2NPSA

Crystal structure of the early endosomal snare complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
63
structure length
63
Chain Sequence
RNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Early endosomal SNAREs form a structurally conserved SNARE complex and fuse liposomes with multiple topologies
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Vesicle-associated membrane protein 4
total genus 28
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2006-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2npsA00
4WY4B 5CCHA 4W80A 2PP6A 2NPSA 1GL2D 4WY4A 3TSIA 5CCHC 3RK2B 1N7SD 1GL2C 1L4AB 1SFCB 1L4AC 1SFCC 1L4AD 1SFCD 1N7SB 1N7SC 2N1TA 5CCHD 1GL2B 1URQC 5CCGA 5KJ7A 2NPSD 1KILA 1NHLA 1XTGB 3RK2D 1T3JA 2NPSB 1JTHA 3RK3D 3HD7C 3RL0D 3HD7A 2WZ7A 3M0DC 1HVVA 2XDJA 2N1TC 1JTHB 4LGDE 3RL0B 5KJ7D 3VOPA 1KILD 2HFED 4W7YA 4WY4C 2YMYA 5CCGC 3B5NB 5CCGD 2HG5D 3HTKB 3B5NC 2M8RA 4N78E 4WY4D 3B5ND 1URQB 3HD7D 2NPSC 1KILC 5KJ7C 4JF7A 3RK2C 2N1TD 1URQA 1KILB 3P8CE 1N7SA 2H8PD 3KYQA 3RL0C 2KOGA 3RK3C 1L4AA 1SFCA 1GL2A 3B5NA 2N1TB 3PP5A 3HD7B 3RK3B 4OH8B 4W7ZA 1URQD
chains in the Genus database with same CATH superfamily
3MD0A 4XE5B 1LTJB 2IBZE 2YXRB 5EFWB 3PHLA 3H1KD 1WRGA 3H1LG 3H1JJ 3CCQP 5KKZB 2G8YA 1PGPA 4HB1A 3CC2P 4L75A 4IOIH 1L0LJ 1NYHA 4EI2A 1QVFO 1MUUA 2KNCB 2QM7A 3GF3A 1YTZT 1ZLLA 4O9BA 4BRYB 4YXWH 5TISE 2R3SA 1E79H 2QIWA 5APTA 1KQLA 1OZHA 1FAVA 1EXIA 4OGQD 5GTHH 4EYYQ 1H0TA 2E5TA 1BGYE 2QJPC 3HTKA 4CPGA 1DEBA 2FYUJ 2OARA 2O3JA 3FXDA 3V5BA 1L4AD 3AE4C 1L0LE 2ZAEB 5B5EE 1AFOA 2KK7A 3L72E 2A06D 1RE4C 3O8ZA 1VQ4P 1M1KQ 5AW0B 1N7LA 1JO5A 1AV1A 3H1ID 3SSUA 2E74D 2FBWC 1AQTA 2VRSA 2Z4EA 1AA0A 1AVYA 1GZLA 1IFMA 1KFMA 1NTKD 2M3EA 1K73Q 2E75C 2J5UA 1FDOA 1LGHB 2WSCH 2R44A 1BE3D 4U3FE 3TF5A 1FOSF 1PP9E 3I55P 1SQVE 2BEQD 1Q86Q 1FOSE 2V7QJ 1T3JA 1X0TA 1IZNB 2MKVA 2R32A 3AE9C 5KLVK 3TYYA 2C9LY 2P10A 