6P 4LLHA 1S5LE 1G2CA 1FE6A 1NU1G 3H1LD 3WU2E 3VOPA 4AQRD 3V4QA 1N8RQ 1AVYA 3BATA 3NTNA 1K73Q 1U7MA 3CXHD 5AVYB 1M56D 4Y99B 1NWQA 2OTLP 3W68A 2KXPB 1DIPA 3IFMA 3G3ZA 2WMMA 3SFDC 3CMAP 1OWAA 5AVRB 2NZ2A 3V2NA 2DW3A 1KQSO 3HUSC 3HTKA 4NPDA 3R4YA 1KN7A 3O8ZA 5KLVJ 2C0XA 3AEEC 3E1IA 1R8EA 2E74D 3K5BA 3IR9A 2ITAA 1GZLA 2HLOA 1N73B 1RHZB 2BCCD 3KHUA 1VQ7P 1P84D 2XNXA 3BRVB 2WSFJ 3PHLA 2KZIA 1JCCA 4WB4A 1OW8A 2E76C 1YBKA 2YXRB 4C46A 3D71A 1X0TA 2AEMA 5CBNA 4JBZA 3WMM0 2KI7B 1RF1A 2W90A 2ZVOB 1T3UA 1KFMA 1N7SC 1N86A 5AW3B 2NPSC 1N7SD 2GM4A 2ZT9B 2NPSD 4JYBA 5GTIH 2J59M 3TNUA 1VF5D 3SFEC 4ASVA 1QVGO 3A0HH 2E5TA 3H1HD 1VQNP 3H1LG 1KMIZ 3CWBG 3RL0B 1G1IA 1L4AC 3CCLP 1JY3P 2W6JH 4W80A 3KZIH 1WT6A 1W5CE 1PGPA 3CX5H 3TK1A 2D2CB 2JR8A 4JQ0D 2N1TD 2ZXXA 4K35A 2A06E 2WSCH 2V4HA 3KXDA 5BU8B 2M0BA 3VP8A 2BCCJ 2M3BA 3M0DA 2M5AA 1JNMA 2CK3H 4GT1A 3H1HG 5AW1B 3NMDA 4HYTB 1OVRA 1EZVG 1TU3F 1VQ4P 1ZN5A 1KZUB 1MFTA 3L73G 1SQVE 1QL1A 3M91A 1MZ9A 2Q3IA 2Q9IA 3L72G 2HYNA 4YTPC 3L75E 2WWWA 2RMZA 1YJWP 5AW2B 5CHXA 4D6TD 1AV1A 2Z4EA 5KAIE 2LXBA 3H6PA 2PP6A 3LIDA 3NFQA 1FOSE 3H1HJ 4PD4E 1CSBA 1NTZE 3BVHA 5B5EH 1YQ4C 1YYCA 3AE3C 3H1LJ 3L71D 2YKOA 2BCCE 1GMJA 3JC22 2FXPA 1PGQA 1L4AD 3MGNA 5CMZA 4YXWH 1SQBJ 2P10A 1N73A 1XTGB 1M90Q 5CCGC 1S3JA 2K3RA 3LIEA 1MKMA 1T2KD 1ZMEC 3S4RA 1L0LG 3U1CA 2FFDC 4L76A 1JY3N 2QJKB 1N73C 4L74A 1FZCA 4R4LA 1URQA 3L70J 3L35A 1JY2N 2IFMA 2KUBA 3BCCG 1YIJP 1H88A 2D2CC 3IAOA 1P84I 2D2CD 4RO0A 3WUTA 5GTHE 4D6TJ 1HBWA 1BCCE 5APUA 2V7QH 4BXLA 1FBMA 4I6MC 1DEBA 1SQXK 2YIUB 3Q5SA 2CPBA 2HG5D 1PPJG 5APTA 1T3JA 2E43A 3RK3D 1SQBE 1NAFA 2R3CA 1FZCC 1L2PA 1EXJA 2WSEJ 1GK4A 3PLNA 5CCHA 2P2UA 1EDJA 1LTJA 1N7SB 1LTBC 2B87A 1BGYJ 1NTZD 2NPSB 1LT9B 3BCCJ 1Y8AA 1VF5B 4U3FG 3V2QA 3W67A
chains in the Genus database with same CATH topology
2A45I 5APYA 1RF1B 1GU5A 2WPQA 2HODB 3PP5A 3M9HA 3B5ND 3SWYA 1NO4A 1NTKK 3II6A 4GKGA 4N78E 1QL2A 4C7NB 1IFJA 2FFDB 3B8EB 5CJ4A 1FZAA 2KYVA 1JCDA 1SQBK 1HJBA 1XTCC 4IFDK 5BVZA 2FXMA 1X8YA 3M9BA 3P8MC 2JEEA 2XZRA 1LTIC 3EFGA 1VPCA 1KILC 2KOGA 1GL2B 2W6AA 4KHXA 1VDFA 1M1JB 2KSJA 4W7ZA 1DH3A 4JF7A 2IFNA 2VRSA 3KDPB 2O1KA 1CI6B 3MUDA 2OYHB 2XDJA 1JTHB 1LGHB 2WT7A 4WY4C 1LWUB 4M3LA 1J1EC 4DOJA 1L0LK 1J1DC 5APXA 4OH8B 1N73C 3VN0A 1SVFA 3N4XA 1FZGA 3RK3B 2Q5UA 5APSA 1HVVA 1RE4A 3HE4A 5KTBA 3HTKB 4WY4A 1URQC 1M1JA 2KB7P 5CJ0A 1H8AA 5CCGA 3L4FA 2I1KA 2KLVA 1LT9A 2IPPA 4GIFA 2OYIC 1HH0A 2WT7B 1LWUA 1OXZA 2PAJA 1SFCC 3GHGA 1KILB 1GL2C 4EOTA 1NHLA 4ZKUA 2Q7CA 3MIWA 4EIJA 2GUVA 5AVXB 2C0WA 2BASA 1IJDB 1MFZA 5AVVB 3A2AA 2HPCB 2YKQA 1DX7A 2Z5IA 5CCGD 1GL2D 5CCHD 2A45H 2HPCA 3M0AA 3H32A 2N9BA 5AW0B 1ZR2A 1CW5A 1MV8A 3A3YB 4DZOA 5AW9B 2QM7A 1LTTC 3VMYA 5KJ7A 1JY2P 3P8CD 1IC2A 3HD7A 3TNUA 2HODA 2H7HA 5AVQB 1RF0A 1ZR4A 1HGVA 2WZ7A 2CPSA 3NXSA 2FYUK 1RE4C 1T8ZA 4Y99C 1SFCA 3B5NC 1GK6A 1LT9C 4WBAA 3I5CA 1GU4A 2FYZA 2C9NY 2A45G 4AYCA 2N1TC 