2NPSA

Crystal structure of the early endosomal snare complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
63
structure length
63
Chain Sequence
RNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vesicle-associated membrane protein 4
publication title Early endosomal SNAREs form a structurally conserved SNARE complex and fuse liposomes with multiple topologies
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 28
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2006-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2npsA00
3RK2D 3PP5A 4WY4D 5CCGD 3RK2C 3HD7A 4WY4C 5CCGC 3RK3D 1JTHA 3HD7B 1JTHB 5KJ7D 5KJ7C 3M0DC 2WZ7A 2NPSC 4WY4A 5CCGA 2HG5D 5CCHD 2N1TD 5CCHC 3KYQA 3B5NB 5KJ7A 2N1TC 1URQA 3P8CE 2NPSA 1URQB 1N7SD 4W80A 2NPSB 5CCHA 4OH8B 1GL2D 1KILD 2N1TA 1GL2C 3RK3C 1SFCD 4N78E 1SFCC 2KOGA 1T3JA 3RK2B 1L4AD 1HVVA 4WY4B 3RK3B 4W7ZA 2M8RA 4JF7A 1XTGB 4W7YA 1N7SC 3RL0D 3RL0C 4LGDE 2N1TB 1KILC 1N7SA 3HD7D 1N7SB 1GL2A 1KILA 1L4AC 3VOPA 1GL2B 3HTKB 1KILB 1SFCA 2H8PD 1SFCB 3TSIA 2XDJA 3B5ND 1L4AA 1NHLA 2HFED 3B5NC 1URQD 1L4AB 2PP6A 2NPSD 1URQC 2YMYA 3B5NA 3HD7C 3RL0B
chains in the Genus database with same CATH superfamily
5KLVJ 3ITKA 2P67A 2OYHA 3VMAA 1CI6A 2OQQA 4C7NB 3SWKA 1AQ5A 3GMAA 2QJKB 2KXPB 1NTZG 2WSCJ 2N9BA 3L70G 1URQB 3CC7P 1FZGA 3BATA 2JJLA 1MUUA 3AEBC 1CI6B 1SFCD 3AECC 1NJIQ 3HE5A 4IL6X 3JSVC 1Y8AA 3L72D 1RF0C 2AEJA 1T3JA 1GDTA 5AVYB 2P10A 4H0LC 1NU1J 2FFDB 1VQ6P 3KHUA 2M3EA 1LNQA 3PHLA 1FDIA 4DT0A 3G3ZA 2IZ0A 3CX5E 1OIPA 4RJTA 2IBZE 2IDBA 3HE5B 2ZXXA 5AVVB 3KZIH 1SQPK 1J1EC 1GL2B 2CPSA 2XU6A 3C1LA 1BE3E 1EZVE 4K3AA 1PP9J 3CXHD 2WSSH 3AEGC 1KN7A 4NPDA 1JY3O 3Q3DA 3A2AA 1FOSE 3B5NA 1LJ2A 4L74A 2WTYA 3HD7A 2WPQA 2P58A 4EYYQ 2KZJA 2LXBA 1SQQE 4UB6E 2NPSC 4JBZA 3RGUA 3B5NB 3BASA 1K73Q 3BRTB 3FXDA 2QEXP 1OW8A 2GUSA 1ZMEC 2N1TA 3RBXA 1ZP0C 4H13D 3JCUE 1SFCC 2WQYC 1RHZB 2KOGA 3RK2B 3WUUA 3P32A 4HH2A 2FXMA 2KSEA 4PV1B 4EDFA 1L2PA 1RF1C 5APVA 1W2EA 1RE4C 4W7YA 1LTJC 4RKUJ 1NTMD 3RL0D 1FZCA 2N1TB 1SQPJ 2HLOA 1NTME 3HD7D 1IFNA 3OW2O 2OYHC 4IOIH 1FE6A 1W5CE 5TISH 1KILB 3KXDA 2KZIA 1UIXA 2W6AA 1N86A 2J58A 2YMYA 3L74D 1SQBD 3H1JJ 4BXLA 2XNXA 2OYIA 3CWBG 1KQGB 1IFPA 5KAFE 2KI7B 1SLQA 2QJYC 3L74E 3TGUG 4U7JA 1M1JC 1N7LA 1YTZT 3MTUE 3TK1A 1H8AA 3HE4B 4C7RA 1L0LG 1QL1A 4XE5B 1HBWA 4D6TG 3I56P 2ZYGA 3AE3C 2OTJP 1KYOI 2ZAEB 2GUVA 3V2QA 4N78E 4PD4H 3AE4C 1P84I 4Y28J 1L0NJ 4JYBA 1BGYG 3F5HA 3CXHH 4I7ZC 3EFGA 1KC8Q 2FXOA 3A7OA 3NFQA 2B9BA 1SQXG 2KB7P 3RL0C 2K88A 2WT7B 1VDFA 2RMZA 2O01H 1DD4A 3Q5PA 4JQ0D 1EDIA 3VOPA 3G6EP 1JCDA 2FYUG 2H8PD 4KT0J 1S5LH 3WU2E 1JY2O 3CMAP 1HGVA 2PP6A 2JEEA 1MFZA 2MJZA 3H1LE 1KORA 3AE5C 4HJGH 5B5EE 3JC22 1IFIA 2H88C 2AXCA 3W68A 1RQVA 2G8YA 3M0AA 1NTKG 3FX0A 1NTZJ 5KLVD 1SVFA 1IFJA 4OVNF 2PRRA 1AQTA 1VQMP 3CCQP 4B86A 3MUDC 3NMDA 1HWTC 1GZLA 1VL2A 5CCHA 1KYOD 5CBNA 2IPPA 4NPFX 1T8ZA 2FYNC 2ZT9D 2KSJA 2IYPA 2SPZA 5AW1B 3M91A 4JF7A 3PLNA 1JMMA 5CJ4A 1NU1D 1GU5A 4GOEA 1JY3N 1OVUA 4XA4A 4LLHA 2OYIC 2Y9ZA 1KTMA 1N7SB 1NWQA 1JUNA 3K5BA 1SQVG 2YIUC 1PFIA 3AEDC 4GIFA 2BCCG 2CK3H 3GHGA 3B8EB 3L37A 3VYIA 1K8AQ 1GU4A 2Q3IA 3TNUB 2R44A 1RQUA 3L35A 1QVFO 1ZR4A 2V4HA 1PP9D 1KB9I 2E75D 2KNCB 5DJUB 2QG4A 2OGUA 2JP3A 3RK3D 3EFFK 1PP9E 4H44D 3BCCG 1JTHB 3O6QA 1QEXA 1EXJA 1FS0E 2O01N 4GODA 4IL6H 5KJ7A 4GOFA 3BRVB 3T97A 3U1AA 1ZR2A 2Q1KA 2B89A 3KPEA 1YJWP 3BVHA 1RE3A 3L75G 1K9MQ 3H1HE 1IJDB 3L73E 2YKPA 2XKMA 3PRJA 4N6JA 1BDDA 3HTKA 3LW5J 1IO4A 3KZIE 3OJAB 5CHXA 3T97B 2W90A 2BEQD 3FWLA 3QWOC 2KUBA 1VF5C 3A0BH 3PTZA 1WMKA 1YQ4C 1NAFA 1T6AA 4WWIA 1X0TA 5H2FE 1U7MA 3HTKB 2H89C 1SQPD 3VTPC 4R4LA 1DH3A 1YITP 1LWUC 2FY8A 1GW3A 2W8ZA 1OZHA 1FDOA 1SQPE 2WSEH 3R4YA 1Q86Q 3H1IJ 2WSCH 1KYOH 2K9JA 5KTBA 5GTHE 1P84H 3CWBJ 4WVZA 5BU5A 2E75C 3Q5RA 3TGUJ 4DOJA 4PJ0H 4PD4I 3H1JD 1T2KD 3SFDC 4UB8E 2A06E 2IBZG 1PGOA 2K9JB 2Q7CA 4NPEA 2DW3A 1VQOP 1URQA 1E5WA 3CPWO 1TU3F 4D6TJ 2NPSB 1VQNP 2E76C 2RN0A 1BE3G 1EZVG 2QM7A 4OGQB 