2XV5A 3HD7A 5B5EH 2IFMA 1FJKA 2A45I 2WZ7A 2Y9YA 3AE2C 3WU2H 3M0DC 3HE5A 2FYUK 2O1KA 3L71E 4PV1D 1SQXG 1HVVA 2V4HA 1PGOA 3HRNA 3VMZA 3Q5SA 1KC8Q 2P1JA 1CI6A 5AVQB 4QMAA 3C9IA 3CXHD 5AVXB 2OYIA 3CCUP 1HJBA 5KJ7D 1RF1C 5APVA 1L0NG 3L73J 1KZUB 1BCCD 2HFED 2W6AA 2HYNA 3RBZA 2ZJSE 3G71P 1L0LG 2L5GB 1L0NE 1FZFA 3S1KA 4GKGA 4WY4C 2FYNB 2IYOA 5CCGC 2WSFH 1LTJC 4H44D 4Z1MH 1LJ2A 1LTIC 2POHA 2WPQA 3AEBC 3B71A 3H1LJ 2JKVA 2QM8A 3IF4A 1JM0A 1K05A 1KB9I 1OXZA 1QLED 3H1JD 3Q2YA 2D2CC 4XFJA 1SQXJ 3I56P 3MHVA 3TNUA 2FYUG 4HH2A 2NRGA 3M9QA 1M1JC 3A3YB 3A5TA 4XA4A 1JY3P 1KYOD 1Q2NA 2H7HA 2N9YB 1ZW0A 1RF1A 3GHGC 4PV1C 2OYIC 2IX7C 3A0BE 3H1LE 3D70A 2Q3EA 1URQB 1ZV8A 1T3UA 2HR3A 2P7JA 1YJ9P 2JWDA 4U7JA 3TGUD 1NKZB 4UB6H 3U1CA 1AJYA 3OAKA 3VMXA 1Y47A 4JF7A 3VTPC 4JYCA 3H25A 1QGKB 2QVAA 4ASWA 2N1TD 1RQVA 3QWOC 3R4YA 1S9KE 3CCEP 1SS1A 2Y9ZA 1VQMP 3II6A 1IC2A 3NMDA 2QA4P 1VQ6P 1YBKA 4EOTA 1KILB 5AVZB 2OYOA 3H1JE 3V2PA 3KYQA 2OTLP 2H89C 1JMMA 3L35A 4H0LD 3JSVC 2K88A 3GLMA 4I1LA 3N7NA 3RK3C 4K3AA 4ZNCA 3M0DA 1RY3A 1SQBK 1BGYD 1X79B 1RE3A 4NPFX 5BU8B 1VQPP 1YJWP 1EQ7A 3N4XA 1LP1B 2LKMA 4L76A 1EZVG 1NU1J 1VDFA 3AE6C 3RK3B 1VQOP 2CPSA 2B87B 4RESB 4W7ZA 1GD2E 1KTMA 5E79E 2FFDC 2IZ1A 4I7ZB 1FDMA 3G6EP 2QJYC 3V2NA 1M1JB 3HUSC 3H1IJ 4GT1A 2XKMA 2KLUA 4KHXA 2HPCB 2C0WA 4U3FG 3GHGB 4PV1B 4W80A 3L75G 4JPZB 1FBMA 5AW6B 3JCUE 1L0NK 4UB6E 2NPSA 1BE3J 1QL2A 1IFDA 2FXMA 1U7MA 1SQXE 2IDBA 3KHUA 3Q5RA 1T2KC 1L0LK 1G2CB 1OW8A 4WY4A 2XZRA 3A0BH 3TSIA 2Q9IA 1CW5A 1P84H 1SQPD 1IFNA 2ZXXA 3M9HA 2K1AA 1W2EA 3CXHI 3GHGA 1GW3A 3RBXA 4DCKA 1SFCB 2K9JA 2XU6A 4DZOA 4DT0A 1J1EC 1SFCD 1SQBD 2AEFA 4GDOA 3L74E 3O6QA 3SWKA 1LTBC 1OIPA 1OW6A 1S1CX 1NU1D 1M57D 1LWUC 2KS1A 2KSEA 2YO3A 4YXDC 1S5LX 2JR8A 1J2JB 3HE4A 1VF5D 3MIWA 4PD4H 1S5LE 1T2KD 5CCGA 1IK9A 3BASA 2C9NY 4WVZA 3OW2O 5KJ7A 1OFCX 2KUBA 4N3YB 5APUA 3CMAP 1EDJA 3H6PA 5AVVB 1NHLA 3L37A 5L8RJ 3AE1C 3V2RA 1A02F 