1S9KD 1LTJB 2LKMA 2O01H 5APQA 1AQ5A 2WTYA 1GL2A 2WSEH 2C9LY 3KQGA 2P7JA 3L37A 3BASA 1URQD 1PFIA 2W27A 2WPRA 1SQQK 1FAVA 3U1AA 3VYIA 2P67A 1HUCA 5KJ7C 2W6BA 4IFMA 2ZXEB 1FZFA 1NTZK 1RE3A 3RL0C 1NKNA 5APVA 5AW6B 3HUSA 1SQVK 2H43A 2R5BA 1SFCD 1JY2O 3A7OA 4JYCA 1FJPA 1ZLLA 2O1JA 1JY3O 1JOCA 4W7YA 2WPSA 2Z5HA 2OARA 4XE5B 1M1JC 3U59A 1FOSE 3MD0A 3M06A 3RK3C 2M8RA 5KJ7D 2YMYA 2NPSA 1GW4A 2R5DA 4HH2A 2J58A 5AW5B 1RY3A 3CL3D 2OYIB 1G1JA 1GD2E 3HE4B 1SLQA 2FFDA 2XU6A 4O9BA 3OJAB 3RL0D 1FZCB 1CZQA 1URQB 3V2PA 3SWFA 1FZEA 1KQLA 2YKPA 2YNYA 1LTAC 1JUNA 3KYQA 3HD7B 1KILA 3P7KA 3HE5B 3TNUB 1X79B 1MUUA 1N2DC 3CI9A 2QM8A 2GUSA 1SFCB 3VMZA 1JO5A 5AVWB 1HWTC 1SP4A 3A5TA 3V2RA 1YTZI 1ZV8A 2WITA 1JTHA 1CI6A 3L36A 3M0DC 5AVTB 4B86A 4LC1A 1IFIA 1T2KC 3HUSB 4C7NA 2MJZA 2OYHA 1H89A 4WY4D 1IFDA 3KPEA 1FJKA 2FKWB 1IK9A 1G2CB 3TSIA 2XV5A 5AVSB 2N1TA 5AW7B 3V4WA 3P8CE 4LGDE 3HD7D 4I2LC 1L4AB 4AUWA 1KILD 1WRGA 3RK2C 3RK2D 1HGZA 4I1LA 4ZKPA 3VTPC 1N7SA 1LWUC 4IFFA 3TYYA 5AW8B 2OYHC 3HE5A 1YTZT 4N3YB 3LW5H 3OA7A 3BRTB 3GHGB 4XA4A 3OAKA 3C9IA 1A02F 2P1JA 1HTLC 3B5NB 5AVUB 1NOHA 3HD7C 3CLQA 3R2PA 1FOSF 3H32B 1J1DB 3P32A 1J2JB 1KFNA 4N78D 4WY4B 5AVZB 1L0NK 1NTMK 1A02J 5BU5A 5KLVK 1X9VA 1JMMA 2JJLA 4C7RA 1IO4A 1IFMA 4RESB 1LTSC 3B5NA 1SQPK 3N7NA 2ZFCA 1NU1K 2YO3A 1NH4A 2YO2A 1GTWA 1RF0C 1LTGC 1NKZB 5APWA 3VMXA 1IFNA 2HFED 5AW4B 2H8PD 1FDMA 2XKMA 1RF1C 1W2EA 3HRNA 2IX7C 2POHA 3RK2B 2E42A 5CCHC 2L5GB 1L4AA 1GW3A 3GHGC 3EQ2A 1Z56A 3T97A 1S9KE 1RE3C 3M9QA 3VP9A 1M7LA 2KP8A 1E5WA 1N7LA 2WSFH 4N6JA 1GDTA 1FU1A 3UIAA 1FZBA 3V5BA 3MTUE 2OYIA 1EQ7A 2R32A 1J1EB 2I1JA 1AFOA 2N1TB 1LTJC 4LLHA 1G2CA 4AQRD 3VOPA 3V4QA 3BATA 3NTNA 5AVYB 4Y99B 1NWQA 3IFMA 3G3ZA 1OWAA 5AVRB 3V2NA 3HUSC 3HTKA 3O8ZA 2C0XA 3E1IA 3IR9A 1GZLA 2HLOA 1N73B 2XNXA 3BRVB 1JCCA 4WB4A 4C46A 3WMM0 1RF1A 1T3UA 1KFMA 1N7SC 1N86A 5AW3B 2NPSC 1N7SD 2GM4A 4JYBA 2NPSD 2J59M 3RL0B 1G1IA 1L4AC 1JY3P 4W80A 1WT6A 3TK1A 2N1TD 2WSCH 5BU8B 3VP8A 1JNMA 2M3BA 3M0DA 4GT1A 5AW1B 3NMDA 4HYTB 1ZN5A 1KZUB 1QL1A 3M91A 1MZ9A 2Q3IA 2Q9IA 2HYNA 2WWWA 5AW2B 5CHXA 2Z4EA 3H6PA 2PP6A 3LIDA 3NFQA 1CSBA 3BVHA 1YYCA 2YKOA 5CMZA 3MGNA 1L4AD 1N73A 1XTGB 5CCGC 3LIEA 1T2KD 3U1CA 2FFDC 1JY3N 1FZCA 1URQA 3L35A 1JY2N 2IFMA 1H88A 1HBWA 5APUA 1FBMA 4I6MC 1DEBA 1SQXK 2CPBA 2HG5D 5APTA 1T3JA 2E43A 3RK3D 2R3CA 1NAFA 1FZCC 1GK4A 5CCHA 2P2UA 1LTJA 1N7SB 1LTBC 2NPSB 3V2QA 1LT9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IFN A;  1IFN A;  1QL2 A;  4IFM A;  1ZN5 A;  2KLV A;  1IFM A;  2IFM A;  2KSJ A;  1QL1 A;  2XKM A;  1PFI A;  3IFM A; 
#chains in the Genus database with same CATH topology