2E74C 2J5UA 5KKZC 1OX3A 1BGYJ 2WSEJ 2XNDH 1M1KQ 2FFDA 1FZFA 4AQRD 2W27A 3P7KA 2M8RA 5AW8B 1JY2N 1OXZA 3GLMA 2A45G 2JKVA 1LTTC 1SQQG 1SS1A 5E79H 5APUA 1LTJB 3N7NA 5AW6B 3VN0A 2V7QJ 1PGJA 1G2CA 1GL2A 3S1KA 4WB4A 1L4AC 3RL0g 1VPCA 1KFMA 2ZYAA 3A0HH 3L72E 4DZOA 2KLUA 5C39A 1URQD 2K1AA 2O3JA 2QVAA 1H88A 3HUSC 2RKLA 4WBAA 5EFWB 5APSA 1G2CB 2I1KA 3G4SP 1KMIZ 2FYZA 4PD4D 2O1JA 2K3RA 1NTKJ 1R5LA 4ASWA 4KHXA 1T2KC 1AFOA 4WY4A 5CCGA 3E7KA 2QJYB 1NTMG 1M1JB 2WMMA 4RESB 3V5BA 4CPGA 5K5GB 3KYQA 3CXHE 1VQ9P 1VQPP 3L71J 1NTZD 5KLIB 3KQGA 3USSA 1GL2D 2ZVOB 1HTLC 1X9VA 3D71A 1LP1A 2I8DA 3CCSP 1HVVA 4WY4B 2QJPC 2YMKA 4L73A 4AYCA 3AE1C 3B4SA 1YQ3C 4GDOA 1KB9H 2JWDA 3TDKA 1S5LE 3L74G 1GTWA 1GK4A 3EQ2A 4TLFA 3W67A 5AW9B 1LP1B 3AE2C 1SQVJ 1KILA 1J2JB 2QJKC 3Q2YA 2BCCJ 2OTLP 1E79H 1FZAA 2M5AA 1L0NK 5KAIH 3B5ND 1W2BO 5AW3B 1IK9A 5DJTB 1URQC 4Z1MH 1HUCA 1PL5A 1PZQA 1A02F 3CL3D 1JEKA 3RK2D 2Q6QA 2M5AB 2WSFH 4PV1D 1HF9A 3BCCJ 2IFNA 1Q7YQ 3V2RA 3Q5SA 3HE4A 2N1TD 1LTBC 1ZW0A 2MKVA 5AVRB 2POHA 4M3LA 1CZQA 1ZLLA 3L75J 4OH8B 1SQBE 1KILD 2PAJA 1ZV8A 3CC2P 1GL2C 2YKQA 5L8RJ 3H1LG 1KV4A 3QH9A 4I2LC 1NTZK 1XTCC 1BCCJ 1J1DB 2D2CB 2WT7A 1OMIA 2WSFJ 1WRGA 2Y0EA 2KLVA 1LT1A 4H13C 2QA4P 3MP7B 1ZRTD 1ZN5A 2WPRA 1UIIA 3ZDMA 2Z4EA 2G3AA 1LT9A 1OVVA 3B5NC 3TF5A 2YIUB 3CCEP 2WPSA 4BWNA 1Z56A 3WUVA 2GA1A 4U3FJ 3HD7C 4IL6E 3CCJP 1KQLA 2W6BA 3H1KD 3H1ID 1EDKA 2P2UA 2A45H 3RK2C 5AW7B 4A7PA 3CCUP 2N9YB 4UB6H 4PV1C 1LT9B 3H1KE 2IX7C 3CWBD 1YBKA 1JO5A 1AV1A 3TGUD 2LXCB 2ITAA 4DJGA 1JY3P 3IN6A 2J59M 2N1TC 3M0DA 2AXTE 1X8YA 1BE3J 1K05A 3JCUH 3CMEP 3M9QA 5APXA 1FAVA 3OAKA 1WT6A 4Y99B 4D6TD 1FU1A 1NO4A 1DEEG 3A0BE 3L70J 1FZCC 3MD0A 1IFMA 3H32B 1NAYA 5KLVE 5BVZA 1BGYD 1PIXA 3PJSK 1FZEA 2PGDA 1N73A 1PP9G 4LGDE 1S9KD 1SQQJ 1P84D 3SWFA 1N7SA 4RO0A 1ZOYC 1D7MA 1KYOE 2WVRA 2Z5IA 1YHQP 3N4XA 1PV3A 3NXSA 2Y9YA 2YO2A 3U1CA 3IR9A 3NTNA 1VF5B 3TNUA 1NHLA 3IF4A 1KQFB 1RH5B 3C9IA 1Q2NA 3H1HG 1IFDA 1N73B 3L73G 1LWUB 5AVXB 2W6JH 5AVZB 1GMJA 1NU1E 1OVRA 2KK7A 1USDA 2B87A 2KNCA 5GTIH 5KAFH 5AW4B 1FZBA 1JTHA 1LTGC 2KP8A 4IFMA 3Q1MA 1MZ9A 2YKOA 3FWNA 3LW5H 5CCHD 3VMXA 2B87B 3D6ZA 2Q3EA 4TT3H 3TYYA 1N7SD 4W80A 4YPCA 3M9BA 1SQPG 3L71D 1JM0A 1LGHB 2E76B 1H0TB 3V4WA 3RK3E 2L5GB 2E74B 3L71E 1RF0A 1YYCA 2QM8A 2YO3A 1FBMA 3L4FA 2UWJE 3A0HE 1NKNA 3AEEC 2BEZF 1L0LK 3G9RA 2NRGA 1FJPA 3V4QA 1YIJP 3CI9A 2ZT9C 2A06G 2R5DA 1M7LA 3GG2A 1NOHA 5BU8B 3TSIA 1R8EA 2H43A 1QGKB 1YJNP 4H0LB 1SQVD 1L4AB 1T3UA 3SWYA 1CSBA 2WWWA 2BCCD 2XV5A 5AVQB 1AA0A 1AJYA 3LIEA 1SQXK 3AEAC 1KD1Q 5AW2B 3MZWB 3M06A 1K04A 1EXIA 4BRYB 1PPJD 5KJ7D 2FYUK 1DX7A 1J1EB 3B71A 1JY2P 1OFCX 5AVSB 1ZXGA 1PPJE 3BCCD 5M1BA 5CCHC 3EWKA 3CX5I 1KB9D 2NPSA 3D6YA 1X79B 3L72G 2IBZI 4GKGA 3CCLP 2Q5UA 2OARA 3RK3C 1HJBA 4H44C 2V7QH 3H1LJ 5AW5B 4JYCA 1S4XA 3L75D 3U59A 1EZVI 1NTKK 3H1JE 1L0LJ 1M57D 3AE9C 4ASVA 1QLED 1X22A 2FBWC 2QJPB 5KAIE 3FXEA 5B66H 1RE4A 1LTJA 1BCCD 1GW4A 1FOSF 1VQ7P 1JB0J 3GHGC 3IFMA 4GT1A 4ZKUA 2A45I 3SFEC 1BCCE 1SFCB 2AEMA 5TISE 1L0ND 3HRNA 2XDJA 1SQXJ 3V6IA 1LTIC 2FXPA 2NPSD 2GM4A 2C9LY 1RF1B 1L0NE 1Q81Q 2I1JA 4OGQD 1JCCA 2H7HA 2FYUJ 3PP5A 2M0BA 4U3FD 2OYHB 1SQVK 3OA7A 5KJ7C 2O1KA 2LKMA 2HG5D 1M1JA 2IYOA 4U3FE 1KQSO 1RE3C 3CX5D 1U7JA 1U57A 2NZ2A 4EI2A 2IBZD 3WUTA 1MKMA 2PFXA 1M8OB 2L91A 3UIAA 2R32A 5APWA 3VMZA 1YJ9P 3L36A 1BE3D 1EZVD 4PD4E 3CCMP 1KZUB 1NH4A 4W7ZA 2C9NY 4L76A 2Y0DA 1IZNB 1VQ8P 3O8ZA 1DD3A 3L70D 2QE7H 2ZVNB 2E5TA 4C46A 1NTZE 1HJ0A 3P8MC 5H2FH 1MV8A 3L70E 5TJHA 1SQQD 1PGQA 2HODA 2LR2A 4H13B 4DCKA 2JR8A 4I7ZB 4IFFA 1SQBG 3H1HJ 5GTHH 3L73J 3MGNA 1N8RQ 2B88A 3RBZA 4LC1A 4OGQC 3RL0B 4WY4D 5CCGD 2HODB 1NGMB 1QX8A 1OW6A 3HD7B 2ZXEB 4UB8H 5CJ0A 4HB1A 2KYVA 1USEA 2VRSA 3R2PA 5APQA 1HGZA 1N2DC 3CC4P 1OWAA 2RH0A 1QL2A 4AUWA 3D70A 3MUDA 2FFDC 3CCRP 3V2NA 1M90Q 1VQLP 4YXDC 4YTPC 1R5SA 4HYTB 2CPBA 4ZMDA 3H25A 1SP4A 2M3BA 1VQKP 4R4MA 1NYHA 2YXRB 1FZCB 4OWFA 3H1IG 3H1KG 2P7JA 1KILE 1H89A 2FYNB 5GTIE 3CX5H 3S4RA 1Q90D 1S72P 2K9YA 