3V4WA 5DJUB 1W5CE 3NXSA 5AW2B 1L0NJ 1XTGB 1ZOYC 1VQKP 5C39A 2WSEJ 2Q7CA 5CBNA 1JTHA 2W8ZA 4H0LC 3B8EB 3RK3D 3CPWO 3AEDC 1NTKE 3H1HJ 5AW7B 3IFMA 1OMIA 2ZXEB 3H32A 3NFQA 5AVYB 5TJHA 1KYOH 3PJSK 3IR9A 1SQPE 3D6ZA 2KNCA 1KFNA 4BRYA 3EQ2A 1FZCA 1SLQA 4H44C 1GK6A 1VF5B 5CJ0A 1SQBG 5BVZA 1JTHB 2J58A 1BCCJ 3H1IG 3RL0B 1FZGA 1EC5A 1M8OB 3GG2A 1HTLC 3H1JG 2ZT9B 3JCUH 2V7QH 3MUDA 1KILD 2IYPA 4R4MA 5AW8B 3AE7C 1YJNP 1GW4A 3MP7B 1YQ4C 2K9YA 4TLFA 4GOFA 2HG5D 2OTKE 2HODB 2WITA 2Y0CA 5KLIC 1IFPA 1LP1A 2W6BA 3L75E 5APYA 3A0HE 1SQBE 2FXOA 4OVNF 2K9JB 1ZR4A 3RL0g 3OA7A 1IK7A 1TU3F 1NAFA 2L91A 2PFXA 4N6JA 4AUWA 5GTHE 3ABVC 2JWAA 4H13D 1K04A 4BWNA 2AXTE 2O01J 2N9BA 1HGVA 1P84E 2KS1B 3AE3C 3L74J 4TT3H 5KKZC 1ZRTE 3B5ND 2QEXP 2KIKA 1NWQA 3TGUE 2YKQA 1KMIZ 1UIIA 1PPJE 2WT7B 4Y99C 1K8AQ 3P8MC 2GM4A 3EFFK 4M3LA 3T97B 2FYZA 3RK2C 1FU1A 1S9KD 2OYHA 2ZYAA 2IBZD 2WPRA 3L73D 3SFEC 1YYCA 5KTBA 1U7JA 1BGYG 1KILE 1T8ZA 1YTZI 2CPBA 1P84I 2R3CA 3V4QA 5E79H 2H43A 3VMAA 1JY2O 3MUDC 2FYUD 1N7SA 2Q1KA 3H1HG 1Y9BA 2PRRA 2SPZA 3LW5H 1PP9G 4HYTB 1YQ3C 2GUSA 1NU1G 2GUVA 1L4AA 3D71A 1NTKJ 3WMM0 1M56D 1OWAA 2AXTH 4EDFA 3Q1MA 3D6YA 1YHQP 3L73E 3L70J 5AVRB 3PLNA 4KT0J 5AW3B 1IFJA 1PL5A 2N1TB 2FYNC 2QJKB 2QJKC 2RMZA 3FX0A 1JY2N 2WPSA 2ZYGA 5AW5B 2WMMA 3A0HH 1J1DB 4HJGH 1NTME 2KZIA 2FFDB 3IAOA 1FZCC 1ZRTD 2QRXA 1URQD 1KYOI 3HUSB 2WT7A 5KAIH 1RE3C 1MZ9A 1L0ND 3U1AA 3WUUA 2B88A 5CCHA 2WVRA 1VQ9P 2FY8A 1NJIQ 4MN4C 3K5BA 1NU1K 2K37A 2OYHC 2PP6A 2H88C 1EDIA 1DX7A 1K9MQ 2FYUE 4H44B 2PGDA 3WUVA 1OVRA 4ZKUA 1EZVI 2KSJA 1RF0A 4JQ0D 3C8VA 1FZBA 3LIDA 3WU2E 1KYOE 3TK1A 3CCVP 1GL2C 1LT9C 2O1JA 3BRTB 1BE3G 1L4AB 2QG4A 3H1KE 1L4AC 3CL3D 5CBOA 2WTYA 3GMAA 1UIXA 4OWFA 1QVGO 2Y0DA 1M90Q 1N7SC 1GDTA 2N1TA 2B9BA 2O01H 2P67A 3I5CA 5CCHD 2OTJP 1NH4A 2A06E 4LC1A 1GTWA 1SQPJ 3KPEA 1KQGB 1URQC 1KORA 4D6TG 2KP8A 3H1KJ 4UB8E 1FC2C 5AW1B 1PV3A 1G1JA 1KB9E 3L72J 3TNUB 1SQQG 2W27A 