 2A45 I;  4L75 A;  5APY A;  1RF1 B;  1GU5 A;  3AEC C;  4RJT A;  1K8A Q;  3CCJ P;  2P58 A;  4PV1 C;  1OZH A;  2WPQ A;  1JEK A;  2Y0D A;  2E74 C;  2HOD B;  2KNC B;  2Y0E A;  1QGK B;  3M9H A;  3PP5 A;  4H0L D;  1FDO A;  5B5E E;  3B5N D;  3SWY A;  1NTK G;  1BGY G;  2IBZ I;  3L71 J;  4UB8 E;  2E76 D;  1LJ2 A;  2FYU E;  3I56 P;  1NO4 A;  1NTK K;  3II6 A;  1KB9 H;  4GKG A;  4DOJ A;  2K9J A;  4N78 E;  1QL2 A;  4C7N B;  1E79 H;  1KQF B;  1SQV D;  2QRX A;  1AQT A;  1BCC D;  1IFJ A;  2AXT H;  1OW7 A;  1S5L X;  3AE2 C;  1SQQ G;  3B8E B;  5KAF H;  1FS0 E;  2FFD B;  1S2E A;  2BCC G;  1BGY D;  1NTZ J;  5CJ4 A;  1FZA A;  5TJH A;  2KYV A;  2FXO A;  2KIK A;  1Q90 D;  4DT0 A;  1JCD A;  1QEX A;  1SQB K;  1HJB A;  1XTC C;  4IFD K;  5BVZ A;  3FXE A;  2IYO A;  2FXM A;  1X8Y A;  3M9B A;  3P8M C;  4JPZ B;  3TGU G;  2JEE A;  1SQB D;  2XZR A;  3A0H E;  1LTI C;  3L72 E;  2YIU C;  3EFG A;  1VPC A;  1KIL C;  2KOG A;  1GL2 B;  2W6A A;  1NU1 D;  3H1I G;  4GDO A;  4IOI H;  4KHX A;  1S72 P;  1SQP D;  1KTM A;  1VDF A;  2HR3 A;  1M1J B;  2KSJ A;  3BCC D;  5B66 H;  1D7M A;  1YIT P;  4W7Z A;  1DH3 A;  3CCU P;  4JF7 A;  2JWD A;  3CC7 P;  1KIL E;  1BCC J;  2IFN A;  2VRS A;  3AE9 C;  3KDP B;  1FC2 C;  1EXI A;  2O1K A;  1NTM D;  1CI6 B;  2IDB A;  2JO1 A;  2XDJ A;  1JTH B;  2YMK A;  1LGH B;  3CX5 D;  3MUD A;  4WY4 C;  2O3J A;  5K5G B;  2WT7 A;  1LWU B;  2AXC A;  2LXC B;  2QSI A;  1J1E C;  2E75 C;  4H0L B;  4H44 D;  1L0L K;  1J1D C;  2JP3 A;  4NPF X;  1SQP G;  4OH8 B;  4U3F E;  1SVF A;  3N4X A;  5APX A;  1PGO A;  4UB8 H;  3VN0 A;  1FDI A;  1FZG A;  3RK3 B;  2J5U A;  1PP9 D;  2Q5U A;  3H1L E;  4R4M A;  5APS A;  1HVV A;  1AJY A;  3RBZ A;  4HKZ H;  1RE4 A;  3AEB C;  3HE4 A;  5KTB A;  1IFP A;  3HTK B;  2KSE A;  1YHQ P;  1YJ9 P;  3AE8 C;  1URQ C;  1M1J A;  1NU1 J;  1NAY A;  2KB7 P;  2R3S A;  4WY4 A;  1NJI Q;  3CCE P;  5CJ0 A;  1H8A A;  1LNQ A;  1EZV I;  3L74 D;  5CCG A;  3L4F A;  2I1K A;  2OYO A;  2KLV A;  1BDC A;  2IBZ E;  1LT9 A;  2IPP A;  3L71 E;  3AEG C;  1P84 H;  1DEE G;  4GIF A;  2OYI C;  1HH0 A;  1PP9 G;  3H1K J;  2WT7 B;  3CCR P;  4U3F J;  1LWU A;  1OXZ A;  1SQV G;  1M57 D;  1NTM J;  1L0N J;  1SFC C;  1SQQ E;  2PAJ A;  1VQ5 P;  2E76 B;  2FYU D;  1KIL B;  3GHG A;  4Z1M H;  1GL2 C;  4EOT A;  3C1L A;  3L75 G;  1KYO D;  5DJT B;  1NHL A;  2A06 D;  3BCC E;  3KZI E;  4ZKU A;  1KD1 Q;  1SQP J;  2KS1 B;  2Q7C A;  5CBO A;  3I55 P;  4IL6 E;  1NU1 E;  2ZT9 C;  3MIW A;  1EZV E;  2QJP B;  1DD3 A;  2GUV A;  3AE6 C;  4EIJ A;  3Q3D A;  5AVX B;  1KYO H;  2C0W A;  2BAS A;  2ZJS E;  1IJD B;  1MFZ A;  1SQB G;  3AED C;  4I7Z C;  4XFJ A;  4PJ0 H;  1PGJ A;  4H13 C;  3A2A A;  5AVV B;  2HPC B;  1S1C X;  2W83 C;  2YKQ A;  1DX7 A;  2Z5I A;  3RK3 E;  1ZP0 C;  2Q3E A;  1H0T A;  5CCG D;  1PL5 A;  3JSV C;  2QA4 P;  2RKL A;  3FX0 A;  1GL2 D;  3CXH I;  4U3F D;  2G8Y A;  1VQO P;  3QH9 A;  5CCH D;  1PP9 J;  2A45 H;  2HPC A;  1JM0 A;  1AA0 A;  1KB9 E;  2N9B A;  3H32 A;  3M0A A;  5AW0 B;  1ZR2 A;  3RL0 g;  4D6T G;  1VQP P;  1CW5 A;  1K05 A;  1MV8 A;  3A3Y B;  4DZO A;  1K04 A;  2QM7 A;  5AW9 B;  1LTT C;  4DCK A;  1EZV D;  3VMY A;  3G6E P;  5KJ7 A;  1JY2 P;  2FY8 