2NPSA

Crystal structure of the early endosomal snare complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
63
structure length
63
Chain Sequence
b'RNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vesicle-associated membrane protein 4
publication title Early endosomal SNAREs form a structurally conserved SNARE complex and fuse liposomes with multiple topologies
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 28
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2006-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2npsA00
2HG5D 1KILC 1JTHA 5KJ7D 2YMYA 1URQD 2H8PD 1N7SD 2KOGA 3KYQA 1XTGB 1HVVA 1L4AD 1JTHB 3M0DC 1URQB 4N78E 1KILA 5KJ7C 1N7SB 2NPSA 1KILD 1URQC 2NPSD 1N7SC 1L4AC 1KILB 2NPSB 5KJ7A 3RL0D 2N1TA 1URQA 2NPSC 4WY4C 2N1TD 1N7SA 4W7YA 3RL0B 1L4AA 5CCGD 2N1TB 3RL0C 3B5NA 2N1TC 3B5ND 1NHLA 4WY4A 1L4AB 3HTKB 5CCGC 4WY4D 2WZ7A 3B5NB 3PP5A 4WY4B 1SFCA 3B5NC 1SFCD 5CCGA 1GL2C 2M8RA 1SFCB 4JF7A 1SFCC 3RK3C 5CCHD 4W7ZA 4W80A 1GL2A 1GL2D 4LGDE 2XDJA 3HD7A 3P8CE 3RK2D 5CCHC 1GL2B 3HD7D 3RK3D 3TSIA 3RK2B 2HFED 1T3JA 3HD7B 3RK3B 2PP6A 3RK2C 3HD7C 5CCHA 4OH8B 3VOPA
chains in the Genus database with same CATH superfamily
1SQQJ 3M9HA 5AW7B 1KILC 5BU5A 3CCSP 3S4RA 3I56P 2KNCB 5AW5B 1J1DB 2LR2A 1RE3A 1N7SB 2NPSA 3L75G 2K1AA 4IL6E 1NWQA 5CJ0A 1KD1Q 2QJPB 2M3BA 3H1IE 2POHA 1R5SA 1VF5D 3N4XA 1L4AA 5CCGD 3HTKA 1FZCC 2QE7H 2KI7B 2WPRA 2B89A 5APXA 4PD4E 4BRYA 3GHGA 1PP9D 2LKMA 2AEJA 1NTMK 1VF5B 1S9KE 4M3LA 1M57D 5APYA 2CPSA 1HF9A 2IFNA 2Z4EA 4L73A 3LIEA 4GKGA 2FXMA 4OWFA 1SQXE 3U59A 1HUCA 2C9LY 1KQSO 1NU1K 2FYUJ 1FZBA 3H1ID 1T3JA 5AVUB 1M1JA 1QVFO 3HRNA 3H25A 1K04A 1IFDA 1LWUB 5B5EE 1IFNA 2KUBA 1S4XA 3AE5C 1J1EB 1NU1J 2KP8A 3BATA 5CBOA 3BRVB 1N2DC 1URQC 2R5DA 2CPBA 2NPSD 1A02J 2BCCJ 3II6A 3L72G 1SQXD 2KYVA 2WQYC 3RL0B 5TISH 3T97A 1SQVE 4L74A 5BU8B 2N9YB 3AE1C 2MKVA 2D2CB 2Y0DA 3E7KA 1YQ3C 3KHUA 1RH5B 4WBAA 1BSHA 2IBZD 1SQPJ 2FYUE 3B71A 3P32A 1PV3A 3V4WA 1ZR4A 1X9VA 2YO2A 1N7LA 3CCVP 1FOSE 5AW8B 1N8RQ 1SS1A 2VRSA 1LTTC 3UIAA 3L71D 2A45G 1KQLA 2WPQA 3P8CE 4EOTA 1VQ4P 2M5AA 3TGUJ 5KLVJ 2OGUA 2JKVA 1QLED 2PAJA 2O01N 3HD7B 1GDTA 4PD4I 1H88A 1N86A 1GU4A 1SQVD 2YNYA 5AW4B 4H0LB 2J59M 3IN6A 2I1KA 5AVZB 2OTKE 3C9IA 4U3FE 2E5TA 5APQA 1FJPA 3V2RA 1QVGO 3CC2P 1EZVG 1NKZB 2Q9IA 2KSEA 3WUUA 3P8CD 1LJ2A 2E5YA 1FS0E 4C7RA 2B87A 2P2UA 1S1CX 1VQ5P 2JWAA 2Q5UA 3B5NB 1BCCG 5KKZC 1YBKA 1D7MA 1SFCA 4OGQC 2IYPA 5AW2B 4D6TJ 1T2KC 2M8RA 1NTMG 3FGAD 5KLVE 2FBWC 1HH0A 1S5LX 1PGQA 1LP1B 1FDIA 1J2JB 3ABVC 1GL2B 4H44B 3WU2H 1SQBD 3D6ZA 2AEMA 3TNUA 1NTZG 3RK2C 1PGPA 1RF1A 4YXWH 1KQFB 4OH8B 3VP9A 3E1IA 5TISE 1KB9D 3OW2O 4LC1A 4QMAA 2O1JA 5AVQB 3KYQA 2HR3A 3L74J 5KJ7C 2QSIA 4JQ0D 1KTMA 1CI6A 3D71A 1N73A 2BEZF 1FU1A 3KZIE 1RQVA 2HLOA 2N1TA 1KYOH 1JY3N 3EWKA 3BCCG 3H1KG 3H1LJ 3I55P 5APWA 2JWDA 4I7ZC 3RGUA 2GUVA 2WZ7A 2FYNB 1OMIA 2XNXA 5CMZA 1K8AQ 1IK7A 1L0NG 1SFCD 3Q1MA 2E43A 2PRRA 1FOSF 1HTLC 1NO4A 1RF0C 1EXIA 3BVHA 3L75J 4Y99C 3MTUE 1OZHA 3L70G 1DD3A 3JSVC 1ZRTD 5KAIE 2ZJSE 3SFEC 1A02F 1MKMA 2E42A 2OTLP 3JC22 1RE3C 4AYCA 2FY8A 2W6JH 4DCKA 1VL2A 3P7KA 2P67A 3FWNA 2H8PD 3QWOC 2A06D 1PGJA 3OA7A 1URQB 2OYHB 2YXQB 3H1LE 3VMXA 2E76B 5H2FE 1GK6A 1L4AC 1M7LA 3H1JD 2E74D 1SVFA 3G6EP 3CL3D 3D70A 1OX3A 2N1TD 3AEEC 2OQQA 3K5BA 3HE5A 5AW9B 3MD0A 3A7OA 1VQKP 1NAFA 1NHLA 3GHGC 4NPFX 2YIUC 1JOCA 2XNDH 2A45H 3L75E 1AVOA 1HBWA 1KMIZ 2RKLA 5CCGA 3M06A 2V4HA 1VQ9P 3PH0A 2K9YA 2A06G 4TLFA 4L76A 3IF4A 1LTBC 1M1JC 2XDJA 3H6PA 4PV1C 4ASWA 1X79B 3L73G 1YTZI 2WSCH 3H1JG 1AVYA 1JY3O 1BE3G 3L72J 1WT6A 3AE4C 1LWUA 1KYOE 1BDCA 1X0TA 3Q5RA 1G1JA 3AE7C 2O01H 1KV4A 4O9BA 2JDIH 1N7SD 1USDA 2FXPA 4BXLA 2Q3EA 1K73Q 2ZYDA 4HB1A 3C8VA 1SQXK 4EYYQ 5CBNA 2W6BA 1Q90D 4IL6X 1JCDA 3CWBD 3SWKA 4DJGA 1L0LD 2XKMA 1NTKD 3H1HE 2P10A 2O3JA 2G3AA 1BGYG 2FKWB 5C39A 2KXPB 1KZUB 1FZAA 1YJ9P 1LTGC 4Y28J 4RESB 3N7NA 1IC2A 4B86A 1LTJA 1IFPA 1PL5A 5E79H 2WSCJ 1JY2P 2Y0EA 3CMAP 4XFJA 1EQ7A 2HODB 