1H8AA 1USDA 1S5LH 5BU5A 1FZAA 3CI9A 1SVFA 1RHZB 4PD4E 3Q3DA 2XNDH 1H88A 1NU1E 3AE5C 1LTAC 1VPCA 2B89A 3BRVB 3V6IA 3RK2D 1ZR2A 2IBZI 4H13C 1FZEA 2E76C 2YIUB 1NTZE 2OGUA 4RKUJ 1SQPG 1RF1B 1SQVJ 2M3BA 3HD7C 3RL0D 3BVHA 4RO0A 1BDDA 1NTKG 2BASA 3BCCE 1NTMG 5CHXA 1N73B 4PD4I 2FFDA 1KV4A 1FE6A 1GU5A 1PGJA 2XDJA 1X9VA 1JCCA 1SQQK 3CWBG 1NO4A 3H1LD 4I2LC 3W68A 1Q7YQ 1NTZJ 3ITKA 5CMZA 3VOPA 4D6TJ 2OYHB 4OGQB 1MFTA 1HBWA 2OQQA 1OX3A 2QJYB 3TGUG 3B5NB 3KDPB 4AYCA 2W90A 4IFDK 1JY2P 3KXDA 4GOEA 2P58A 4ZKPA 1VQ8P 3P8CD 1HWTC 1LTGC 1S2EA 1EDKA 1LNQA 4JYBA 1SQQD 1X22A 1ZN5A 2WWWA 4C7RA 4D6TE 3HTKB 3CWBE 3KQGA 1SQBJ 1G2CA 3CCSP 3CC4P 3AEGC 1HJ0A 3B5NC 5APWA 1DD3A 2M8RA 5KLVJ 1KN7A 2KYVA 2R5BA 2IBZG 1RH5B 3FGAD 2J59M 3AEEC 4N78E 4DJGA 3CCRP 1CZQA 5TISH 5M1BA 2ZYDA 1BDCA 1S3JA 3HD7D 1HH0A 4Y99B 1X8YA 2WPVB 1R5LA 1KILC 3CX5I 3P7KA 5KJ7C 4YPCA 5APXA 2ZVNB 2JDIH 1HGZA 1EZVD 2QSIA 3VP8A 3FXEA 3ZDMA 5K5GB 1DH3A 2E74B 2P2UA 2NZ2A 3RGUA 1GMJA 4IL6E 3H1KG 1URQA 1J1EB 1JCDA 1JNMA 2LXBA 1MV8A 1SQQE 2Q5UA 3CXHE 3U59A 3A7OA 3WUTA 3VN0A 2ZVOB 3P8CE 4HKZH 3RL0C 1JY3N 3PRJA 1SQVD 2KOGA 1R5SA 1YITP 1SQVG 3BATA 1OVUA 2E74C 3LIEA 1SFCA 1Y8AA 3CX5E 5KLVD 5APSA 3VP9A 4PJ0E 3UIAA 1G1IA 1EXJA 2BEZF 1LTSC 1N73A 2M5AA 3Q5PA 1XTCC 3O6QB 4A7PA 1BSNA 2W6JH 1PP9J 3CX5H 3PP5A 4ZMDA 3H1IE 3V2QA 1ZXGA 1CI6B 3A2AA 4GIFA 4IFMA 3CC7P 1SQPK 3AE8C 3KZIE 2FXPA 1CSBA 1PZQA 3L71G 3L4FA 1L0LD 4I7ZC 4K35A 1W2BO 2WSCJ 1NTKK 4DOJA 1VF5C 1NTMK 2IZ0A 2A45H 1BE3E 2M5AB 3BCCD 5KAFH 2MJZA 4WY4B 2KI7B 2WQYC 5APQA 1NTZG 2Q6QA 3L71J 1NTZD 3L73G 2E75D 4C46A 4Y28J 5AW9B 2Y0EA 5B66E 3CMEP 2JJLA 3G4SP 2HLOA 1NTMD 1GL2D 3JC22 2I1KA 3M9BA 3L36A 1YI2P 2I8DA 1T6AA 3S4RA 2BCCD 1JMBA 4N78D 1NAYA 2KZJA 2PAJA 3RK2B 5CCHC 1M7LA 1N7SD 3HE4B 1KB9D 1SFCC 1NOHA 1PIXA 3CX5D 3USSA 1N7SB 1N8RQ 2KLVA 1SQXD 4C7NA 5AVWB 1NGMB 1LWUA 3M91A 3CD6P 2Z5IA 1BSHA 1NTZK 3R2PA 1GL2B 1LT9B 1WT6A 2D2CB 2Q3IA 