2R3SA 1YTZI 5KLIC 2OYOA 1SQQK 4N78D 2FKWB 3G71P 2Q9IA 1ZRTE 5KLVG 2OYIB 4WY4C 5CCGC 1HH0A 3PH0A 5AVTB 2HYNA 3P8CD 1GK6A 2IFMA 3C8VA 2D2CD 3VMYA 2E42A 2QSIA 4ZNCA 3P8CE 3AE7C 5AVUB 3L72J 2YXQB 3GW6A 2ZYDA 3H1IE 1S3JA 1NU1G 3H32A 4MN4C 3CWBE 3H1LD 1NTMK 3TGUE 1S1CX 4N3YB 4O9BA 1KILC 1FJKA 1L0LD 2XZRA 3GF3A 5AVWB 1L0LE 3AE6C 4D6TE 3CD6P 1FC2C 2ZT9B 3ABVC 3AEFC 2ZJSE 3AE8C 2E43A 1LWUA 1BGYE 1SQBK 1SQXD 2O01J 1NKZB 1S9KE 1VQ5P 1IC2A 1BSHA 1P84E 3MIWA 3L71G 1SQXE 1BDCA 2FYUD 4PJ0E 2BASA 1GD2E 1NVOA 1J1DC 4YXWH 2D2CC 2ZFCA 2FYUE 3F89A 2JWAA 3SSUA 3LIDA 1VF5D 1H0TA 2E75B 5B66E 2QIWA 1NTMJ 1M56D 3I5CA 2P1JA 1LTSC 5CMZA 3RK3B 1NTKD 4H44B 1XTGB 3M9HA 4K35A 1NTKE 3FGAD 1LTAC 1PPJG 5E79E 4XFJA 3KDPB 1LT9C 5KKZB 4KJMA 3GHGB 4ZKPA 3L74J 1L4AA 1SQBJ 2HFED 3E1RA 1IK7A 1G1IA 2Z5HA 1BSNA 3WMM0 1OW7A 4HKZH 1S5LX 2R3CA 2YNYA 3H1HD 2C0XA 3H1JG 3WU2H 1CW5A 2E76D 3HUSA 3L73D 4QMAA 4Y99C 2HPCA 1EQ7A 4BRYA 4I1LA 1JNMA 3VP8A 2E74D 1S2EA 5CBOA 2JDIH 1KFNA 2JO1A 2KS1A 5KLVK 3M0DC 2WZ7A 3O6QB 5B5EH 1EDJA 1DIPA 2AXTH 2QRXA 3A5TA 1SQVE 2IZ1A 2C0WA 2HR3A 2OTKE 2BCCE 4EOTA 2K37A 2WITA 1BCCG 3HUSB 2HPCB 1G1JA 1Y47A 1Y9BA 2AEFA 1JMBA 2KS1B 1RY3A 1L0NG 4H0LD 1L4AD 1DEBA 3S9OA 1EC5A 5AW0B 3V2PA 1QVGO 1A02J 1VQ4P 3H6PA 3VP9A 1N73C 1EDLA 4I6MC 4JPZB 2Y0CA 1N7SC 1NU1K 3BCCE 3GF7A 1AVOA 1KB9E 3H1KJ 3II6A 2W83C 2KIKA 1MFTA 3A3YB 1PGPA 3CLQA 4L75A 4IFDK 4EIJA 4U3FG 2R5BA 1SFCA 3CCVP 2WPVB 4C7NA 2A06D 3L75E 3MHVA 1FDMA 1RF1A 3CXHI 1Q82Q 1AVYA 3IAOA 5APYA 2E5YA 3E1IA 1YI2P 3I55P 5APTA 1JOCA
chains in the Genus database with same CATH topology
1KQLA 2W6BA 2P2UA 4WY4D 2A45H 5CCGD 3RK2C 2P67A 2HODB 5AW7B 2OYHA 3RK3D 1CI6A 4C7NB 3HD7B 1AQ5A 1JTHB 2ZXEB 1LT9B 5CJ0A 2IX7C 2KYVA 2VRSA 1JO5A 3R2PA 2N9BA 1JY3P 5APQA 5KJ7A 1HGZA 2J59M 2N1TC 3M0DA 3BRVB 3T97A 3U1AA 1URQB 1ZR2A 1N2DC 1X8YA 3KPEA 1FZGA 3BVHA 3BATA 2JJLA 1RE3A 1OWAA 1QL2A 3M9QA 5APXA 4AUWA 1FAVA 1MUUA 3MUDA 1CI6B 1SFCD 2FFDC 1IJDB 3HE5A 3OAKA 2YKPA 1WT6A 4Y99B 3V2NA 2XKMA 1FU1A 1RF0C 1T3JA 1GDTA 4N6JA 5AVYB 1NO4A 3HTKA 1IO4A 4HYTB 2FFDB 1FZCC 2CPBA 3MD0A 1IFMA 3OJAB 3H32B 5CHXA 5BVZA 1SP4A 2M3BA 1FZEA 3G3ZA 1N73A 4LGDE 1S9KD 1FZCB 3SWFA 1N7SA 2P7JA 3HE5B 5AVVB 2Z5IA 1NAFA 3N4XA 3NXSA 1SQPK 1J1EC 1GL2B 3HTKB 2CPSA 2YO2A 3VTPC 3U1CA 3IR9A 1DH3A 1H89A 2XU6A 1LWUC 3NTNA 3TNUA 1GW3A 1NHLA 3C9IA 2WSEH 1IFDA 1YTZI 1N73B 2WSCH 1JY3O 3A2AA 1LWUB 5AVXB 5KTBA 1FOSE 3B5NA 5AVZB 1SQQK 4N78D 2FKWB 5BU5A 2WTYA 2Q9IA 2OYIB 5AW4B 3HD7A 1FZBA 4WY4C 5CCGC 4DOJA 1HH0A 2WPQA 1JTHA 1LTGC 5AVTB 2KP8A 1T2KD 2HYNA 3P8CD 4IFMA 1GK6A 2NPSC 1MZ9A 2YKOA 3LW5H 2IFMA 5CCHD 3VMXA 2Q7CA 3VMYA 2E42A 3B5NB 1URQA 3P8CE 1E5WA 3BASA 1N7SD 4W80A 3TYYA 2NPSB 5AVUB 3BRTB 2GUSA 2N1TA 2QM7A 3M9BA 1SFCC 1LGHB 2KOGA 3V4WA 3RK2B 2L5GB 2FFDA 1FZFA 3P32A 4AQRD 4HH2A 2FXMA 2W27A 3H32A 3P7KA 2M8RA 1RF0A 1RF1C 1YYCA 5APVA 2QM8A 1W2EA 1RE4C 4W7YA 1LTJC 1FBMA 1NTMK 2YO3A 3L4FA 5AW8B 3RL0D 1JY2N 1OXZA 4N3YB 1FZCA 1NKNA 4O9BA 2A45G 1L0LK 2N1TB 1KILC 1FJKA 2HLOA 1LTTC 1FJPA 5APUA 3V4QA 1LTJB 3HD7D 3N7NA 3CI9A 5AW6B 1IFNA 3VN0A 2OYHC 2R5DA 1M7LA 2XZRA 1G2CA 1GL2A 4WB4A 1L4AC 5AVWB 1NOHA 1KILB 1VPCA 1KFMA 5BU8B 3TSIA 2H43A 4DZOA 1URQD 1L4AB 1T3UA 3SWYA 1CSBA 2E43A 2WWWA 2W6AA 2XV5A 5AVQB 1LWUA 1H88A 3HUSC 3LIEA 1SQXK 1N86A 2J58A 2YMYA 1SQBK 1NKZB 4WBAA 1S9KE 2XNXA 1IC2A 1G2CB 5APSA 2I1KA 5AW2B 3MIWA 2OYIA 3M06A 2FYZA 1SLQA 2O1JA 1M1JC 1N7LA 5KJ7D 1YTZT 2FYUK 3MTUE 1DX7A 1J1EB 4KHXA 3TK1A 1H8AA 2BASA 1T2KC 1JY2P 1AFOA 4WY4A 5AVSB 5CCGA 1GD2E 3HE4B 1J1DC 1M1JB 4RESB 3V5BA 5CCHC 3KYQA 4C7RA 2ZFCA 2NPSA 1QL1A 4XE5B 1HBWA 1X79B 3KQGA 4GKGA 2Q5UA 1GL2D 2OARA 2GUVA 3LIDA 3V2QA 3RK3C 1HJBA 1HTLC 1X9VA 4N78E 4JYBA 5AW5B 4JYCA 3I5CA 2P1JA 3U59A 1HVVA 4WY4B 1LTSC 5CMZA 3EFGA 4AYCA 1NTKK 3RK3B 3A7OA 3NFQA 1XTGB 3M9HA 2KB7P 3RL0C 1GTWA 1RE4A 2WT7B 1GK4A 1LTJA 3EQ2A 1GW4A 1VDFA 1LTAC 1FOSF 2O01H 3GHGC 3IFMA 5AW9B 4GT1A 4ZKUA 1KILA 3KDPB 1LT9C 1J2JB 2A45I 3VOPA 1JCDA 1FZAA 