4IFFA 2BEQD 1KFMA 2OYIB 3HD7A 4I1LA 3V6IA 3CX5H 3GF7A 3RK2B 2HFED 3VP8A 1W5CE 2O01J 1L0LG 1M8OB 2Q6QA 2H88C 3RK3E 1SQQE 3PRJA 2FFDC 3OJAB 1NTKG 2O1KA 2N9BA 1FDOA 3I5CA 1OIPA 3PHLA 2V7QH 2WSSH 1BCCJ 2KZIA 2W6AA 3MHVA 4GOFA 1JY2N 2WITA 3PJSK 4RO0A 3V5BA 3RBXA 3G9RA 1NTMJ 1NTZK 1FDMA 3RL0D 1X22A 3L36A 1ZR2A 1RE4A 3TF5A 2R3CA 4PD4D 3SWYA 1ZW0A 1KYOI 4H13C 3A0BE 1GW4A 3IAOA 1H8AA 2D2CD 3B5NA 1PP9G 3C1LA 4XE5B 4U7JA 1X8YA 1HJBA 1S9KD 1NTZJ 2ZXEB 2HPCB 2HYNA 4WY4B 1FC2C 1AQTA 2IZ1A 1LP1A 1T6AA 1T8ZA 1VPCA 1FZGA 2JEEA 5KLIC 5CCHD 4W7ZA 3H1IG 1OW7A 2B9BA 1GL2A 1SQBK 2OTJP 1P84E 3Q5SA 1EDKA 3V2NA 1RF1C 3HD7D 5APVA 2QJKC 1BCCE 1L0NK 3RK3B 1SP4A 2V7QJ 4K3AA 3BCCJ 4H0LD 3H1KJ 2RMZA 4GOEA 1MZ9A 1QL2A 1RQUA 1N73C 1JTHB 5GTHH 1NU1E 1L0NJ 1EDLA 3V2QA 3KXDA 4AUWA 1SQXG 2H43A 1JCCA 1LT9A 1NOHA 2KSJA 3CPWO 2ZT9B 4L75A 2AXTH 4R4LA 3CCMP 2BCCE 3H32A 4GIFA 1CSBA 2FYZA 1KILE 4EDFA 2W83C 3HUSC 2E75D 3L70J 1JM0A 1EXJA 2IBZG 3CX5E 1KQGB 1YITP 2FYUD 3B5ND 3FXDA 3O6QB 4PJ0H 5DJUB 1IFJA 2A45I 2KLUA 3L71G 1SQPE 3BRTB 2WSEH 3VMZA 5AW1B 1ZXGA 1JY2O 2E75B 3BCCE 4PV1B 3H1KE 1EC5A 1GL2D 3D6YA 4H44D 3KPEA 2Q1KA 4DT0A 5CJ4A 5APSA 1SQVG 3W67A 4OVNF 2QJYC 1Y9BA 1QX8A 3TGUE 2GA1A 3EFGA 1J1DC 4WVZA 1JEKA 2KLVA 1OVUA 4HJGH 2WSFH 4U3FD 2RN0A 4AQRD 2P7JA 1ZLLA 4JBZA 2AXCA 3EFFK 2OYHA 2QJPC 1EZVI 3L70E 1W2EA 1P84I 1SQPD 1H0TB 3T97B 1KC8Q 1NVOA 1DEBA 1BSNA 1KILB 2WTYA 2K9JB 3GMAA 1FJKA 4ZKPA 1JUNA 3CCQP 1PZQA 4ASVA 3ITKA 1IFMA 5BVZA 1KORA 2KK7A 3A0HH 5K5GB 3L73J 2QG4A 3CXHH 3H1JJ 3TGUD 1VF5C 1M56D 1GW3A 1BE3J 5KLVD 5CCGC 2WT7B 2WSEJ 3JCUH 1TU3F 4JPZB 4GT1A 4U3FG 2M3EA 4UB8H 2ZVNB 1GU5A 1FZCB 1PIXA 4D6TE 4GODA 1U57A 4JF7A 1SQBG 3CD6P 4YTPC 2KS1A 1JNMA 3CC4P 1S2EA 2QM7A 2WSFJ 1BDDA 1EDIA 4I2LC 4KHXA 3CX5I 1DX7A 1IJDB 1MFTA 5B66H 3KDPB 2KB7P 1J1EC 3G4SP 3NFQA 1VQ8P 2FFDB 2QRXA 1LT1A 3AE3C 3NXSA 1VQ7P 1CZQA 1OXZA 2IDBA 1BGYJ 1URQD 2K88A 1G2CB 2R3SA 2E76D 5GTIH 3CCEP 4D6TD 3L74E 3AEAC 1UIIA 1BE3E 2JP3A 1QEXA 1Y47A 2B87B 1L0LK 2D2CC 2KNCA 2GM4A 1NH4A 2XU6A 3MUDA 2NPSC 2YKOA 1N7SA 1NTKK 2KIKA 2AEFA 3AEDC 5AVVB 2IZ0A 2IX7C 1AJYA 1LTJC 1L0LJ 4BWNA 2Y9ZA 1JO5A 3VMYA 1PPJE 2QEXP 3S1KA 1NTKJ 3CCJP 1AV1A 3M9BA 1ZV8A 1IZNB 2HODA 5KLIB 2OYIA 3TDKA 2GUSA 3WU2E 3L74D 1PFIA 1JB0J 1FAVA 1RF1B 1LTIC 2G8YA 4C7NB 1HGZA 4WWIA 2H89C 2XV5A 1AQ5A 3FXEA 3H1LD 3CCRP 1PP9J 3CXHE 4DZOA 1L2PA 1N73B 4CPGA 1PPJD 1Q82Q 3Q2YA 1QL1A 1K9MQ 4IFDK 4NPDA 5B5EH 3GF3A 1RE4C 1LNQA 1OFCX 5AVSB 3RBZA 2JO1A 1YQ4C 3AEBC 4LLHA 3H1IJ 3QH9A 2P1JA 3HUSB 3AE9C 3CI9A 3L75D 5AVTB 2J58A 3P8MC 2HPCA 1HWTC 2WMMA 4WY4A 3PTZA 3L37A 1USEA 5B66E 1RHZB 1KFNA 1NYHA 1IK9A 1YHQP 1RF0A 3AE8C 3B4SA 1GL2C 1NAYA 4H44C 1GK4A 5AVXB 1H89A 5L8RJ 3R4YA 5KAFH 2L91A 5KKZB 1KYOD 5GTIE 1PP9E 1SQXJ 4OGQB 2QJYB 2IYOA 3RK2D 3SFDC 2OARA 3IFMA 2WPSA 3G71P 1ZOYC 1GD2E 4JYBA 3L72E 5AW6B 5CCHA 2BASA 1JTHA 4RKUJ 5KJ7D 1LT9C 1SQVK 2L5GB 3CWBG 1DD4A 1M90Q 3VYIA 3L71J 2JJLA 3HE5B 3M0DA 2C0XA 2W8ZA 3H1HD 3VN0A 1OW6A 2FYNC 3ZDMA 2FYUK 1AA0A 4A7PA 2W90A 3HE4B 3O6QA 4YPCA 1SQVJ 1Q86Q 1RY3A 3GW6A 2YMKA 5M1BA 3CXHI 4MN4C 3L72D 4WY4D 3F89A 1OW8A 3G3ZA 3A5TA 2R44A 1KB9H 4IFMA 4HH2A 2B88A 1SFCC 4I7ZB 4XA4A 2IBZE 2C9NY 3AECC 2R5BA 4LGDE 3Q5PA 4I6MC 1KN7A 3E1RA 3RK3D 1SQQD 3H1HG 1K05A 3U1CA 2OYHC 2QVAA 1EZVE 4DOJA 1FZEA 1MUUA 3L71E 2E76C 4Y99B 3OAKA 1S5LH 2PFXA 2I8DA 1SQPK 1DIPA 1H0TA 4U3FJ 1XTGB 1L4AD 1NKNA 2FXOA 4N78E 1KILA 2ZT9D 1R5LA 2K9JA 4NPEA 4R4MA 1Y8AA 1NTME 5AVWB 2H7HA 2LXBA 1R8EA 2NPSB 1SQBJ 1SLQA 2QIWA 1VQMP 3AEGC 5APTA 1WMKA 5KAFE 5KLVK 2K37A 4KT0J 4RJTA 1JMMA 3KZIH 2E74C 2WT7A 1SQQG 2N1TC 2DW3A 1L4AB 2KZJA 1LTSC 3HTKB 3NTNA 1LTJB 1EZVD 1FZCA 1NTZE 3PP5A 3IR9A 5E79E 1P84D 2ZYAA 1OWAA 2NRGA 4BRYB 3GHGB 2YIUB 4PV1D 1BCCD 1VQOP 1JMBA 4N78D 3PLNA 1Q7YQ 2ZXXA 3M0AA 4N6JA 1YTZT 4Z1MH 1NTMD 1CW5A 1S72P 1VQ6P 1DEEG 4EI2A 2WPVB 2XZRA 2FFDA 1VQNP 5AVYB 5AW0B 5KAIH 4ZNCA 1NU1D 3VOPA 2W27A 1M1JB 2HG5D 4WB4A 1G2CA 4JYCA 1SQBE 3MIWA 1OVRA 1PGOA 1YJWP 3O8ZA 