1Q82Q 1FJPA 2WSFJ 2A06G 2E42A 1AQ5A 3QH9A 1D7MA 2E75B 3CLQA 1IJDB 1OVVA 2YIUC 1N2DC 1M1JA 2NPSD 1KILA 2WSSH 3T97A 4C7NB 4IL6X 2HPCA 3SWFA 1BCCG 1VQNP 3LW5J 2KB7P 4WB4A 4WY4D 2RN0A 3C1LA 3E1RA 3OJAB 3P32A 1N86A 2Z5HA 4L73A 2AEMA 3VYIA 2JO1A 2E43A 3L70D 1YIJP 1FS0E 3AEAC 2NPSB 1NTMJ 3GF7A 1GK4A 1LTJA 2K3RA 3F5HA 3L70G 1PPJG 1P84D 1S72P 4RJTA 4H0LB 1LTTC 2UWJE 3PTZA 4WBAA 1DD4A 1Q90D 2ZT9C 2G3AA 2D2CD 1J1DC 1SQVK 3CWBD 4YTPC 3AECC 3NTNA 2B87A 2WSEH 4B86A 4H13B 1VL2A 1ZMEC 1DIPA 1QL1A 1NVOA 2AEJA 2GA1A 2LR2A 3BCCJ 2ITAA 2N1TC 3M06A 4IFFA 1KQFB 3CCMP 1KQSO 1Q81Q 4LGDE 1L2PA 3CCLP 2FKWB 2O01N 4U3FD 5KLIB 1RE4A 5B66H 1EDLA 3GW6A 5AVUB 4NPEA 1HF9A 1JUNA 3L75J 3FWLA 3CCJP 1FZCB 1KB9H 3EWKA 4WWIA 3W67A 2CK3H 4UB8H 1HUCA 1SP4A 4W7YA 3TDKA 2RH0A 2YO2A 2YMYA 1MKMA 4BXLA 5CCGD 5CJ4A 1VQ5P 1VQ7P 3S9OA 1RF0C 2JEEA 4U3FJ 1LT1A 2ZFCA 1OW7A 1QEXA 1Z56A 3IN6A 2OYIB 3E1IA 2ZT9D 3E7KA 1AVOA 3SWYA 3G9RA 3MTUE 3CWBJ 4ASVA 1R8EA 3G3ZA 2HODA 1FDIA 2XNXA 1VQLP 2IFNA 3VMYA 5KLVE 3RK3E 1LWUB 1USEA 2BCCE 2I1JA 2QJPB 3FWNA 3H1HE 1JY3O 3PH0A 4I6MC 2A45G 3EFGA 4JBZA 1PPJD 2LXCB 1S4XA 5H2FH 4NPDA 5AVSB 2BCCG 2YNYA 3MZWB 3L72D 5GTIE 2NPSC 1BGYJ 3CXHH 3L72G 4EIJA 1JEKA 2AXCA 2IPPA 3F89A 4IL6H 1JOCA 1BCCE 1NKNA 1PGQA 2YKPA 3SFDC 3AEFC 1EZVE 2BCCJ 2M0BA 3MGNA 5KAIE 2E5YA 2QE7H 5KAFE 1ZP0C 3M0AA 3L70E 5KLVG 5GTIH 1PFIA 1DEEG 1IFIA 1SQQJ 3KZIH 2H8PD 3L75D 3L74G 5H2FE 2W83C 2YXQB 3L74D 1H0TB 3L71D 4L74A 4LLHA 5AW4B 1IO4A 3H32B 4PD4D 1SQXK 2RKLA 5AVTB 1GL2A 1LT9A 1GU4A 1U57A 3BCCG 2R5DA 1H89A 2E76B 3B5NA 2YKOA 1KD1Q 3HUSA 1MFZA 1JB0J 4PJ0H 1N73C 4AQRD 4KJMA 4R4LA 1QX8A 2C0XA 2JP3A 3HD7B 4D6TD 4OH8B 3B4SA 3HE5B 1E5WA 2KXPB 4GODA 4OGQC 2DW3A 2E76D 1PP9D 5DJTB 1WMKA 2YMKA 1A02J 3H1HD 3TGUJ 1RQUA
chains in the Genus database with same CATH topology