2H8PD 1L0NK 1SFCB 3HRNA 2XDJA 3B5ND 3GHGB 4ZKPA 1L4AA 2HFED 5AW3B 1JY2O 1LTIC 1G1IA 1HGVA 1IK9A 2PP6A 2Z5HA 2NPSD 1URQC 2GM4A 2JEEA 2C9LY 1MFZA 2MJZA 1RF1B 3WMM0 2I1JA 1JCCA 1HUCA 2R3CA 2YNYA 1A02F 1IFIA 2H7HA 2C0XA 1CW5A 3CL3D 3HUSA 4Y99C 2HPCA 3RK2D 1EQ7A 3PP5A 4I1LA 1JNMA 3VP8A 2WSFH 2IFNA 2OYHB 1SQVK 3M0AA 1KFNA 3OA7A 3V2RA 5KJ7C 5KLVK 2O1KA 3M0DC 2WZ7A 2LKMA 1SVFA 3HE4A 2HG5D 1M1JA 1IFJA 2N1TD 3A5TA 1LTBC 1RE3C 2C0WA 4B86A 4EOTA 5AVRB 2POHA 2WITA 3NMDA 4M3LA 1HWTC 1CZQA 1ZLLA 3HUSB 1GZLA 2HPCB 1G1JA 5CCHA 4OH8B 1KILD 2PAJA 2IPPA 1ZV8A 1GL2C 1T8ZA 3UIAA 2R32A 2YKQA 1RY3A 5APWA 2KSJA 3VMZA 3L36A 1L4AD 1DEBA 1KZUB 5AW0B 5AW1B 3V2PA 1A02J 1NH4A 4W7ZA 3H6PA 3VP9A 3M91A 4I2LC 1N73C 4JF7A 2C9NY 1NTZK 1XTCC 1JMMA 4I6MC 1N7SC 5CJ4A 1NU1K 1J1DB 3O8ZA 1GU5A 2WT7A 1JY3N 3II6A 1WRGA 2KLVA 4C46A 4XA4A 3A3YB 3P8MC 4LLHA 3CLQA 2OYIC 1ZN5A 1N7SB 4IFDK 1NWQA 1MV8A 2WPRA 1JUNA 4EIJA 1PFIA 2R5BA 1SFCA 4GIFA 2HODA 4C7NA 3GHGA 2Z4EA 3B8EB 3L37A 3VYIA 1GU4A 2Q3IA 1LT9A 4IFFA 3TNUB 3B5NC 1FDMA 1RF1A 2WPSA 3MGNA 5APYA 1Z56A 3L35A 4LC1A 3E1IA 1ZR4A 3HD7C 5APTA 3RL0B 1JOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RK2 D;  3PP5 A;  4WY4 D;  5CCG D;  3RK2 C;  3HD7 A;  4WY4 C;  5CCG C;  3RK3 D;  1JTH A;  3HD7 B;  1JTH B;  5KJ7 D;  5KJ7 C;  3M0D C;  2WZ7 A;  2NPS C;  4WY4 A;  5CCG A;  2HG5 D;  5CCH D;  2N1T D;  5CCH C;  3KYQ A;  3B5N B;  5KJ7 A;  2N1T C;  1URQ A;  3P8C E;  2NPS A;  1URQ B;  1N7S D;  4W80 A;  2NPS B;  5CCH A;  4OH8 B;  1GL2 D;  1KIL D;  2N1T A;  1GL2 C;  3RK3 C;  1SFC D;  4N78 E;  1SFC C;  2KOG A;  1T3J A;  3RK2 B;  1L4A D;  1HVV A;  4WY4 B;  3RK3 B;  4W7Z A;  2M8R A;  4JF7 A;  1XTG B;  4W7Y A;  1N7S C;  3RL0 D;  3RL0 C;  4LGD E;  2N1T B;  1KIL C;  1N7S A;  3HD7 D;  1N7S B;  1GL2 A;  1KIL A;  1L4A C;  3VOP A;  1GL2 B;  3HTK B;  1KIL B;  1SFC A;  2H8P D;  1SFC B;  3TSI A;  2XDJ A;  3B5N D;  1L4A A;  1NHL A;  2HFE D;  3B5N C;  1URQ D;  1L4A B;  2PP6 A;  2NPS D;  1URQ C;  2YMY A;  3B5N A;  3HD7 C;  3RL0 B; 
#chains in the Genus database with same CATH topology
 5KLV J;  3ITK A;  2P67 A;  2OYH A;  3VMA A;  1CI6 A;  2OQQ A;  4C7N B;  3SWK A;  1AQ5 A;  3GMA A;  2QJK B;  2KXP B;  1NTZ G;  2WSC J;  2N9B A;  3L70 G;  1URQ B;  3CC7 P;  1FZG A;  3BAT A;  2JJL A;  1MUU A;  3AEB C;  1CI6 B;  1SFC D;  3AEC C;  1NJI Q;  3HE5 A;  4IL6 X;  3JSV C;  1Y8A A;  3L72 D;  1RF0 C;  2AEJ A;  1T3J A;  1GDT A;  5AVY B;  2P10 A;  4H0L C;  1NU1 J;  2FFD B;  1VQ6 P;  3KHU A;  2M3E A;  1LNQ A;  3PHL A;  1FDI A;  4DT0 A;  3G3Z A;  2IZ0 A;  3CX5 E;  1OIP A;  4RJT A;  2IBZ E;  2IDB A;  3HE5 B;  2ZXX A;  5AVV B;  3KZI H;  1SQP K;  1J1E C;  1GL2 B;  2CPS A;  2XU6 A;  3C1L A;  1BE3 E;  1EZV E;  4K3A A;  1PP9 J;  3CXH D;  2WSS H;  3AEG C;  1KN7 A;  4NPD A;  1JY3 O;  3Q3D A;  3A2A A;  1FOS E;  3B5N A;  1LJ2 A;  4L74 A;  2WTY A;  3HD7 A;  2WPQ A;  2P58 A;  4EYY Q;  2KZJ A;  2LXB A;  1SQQ E;  4UB6 E;  2NPS C;  4JBZ A;  3RGU A;  3B5N B;  3BAS A;  1K73 Q;  3BRT B;  3FXD A;  2QEX P;  1OW8 A;  2GUS A;  1ZME C;  2N1T A;  3RBX A;  1ZP0 C;  4H13 D;  3JCU E;  1SFC C;  2WQY C;  1RHZ B;  2KOG A;  3RK2 B;  3WUU A;  3P32 A;  4HH2 A;  2FXM A;  2KSE A;  4PV1 B;  4EDF A;  1L2P A;  1RF1 C;  5APV A;  1W2E A;  1RE4 C;  4W7Y A;  1LTJ C;  4RKU J;  1NTM D;  3RL0 D;  1FZC A;  2N1T B;  1SQP J;  2HLO A;  1NTM E;  3HD7 D;  1IFN A;  3OW2 O;  2OYH C;  4IOI H;  1FE6 A;  1W5C E;  5TIS H;  1KIL B;  3KXD A;  2KZI A;  1UIX A;  2W6A A;  1N86 A;  2J58 A;  2YMY A;  3L74 D;  1SQB D;  3H1J J;  4BXL A;  2XNX A;  2OYI A;  3CWB G;  1KQG B;  1IFP A;  5KAF E;  2KI7 B;  1SLQ A;  2QJY C;  3L74 E;  3TGU G;  4U7J A;  1M1J C;  1N7L A;  1YTZ T;  3MTU E;  3TK1 A;  1H8A A;  3HE4 B;  4C7R A;  1L0L G;  1QL1 A;  4XE5 B;  1HBW A;  4D6T G;  3I56 P;  2ZYG A;  3AE3 C;  2OTJ P;  1KYO I;  2ZAE B;  2GUV A;  3V2Q A;  4N78 E;  4PD4 H;  3AE4 C;  1P84 I;  4Y28 J;  1L0N J;  4JYB A;  1BGY G;  3F5H A;  3CXH H;  4I7Z C;  