4HYTB 1NTZD 2KOGA 2BCCD 3GG2A 4C46A 3LIDA 2YKPA 1L0NE 1T3UA 2IBZI 3MUDC 1KILD 3M9QA 3FX0A 1KB9E 1N7SC 1ZMEC 3CCUP 3CX5D 1GMJA 2FYUG 1URQA 1XTCC 4YXDC 4W7YA 2R32A 1FE6A 3MP7B 5H2FH 5AVRB 1NGMB 5DJTB 2IPPA 3WMM0 3TK1A 2WVRA 3AE6C 4IOIH 3BCCD 1IFIA 1NU1G 3RL0g 3H1KD 2SPZA 2OYIC 3SSUA 1QGKB 1JY3P 1IO4A 3AE2C 1S5LE 5EFWB 3EQ2A 4EIJA 2BCCG 2YXRB 2Y0CA 4C7NA 1L0ND 3R2PA 2Q3IA 1OVVA 2YO3A 2ITAA 2ZFCA 3WUTA 3WUVA 3L35A 1VQLP 3MZWB 1ZN5A 2QA4P 2J5UA 1Z56A 5CHXA 3AEFC 1U7JA 5TJHA 2M5AB 2YKQA 3L70D 4UB6H 1LTAC 5GTHE 1SQPG 1ZRTE 1LT9B 1LWUC 2YMYA 1AFOA 2AXTE 2LXCB 2Z5IA 3H32B 1HVVA 2JR8A 3TYYA 3M91A 4HKZH 3W68A 3HUSA 1Q2NA 3U1AA 4H13D 1E5WA 1S3JA 3LW5H 3TGUG 5KLVG 2A06E 4WY4C 4PJ0E 4TT3H 3B8EB 2RH0A 3V4QA 3RL0C 3L73E 3H1JE 1GZLA 1YYCA 3CC7P 4H13B 2Y9YA 4IL6H 1SFCB 1KB9I 2ZYGA 2K3RA 1YI2P 1EDJA 4N3YB 3RK3C 3MGNA 3CWBJ 2MJZA 3NMDA 2P58A 3GLMA 5CCHC 3VMAA 3L4FA 3TSIA 2ZVOB 2Q7CA 2I1JA 4PD4H 1FBMA 1HJ0A 1NJIQ 3HD7C 1VQPP 3L73D 1FZFA 1YJNP 2ZAEB 4D6TG 3SWFA 2ZT9C 3TNUB 1BE3D 2CK3H 3A3YB 2QJKB 1BGYE 4H0LC 2UWJE 3Q3DA 3M0DC 3LW5J 5AW3B 3KQGA 3F5HA 3A0HE 5KJ7A 3HE4A 5APUA 1G1IA 1CI6B 1UIXA 2E74B 3FWLA 3USSA 2NZ2A 1VDFA 3V2PA 1LGHB 3JCUE 2N1TB 4UB8E 1DH3A 3H1HJ 2QM8A 3CWBE 2C0WA 2E75C 3A0BH 1E79H 3CCLP 4ZMDA 4K35A 1U7MA 1L0LE 3B5NC 2KS1B 4GDOA 3L74G 1GTWA 4UB6E 2M0BA 5KTBA 1Q81Q 1M1KQ 1NTKE 1BGYD 4ZKUA 4KJMA 3VTPC 4W80A 4OGQD 1SQQK 1T2KD 3S9OA 1MV8A 1WRGA 1W2BO 1MFZA 3CMEP 3BASA 1HGVA 3CLQA 3H1LG 3CXHD 3A2AA 1P84H 2Z5HA 1ZP0C 2PGDA 2PP6A 2WWWA 1PPJG 1YIJP 2IFMA 2OYOA
chains in the Genus database with same CATH topology
3M9HA 3OAKA 1RE3C 1KILC 5AW7B 4AYCA 5BU5A 2OYHA 1SQPK 3P7KA 2P67A 2H8PD 5AW5B 1J1DB 1XTGB 1L4AD 1NKNA 1W2EA 3OA7A 1URQB 2OYHB 1RE3A 1KILA 4N78E 1N7SB 2NPSA 3VMXA 1GK6A 5AVWB 1L4AC 1KILB 1DEBA 1M7LA 2H7HA 2WTYA 1NWQA 2NPSB 1SLQA 1FJKA 1SVFA 5CJ0A 5APTA 4ZKPA 2M3BA 3CL3D 1JUNA 2POHA 2N1TD 1IFMA 5KLVK 3N4XA 5BVZA 1L4AA 5CCGD 3HTKA 1FZCC 1JMMA 2WT7A 2WPRA 3HE5A 5AW9B 3MD0A 3A7OA 2N1TC 1NAFA 1NHLA 5APXA 1L4AB 3GHGC 1GW3A 1LTSC 3HTKB 1JOCA 3NTNA 1LTJB 5CCGC 2WT7B 1FZCA 2A45H 3PP5A 4GT1A 1HBWA 3IR9A 1GU5A 3GHGA 1FZCB 1OWAA 2LKMA 5CCGA 3M06A 4JF7A 1NTMK 3GHGB 1S9KE 4M3LA 5APYA 4N78D 1JNMA 2CPSA 3M0AA 4N6JA 2IFNA 1YTZT 2Z4EA 3LIEA 4GKGA 1LTBC 2FXMA 1M1JC 2XDJA 3H6PA 1CW5A 3U59A 1X79B 2QM7A 1YTZI 1HUCA 2WSCH 2C9LY 4I2LC 4KHXA 1NU1K 1JY3O 1FZBA 2XZRA 2FFDA 1DX7A 1T3JA 1WT6A 5AVUB 1IJDB 1LWUA 2KB7P 1J1EC 3KDPB 1M1JA 5AVYB 5AW0B 3NFQA 3HRNA 1IFDA 2FFDB 3VOPA 2W27A 1G1JA 1LWUB 1M1JB 2HG5D 4WB4A 1G2CA 3NXSA 4JYCA 1IFNA 1CZQA 1OXZA 3MIWA 2O01H 3O8ZA 1URQD 4HYTB 4O9BA 1N7SD 1G2CB 2KOGA 1J1EB 2KP8A 4C46A 3LIDA 2YKPA 3BATA 3BRVB 1N2DC 1T3UA 1KILD 1URQC 2R5DA 2CPBA 3M9QA 2NPSD 1N7SC 1A02J 1SQXK 1L0LK 2W6BA 2GM4A 1NH4A 2XU6A 1JCDA 3MUDA 3II6A 1URQA 2NPSC 2YKOA 1XTCC 1N7SA 4W7YA 1NTKK 2R32A 3RL0B 2KYVA 5AVRB 2IPPA 3WMM0 5AVVB 3T97A 3TK1A 5BU8B 2XKMA 2IX7C 2FKWB 4WBAA 1LTJC 1KZUB 1JO5A 1IFIA 3VMYA 1FZAA 1LTGC 2OYIC 4RESB 1JY3P 3N7NA 1IO4A 1IC2A 3M9BA 3P32A 4B86A 1ZV8A 3V4WA 1ZR4A 2HODA 1LTJA 3EQ2A 4EIJA 1X9VA 2YO2A 1JY2P 1N7LA 2OYIA 1FOSE 4C7NA 2GUSA 1EQ7A 2HODB 4IFFA 3R2PA 5AW8B 1PFIA 2Q3IA 1FAVA 2VRSA 1LTTC 2YO3A 3UIAA 1KFMA 1RF1B 2A45G 1KQLA 1LTIC 2OYIB 2ZFCA 3HD7A 4C7NB 2WPQA 4I1LA 1HGZA 3L35A 3P8CE 4EOTA 1ZN5A 2XV5A 3RK2B 2HFED 1Z56A 2PAJA 3HD7B 1GDTA 5CHXA 3VP8A 1H88A 1N86A 2YKQA 1GU4A 1AQ5A 1LTAC 2YNYA 4DZOA 2FFDC 3OJAB 1LT9B 1LWUC 2O1KA 5AW4B 2N9BA 2J59M 2YMYA 3I5CA 1N73B 2I1KA 1AFOA 2Z5IA 5AVZB 1QL1A 1HVVA 2W6AA 3H32B 3C9IA 3TYYA 4IFDK 1JY2N 3M91A 2WITA 5APQA 1RE4C 3V5BA 1FJPA 5AVSB 3V2RA 3HUSA 1NTZK 3U1AA 1E5WA 4LLHA 1FDMA 3LW5H 3RL0D 3L36A 1ZR2A 1RE4A 2P1JA 2R3CA 3HUSB 3SWYA 3CI9A 4WY4C 1NKZB 2Q9IA 3B8EB 3P8CD 1GW4A 3V4QA 4C7RA 5AVTB 3RL0C 2J58A 1H8AA 3B5NA 3P8MC 2P2UA 2HPCA 4XE5B 1HWTC 4WY4A 1X8YA 3L37A 1HJBA 1GZLA 1S9KD 2Q5UA 1YYCA 3B5NB 1KFNA 2ZXEB 2HPCB 2HYNA 4WY4B 1SFCA 1IK9A 1RF0A 5AW2B 1T2KC 1GL2C 2M8RA 1SFCB 1HH0A 1GK4A 