A;  3P8C D;  1IC2 A;  1PZQ A;  3L70 D;  2ZYG A;  3HD7 A;  4PD4 D;  2Q1K A;  4TT3 H;  2BEQ D;  2HOD A;  1SQX J;  2KNC A;  3CXH E;  4DJG A;  2H7H A;  3C8V A;  3MP7 B;  3H1K D;  1KYO E;  4BRY A;  4OGQ C;  2KK7 A;  5AVQ B;  1RF0 A;  1KQG B;  1L0N D;  1ZR4 A;  1BCC G;  2W8Z A;  1HGV A;  1JMB A;  2WZ7 A;  3ITK A;  1NTK E;  2AEF A;  2CPS A;  2IBZ G;  3NXS A;  2FYU K;  5M1B A;  2N9Y B;  2ZVN B;  3CPW O;  1RE4 C;  1T8Z A;  3L74 J;  5TIS H;  1Y47 A;  1OFC X;  1RH5 B;  1SQX G;  2K88 A;  3E1R A;  5KKZ B;  4Y99 C;  1SFC A;  3WUU A;  2FYU G;  4EYY Q;  3B5N C;  1GK6 A;  1LP1 A;  3H1I E;  2E5Y A;  1U7J A;  2JWA A;  2QIW A;  1LT9 C;  4WBA A;  4EI2 A;  1VF5 C;  1PPJ D;  4PJ0 E;  3I5C A;  5B66 E;  3Q5P A;  2FYZ A;  1W2B O;  2A45 G;  1GU4 A;  2C9N Y;  4AYC A;  3G9R A;  4YPC A;  2N1T C;  3L74 G;  1S9K D;  1LTJ B;  1SQX D;  2LKM A;  1NTZ G;  2O01 H;  5APQ A;  2WTY A;  1YJN P;  1AQ5 A;  1GL2 A;  2WSE H;  2C9L Y;  3KQG A;  1ZXG A;  2P7J A;  3TDK A;  3B71 A;  3GMA A;  3BAS A;  3L37 A;  4YXD C;  1NTM G;  1SQV J;  1URQ D;  2H89 C;  2O01 N;  2RN0 A;  1PFI A;  1HJ0 A;  2W27 A;  1KV4 A;  4BWN A;  2WPR A;  4OVN F;  1BSN A;  1SQQ K;  1NYH A;  1FAV A;  3U1A A;  3CWB D;  3VYI A;  2P67 A;  1BDD A;  1HUC A;  3AE7 C;  2L91 A;  1Q7Y Q;  5KLV G;  2AXT E;  3H1I D;  5KJ7 C;  2W6B A;  3L71 G;  1H0T B;  4IFM A;  2ZXE B;  1BE3 D;  3O6Q A;  1Q82 Q;  3ZDM A;  2O01 J;  1OIP A;  2ZAE B;  1FZF A;  2RH0 A;  1NTZ K;  1Q81 Q;  1DD4 A;  4OGQ D;  1M1K Q;  2B88 A;  1RE3 A;  3F89 A;  3D6Y A;  5H2F H;  3RL0 C;  1VQL P;  1NKN A;  2IBZ D;  3S9O A;  3QWO C;  1L0L J;  2IZ1 A;  3A0B H;  5APV A;  4UB6 H;  3HUS A;  5AW6 B;  4BRY B;  4D6T E;  3Q2Y A;  1EDL A;  1SQV K;  2H43 A;  2R5B A;  2B87 B;  1SFC D;  1JY2 O;  2OQQ A;  3A7O A;  4PV1 D;  4JYC A;  1PV3 A;  1FJP A;  1NTK D;  1ZLL A;  2O1J A;  2ZYA A;  2OGU A;  1JY3 O;  2Y0C A;  5C39 A;  3G4S P;  1BSH A;  1JB0 J;  1JOC A;  4W7Y A;  2JKV A;  4CPG A;  3PJS K;  3L75 J;  2WPS A;  2Z5H A;  1PP9 E;  2OAR A;  1M1J C;  4KJM A;  4XE5 B;  3U59 A;  3H1I J;  3MD0 A;  3D6Z A;  1SQQ D;  1BE3 E;  1L0N G;  4TLF A;  4ASW A;  2QVA A;  3M06 A;  3RK3 C;  2M8R A;  1USE A;  2E75 D;  1T6A A;  2FYN B;  5KJ7 D;  3FXD A;  2YMY A;  4QMA A;  3D70 A;  2NPS A;  2QJK C;  3L70 G;  3ABV C;  3CC2 P;  1GW4 A;  2R5D A;  4HH2 A;  1QX8 A;  2J58 A;  5AW5 B;  1RY3 A;  5GTH H;  3CL3 D;  3IN6 A;  1K9M Q;  2OYI B;  2V7Q J;  1G1J A;  1GD2 E;  3HE4 B;  2ZT9 D;  2PRR A;  1SLQ A;  2FYU J;  2FFD A;  1OVU A;  1SQP E;  2XU6 A;  3MUD C;  4O9B A;  5L8R J;  3A0B E;  5E79 H;  3OJA B;  1USD A;  3RL0 D;  3CCM P;  1NTK J;  2G3A A;  1CZQ A;  3GLM A;  1FZC B;  1URQ B;  4GOD A;  4HJG H;  1BE3 J;  2QE7 H;  5DJU B;  3V2P A;  1KC8 Q;  1ZRT D;  3SWF A;  4OWF A;  1FZE A;  1OMI A;  2PFX A;  1KQL A;  5KLV E;  5TIS E;  3H1J E;  2YKP A;  2YNY A;  3CX5 E;  1LTA C;  1YI2 P;  1JUN A;  3HD7 B;  2QJY B;  1KIL