3EFG A;  1KC8 Q;  2FXO A;  3A7O A;  3NFQ A;  2B9B A;  1SQX G;  2KB7 P;  3RL0 C;  2K88 A;  2WT7 B;  1VDF A;  2RMZ A;  2O01 H;  1DD4 A;  3Q5P A;  4JQ0 D;  1EDI A;  3VOP A;  3G6E P;  1JCD A;  2FYU G;  2H8P D;  4KT0 J;  1S5L H;  3WU2 E;  1JY2 O;  3CMA P;  1HGV A;  2PP6 A;  2JEE A;  1MFZ A;  2MJZ A;  3H1L E;  1KOR A;  3AE5 C;  4HJG H;  5B5E E;  3JC2 2;  1IFI A;  2H88 C;  2AXC A;  3W68 A;  1RQV A;  2G8Y A;  3M0A A;  1NTK G;  3FX0 A;  1NTZ J;  5KLV D;  1SVF A;  1IFJ A;  4OVN F;  2PRR A;  1AQT A;  1VQM P;  3CCQ P;  4B86 A;  3MUD C;  3NMD A;  1HWT C;  1GZL A;  1VL2 A;  5CCH A;  1KYO D;  5CBN A;  2IPP A;  4NPF X;  1T8Z A;  2FYN C;  2ZT9 D;  2KSJ A;  2IYP A;  2SPZ A;  5AW1 B;  3M91 A;  4JF7 A;  3PLN A;  1JMM A;  5CJ4 A;  1NU1 D;  1GU5 A;  4GOE A;  1JY3 N;  1OVU A;  4XA4 A;  4LLH A;  2OYI C;  2Y9Z A;  1KTM A;  1N7S B;  1NWQ A;  1JUN A;  3K5B A;  1SQV G;  2YIU C;  1PFI A;  3AED C;  4GIF A;  2BCC G;  2CK3 H;  3GHG A;  3B8E B;  3L37 A;  3VYI A;  1K8A Q;  1GU4 A;  2Q3I A;  3TNU B;  2R44 A;  1RQU A;  3L35 A;  1QVF O;  1ZR4 A;  2V4H A;  1PP9 D;  1KB9 I;  2E75 D;  2KNC B;  5DJU B;  2QG4 A;  2OGU A;  2JP3 A;  3RK3 D;  3EFF K;  1PP9 E;  4H44 D;  3BCC G;  1JTH B;  3O6Q A;  1QEX A;  1EXJ A;  1FS0 E;  2O01 N;  4GOD A;  4IL6 H;  5KJ7 A;  4GOF A;  3BRV B;  3T97 A;  3U1A A;  1ZR2 A;  2Q1K A;  2B89 A;  3KPE A;  1YJW P;  3BVH A;  1RE3 A;  3L75 G;  1K9M Q;  3H1H E;  1IJD B;  3L73 E;  2YKP A;  2XKM A;  3PRJ A;  4N6J A;  1BDD A;  3HTK A;  3LW5 J;  1IO4 A;  3KZI E;  3OJA B;  5CHX A;  3T97 B;  2W90 A;  2BEQ D;  3FWL A;  3QWO C;  2KUB A;  1VF5 C;  3A0B H;  3PTZ A;  1WMK A;  1YQ4 C;  1NAF A;  1T6A A;  4WWI A;  1X0T A;  5H2F E;  1U7M A;  3HTK B;  2H89 C;  1SQP D;  3VTP C;  4R4L A;  1DH3 A;  1YIT P;  1LWU C;  2FY8 A;  1GW3 A;  2W8Z A;  1OZH A;  1FDO A;  1SQP E;  2WSE H;  3R4Y A;  1Q86 Q;  3H1I J;  2WSC H;  1KYO H;  2K9J A;  5KTB A;  5GTH E;  1P84 H;  3CWB J;  4WVZ A;  5BU5 A;  2E75 C;  3Q5R A;  3TGU J;  4DOJ A;  4PJ0 H;  4PD4 I;  3H1J D;  1T2K D;  3SFD C;  4UB8 E;  2A06 E;  2IBZ G;  1PGO A;  2K9J B;  2Q7C A;  4NPE A;  2DW3 A;  1VQO P;  1URQ A;  1E5W A;  3CPW O;  1TU3 F;  4D6T J;  2NPS B;  1VQN P;  2E76 C;  2RN0 A;  1BE3 G;  1EZV G;  2QM7 A;  4OGQ B;  2E74 C;  2J5U A;  5KKZ C;  1OX3 A;  1BGY J;  2WSE J;  2XND H;  1M1K Q;  2FFD A;  1FZF A;  4AQR D;  2W27 A;  3P7K A;  2M8R A;  5AW8 B;  1JY2 N;  1OXZ A;  3GLM A;  2A45 G;  2JKV A;  1LTT C;  1SQQ G;  1SS1 A;  5E79 H;  5APU A;  1LTJ B;  3N7N A;  5AW6 B;  3VN0 A;  2V7Q J;  1PGJ A;  1G2C A;  1GL2 A;  3S1K A;  4WB4 A;  1L4A C;  3RL0 g;  1VPC A;  1KFM A;  2ZYA A;  3A0H H;  3L72 E;  4DZO A;  2KLU A;  5C39 A;  1URQ D;  2K1A A;  2O3J A;  2QVA A;  1H88 A;  3HUS C;  2RKL A;  4WBA A;  5EFW B;  5APS A;  1G2C B;  2I1K A;  3G4S P;  1KMI Z;  2FYZ A;  4PD4 D;  2O1J A;  2K3R A;  1NTK J;  1R5L A;  4ASW A;  4KHX A;  1T2K C;  1AFO A;  4WY4 A;  5CCG A;  3E7K A;  2QJY B;  1NTM G;  1M1J B;  2WMM A;  4RES B;  3V5B A;  4CPG A;  5K5G B;  3KYQ A;  3CXH E;  1VQ9 P;  1VQP P;  3L71 J;  1NTZ D;  5KLI B;  3KQG A;  3USS A;  1GL2 D;  2ZVO B;  1HTL C;  1X9V A;  3D71 A;  1LP1 A;  2I8D A;  3CCS P;  1HVV A;  4WY4 B;  2QJP C;  2YMK A;  4L73 A;  4AYC A;  3AE1 C;  3B4S A;  1YQ3 C;  4GDO A;  1KB9 H;  2JWD A;  3TDK A;  1S5L E;  3L74 G;  1GTW A;  1GK4 A;  3EQ2 A;  4TLF A;  3W67 A;  5AW9 B;  1LP1 B;  3AE2 C;  1SQV J;  1KIL A;  1J2J B;  2QJK C;  3Q2Y A;  2BCC J;  2OTL P;  1E79 H;  1FZA A;  2M5A A;  1L0N K;  5KAI H;  3B5N D;  1W2B O;  5AW3 B;  1IK9 A;  5DJT B;  1URQ C;  4Z1M H;  1HUC A;  1PL5 A;  1PZQ A;  1A02 F;  3CL3 D;  1JEK A;  3RK2 D;  2Q6Q A;  2M5A B;  2WSF H;  4PV1 D;  1HF9 A;  3BCC J;  2IFN A;  1Q7Y Q;  3V2R A;  3Q5S A;  3HE4 A;  2N1T D;  1LTB C;  1ZW0 A;  2MKV A;  5AVR B;  2POH A;  4M3L A;  1CZQ A;  1ZLL A;  3L75 J;  4OH8 B;  1SQB E;  1KIL D;  2PAJ A;  1ZV8 A;  3CC2 P;  1GL2 C;  2YKQ A;  5L8R J;  3H1L G;  1KV4 A;  3QH9 A;  4I2L C;  1NTZ K;  