5AVXB 1T8ZA 1VPCA 1H89A 1FZGA 4N3YB 3RK3C 2JEEA 5CCHD 3MGNA 4W7ZA 1GL2A 1SQBK 2MJZA 3NMDA 3V2NA 1J2JB 1RF1C 5CCHC 3RK2D 1GL2B 3HD7D 2OARA 3IFMA 2WPSA 3L4FA 5APVA 3TSIA 2Q7CA 1L0NK 2I1JA 1GD2E 4JYBA 5AW6B 3RK3B 1FBMA 3TNUA 1SP4A 3RK2C 3HD7C 5CCHA 1RF1A 2BASA 4OH8B 1FZFA 3VP9A 3E1IA 3SWFA 3TNUB 4LC1A 1JTHA 5KJ7D 3A3YB 1LT9C 1MZ9A 2O1JA 5AVQB 1QL2A 3KYQA 1SQVK 1N73C 3M0DC 2L5GB 1JTHB 5AW3B 5KJ7C 3V2QA 4AUWA 3VYIA 2H43A 3KQGA 1JCCA 1CI6A 1LT9A 1NOHA 2KSJA 2JJLA 1N73A 1FU1A 3HE5B 3M0DA 2C0XA 3HE4A 2HLOA 3VN0A 5KJ7A 5APUA 1G1IA 3H32A 4GIFA 1CI6B 2N1TA 1JY3N 2FYUK 1CSBA 2FYZA 3HUSC 1VDFA 3V2PA 3HE4B 1LGHB 2N1TB 1RY3A 1DH3A 3B5ND 2QM8A 5APWA 2C0WA 4WY4D 2GUVA 2WZ7A 3G3ZA 2XNXA 5CMZA 3A5TA 1IFJA 2A45I 3B5NC 1GTWA 1SFCD 5KTBA 3BRTB 2E43A 2WSEH 4IFMA 4HH2A 1FOSF 4ZKUA 1HTLC 5AW1B 3VMZA 3VTPC 1SFCC 1NO4A 1JY2O 4XA4A 1RF0C 4W80A 1SQQK 1T2KD 3BVHA 1MV8A 2C9NY 1GL2D 2R5BA 4LGDE 4Y99C 3KPEA 1WRGA 3MTUE 5APSA 4I6MC 1MFZA 5CJ4A 3BASA 1HGVA 3CLQA 3RK3D 3A2AA 3EFGA 1J1DC 2Z5HA 3U1CA 2KLVA 2OYHC 1A02F 2PP6A 2WWWA 2E42A 4DOJA 1FZEA 1MUUA 2WSFH 2IFMA 4Y99B 4AQRD 2P7JA 1ZLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HG5 D;  1KIL C;  1JTH A;  5KJ7 D;  2YMY A;  1URQ D;  2H8P D;  1N7S D;  2KOG A;  3KYQ A;  1XTG B;  1HVV A;  1L4A D;  1JTH B;  3M0D C;  1URQ B;  4N78 E;  1KIL A;  5KJ7 C;  1N7S B;  2NPS A;  1KIL D;  1URQ C;  2NPS D;  1N7S C;  1L4A C;  1KIL B;  2NPS B;  5KJ7 A;  3RL0 D;  2N1T A;  1URQ A;  2NPS C;  4WY4 C;  2N1T D;  1N7S A;  4W7Y A;  3RL0 B;  1L4A A;  5CCG D;  2N1T B;  3RL0 C;  3B5N A;  2N1T C;  3B5N D;  1NHL A;  4WY4 A;  1L4A B;  3HTK B;  5CCG C;  4WY4 D;  2WZ7 A;  3B5N B;  3PP5 A;  4WY4 B;  1SFC A;  3B5N C;  1SFC D;  5CCG A;  1GL2 C;  2M8R A;  1SFC B;  4JF7 A;  1SFC C;  3RK3 C;  5CCH D;  4W7Z A;  4W80 A;  1GL2 A;  1GL2 D;  4LGD E;  2XDJ A;  3HD7 A;  3P8C E;  3RK2 D;  5CCH C;  1GL2 B;  3HD7 D;  3RK3 D;  3TSI A;  3RK2 B;  2HFE D;  1T3J A;  3HD7 B;  3RK3 B;  2PP6 A;  3RK2 C;  3HD7 C;  5CCH A;  4OH8 B;  3VOP A; 
#chains in the Genus database with same CATH topology
 1SQQ J;  3M9H A;  5AW7 B;  1KIL C;  5BU5 A;  3CCS P;  3S4R A;  3I56 P;  2KNC B;  5AW5 B;  1J1D B;  2LR2 A;  1RE3 A;  1N7S B;  2NPS A;  3L75 G;  2K1A A;  4IL6 E;  1NWQ A;  5CJ0 A;  1KD1 Q;  2QJP B;  2M3B A;  3H1I E;  2POH A;  1R5S A;  1VF5 D;  3N4X A;  1L4A A;  5CCG D;  3HTK A;  1FZC C;  2QE7 H;  2KI7 B;  2WPR A;  2B89 A;  5APX A;  4PD4 E;  4BRY A;  3GHG A;  1PP9 D;  2LKM A;  2AEJ A;  1NTM K;  1VF5 B;  1S9K E;  4M3L A;  1M57 D;  5APY A;  2CPS A;  1HF9 A;  2IFN A;  2Z4E A;  4L73 A;  3LIE A;  4GKG A;  2FXM A;  4OWF A;  1SQX E;  3U59 A;  1HUC A;  2C9L Y;  1KQS O;  1NU1 K;  2FYU J;  1FZB A;  3H1I D;  1T3J A;  5AVU B;  1M1J A;  1QVF O;  3HRN A;  3H25 A;  1K04 A;  1IFD A;  1LWU B;  5B5E E;  1IFN A;  2KUB A;  1S4X A;  3AE5 C;  1J1E B;  1NU1 J;  2KP8 A;  3BAT A;  5CBO A;  3BRV B;  1N2D C;  1URQ C;  2R5D A;  2CPB A;  2NPS D;  1A02 J;  2BCC J;  3II6 A;  3L72 G;  1SQX D;  2KYV A;  2WQY C;  3RL0 B;  5TIS H;  3T97 A;  1SQV E;  4L74 A;  5BU8 B;  2N9Y B;  3AE1 C;  2MKV A;  2D2C B;  2Y0D A;  3E7K A;  1YQ3 C;  3KHU A;  1RH5 B;  4WBA A;  1BSH A;  2IBZ D;  1SQP J;  2FYU E;  3B71 A;  3P32 A;  1PV3 A;  3V4W A;  1ZR4 A;  1X9V A;  2YO2 A;  1N7L A;  3CCV P;  1FOS E;  5AW8 B;  1N8R Q;  1SS1 A;  2VRS A;  1LTT C;  3UIA A;  3L71 D;  2A45 G;  1KQL A;  2WPQ A;  3P8C E;  4EOT A;  1VQ4 P;  2M5A A;  3TGU J;  5KLV J;  2OGU A;  2JKV A;  1QLE D;  2PAJ A;  2O01 N;  3HD7 B;  1GDT A;  4PD4 I;  1H88 A;  1N86 A;  1GU4 A;  1SQV D;  2YNY A;  5AW4 B;  4H0L B;  2J59 M;  3IN6 A;  2I1K A;  5AVZ B;  2OTK E;  3C9I A;  4U3F E;  2E5T A;  5APQ A;  1FJP A;  3V2R A;  1QVG O;  3CC2 P;  1EZV G;  1NKZ B;  2Q9I A;  2KSE A;  3WUU A;  3P8C D;  1LJ2 A;  2E5Y A;  1FS0 E;  4C7R A;  2B87 A;  2P2U A;  1S1C X;  1VQ5 P;  2JWA A;  2Q5U A;  3B5N B;  1BCC G;  5KKZ C;  1YBK A;  1D7M A;  1SFC A;  4OGQ C;  2IYP A;  5AW2 B;  4D6T