A;  3HE5 B;  3KYQ A;  3P7K A;  1X79 B;  1MUU A;  3TNU B;  1N2D C;  3CI9 A;  3LW5 J;  3FGA D;  1L0L D;  2QM8 A;  4PD4 H;  2GUS A;  1SFC B;  2Q6Q A;  3VMZ A;  4H13 B;  1JO5 A;  4M3L A;  1S5L H;  2SPZ A;  2Y9Y A;  4I7Z B;  5AVW B;  1YQ3 C;  2Y9Z A;  1HWT C;  1SP4 A;  3A5T A;  1EC5 A;  3V2R A;  1YTZ I;  1ZV8 A;  2GA1 A;  3L75 D;  3V6I A;  2WIT A;  3H1K E;  1JTH A;  2QJP C;  2WVR A;  1CI6 A;  1SQQ J;  3AE5 C;  3L36 A;  3M0D C;  4MN4 C;  5AVT B;  3T97 B;  4B86 A;  1SQX E;  2FYN C;  4K3A A;  4LC1 A;  1IFI A;  4H44 B;  2OYH B;  1RQV A;  1T2K C;  1U57 A;  3HUS B;  4EDF A;  2BEZ F;  4PV1 B;  1LT1 A;  2XND H;  4C7N A;  1RQU A;  3GW6 A;  2K9J B;  2MJZ A;  2NRG A;  3IF4 A;  4RKU J;  3TGU J;  5GTI E;  1Y9B A;  3H1J D;  3Q5R A;  3FWL A;  2OYH A;  1H89 A;  1QVF O;  4WY4 D;  2WQY C;  1IFD A;  1OW6 A;  1QLE D;  3EWK A;  3L74 E;  3AEA C;  3KPE A;  1FJK A;  4KT0 J;  2FKW B;  1IK9 A;  1G2C B;  2JDI H;  3B4S A;  3CXH H;  3PH0 A;  3TSI A;  3H25 A;  2XV5 A;  5AVS B;  2N1T A;  5AW7 B;  1Q2N A;  1IK7 A;  3L73 D;  3CCS P;  4ZMD A;  4GOE A;  3RBX A;  3V4W A;  3P8C E;  3PRJ A;  3CCQ P;  1VQ8 P;  4WWI A;  4LGD E;  3HD7 D;  1ZRT E;  1L0L E;  4I2L C;  1L4A B;  4AUW A;  1KIL D;  1WRG A;  3RK2 C;  2IZ0 A;  3RK2 D;  1HGZ A;  3CWB E;  4H13 D;  2WSS H;  3OW2 O;  4I1L A;  3F5H A;  3VTP C;  4ZKP A;  1N7S A;  2B9B A;  1LWU C;  2M3E A;  1SS1 A;  4IFF A;  3TYY A;  5AW8 B;  2OYH C;  3HE5 A;  1YTZ T;  1ZOY C;  4N3Y B;  3LW5 H;  1IZN B;  3L72 D;  3OA7 A;  3SSU A;  3TGU D;  3H1J J;  1UII A;  3BRT B;  1PIX A;  3GHG B;  4XA4 A;  1LP1 B;  3OAK A;  1S4X A;  2KLU A;  2MKV A;  2WSC J;  3C9I A;  5EFW B;  3USS A;  5KKZ C;  1VQM P;  1A02 F;  4PD4 I;  2P1J A;  3L73 E;  1HTL C;  3B5N B;  3JCU E;  4H44 C;  5AVU B;  1HF9 A;  1NOH A;  4IL6 X;  3HD7 C;  2PGD A;  2YXQ B;  3CLQ A;  3R2P A;  5KAI H;  1FOS F;  1X22 A;  3CWB J;  3H1K G;  3H32 B;  1J1D B;  4GOF A;  2H88 C;  3P32 A;  3GG2 A;  1J2J B;  1KFN A;  4N78 D;  4WY4 B;  5AVZ B;  1L0N K;  1NTM K;  4HB1 A;  5KAF E;  1A02 J;  2A06 G;  4L73 A;  1BGY E;  4Y28 J;  5BU5 A;  5KLV K;  2R44 A;  4U7J A;  1X9V A;  5E79 E;  1JMM A;  2JJL A;  4C7R A;  3H1H E;  1IO4 A;  2ZYD A;  1IFM A;  4RES B;  2QEX P;  5KLI C;  3L72 J;  4WVZ A;  1LTS C;  2K9Y A;  3B5N A;  1SQP K;  2ZFC A;  3L73 J;  1NTM E;  3N7N A;  3GF7 A;  1L0N E;  4A7P A;  1NU1 K;  4ZNC A;  4NPE A;  2WPV B;  2YO3 A;  1NH4 A;  2AEJ A;  2YO2 A;  1GTW A;  3AEF C;  3CCV P;  3JCU H;  1UIX A;  2OTJ P;  1RF0 C;  1LTG C;  1NKZ B;  2M5A B;  1VL2 A;  2OTK E;  5APW A;  1WMK A;  1Q86 Q;  3SWK A;  2E74 B;  3MZW B;  3VMX A;  1IFN A;  3CC4 P;  4UB6 E;  3CX5 I;  3EFF K;  1M8O B;  2HFE D;  5AW4 B;  2H8P D;  1KB9 D;  1FDM A;  3AE1 C;  2KZJ A;  2XKM A;  1RF1 C;  5H2F E;  1W2E A;  3WU2 H;  3HRN A;  1BE3 G;  2IX7 C;  3O6Q B;  2POH A;  3RK2 B;  2E42 A;  3GF3 A;  2K1A A;  2QG4 A;  2L5G B;  1OVV A;  5CCH C;  1R5S A;  