1XTC C;  1BCC J;  1J1D B;  2D2C B;  2WT7 A;  1OMI A;  2WSF J;  1WRG A;  2Y0E A;  2KLV A;  1LT1 A;  4H13 C;  2QA4 P;  3MP7 B;  1ZRT D;  1ZN5 A;  2WPR A;  1UII A;  3ZDM A;  2Z4E A;  2G3A A;  1LT9 A;  1OVV A;  3B5N C;  3TF5 A;  2YIU B;  3CCE P;  2WPS A;  4BWN A;  1Z56 A;  3WUV A;  2GA1 A;  4U3F J;  3HD7 C;  4IL6 E;  3CCJ P;  1KQL A;  2W6B A;  3H1K D;  3H1I D;  1EDK A;  2P2U A;  2A45 H;  3RK2 C;  5AW7 B;  4A7P A;  3CCU P;  2N9Y B;  4UB6 H;  4PV1 C;  1LT9 B;  3H1K E;  2IX7 C;  3CWB D;  1YBK A;  1JO5 A;  1AV1 A;  3TGU D;  2LXC B;  2ITA A;  4DJG A;  1JY3 P;  3IN6 A;  2J59 M;  2N1T C;  3M0D A;  2AXT E;  1X8Y A;  1BE3 J;  1K05 A;  3JCU H;  3CME P;  3M9Q A;  5APX A;  1FAV A;  3OAK A;  1WT6 A;  4Y99 B;  4D6T D;  1FU1 A;  1NO4 A;  1DEE G;  3A0B E;  3L70 J;  1FZC C;  3MD0 A;  1IFM A;  3H32 B;  1NAY A;  5KLV E;  5BVZ A;  1BGY D;  1PIX A;  3PJS K;  1FZE A;  2PGD A;  1N73 A;  1PP9 G;  4LGD E;  1S9K D;  1SQQ J;  1P84 D;  3SWF A;  1N7S A;  4RO0 A;  1ZOY C;  1D7M A;  1KYO E;  2WVR A;  2Z5I A;  1YHQ P;  3N4X A;  1PV3 A;  3NXS A;  2Y9Y A;  2YO2 A;  3U1C A;  3IR9 A;  3NTN A;  1VF5 B;  3TNU A;  1NHL A;  3IF4 A;  1KQF B;  1RH5 B;  3C9I A;  1Q2N A;  3H1H G;  1IFD A;  1N73 B;  3L73 G;  1LWU B;  5AVX B;  2W6J H;  5AVZ B;  1GMJ A;  1NU1 E;  1OVR A;  2KK7 A;  1USD A;  2B87 A;  2KNC A;  5GTI H;  5KAF H;  5AW4 B;  1FZB A;  1JTH A;  1LTG C;  2KP8 A;  4IFM A;  3Q1M A;  1MZ9 A;  2YKO A;  3FWN A;  3LW5 H;  5CCH D;  3VMX A;  2B87 B;  3D6Z A;  2Q3E A;  4TT3 H;  3TYY A;  1N7S D;  4W80 A;  4YPC A;  3M9B A;  1SQP G;  3L71 D;  1JM0 A;  1LGH B;  2E76 B;  1H0T B;  3V4W A;  3RK3 E;  2L5G B;  2E74 B;  3L71 E;  1RF0 A;  1YYC A;  2QM8 A;  2YO3 A;  1FBM A;  3L4F A;  2UWJ E;  3A0H E;  1NKN A;  3AEE C;  2BEZ F;  1L0L K;  3G9R A;  2NRG A;  1FJP A;  3V4Q A;  1YIJ P;  3CI9 A;  2ZT9 C;  2A06 G;  2R5D A;  1M7L A;  3GG2 A;  1NOH A;  5BU8 B;  3TSI A;  1R8E A;  2H43 A;  1QGK B;  1YJN P;  4H0L B;  1SQV D;  1L4A B;  1T3U A;  3SWY A;  1CSB A;  2WWW A;  2BCC D;  2XV5 A;  5AVQ B;  1AA0 A;  1AJY A;  3LIE A;  1SQX K;  3AEA C;  1KD1 Q;  5AW2 B;  3MZW B;  3M06 A;  1K04 A;  1EXI A;  4BRY B;  1PPJ D;  5KJ7 D;  2FYU K;  1DX7 A;  1J1E B;  3B71 A;  1JY2 P;  1OFC X;  5AVS B;  1ZXG A;  1PPJ E;  3BCC D;  5M1B A;  5CCH C;  3EWK A;  3CX5 I;  1KB9 D;  2NPS A;  3D6Y A;  1X79 B;  3L72 G;  2IBZ I;  4GKG A;  3CCL P;  2Q5U A;  2OAR A;  3RK3 C;  1HJB A;  4H44 C;  2V7Q H;  3H1L J;  5AW5 B;  4JYC A;  1S4X A;  3L75 D;  3U59 A;  1EZV I;  1NTK K;  3H1J E;  1L0L J;  1M57 D;  3AE9 C;  4ASV A;  1QLE D;  1X22 A;  2FBW C;  2QJP B;  5KAI E;  3FXE A;  5B66 H;  1RE4 A;  1LTJ A;  1BCC D;  1GW4 A;  1FOS F;  1VQ7 P;  1JB0 J;  3GHG C;  3IFM A;  4GT1 A;  4ZKU A;  2A45 I;  3SFE C;  1BCC E;  1SFC B;  2AEM A;  5TIS E;  1L0N D;  3HRN A;  2XDJ A;  1SQX J;  3V6I A;  1LTI C;  2FXP A;  2NPS D;  2GM4 A;  2C9L Y;  1RF1 B;  1L0N E;  1Q81 Q;  2I1J A;  4OGQ D;  1JCC A;  2H7H A;  2FYU J;  3PP5 A;  2M0B A;  4U3F D;  2OYH B;  1SQV K;  3OA7 A;  5KJ7 C;  2O1K A;  2LKM A;  2HG5 D;  1M1J A;  2IYO A;  4U3F E;  1KQS O;  1RE3 C;  3CX5 D;  1U7J A;  1U57 A;  2NZ2 A;  4EI2 A;  2IBZ D;  3WUT A;  1MKM A;  2PFX A;  1M8O B;  2L91 A;  3UIA A;  2R32 A;  5APW A;  3VMZ A;  1YJ9 P;  3L36 A;  1BE3 D;  1EZV D;  4PD4 E;  3CCM P;  1KZU B;  1NH4 A;  4W7Z A;  2C9N Y;  4L76 A;  2Y0D A;  1IZN B;  1VQ8 P;  3O8Z A;  1DD3 A;  3L70 D;  2QE7 H;  2ZVN B;  2E5T A;  4C46 A;  1NTZ E;  1HJ0 A;  3P8M C;  5H2F H;  1MV8 A;  3L70 E;  5TJH A;  1SQQ D;  1PGQ A;  2HOD A;  2LR2 A;  4H13 B;  4DCK A;  2JR8 A;  4I7Z B;  4IFF A;  1SQB G;  3H1H J;  5GTH H;  3L73 J;  3MGN A;  1N8R Q;  2B88 A;  3RBZ A;  4LC1 A;  4OGQ C;  3RL0 B;  4WY4 D;  5CCG D;  2HOD B;  1NGM B;  1QX8 A;  1OW6 A;  3HD7 B;  2ZXE B;  4UB8 H;  5CJ0 A;  4HB1 A;  2KYV A;  1USE A;  2VRS A;  3R2P A;  5APQ A;  1HGZ A;  1N2D C;  3CC4 P;  1OWA A;  2RH0 A;  1QL2 A;  4AUW A;  3D70 A;  3MUD A;  2FFD C;  3CCR P;  3V2N