J;  1T2K C;  2M8R A;  1NTM G;  3FGA D;  5KLV E;  2FBW C;  1HH0 A;  1S5L X;  1PGQ A;  1LP1 B;  1FDI A;  1J2J B;  3ABV C;  1GL2 B;  4H44 B;  3WU2 H;  1SQB D;  3D6Z A;  2AEM A;  3TNU A;  1NTZ G;  3RK2 C;  1PGP A;  1RF1 A;  4YXW H;  1KQF B;  4OH8 B;  3VP9 A;  3E1I A;  5TIS E;  1KB9 D;  3OW2 O;  4LC1 A;  4QMA A;  2O1J A;  5AVQ B;  3KYQ A;  2HR3 A;  3L74 J;  5KJ7 C;  2QSI A;  4JQ0 D;  1KTM A;  1CI6 A;  3D71 A;  1N73 A;  2BEZ F;  1FU1 A;  3KZI E;  1RQV A;  2HLO A;  2N1T A;  1KYO H;  1JY3 N;  3EWK A;  3BCC G;  3H1K G;  3H1L J;  3I55 P;  5APW A;  2JWD A;  4I7Z C;  3RGU A;  2GUV A;  2WZ7 A;  2FYN B;  1OMI A;  2XNX A;  5CMZ A;  1K8A Q;  1IK7 A;  1L0N G;  1SFC D;  3Q1M A;  2E43 A;  2PRR A;  1FOS F;  1HTL C;  1NO4 A;  1RF0 C;  1EXI A;  3BVH A;  3L75 J;  4Y99 C;  3MTU E;  1OZH A;  3L70 G;  1DD3 A;  3JSV C;  1ZRT D;  5KAI E;  2ZJS E;  3SFE C;  1A02 F;  1MKM A;  2E42 A;  2OTL P;  3JC2 2;  1RE3 C;  4AYC A;  2FY8 A;  2W6J H;  4DCK A;  1VL2 A;  3P7K A;  2P67 A;  3FWN A;  2H8P D;  3QWO C;  2A06 D;  1PGJ A;  3OA7 A;  1URQ B;  2OYH B;  2YXQ B;  3H1L E;  3VMX A;  2E76 B;  5H2F E;  1GK6 A;  1L4A C;  1M7L A;  3H1J D;  2E74 D;  1SVF A;  3G6E P;  3CL3 D;  3D70 A;  1OX3 A;  2N1T D;  3AEE C;  2OQQ A;  3K5B A;  3HE5 A;  5AW9 B;  3MD0 A;  3A7O A;  1VQK P;  1NAF A;  1NHL A;  3GHG C;  4NPF X;  2YIU C;  1JOC A;  2XND H;  2A45 H;  3L75 E;  1AVO A;  1HBW A;  1KMI Z;  2RKL A;  5CCG A;  3M06 A;  2V4H A;  1VQ9 P;  3PH0 A;  2K9Y A;  2A06 G;  4TLF A;  4L76 A;  3IF4 A;  1LTB C;  1M1J C;  2XDJ A;  3H6P A;  4PV1 C;  4ASW A;  1X79 B;  3L73 G;  1YTZ I;  2WSC H;  3H1J G;  1AVY A;  1JY3 O;  1BE3 G;  3L72 J;  1WT6 A;  3AE4 C;  1LWU A;  1KYO E;  1BDC A;  1X0T A;  3Q5R A;  1G1J A;  3AE7 C;  2O01 H;  1KV4 A;  4O9B A;  2JDI H;  1N7S D;  1USD A;  2FXP A;  4BXL A;  2Q3E A;  1K73 Q;  2ZYD A;  4HB1 A;  3C8V A;  1SQX K;  4EYY Q;  5CBN A;  2W6B A;  1Q90 D;  4IL6 X;  1JCD A;  3CWB D;  3SWK A;  4DJG A;  1L0L D;  2XKM A;  1NTK D;  3H1H E;  2P10 A;  2O3J A;  2G3A A;  1BGY G;  2FKW B;  5C39 A;  2KXP B;  1KZU B;  1FZA A;  1YJ9 P;  1LTG C;  4Y28 J;  4RES B;  3N7N A;  1IC2 A;  4B86 A;  1LTJ A;  1IFP A;  1PL5 A;  5E79 H;  2WSC J;  1JY2 P;  2Y0E A;  3CMA P;  4XFJ A;  1EQ7 A;  2HOD B;  4IFF A;  2BEQ D;  1KFM A;  2OYI B;  3HD7 A;  4I1L A;  3V6I A;  3CX5 H;  3GF7 A;  3RK2 B;  2HFE D;  3VP8 A;  1W5C E;  2O01 J;  1L0L G;  1M8O B;  2Q6Q A;  2H88 C;  3RK3 E;  1SQQ E;  3PRJ A;  2FFD C;  3OJA B;  1NTK G;  2O1K A;  2N9B A;  1FDO A;  3I5C A;  1OIP A;  3PHL A;  2V7Q H;  2WSS H;  1BCC J;  2KZI A;  2W6A A;  3MHV A;  4GOF A;  1JY2 N;  2WIT A;  3PJS K;  4RO0 A;  3V5B A;  3RBX A;  3G9R A;  1NTM J;  1NTZ K;  1FDM A;  3RL0 D;  1X22 A;  3L36 A;  1ZR2 A;  1RE4 A;  3TF5 A;  2R3C A;  4PD4 D;  3SWY A;  1ZW0 A;  1KYO I;  4H13 C;  3A0B E;  1GW4 A;  3IAO A;  1H8A A;  2D2C D;  3B5N A;  1PP9 G;  3C1L A;  4XE5 B;  4U7J A;  1X8Y A;  1HJB A;  1S9K D;  1NTZ J;  2ZXE B;  2HPC B;  2HYN A;  4WY4 B;  1FC2 C;  1AQT A;  2IZ1 A;  1LP1 A;  1T6A A;  1T8Z A;  1VPC A;  1FZG A;  2JEE A;  5KLI C;  5CCH D;  4W7Z A;  3H1I G;  1OW7 A;  2B9B A;  1GL2 A;  1SQB K;  2OTJ P;  1P84 E;  3Q5S A;  1EDK A;  3V2N A;  1RF1 C;  3HD7 D;  5APV A;  2QJK C;  1BCC E;  1L0N K;  3RK3 B;  1SP4 A;  2V7Q J;  4K3A A;  3BCC J;  4H0L D;  3H1K J;  2RMZ A;  4GOE A;  1MZ9 A;  1QL2 A;  1RQU A;  1N73 C;  1JTH B;  5GTH H;  1NU1 E;  1L0N J;  1EDL A;  3V2Q A;  3KXD A;  4AUW A;  1SQX G;  2H43 A;  1JCC A;  1LT9 A;  1NOH A;  2KSJ A;  3CPW O;  2ZT9 B;  4L75 A;  2AXT H;  4R4L A;  3CCM P;  2BCC E;  3H32 A;  4GIF A;  1CSB A;  2FYZ A;  1KIL E;  4EDF A;  2W83 C;  3HUS C;  2E75 D;  3L70 J;  1JM0 A;  1EXJ A;  2IBZ G;  3CX5 E;  1KQG B;  1YIT P;  2FYU D;  3B5N D;  3FXD A;  3O6Q B;  4PJ0 H;  5DJU B;  1IFJ A;  2A45 I;  2KLU A;  3L71 G;  1SQP E;  3BRT B;  2WSE H;  3VMZ A;  5AW1 B;  1ZXG A;  1JY2 O;  2E75 B;  3BCC E;  4PV1 B;  3H1K E;  1EC5 A;  1GL2 D;  3D6Y A;  4H44 D;  3KPE