3MD0A 4XE5B 1LTJB 1WRGA 1MUUA 2QM7A 4O9BA 1YTZT 1ZLLA 5APTA 1KQLA 1FAVA 3HTKA 1DEBA 2OARA 3V5BA 1L4AD 1AFOA 1RE4C 3O8ZA 5AW0B 1N7LA 1JO5A 2VRSA 2Z4EA 1GZLA 1IFMA 1KFMA 1LGHB 2WSCH 1FOSF 1FOSE 1T3JA 2R32A 5KLVK 3TYYA 2XV5A 3HD7A 2IFMA 1FJKA 2A45I 2WZ7A 2OYHB 1AQ5A 3M0DC 3HE5A 2FYUK 2O1KA 1HVVA 3HRNA 3VMZA 2P1JA 1CI6A 5AVQB 2OYIA 3C9IA 1RF1C 5AVXB 1HJBA 5KJ7D 5APVA 1KZUB 2HFED 2W6AA 2HYNA 2L5GB 4GKGA 4WY4C 5CCGC 2WSFH 1LTJC 2POHA 1LTIC 2WPQA 4WBAA 3N4XA 2QM8A 1OXZA 4HH2A 3M9QA 1M1JC 3A3YB 3A5TA 4XA4A 1JY3P 2H7HA 1RF1A 3GHGC 2OYIC 2IX7C 1URQB 1ZV8A 1T3UA 2P7JA 3U1CA 1NKZB 3OAKA 3VMXA 4JF7A 3VTPC 4JYCA 2N1TD 1S9KE 3II6A 1IC2A 3NMDA 4EOTA 1KILB 5AVZB 3V2PA 3KYQA 1JMMA 3L35A 3RK3C 4I1LA 3N7NA 3M0DA 1RY3A 1SQBK 1X79B 1RE3A 5BU8B 1EQ7A 2LKMA 1VDFA 3RK3B 2CPSA 4RESB 4W7ZA 1GD2E 2FFDC 1FDMA 3V2NA 1M1JB 3HUSC 2HPCB 4GT1A 2XKMA 4KHXA 2C0WA 3GHGB 4W80A 5AW6B 1FBMA 1L0NK 2NPSA 1T2KC 1QL2A 1IFDA 2FXMA 1GDTA 1L0LK 1G2CB 4WY4A 2XZRA 3TSIA 2Q9IA 1CW5A 1IFNA 3M9HA 3GHGA 1W2EA 2OYIB 4DZOA 1GW3A 1FJPA 1SFCB 2XU6A 1J1EC 1SFCD 1LTBC 2YO3A 1LWUC 1J2JB 3HE4A 3MIWA 1T2KD 5CCGA 1IK9A 3BASA 2C9NY 5KJ7A 4N3YB 5APUA 3H6PA 5AVVB 1NHLA 3L37A 3V2RA 1A02F 3NXSA 5AW2B 1XTGB 2Q7CA 1JTHA 3RK3D 3B8EB 5AW7B 3IFMA 2ZXEB 3H32A 3NFQA 5AVYB 3IR9A 1FZCA 1KFNA 3EQ2A 1SLQA 1GK6A 5CJ0A 5BVZA 1JTHB 2J58A 3RL0B 1FZGA 3MUDA 1HTLC 1KILD 5AW8B 1GW4A 2HG5D 2HODB 2WITA 2W6BA 5APYA 1ZR4A 3OA7A 1NAFA 4N6JA 4AUWA 2N9BA 1HGVA 3B5ND 1NWQA 2YKQA 2WT7B 4Y99C 3P8MC 2GM4A 4M3LA 2FYZA 3RK2C 1FU1A 1S9KD 2OYHA 2WPRA 1YYCA 5KTBA 2CPBA 1T8ZA 1YTZI 2R3CA 3V4QA 2H43A 1JY2O 1N7SA 3LW5H 4HYTB 2GUSA 2GUVA 1L4AA 3WMM0 1OWAA 5AVRB 5AW3B 1IFJA 2N1TB 1JY2N 2WPSA 5AW5B 1J1DB 2FFDB 1FZCC 1URQD 3HUSB 2WT7A 1RE3C 1MZ9A 3U1AA 5CCHA 1NU1K 2OYHC 2PP6A 1DX7A 4ZKUA 2KSJA 1RF0A 3LIDA 1FZBA 3TK1A 1GL2C 1LT9C 2O1JA 3BRTB 1L4AB 2WTYA 1L4AC 3CL3D 1N7SC 2N1TA 2O01H 2P67A 3I5CA 5CCHD 1NH4A 4LC1A 3KPEA 1URQC 2KP8A 5AW1B 1G1JA 3TNUB 2W27A 1H8AA 5BU5A 1FZAA 3CI9A 1SVFA 1H88A 3BRVB 1ZR2A 1LTAC 1VPCA 