A;  1M90 Q;  1VQL P;  4YXD C;  4YTP C;  1R5S A;  4HYT B;  2CPB A;  4ZMD A;  3H25 A;  1SP4 A;  2M3B A;  1VQK P;  4R4M A;  1NYH A;  2YXR B;  1FZC B;  4OWF A;  3H1I G;  3H1K G;  2P7J A;  1KIL E;  1H89 A;  2FYN B;  5GTI E;  3CX5 H;  3S4R A;  1Q90 D;  1S72 P;  2K9Y A;  2R3S A;  1YTZ I;  5KLI C;  2OYO A;  1SQQ K;  4N78 D;  2FKW B;  3G71 P;  2Q9I A;  1ZRT E;  5KLV G;  2OYI B;  4WY4 C;  5CCG C;  1HH0 A;  3PH0 A;  5AVT B;  2HYN A;  3P8C D;  1GK6 A;  2IFM A;  3C8V A;  2D2C D;  3VMY A;  2E42 A;  2QSI A;  4ZNC A;  3P8C E;  3AE7 C;  5AVU B;  3L72 J;  2YXQ B;  3GW6 A;  2ZYD A;  3H1I E;  1S3J A;  1NU1 G;  3H32 A;  4MN4 C;  3CWB E;  3H1L D;  1NTM K;  3TGU E;  1S1C X;  4N3Y B;  4O9B A;  1KIL C;  1FJK A;  1L0L D;  2XZR A;  3GF3 A;  5AVW B;  1L0L E;  3AE6 C;  4D6T E;  3CD6 P;  1FC2 C;  2ZT9 B;  3ABV C;  3AEF C;  2ZJS E;  3AE8 C;  2E43 A;  1LWU A;  1BGY E;  1SQB K;  1SQX D;  2O01 J;  1NKZ B;  1S9K E;  1VQ5 P;  1IC2 A;  1BSH A;  1P84 E;  3MIW A;  3L71 G;  1SQX E;  1BDC A;  2FYU D;  4PJ0 E;  2BAS A;  1GD2 E;  1NVO A;  1J1D C;  4YXW H;  2D2C C;  2ZFC A;  2FYU E;  3F89 A;  2JWA A;  3SSU A;  3LID A;  1VF5 D;  1H0T A;  2E75 B;  5B66 E;  2QIW A;  1NTM J;  1M56 D;  3I5C A;  2P1J A;  1LTS C;  5CMZ A;  3RK3 B;  1NTK D;  4H44 B;  1XTG B;  3M9H A;  4K35 A;  1NTK E;  3FGA D;  1LTA C;  1PPJ G;  5E79 E;  4XFJ A;  3KDP B;  1LT9 C;  5KKZ B;  4KJM A;  3GHG B;  4ZKP A;  3L74 J;  1L4A A;  1SQB J;  2HFE D;  3E1R A;  1IK7 A;  1G1I A;  2Z5H A;  1BSN A;  3WMM 0;  1OW7 A;  4HKZ H;  1S5L X;  2R3C A;  2YNY A;  3H1H D;  2C0X A;  3H1J G;  3WU2 H;  1CW5 A;  2E76 D;  3HUS A;  3L73 D;  4QMA A;  4Y99 C;  2HPC A;  1EQ7 A;  4BRY A;  4I1L A;  1JNM A;  3VP8 A;  2E74 D;  1S2E A;  5CBO A;  2JDI H;  1KFN A;  2JO1 A;  2KS1 A;  5KLV K;  3M0D C;  2WZ7 A;  3O6Q B;  5B5E H;  1EDJ A;  1DIP A;  2AXT H;  2QRX A;  3A5T A;  1SQV E;  2IZ1 A;  2C0W A;  2HR3 A;  2OTK E;  2BCC E;  4EOT A;  2K37 A;  2WIT A;  1BCC G;  3HUS B;  2HPC B;  1G1J A;  1Y47 A;  1Y9B A;  2AEF A;  1JMB A;  2KS1 B;  1RY3 A;  1L0N G;  4H0L D;  1L4A D;  1DEB A;  3S9O A;  1EC5 A;  5AW0 B;  3V2P A;  1QVG O;  1A02 J;  1VQ4 P;  3H6P A;  3VP9 A;  1N73 C;  1EDL A;  4I6M C;  4JPZ B;  2Y0C A;  1N7S C;  1NU1 K;  3BCC E;  3GF7 A;  1AVO A;  1KB9 E;  3H1K J;  3II6 A;  2W83 C;  2KIK A;  1MFT A;  3A3Y B;  1PGP A;  3CLQ A;  4L75 A;  4IFD K;  4EIJ A;  4U3F G;  2R5B A;  1SFC A;  3CCV P;  2WPV B;  4C7N A;  2A06 D;  3L75 E;  3MHV A;  1FDM A;  1RF1 A;  3CXH I;  1Q82 Q;  1AVY A;  3IAO A;  5APY A;  2E5Y A;  3E1I A;  1YI2 P;  3I55 P;  5APT A;  1JOC A; 
#chains in the Genus database with same CATH homology
 1KQL A;  2W6B A;  2P2U A;  4WY4 D;  2A45 H;  5CCG D;  3RK2 C;  2P67 A;  2HOD B;  5AW7 B;  2OYH A;  3RK3 D;  1CI6 A;  4C7N B;  3HD7 B;  1AQ5 A;  1JTH B;  2ZXE B;  1LT9 B;  5CJ0 A;  2IX7 C;  2KYV A;  2VRS A;  1JO5 A;  3R2P A;  2N9B A;  1JY3 P;  5APQ A;  5KJ7 A;  1HGZ A;  2J59 M;  2N1T C;  3M0D A;  3BRV B;  3T97 A;  3U1A A;  1URQ B;  1ZR2 A;  1N2D C;  1X8Y A;  3KPE A;  1FZG A;  3BVH A;  3BAT A;  2JJL A;  1RE3 A;  1OWA A;  1QL2 A;  3M9Q A;  5APX A;  4AUW A;  1FAV A;  1MUU A;  3MUD A;  1CI6 B;  1SFC D;  2FFD C;  1IJD B;  3HE5 A;  3OAK A;  2YKP A;  1WT6 A;  4Y99 B;  3V2N A;  2XKM A;  1FU1 A;  1RF0 C;  1T3J A;  1GDT A;  4N6J A;  5AVY B;  1NO4 A;  3HTK A;  1IO4 A;  4HYT B;  2FFD B;  1FZC C;  2CPB A;  3MD0 A;  1IFM A;  3OJA B;  3H32 B;  5CHX A;  5BVZ A;  1SP4 A;  2M3B A;  1FZE A;  3G3Z A;  1N73 A;  4LGD E;  1S9K D;  1FZC B;  3SWF A;  1N7S A;  2P7J A;  3HE5 B;  5AVV B;  2Z5I A;  1NAF A;  3N4X A;  3NXS A;  1SQP K;  1J1E C;  1GL2 B;  3HTK B;  2CPS A;  2YO2 A;  3VTP C;  3U1C A;  3IR9 A;  1DH3 A;  1H89 A;  2XU6 A;  1LWU C;  3NTN A;  3TNU A;  1GW3 A;  1NHL A;  3C9I A;  2WSE H;  1IFD A;  1YTZ I;  1N73 B;  2WSC H;  1JY3 O;  3A2A A;  1LWU B;  5AVX B;  5KTB A;  1FOS E;  3B5N A;  5AVZ B;  1SQQ K;  4N78 D;  2FKW B;  5BU5 A;  2WTY A;  2Q9I A;  2OYI B;  5AW4 