3Q1M A;  2K37 A;  5KLV D;  2LR2 A;  1L4A A;  2I8D A;  3S1K A;  1R5L A;  1NVO A;  3TGU E;  1GW3 A;  2UWJ E;  3GHG C;  3EQ2 A;  1PPJ E;  4OGQ B;  2IYP A;  1EDI A;  3MHV A;  3TF5 A;  1VQK P;  1P84 E;  1AVO A;  1Z56 A;  3PTZ A;  2B89 A;  2FBW C;  3T97 A;  1S9K E;  1RE3 C;  3M9Q A;  3VP9 A;  3E7K A;  1M7L A;  1KYO I;  3H1J G;  3G71 P;  1KOR A;  2KP8 A;  1E5W A;  1OX3 A;  2QJY C;  4IL6 H;  3L70 E;  1N7L A;  3FWN A;  3CME P;  2WSF H;  4N6J A;  1GDT A;  1VQ9 P;  1FU1 A;  2KS1 A;  3UIA A;  1FZB A;  3AE4 C;  1ZW0 A;  3RGU A;  3V5B A;  3MTU E;  3WUV A;  3VMA A;  1EQ7 A;  2R32 A;  4H0L C;  1NGM B;  2OYI A;  1J1E B;  2E75 B;  3CD6 P;  2I1J A;  1AFO A;  1KB9 I;  5KLI B;  1EDK A;  2N1T B;  1LTJ C;  1VQ6 P;  4LLH A;  1S5L E;  1G2C A;  1FE6 A;  1NU1 G;  3H1L D;  3WU2 E;  3VOP A;  4AQR D;  3V4Q A;  1N8R Q;  1AVY A;  3BAT A;  3NTN A;  1K73 Q;  1U7M A;  3CXH D;  5AVY B;  1M56 D;  4Y99 B;  1NWQ A;  2OTL P;  3W68 A;  2KXP B;  1DIP A;  3IFM A;  3G3Z A;  2WMM A;  3SFD C;  3CMA P;  1OWA A;  5AVR B;  2NZ2 A;  3V2N A;  2DW3 A;  1KQS O;  3HUS C;  3HTK A;  4NPD A;  3R4Y A;  1KN7 A;  3O8Z A;  5KLV J;  2C0X A;  3AEE C;  3E1I A;  1R8E A;  2E74 D;  3K5B A;  3IR9 A;  2ITA A;  1GZL A;  2HLO A;  1N73 B;  1RHZ B;  2BCC D;  3KHU A;  1VQ7 P;  1P84 D;  2XNX A;  3BRV B;  2WSF J;  3PHL A;  2KZI A;  1JCC A;  4WB4 A;  1OW8 A;  2E76 C;  1YBK A;  2YXR B;  4C46 A;  3D71 A;  1X0T A;  2AEM A;  5CBN A;  4JBZ A;  3WMM 0;  2KI7 B;  1RF1 A;  2W90 A;  2ZVO B;  1T3U A;  1KFM A;  1N7S C;  1N86 A;  5AW3 B;  2NPS C;  1N7S D;  2GM4 A;  2ZT9 B;  2NPS D;  4JYB A;  5GTI H;  2J59 M;  3TNU A;  1VF5 D;  3SFE C;  4ASV A;  1QVG O;  3A0H H;  2E5T A;  3H1H D;  1VQN P;  3H1L G;  1KMI Z;  3CWB G;  3RL0 B;  1G1I A;  1L4A C;  3CCL P;  1JY3 P;  2W6J H;  4W80 A;  3KZI H;  1WT6 A;  1W5C E;  1PGP A;  3CX5 H;  3TK1 A;  2D2C B;  2JR8 A;  4JQ0 D;  2N1T D;  2ZXX A;  4K35 A;  2A06 E;  2WSC H;  2V4H A;  3KXD A;  5BU8 B;  2M0B A;  3VP8 A;  2BCC J;  2M3B A;  3M0D A;  2M5A A;  1JNM A;  2CK3 H;  4GT1 A;  3H1H G;  5AW1 B;  3NMD A;  4HYT B;  1OVR A;  1EZV G;  1TU3 F;  1VQ4 P;  1ZN5 A;  1KZU B;  1MFT A;  3L73 G;  1SQV E;  1QL1 A;  3M91 A;  1MZ9 A;  2Q3I A;  2Q9I A;  3L72 G;  2HYN A;  4YTP C;  3L75 E;  2WWW A;  2RMZ A;  1YJW P;  5AW2 B;  5CHX A;  4D6T D;  1AV1 A;  2Z4E A;  5KAI E;  2LXB A;  3H6P A;  2PP6 A;  3LID A;  3NFQ A;  1FOS E;  3H1H J;  4PD4 E;  1CSB A;  1NTZ E;  3BVH A;  5B5E H;  1YQ4 C;  1YYC A;  3AE3 C;  3H1L J;  3L71 D;  2YKO A;  2BCC E;  1GMJ A;  3JC2 2;  2FXP A;  1PGQ A;  1L4A D;  3MGN A;  5CMZ A;  4YXW H;  1SQB J;  2P10 A;  1N73 A;  1XTG B;  1M90 Q;  5CCG C;  1S3J A;  2K3R A;  3LIE A;  1MKM A;  1T2K D;  1ZME C;  3S4R A;  1L0L G;  3U1C A;  2FFD C;  4L76 A;  1JY3 N;  2QJK B;  1N73 C;  4L74 A;  1FZC A;  4R4L A;  1URQ A;  3L70 J;  3L35 A;  1JY2 N;  2IFM A;  2KUB A;  3BCC G;  1YIJ P;  1H88 A;  2D2C C;  3IAO A;  1P84 I;  2D2C D;  4RO0 A;  3WUT A;  5GTH E;  4D6T J;  1HBW A;  1BCC E;  5APU A;  2V7Q H;  4BXL A;  1FBM A;  4I6M C;  1DEB A;  1SQX K;  2YIU B;  3Q5S A;  2CPB A;  2HG5 D;  1PPJ G;  5APT A;  1T3J A;  2E43 A;  3RK3 D;  1SQB E;  1NAF A;  2R3C A;  1FZC C;  1L2P A;  1EXJ A;  2WSE J;  1GK4 A;  3PLN A;  5CCH A;  2P2U A;  1EDJ A;  1LTJ A;  1N7S B;  1LTB C;  2B87 A;  1BGY J;  1NTZ D;  2NPS B;  1LT9 B;  3BCC J;  1Y8A A;  1VF5 B;  4U3F G;  3V2Q A;  3W67 A; 
#chains in the Genus database with same CATH homology
 2A45 I;  5APY A;  1RF1 B;  1GU5 A;  2WPQ A;  2HOD B;  3PP5 A;  3M9H A;  3B5N D;  3SWY A;  1NO4 A;  1NTK K;  3II6 A;  4GKG A;  4N78 E;  1QL2 A;  4C7N B;  1IFJ A;  2FFD B;  3B8E B;  5CJ4 A;  1FZA A;  2KYV A;  1JCD A;  1SQB K;  1HJB A;  1XTC C;  4IFD K;  5BVZ A;  2FXM A;  1X8Y A;  3M9B A;  3P8M C;  2JEE A;  2XZR A;  1LTI C;  3EFG A;  1VPC A;  1KIL C;  2KOG A;  1GL2 B;  2W6A A;  4KHX A;  1VDF A;  1M1J B;  2KSJ A;  4W7Z A;  1DH3 A;  4JF7 A;  2IFN A;  2VRS A;  3KDP B;  2O1K A;  1CI6 B;  3MUD A;  2OYH B;  2XDJ A;  1JTH B;  1LGH B;  2WT7 A;  4WY4 C;  1LWU B;  4M3L A;  1J1E C;  4DOJ A;  1L0L K;  1J1D C;  5APX A;  4OH8 B;  1N73 C;  3VN0 A;  1SVF A;  3N4X A;  1FZG A;  3RK3 B;  2Q5U A;  5APS A;  1HVV A;  1RE4 A;  3HE4 A;  5KTB A;  3HTK B;  4WY4 A;  1URQ C;  1M1J A;  2KB7 P;  5CJ0 A;  1H8A A;  5CCG A;  3L4F A;  2I1K A;  2KLV A;  1LT9 A;  2IPP A;  4GIF A;  2OYI C;  1HH0 A;  2WT7 B;  1LWU A;  1OXZ A;  2PAJ A;  1SFC C;  3GHG A;  1KIL B;  1GL2 C;  4EOT A;  1NHL A;  4ZKU A;  2Q7C A;  3MIW A;  4EIJ A;  2GUV A;  5AVX B;  2C0W A;  2BAS A;  1IJD B;  1MFZ A;  5AVV B;  3A2A A;  2HPC B;  2YKQ A;  1DX7 A;  2Z5I A;  5CCG D;  1GL2 D;  5CCH D;  2A45 H;  2HPC A;  3M0A A;  3H32 A;  2N9B A;  5AW0 B;  1ZR2 A;  1CW5 A;  1MV8 A;  3A3Y B;  4DZO A;  5AW9 B;  2QM7 A;  1LTT C;  3VMY A;  5KJ7 A;  1JY2 P;  3P8C D;  1IC2 A;  3HD7 A;  3TNU A;  2HOD A;  2H7H A;  5AVQ B;  1RF0 A;  1ZR4 A;  1HGV A;  2WZ7 A;  2CPS A;  3NXS A;  2FYU K;  1RE4 C;  1T8Z A;  4Y99 C;  1SFC A;  3B5N C;  1GK6 A;  1LT9 C;  4WBA A;  3I5C A;  1GU4 A;  2FYZ A;  2C9N Y;  2A45 G;  4AYC A;  2N1T C;  1S9K D;  1LTJ B;  2LKM A;  2O01 H;  5APQ A;  1AQ5 A;  2WTY A;  1GL2 A;  2WSE H;  2C9L Y;  3KQG A;  2P7J A;  3L37 A;  3BAS A;  1URQ D;  1PFI A;  2W27 A;  2WPR A;  1SQQ K;  1FAV A;  3U1A A;  3VYI A;  2P67 A;  1HUC A;  5KJ7 C;  2W6B A;  4IFM A;  2ZXE B;  1FZF A;  1NTZ K;  1RE3 A;  3RL0 C;  1NKN A;  5APV A;  5AW6 B;  3HUS A;  1SQV K;  2H43 A;  2R5B A;  1SFC D;  1JY2 O;  3A7O A;  4JYC A;  1FJP A;  1ZLL A;  2O1J A;  1JY3 O;  1JOC A;  4W7Y A;  2WPS A;  2Z5H A;  2OAR A;  4XE5 B;  1M1J C;  3U59 A;  1FOS E;  3MD0 A;  3M06 A;  3RK3 C;  2M8R A;  5KJ7 D;  2YMY A;  2NPS A;  1GW4 A;  2R5D A;  4HH2 A;  2J58 A;  5AW5 B;  1RY3 A;  3CL3 D;  2OYI B;  1G1J A;  1GD2 E;  3HE4 B;  1SLQ A;  2FFD A;  2XU6 A;  4O9B A;  3OJA B;  3RL0 