3RK2D 1FZEA 1RF1B 3HD7C 2M3BA 3RL0D 3BVHA 2BASA 5CHXA 1N73B 2FFDA 1GU5A 2XDJA 1X9VA 1JCCA 1SQQK 1NO4A 4I2LC 2C9LY 3VOPA 5CMZA 1HBWA 3B5NB 3KDPB 4AYCA 4IFDK 1JY2P 4ZKPA 3P8CD 1HWTC 1LTGC 4JYBA 2WWWA 1ZN5A 3HTKB 3KQGA 1G2CA 3B5NC 5APWA 2M8RA 2KYVA 2R5BA 2J59M 4N78E 1CZQA 3HD7D 1HH0A 4Y99B 1X8YA 1KILC 3P7KA 5KJ7C 5APXA 3VP8A 1HGZA 1DH3A 2P2UA 1URQA 1J1EB 1JCDA 1JNMA 3U59A 1MV8A 2Q5UA 3A7OA 3VN0A 1GTWA 3P8CE 3RL0C 1JY3N 2KOGA 3BATA 3LIEA 1SFCA 5APSA 3VP9A 3UIAA 1G1IA 1LTSC 1N73A 1XTCC 3PP5A 3V2QA 1CI6B 3A2AA 4GIFA 4IFMA 1SQPK 1CSBA 3L4FA 1NTKK 4DOJA 1FZFA 1NTMK 2A45H 2MJZA 4WY4B 5APQA 4C46A 5AW9B 2JJLA 2HLOA 1GL2D 3M9BA 2I1KA 3L36A 4N78D 5CCHC 2PAJA 3RK2B 1M7LA 1N7SD 3HE4B 1SFCC 1NOHA 1N7SB 2KLVA 4C7NA 5AVWB 1LWUA 3M91A 2Z5IA 1NTZK 3R2PA 1GL2B 1LT9B 1WT6A 2Q3IA 2E42A 3CLQA 1IJDB 1N2DC 1M1JA 2NPSD 1KILA 3T97A 2HPCA 4C7NB 3SWFA 4WB4A 2KB7P 3V4WA 3OJAB 3P32A 1N86A 2Z5HA 3VYIA 2E43A 2NPSB 1GK4A 1LTJA 1LTTC 1J1DC 1SQVK 3NTNA 4B86A 2WSEH 1QL1A 4IFFA 2N1TC 3M06A 4LGDE 2FKWB 1RE4A 5AVUB 1JUNA 1FZCB 1HUCA 1SP4A 4W7YA 5CJ4A 2YO2A 2YMYA 5CCGD 1RF0C 2JEEA 2ZFCA 1Z56A 3E1IA 3SWYA 3MTUE 3G3ZA 2HODA 2XNXA 2IFNA 3VMYA 1LWUB 2I1JA 4WY4D 1JY3O 4I6MC 4C7RA 2A45G 3EFGA 5AVSB 2YNYA 2NPSC 4EIJA 2IPPA 1JOCA 1NKNA 2YKPA 3MGNA 3M0AA 1PFIA 1IFIA 2H8PD 4LLHA 5AW4B 1IO4A 3H32B 1SQXK 5AVTB 1GL2A 1LT9A 1GU4A 1H89A 2R5DA 1N73C 3B5NA 2YKOA 3HUSA 1MFZA 4AQRD 2C0XA 3HD7B 4OH8B 3HE5B 1E5WA 1A02J 3TNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WY4 B;  5CCH A;  4W80 A;  2PP6 A;  2NPS A;  1GL2 D;  4WY4 A;  3TSI A;  5CCH C;  3RK2 B;  1N7S D;  1GL2 C;  1L4A B;  1SFC B;  1L4A C;  1SFC C;  1L4A D;  1SFC D;  1N7S B;  1N7S C;  2N1T A;  5CCH D;  1GL2 B;  1URQ C;  5CCG A;  5KJ7 A;  2NPS D;  1KIL A;  1NHL A;  1XTG B;  3RK2 D;  1T3J A;  2NPS B;  1JTH A;  3RK3 D;  3HD7 C;  3RL0 D;  3HD7 A;  2WZ7 A;  3M0D C;  1HVV A;  2XDJ A;  2N1T C;  1JTH B;  