A;  2Q1K A;  4DT0 A;  5CJ4 A;  5APS A;  1SQV G;  3W67 A;  4OVN F;  2QJY C;  1Y9B A;  1QX8 A;  3TGU E;  2GA1 A;  3EFG A;  1J1D C;  4WVZ A;  1JEK A;  2KLV A;  1OVU A;  4HJG H;  2WSF H;  4U3F D;  2RN0 A;  4AQR D;  2P7J A;  1ZLL A;  4JBZ A;  2AXC A;  3EFF K;  2OYH A;  2QJP C;  1EZV I;  3L70 E;  1W2E A;  1P84 I;  1SQP D;  1H0T B;  3T97 B;  1KC8 Q;  1NVO A;  1DEB A;  1BSN A;  1KIL B;  2WTY A;  2K9J B;  3GMA A;  1FJK A;  4ZKP A;  1JUN A;  3CCQ P;  1PZQ A;  4ASV A;  3ITK A;  1IFM A;  5BVZ A;  1KOR A;  2KK7 A;  3A0H H;  5K5G B;  3L73 J;  2QG4 A;  3CXH H;  3H1J J;  3TGU D;  1VF5 C;  1M56 D;  1GW3 A;  1BE3 J;  5KLV D;  5CCG C;  2WT7 B;  2WSE J;  3JCU H;  1TU3 F;  4JPZ B;  4GT1 A;  4U3F G;  2M3E A;  4UB8 H;  2ZVN B;  1GU5 A;  1FZC B;  1PIX A;  4D6T E;  4GOD A;  1U57 A;  4JF7 A;  1SQB G;  3CD6 P;  4YTP C;  2KS1 A;  1JNM A;  3CC4 P;  1S2E A;  2QM7 A;  2WSF J;  1BDD A;  1EDI A;  4I2L C;  4KHX A;  3CX5 I;  1DX7 A;  1IJD B;  1MFT A;  5B66 H;  3KDP B;  2KB7 P;  1J1E C;  3G4S P;  3NFQ A;  1VQ8 P;  2FFD B;  2QRX A;  1LT1 A;  3AE3 C;  3NXS A;  1VQ7 P;  1CZQ A;  1OXZ A;  2IDB A;  1BGY J;  1URQ D;  2K88 A;  1G2C B;  2R3S A;  2E76 D;  5GTI H;  3CCE P;  4D6T D;  3L74 E;  3AEA C;  1UII A;  1BE3 E;  2JP3 A;  1QEX A;  1Y47 A;  2B87 B;  1L0L K;  2D2C C;  2KNC A;  2GM4 A;  1NH4 A;  2XU6 A;  3MUD A;  2NPS C;  2YKO A;  1N7S A;  1NTK K;  2KIK A;  2AEF A;  3AED C;  5AVV B;  2IZ0 A;  2IX7 C;  1AJY A;  1LTJ C;  1L0L J;  4BWN A;  2Y9Z A;  1JO5 A;  3VMY A;  1PPJ E;  2QEX P;  3S1K A;  1NTK J;  3CCJ P;  1AV1 A;  3M9B A;  1ZV8 A;  1IZN B;  2HOD A;  5KLI B;  2OYI A;  3TDK A;  2GUS A;  3WU2 E;  3L74 D;  1PFI A;  1JB0 J;  1FAV A;  1RF1 B;  1LTI C;  2G8Y A;  4C7N B;  1HGZ A;  4WWI A;  2H89 C;  2XV5 A;  1AQ5 A;  3FXE A;  3H1L D;  3CCR P;  1PP9 J;  3CXH E;  4DZO A;  1L2P A;  1N73 B;  4CPG A;  1PPJ D;  1Q82 Q;  3Q2Y A;  1QL1 A;  1K9M Q;  4IFD K;  4NPD A;  5B5E H;  3GF3 A;  1RE4 C;  1LNQ A;  1OFC X;  5AVS B;  3RBZ A;  2JO1 A;  1YQ4 C;  3AEB C;  4LLH A;  3H1I J;  3QH9 A;  2P1J A;  3HUS B;  3AE9 C;  3CI9 A;  3L75 D;  5AVT B;  2J58 A;  3P8M C;  2HPC A;  1HWT C;  2WMM A;  4WY4 A;  3PTZ A;  3L37 A;  1USE A;  5B66 E;  1RHZ B;  1KFN A;  1NYH A;  1IK9 A;  1YHQ P;  1RF0 A;  3AE8 C;  3B4S A;  1GL2 C;  1NAY A;  4H44 C;  1GK4 A;  5AVX B;  1H89 A;  5L8R J;  3R4Y A;  5KAF H;  2L91 A;  5KKZ B;  1KYO D;  5GTI E;  1PP9 E;  1SQX J;  4OGQ B;  2QJY B;  2IYO A;  3RK2 D;  3SFD C;  2OAR A;  3IFM A;  2WPS A;  3G71 P;  1ZOY C;  1GD2 E;  4JYB A;  3L72 E;  5AW6 B;  5CCH A;  2BAS A;  1JTH A;  4RKU J;  5KJ7 D;  1LT9 C;  1SQV K;  2L5G B;  3CWB G;  1DD4 A;  1M90 Q;  3VYI A;  3L71 J;  2JJL A;  3HE5 B;  3M0D A;  2C0X A;  2W8Z A;  3H1H D;  3VN0 A;  1OW6 A;  2FYN C;  3ZDM A;  2FYU K;  1AA0 A;  4A7P A;  2W90 A;  3HE4 B;  3O6Q A;  4YPC A;  1SQV J;  1Q86 Q;  1RY3 A;  3GW6 A;  2YMK A;  5M1B A;  3CXH I;  4MN4 C;  3L72 D;  4WY4 D;  3F89 A;  1OW8 A;  3G3Z A;  3A5T A;  2R44 A;  1KB9 H;  4IFM A;  4HH2 A;  2B88 A;  1SFC C;  4I7Z B;  4XA4 A;  2IBZ E;  2C9N Y;  3AEC C;  2R5B A;  4LGD E;  3Q5P A;  4I6M C;  1KN7 A;  3E1R A;  3RK3 D;  1SQQ D;  3H1H G;  1K05 A;  3U1C A;  2OYH C;  2QVA A;  1EZV E;  4DOJ A;  1FZE A;  1MUU A;  3L71 E;  2E76 C;  4Y99 B;  3OAK A;  1S5L H;  2PFX A;  2I8D A;  1SQP K;  1DIP A;  1H0T A;  4U3F J;  1XTG B;  1L4A D;  1NKN A;  2FXO A;  4N78 E;  1KIL A;  2ZT9 D;  1R5L A;  2K9J A;  4NPE A;  4R4M A;  1Y8A A;  1NTM E;  5AVW B;  2H7H A;  2LXB A;  1R8E A;  2NPS B;  1SQB J;  1SLQ A;  2QIW A;  1VQM P;  3AEG C;  5APT A;  1WMK A;  5KAF E;  5KLV K;  2K37 A;  4KT0 J;  4RJT A;  1JMM A;  3KZI H;  2E74 C;  2WT7 A;  1SQQ G;  2N1T C;  2DW3 A;  1L4A B;  2KZJ A;  1LTS C;  3HTK B;  3NTN A;  1LTJ B;  1EZV D;  1FZC A;  1NTZ E;  3PP5 A;  3IR9 A;  5E79 E;  1P84 D;  2ZYA A;  1OWA A;  2NRG A;  4BRY B;  3GHG B;  2YIU B;  4PV1 D;  1BCC D;  1VQO P;  1JMB A;  4N78 D;  3PLN A;  1Q7Y Q;  2ZXX A;  3M0A A;  4N6J A;  1YTZ T;  4Z1M H;  1NTM D;  1CW5 A;  1S72 P;  1VQ6 P;  1DEE G;  4EI2 A;  2WPV B;  2XZR A;  2FFD A;  1VQN P;  5AVY B;  5AW0 B;  5KAI H;  4ZNC A;  1NU1 D;  3VOP A;  2W27 A;  1M1J B;  2HG5 D;  4WB4 A;  1G2C A;  4JYC A;  1SQB E;  3MIW A;  1OVR A;  1PGO A;  1YJW P;  3O8Z A;  4HYT B;  1NTZ D;  2KOG A;  2BCC D;  3GG2 A;  4C46 A;  3LID A;  2YKP A;  1L0N E;  1T3U A;  2IBZ I;  3MUD C;  1KIL D;  3M9Q A;  3FX0 A;  1KB9 E;  1N7S C;  1ZME C;  3CCU P;  3CX5 D;  1GMJ A;  2FYU G;  1URQ A;  1XTC C;  4YXD C;  4W7Y A;  2R32 A;  1FE6 A;  3MP7 B;  5H2F H;  5AVR B;  1NGM B;  5DJT B;  2IPP A;  3WMM 0;  3TK1 A;  2WVR A;  3AE6 C;  4IOI H;  3BCC D;  1IFI A;  1NU1 G;  3RL0 g;  3H1K D;  2SPZ A;  2OYI C;  3SSU A;  1QGK B;  1JY3 P;  1IO4 A;  3AE2 C;  1S5L E;  5EFW B;  3EQ2 A;  4EIJ A;  2BCC G;  2YXR B;  2Y0C A;  4C7N A;  1L0N D;  3R2P A;  2Q3I A;  1OVV A;  2YO3 A;  2ITA A;  2ZFC A;  3WUT A;  3WUV A;  3L35 A;  1VQL P;  3MZW B;  1ZN5 A;  2QA4 P;  2J5U A;  1Z56 A;  5CHX A;  3AEF C;  1U7J A;  5TJH A;  2M5A B;  2YKQ A;  3L70 D;  4UB6 H;  1LTA C;  5GTH E;  1SQP G;  1ZRT E;  1LT9 B;  1LWU C;  2YMY A;  1AFO A;  2AXT E;  2LXC B;  2Z5I A;  3H32 B;  1HVV A;  2JR8 A;  3TYY A;  3M91 A;  4HKZ H;  3W68 A;  3HUS A;  1Q2N A;  3U1A A;  4H13 D;  1E5W A;  1S3J A;  3LW5 H;  3TGU G;  5KLV G;  2A06 E;  4WY4 C;  4PJ0 E;  4TT3 H;  3B8E B;  2RH0 A;  3V4Q A;  3RL0 C;  3L73 E;  3H1J E;  1GZL A;  1YYC A;  3CC7 P;  4H13 B;  2Y9Y A;  4IL6 H;  1SFC B;  1KB9 I;  2ZYG A;  2K3R A;  1YI2 P;  1EDJ A;  4N3Y B;  3RK3 C;  3MGN A;  3CWB J;  2MJZ A;  3NMD A;  2P58 A;  3GLM A;  5CCH C;  3VMA A;  3L4F A;  3TSI A;  2ZVO B;  2Q7C A;  2I1J A;  4PD4 H;  1FBM A;  1HJ0 A;  1NJI Q;  3HD7 C;  1VQP P;  3L73 D;  1FZF A;  1YJN P;  2ZAE B;  4D6T G;  3SWF A;  2ZT9 C;  3TNU B;  1BE3 D;  2CK3 H;  3A3Y B;  2QJK B;  1BGY E;  4H0L C;  2UWJ E;  3Q3D A;  3M0D C;  3LW5 J;  5AW3 B;  3KQG A;  3F5H A;  3A0H E;  5KJ7 A;  3HE4 A;  5APU A;  1G1I A;  1CI6 B;  1UIX A;  2E74 B;  3FWL A;  3USS A;  2NZ2 A;  1VDF A;  3V2P A;  1LGH B;  3JCU E;  2N1T B;  4UB8 E;  1DH3 A;  3H1H J;  2QM8 A;  3CWB E;  2C0W A;  2E75 C;  3A0B H;  1E79 H;  3CCL P;  4ZMD A;  4K35 A;  1U7M A;  1L0L E;  3B5N C;  2KS1 B;  4GDO A;  3L74 G;  1GTW A;  4UB6 E;  2M0B A;  5KTB A;  1Q81 Q;  1M1K Q;  1NTK E;  1BGY D;  4ZKU A;  4KJM A;  3VTP C;  4W80 A;  4OGQ D;  1SQQ K;  1T2K D;  3S9O A;  1MV8 A;  1WRG A;  1W2B O;  1MFZ A;  3CME P;  3BAS A;  1HGV A;  3CLQ A;  3H1L G;  3CXH D;  3A2A A;  1P84 H;  2Z5H A;  1ZP0 C;  2PGD A;  2PP6 A;  2WWW A;  1PPJ G;  1YIJ P;  2IFM A;  2OYO A; 
#chains in the Genus database with same CATH homology
 3M9H A;  3OAK A;  1RE3 C;  1KIL C;  5AW7 B;  4AYC A;  5BU5 A;  2OYH A;  1SQP K;  3P7K A;  2P67 A;  2H8P D;  5AW5 B;  1J1D B;  1XTG B;  1L4A D;  1NKN A;  1W2E A;  3OA7 A;  1URQ B;  2OYH B;  1RE3 A;  1KIL A;  4N78 E;  1N7S B;  2NPS A;  3VMX A;  1GK6 A;  5AVW B;  1L4A C;  1KIL B;  1DEB A;  1M7L A;  2H7H A;  2WTY A;  1NWQ A;  2NPS B;  1SLQ A;  1FJK A;  1SVF A;  5CJ0 A;  5APT A;  4ZKP A;  2M3B A;  3CL3 D;  1JUN A;  2POH A;  2N1T D;  1IFM A;  5KLV K;  3N4X A;  5BVZ A;  1L4A A;  5CCG D;  3HTK A;  1FZC C;  1JMM A;  2WT7 A;  2WPR A;  3HE5 A;  5AW9 B;  3MD0 A;  3A7O A;  2N1T C;  1NAF A;  1NHL A;  5APX A;  1L4A B;  3GHG C;  1GW3 A;  1LTS C;  3HTK B;  1JOC A;  3NTN A;  1LTJ B;  5CCG C;  2WT7 B;  1FZC A;  2A45 H;  3PP5 A;  4GT1 A;  1HBW A;  3IR9 A;  1GU5 A;  3GHG A;  1FZC B;  1OWA A;  2LKM A;  5CCG A;  3M06 A;  4JF7 A;  1NTM K;  3GHG B;  1S9K E;  4M3L A;  5APY A;  4N78 D;  1JNM A;  2CPS A;  3M0A A;  4N6J A;  2IFN A;  1YTZ T;  2Z4E A;  3LIE A;  4GKG A;  1LTB C;  2FXM A;  1M1J C;  2XDJ A;  3H6P A;  1CW5 A;  3U59 A;  1X79 B;  2QM7 A;  1YTZ I;  1HUC A;  2WSC H;  2C9L Y;  4I2L C;  4KHX A;  1NU1 K;  1JY3 O;  1FZB A;  2XZR A;  2FFD A;  1DX7 A;  1T3J A;  1WT6 A;  5AVU B;  1IJD B;  1LWU A;  2KB7 P;  1J1E C;  3KDP B;  1M1J A;  5AVY B;  5AW0 B;  3NFQ A;  3HRN