D;  1FZC B;  1CZQ A;  1URQ B;  3V2P A;  3SWF A;  1FZE A;  1KQL A;  2YKP A;  2YNY A;  1LTA C;  1JUN A;  3KYQ A;  3HD7 B;  1KIL A;  3P7K A;  3HE5 B;  3TNU B;  1X79 B;  1MUU A;  1N2D C;  3CI9 A;  2QM8 A;  2GUS A;  1SFC B;  3VMZ A;  1JO5 A;  5AVW B;  1HWT C;  1SP4 A;  3A5T A;  3V2R A;  1YTZ I;  1ZV8 A;  2WIT A;  1JTH A;  1CI6 A;  3L36 A;  3M0D C;  5AVT B;  4B86 A;  4LC1 A;  1IFI A;  1T2K C;  3HUS B;  4C7N A;  2MJZ A;  2OYH A;  1H89 A;  4WY4 D;  1IFD A;  3KPE A;  1FJK A;  2FKW B;  1IK9 A;  1G2C B;  3TSI A;  2XV5 A;  5AVS B;  2N1T A;  5AW7 B;  3V4W A;  3P8C E;  4LGD E;  3HD7 D;  4I2L C;  1L4A B;  4AUW A;  1KIL D;  1WRG A;  3RK2 C;  3RK2 D;  1HGZ A;  4I1L A;  4ZKP A;  3VTP C;  1N7S A;  1LWU C;  4IFF A;  3TYY A;  5AW8 B;  2OYH C;  3HE5 A;  1YTZ T;  4N3Y B;  3LW5 H;  3OA7 A;  3BRT B;  3GHG B;  4XA4 A;  3OAK A;  3C9I A;  1A02 F;  2P1J A;  1HTL C;  3B5N B;  5AVU B;  1NOH A;  3HD7 C;  3CLQ A;  3R2P A;  1FOS F;  3H32 B;  1J1D B;  3P32 A;  1J2J B;  1KFN A;  4N78 D;  4WY4 B;  5AVZ B;  1L0N K;  1NTM K;  1A02 J;  5BU5 A;  5KLV K;  1X9V A;  1JMM A;  2JJL A;  4C7R A;  1IO4 A;  1IFM A;  4RES B;  1LTS C;  3B5N A;  1SQP K;  3N7N A;  2ZFC A;  1NU1 K;  2YO3 A;  1NH4 A;  2YO2 A;  1GTW A;  1RF0 C;  1LTG C;  1NKZ B;  5APW A;  3VMX A;  1IFN A;  2HFE D;  5AW4 B;  2H8P D;  1FDM A;  2XKM A;  1RF1 C;  1W2E A;  3HRN A;  2IX7 C;  2POH A;  3RK2 B;  2E42 A;  5CCH C;  2L5G B;  1L4A A;  1GW3 A;  3GHG C;  3EQ2 A;  1Z56 A;  3T97 A;  1S9K E;  1RE3 C;  3M9Q A;  3VP9 A;  1M7L A;  2KP8 A;  1E5W A;  1N7L A;  2WSF H;  4N6J A;  1GDT A;  1FU1 A;  3UIA A;  1FZB A;  3V5B A;  3MTU E;  2OYI A;  1EQ7 A;  2R32 A;  1J1E B;  2I1J A;  1AFO A;  2N1T B;  1LTJ C;  4LLH A;  1G2C A;  4AQR D;  3VOP A;  3V4Q A;  3BAT A;  3NTN A;  5AVY B;  4Y99 B;  1NWQ A;  3IFM A;  3G3Z A;  1OWA A;  5AVR B;  3V2N A;  3HUS C;  3HTK A;  3O8Z A;  2C0X A;  3E1I A;  3IR9 A;  1GZL A;  2HLO A;  1N73 B;  2XNX A;  3BRV B;  1JCC A;  4WB4 A;  4C46 A;  3WMM 0;  1RF1 A;  1T3U A;  1KFM A;  1N7S C;  1N86 A;  5AW3 B;  2NPS C;  1N7S D;  2GM4 A;  4JYB A;  2NPS D;  2J59 M;  3RL0 B;  1G1I A;  1L4A C;  1JY3 P;  4W80 A;  1WT6 A;  3TK1 A;  2N1T D;  2WSC H;  5BU8 B;  3VP8 A;  1JNM A;  2M3B A;  3M0D A;  4GT1 A;  5AW1 B;  3NMD A;  4HYT B;  1ZN5 A;  1KZU B;  1QL1 A;  3M91 A;  1MZ9 A;  2Q3I A;  2Q9I A;  2HYN A;  2WWW A;  5AW2 B;  5CHX A;  2Z4E A;  3H6P A;  2PP6 A;  3LID A;  3NFQ A;  1CSB A;  3BVH A;  1YYC A;  2YKO A;  5CMZ A;  3MGN A;  1L4A D;  1N73 A;  1XTG B;  5CCG C;  3LIE A;  1T2K D;  3U1C A;  2FFD C;  1JY3 N;  1FZC A;  1URQ A;  3L35 A;  1JY2 N;  2IFM A;  1H88 A;  1HBW A;  5APU A;  1FBM A;  4I6M C;  1DEB A;  1SQX K;  2CPB A;  2HG5 D;  5APT A;  1T3J A;  2E43 A;  3RK3 D;  2R3C A;  1NAF A;  1FZC C;  1GK4 A;  5CCH A;  2P2U A;  1LTJ A;  1N7S B;  1LTB C;  2NPS B;  3V2Q A;  1LT9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...