B;  3HD7 A;  1FZB A;  4WY4 C;  5CCG C;  4DOJ A;  1HH0 A;  2WPQ A;  1JTH A;  1LTG C;  5AVT B;  2KP8 A;  1T2K D;  2HYN A;  3P8C D;  4IFM A;  1GK6 A;  2NPS C;  1MZ9 A;  2YKO A;  3LW5 H;  2IFM A;  5CCH D;  3VMX A;  2Q7C A;  3VMY A;  2E42 A;  3B5N B;  1URQ A;  3P8C E;  1E5W A;  3BAS A;  1N7S D;  4W80 A;  3TYY A;  2NPS B;  5AVU B;  3BRT B;  2GUS A;  2N1T A;  2QM7 A;  3M9B A;  1SFC C;  1LGH B;  2KOG A;  3V4W A;  3RK2 B;  2L5G B;  2FFD A;  1FZF A;  3P32 A;  4AQR D;  4HH2 A;  2FXM A;  2W27 A;  3H32 A;  3P7K A;  2M8R A;  1RF0 A;  1RF1 C;  1YYC A;  5APV A;  2QM8 A;  1W2E A;  1RE4 C;  4W7Y A;  1LTJ C;  1FBM A;  1NTM K;  2YO3 A;  3L4F A;  5AW8 B;  3RL0 D;  1JY2 N;  1OXZ A;  4N3Y B;  1FZC A;  1NKN A;  4O9B A;  2A45 G;  1L0L K;  2N1T B;  1KIL C;  1FJK A;  2HLO A;  1LTT C;  1FJP A;  5APU A;  3V4Q A;  1LTJ B;  3HD7 D;  3N7N A;  3CI9 A;  5AW6 B;  1IFN A;  3VN0 A;  2OYH C;  2R5D A;  1M7L A;  2XZR A;  1G2C A;  1GL2 A;  4WB4 A;  1L4A C;  5AVW B;  1NOH A;  1KIL B;  1VPC A;  1KFM A;  5BU8 B;  3TSI A;  2H43 A;  4DZO A;  1URQ D;  1L4A B;  1T3U A;  3SWY A;  1CSB A;  2E43 A;  2WWW A;  2W6A A;  2XV5 A;  5AVQ B;  1LWU A;  1H88 A;  3HUS C;  3LIE A;  1SQX K;  1N86 A;  2J58 A;  2YMY A;  1SQB K;  1NKZ B;  4WBA A;  1S9K E;  2XNX A;  1IC2 A;  1G2C B;  5APS A;  2I1K A;  5AW2 B;  3MIW A;  2OYI A;  3M06 A;  2FYZ A;  1SLQ A;  2O1J A;  1M1J C;  1N7L A;  5KJ7 D;  1YTZ T;  2FYU K;  3MTU E;  1DX7 A;  1J1E B;  4KHX A;  3TK1 A;  1H8A A;  2BAS A;  1T2K C;  1JY2 P;  1AFO A;  4WY4 A;  5AVS B;  5CCG A;  1GD2 E;  3HE4 B;  1J1D C;  1M1J B;  4RES B;  3V5B A;  5CCH C;  3KYQ A;  4C7R A;  2ZFC A;  2NPS A;  1QL1 A;  4XE5 B;  1HBW A;  1X79 B;  3KQG A;  4GKG A;  2Q5U A;  1GL2 D;  2OAR A;  2GUV A;  3LID A;  3V2Q A;  3RK3 C;  1HJB A;  1HTL C;  1X9V A;  4N78 E;  4JYB A;  5AW5 B;  4JYC A;  3I5C A;  2P1J A;  3U59 A;  1HVV A;  4WY4 B;  1LTS C;  5CMZ A;  3EFG A;  4AYC A;  1NTK K;  3RK3 B;  3A7O A;  3NFQ A;  1XTG B;  3M9H A;  2KB7 P;  3RL0 C;  1GTW A;  1RE4 A;  2WT7 B;  1GK4 A;  1LTJ A;  3EQ2 A;  1GW4 A;  1VDF A;  1LTA C;  1FOS F;  2O01 H;  3GHG C;  3IFM A;  5AW9 B;  4GT1 A;  4ZKU A;  1KIL A;  3KDP B;  1LT9 C;  1J2J B;  2A45 I;  3VOP A;  1JCD A;  1FZA A;  2H8P D;  1L0N K;  1SFC B;  3HRN A;  2XDJ A;  3B5N D;  3GHG B;  4ZKP A;  1L4A A;  2HFE D;  5AW3 B;  1JY2 O;  1LTI C;  1G1I A;  1HGV A;  1IK9 A;  2PP6 A;  2Z5H A;  2NPS D;  1URQ C;  2GM4 A;  2JEE A;  2C9L Y;  1MFZ A;  2MJZ A;  1RF1 B;  3WMM 0;  2I1J A;  1JCC A;  1HUC A;  2R3C A;  2YNY A;  1A02 F;  1IFI A;  2H7H A;  2C0X A;  1CW5 A;  3CL3 D;  3HUS A;  4Y99 C;  2HPC A;  3RK2 D;  1EQ7 A;  3PP5 A;  4I1L A;  1JNM A;  3VP8 A;  2WSF H;  2IFN A;  2OYH B;  1SQV K;  3M0A A;  1KFN A;  3OA7 A;  3V2R A;  5KJ7 C;  5KLV K;  2O1K A;  3M0D C;  2WZ7 A;  2LKM A;  1SVF A;  3HE4 A;  2HG5 D;  1M1J A;  1IFJ A;  2N1T D;  3A5T A;  1LTB C;  1RE3 C;  2C0W A;  4B86 A;  4EOT A;  5AVR B;  2POH A;  2WIT A;  3NMD A;  4M3L A;  1HWT C;  1CZQ A;  1ZLL A;  3HUS B;  1GZL A;  2HPC B;  1G1J A;  5CCH A;  4OH8 B;  1KIL D;  2PAJ A;  2IPP A;  1ZV8 A;  1GL2 C;  1T8Z A;  3UIA A;  2R32 A;  2YKQ A;  1RY3 A;  5APW A;  2KSJ A;  3VMZ A;  3L36 A;  1L4A D;  1DEB A;  1KZU B;  5AW0 B;  5AW1 B;  3V2P A;  1A02 J;  1NH4 A;  4W7Z A;  3H6P A;  3VP9 A;  3M91 A;  4I2L C;  1N73 C;  4JF7 A;  2C9N Y;  1NTZ K;  1XTC C;  1JMM A;  4I6M C;  1N7S C;  5CJ4 A;  1NU1 K;  1J1D B;  3O8Z A;  1GU5 A;  2WT7 A;  1JY3 N;  3II6 A;  1WRG A;  2KLV A;  4C46 A;  4XA4 A;  3A3Y B;  3P8M C;  4LLH A;  3CLQ A;  2OYI C;  1ZN5 A;  1N7S B;  4IFD K;  1NWQ A;  1MV8 A;  2WPR A;  1JUN A;  4EIJ A;  1PFI A;  2R5B A;  1SFC A;  4GIF A;  2HOD A;  4C7N A;  3GHG A;  2Z4E A;  3B8E B;  3L37 A;  3VYI A;  1GU4 A;  2Q3I A;  1LT9 A;  4IFF A;  3TNU B;  3B5N C;  1FDM A;  1RF1 A;  2WPS A;  3MGN A;  5APY A;  1Z56 A;  3L35 A;  4LC1 A;  3E1I A;  1ZR4 A;  3HD7 C;  5APT A;  3RL0 B;  1JOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...