A;  1IFD A;  2FFD B;  3VOP A;  2W27 A;  1G1J A;  1LWU B;  1M1J B;  2HG5 D;  4WB4 A;  1G2C A;  3NXS A;  4JYC A;  1IFN A;  1CZQ A;  1OXZ A;  3MIW A;  2O01 H;  3O8Z A;  1URQ D;  4HYT B;  4O9B A;  1N7S D;  1G2C B;  2KOG A;  1J1E B;  2KP8 A;  4C46 A;  3LID A;  2YKP A;  3BAT A;  3BRV B;  1N2D C;  1T3U A;  1KIL D;  1URQ C;  2R5D A;  2CPB A;  3M9Q A;  2NPS D;  1N7S C;  1A02 J;  1SQX K;  1L0L K;  2W6B A;  2GM4 A;  1NH4 A;  2XU6 A;  1JCD A;  3MUD A;  3II6 A;  1URQ A;  2NPS C;  2YKO A;  1XTC C;  1N7S A;  4W7Y A;  1NTK K;  2R32 A;  3RL0 B;  2KYV A;  5AVR B;  2IPP A;  3WMM 0;  5AVV B;  3T97 A;  3TK1 A;  5BU8 B;  2XKM A;  2IX7 C;  2FKW B;  4WBA A;  1LTJ C;  1KZU B;  1JO5 A;  1IFI A;  3VMY A;  1FZA A;  1LTG C;  2OYI C;  4RES B;  1JY3 P;  3N7N A;  1IO4 A;  1IC2 A;  3M9B A;  3P32 A;  4B86 A;  1ZV8 A;  3V4W A;  1ZR4 A;  2HOD A;  1LTJ A;  3EQ2 A;  4EIJ A;  1X9V A;  2YO2 A;  1JY2 P;  1N7L A;  2OYI A;  1FOS E;  4C7N A;  2GUS A;  1EQ7 A;  2HOD B;  4IFF A;  3R2P A;  5AW8 B;  1PFI A;  2Q3I A;  1FAV A;  2VRS A;  1LTT C;  2YO3 A;  3UIA A;  1KFM A;  1RF1 B;  2A45 G;  1KQL A;  1LTI C;  2OYI B;  2ZFC A;  3HD7 A;  4C7N B;  2WPQ A;  4I1L A;  1HGZ A;  3L35 A;  3P8C E;  4EOT A;  1ZN5 A;  2XV5 A;  3RK2 B;  2HFE D;  1Z56 A;  2PAJ A;  3HD7 B;  1GDT A;  5CHX A;  3VP8 A;  1H88 A;  1N86 A;  2YKQ A;  1GU4 A;  1AQ5 A;  1LTA C;  2YNY A;  4DZO A;  2FFD C;  3OJA B;  1LT9 B;  1LWU C;  2O1K A;  5AW4 B;  2N9B A;  2J59 M;  2YMY A;  3I5C A;  1N73 B;  2I1K A;  1AFO A;  2Z5I A;  5AVZ B;  1QL1 A;  1HVV A;  2W6A A;  3H32 B;  3C9I A;  3TYY A;  4IFD K;  1JY2 N;  3M91 A;  2WIT A;  5APQ A;  1RE4 C;  3V5B A;  1FJP A;  5AVS B;  3V2R A;  3HUS A;  1NTZ K;  3U1A A;  1E5W A;  4LLH A;  1FDM A;  3LW5 H;  3RL0 D;  3L36 A;  1ZR2 A;  1RE4 A;  2P1J A;  2R3C A;  3HUS B;  3SWY A;  3CI9 A;  4WY4 C;  1NKZ B;  2Q9I A;  3B8E B;  3P8C D;  1GW4 A;  3V4Q A;  4C7R A;  5AVT B;  3RL0 C;  2J58 A;  1H8A A;  3B5N A;  3P8M C;  2P2U A;  2HPC A;  4XE5 B;  1HWT C;  4WY4 A;  1X8Y A;  3L37 A;  1HJB A;  1GZL A;  1S9K D;  2Q5U A;  1YYC A;  3B5N B;  1KFN A;  2ZXE B;  2HPC B;  2HYN A;  4WY4 B;  1SFC A;  1IK9 A;  1RF0 A;  5AW2 B;  1T2K C;  1GL2 C;  2M8R A;  1SFC B;  1HH0 A;  1GK4 A;  5AVX B;  1T8Z A;  1VPC A;  1H89 A;  1FZG A;  4N3Y B;  3RK3 C;  2JEE A;  5CCH D;  3MGN A;  4W7Z A;  1GL2 A;  1SQB K;  2MJZ A;  3NMD A;  3V2N A;  1J2J B;  1RF1 C;  5CCH C;  3RK2 D;  1GL2 B;  3HD7 D;  2OAR A;  3IFM A;  2WPS A;  3L4F A;  5APV A;  3TSI A;  2Q7C A;  1L0N K;  2I1J A;  1GD2 E;  4JYB A;  5AW6 B;  3RK3 B;  1FBM A;  3TNU A;  1SP4 A;  3RK2 C;  3HD7 C;  5CCH A;  1RF1 A;  2BAS A;  4OH8 B;  1FZF A;  3VP9 A;  3E1I A;  3SWF A;  3TNU B;  4LC1 A;  1JTH A;  5KJ7 D;  3A3Y B;  1LT9 C;  1MZ9 A;  2O1J A;  5AVQ B;  1QL2 A;  3KYQ A;  1SQV K;  1N73 C;  3M0D C;  2L5G B;  1JTH B;  5AW3 B;  5KJ7 C;  3V2Q A;  4AUW A;  3VYI A;  2H43 A;  3KQG A;  1JCC A;  1CI6 A;  1LT9 A;  1NOH A;  2KSJ A;  2JJL A;  1N73 A;  1FU1 A;  3HE5 B;  3M0D A;  2C0X A;  3HE4 A;  2HLO A;  3VN0 A;  5KJ7 A;  5APU A;  1G1I A;  3H32 A;  4GIF A;  1CI6 B;  2N1T A;  1JY3 N;  2FYU K;  1CSB A;  2FYZ A;  3HUS C;  1VDF A;  3V2P A;  3HE4 B;  1LGH B;  2N1T B;  1RY3 A;  1DH3 A;  3B5N D;  2QM8 A;  5APW A;  2C0W A;  4WY4 D;  2GUV A;  2WZ7 A;  3G3Z A;  2XNX A;  5CMZ A;  3A5T A;  1IFJ A;  2A45 I;  3B5N C;  1GTW A;  1SFC D;  5KTB A;  3BRT B;  2E43 A;  2WSE H;  4IFM A;  4HH2 A;  1FOS F;  4ZKU A;  1HTL C;  5AW1 B;  3VMZ A;  3VTP C;  1SFC C;  1NO4 A;  1JY2 O;  4XA4 A;  1RF0 C;  4W80 A;  1SQQ K;  1T2K D;  3BVH A;  1MV8 A;  2C9N Y;  1GL2 D;  2R5B A;  4LGD E;  4Y99 C;  3KPE A;  1WRG A;  3MTU E;  5APS A;  4I6M C;  1MFZ A;  5CJ4 A;  3BAS A;  1HGV A;  3CLQ A;  3RK3 D;  3A2A A;  3EFG A;  1J1D C;  2Z5H A;  3U1C A;  2KLV A;  2OYH C;  1A02 F;  2PP6 A;  2WWW A;  2E42 A;  4DOJ A;  1FZE A;  1MUU A;  2WSF H;  2IFM A;  4Y99 B;  4AQR D;  2P7J A;  1ZLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...