4LGD E;  3RL0 B;  5KJ7 D;  3VOP A;  1KIL D;  2HFE D;  4W7Y A;  4WY4 C;  2YMY A;  5CCG C;  3B5N B;  5CCG D;  2HG5 D;  3HTK B;  3B5N C;  2M8R A;  4N78 E;  4WY4 D;  3B5N D;  1URQ B;  3HD7 D;  2NPS C;  1KIL C;  5KJ7 C;  4JF7 A;  3RK2 C;  2N1T D;  1URQ A;  1KIL B;  3P8C E;  1N7S A;  2H8P D;  3KYQ A;  3RL0 C;  2KOG A;  3RK3 C;  1L4A A;  1SFC A;  1GL2 A;  3B5N A;  2N1T B;  3PP5 A;  3HD7 B;  3RK3 B;  4OH8 B;  4W7Z A;  1URQ D; 
#chains in the Genus database with same CATH topology
 3MD0 A;  4XE5 B;  1LTJ B;  2IBZ E;  2YXR B;  5EFW B;  3PHL A;  3H1K D;  1WRG A;  3H1L G;  3H1J J;  3CCQ P;  5KKZ B;  2G8Y A;  1PGP A;  4HB1 A;  3CC2 P;  4L75 A;  4IOI H;  1L0L J;  1NYH A;  4EI2 A;  1QVF O;  1MUU A;  2KNC B;  2QM7 A;  3GF3 A;  1YTZ T;  1ZLL A;  4O9B A;  4BRY B;  4YXW H;  5TIS E;  2R3S A;  1E79 H;  2QIW A;  5APT A;  1KQL A;  1OZH A;  1FAV A;  1EXI A;  4OGQ D;  5GTH H;  4EYY Q;  1H0T A;  2E5T A;  1BGY E;  2QJP C;  3HTK A;  4CPG A;  1DEB A;  2FYU J;  2OAR A;  2O3J A;  3FXD A;  3V5B A;  1L4A D;  3AE4 C;  1L0L E;  2ZAE B;  5B5E E;  1AFO A;  2KK7 A;  3L72 E;  2A06 D;  1RE4 C;  3O8Z A;  1VQ4 P;  1M1K Q;  5AW0 B;  1N7L A;  1JO5 A;  1AV1 A;  3H1I D;  3SSU A;  2E74 D;  2FBW C;  1AQT A;  2VRS A;  2Z4E A;  1AA0 A;  1AVY A;  1GZL A;  1IFM A;  1KFM A;  1NTK D;  2M3E A;  1K73 Q;  2E75 C;  2J5U A;  1FDO A;  1LGH B;  2WSC H;  2R44 A;  1BE3 D;  4U3F E;  3TF5 A;  1FOS F;  1PP9 E;  3I55 P;  1SQV E;  2BEQ D;  1Q86 Q;  1FOS E;  2V7Q J;  1T3J A;  1X0T A;  1IZN B;  2MKV A;  2R32 A;  3AE9 C;  5KLV K;  3TYY A;  2C9L Y;  2P10 A;  2XV5 A;  3HD7 A;  5B5E H;  2IFM A;  1FJK A;  2A45 I;  2WZ7 A;  2Y9Y A;  3AE2 C;  3WU2 H;  3M0D C;  3HE5 A;  2FYU K;  2O1K A;  3L71 E;  4PV1 D;  1SQX G;  1HVV A;  2V4H A;  1PGO A;  3HRN A;  3VMZ A;  3Q5S A;  1KC8 Q;  2P1J A;  1CI6 A;  5AVQ B;  4QMA A;  3C9I A;  3CXH D;  5AVX B;  2OYI A;  3CCU P;  1HJB A;  5KJ7 D;  1RF1 C;  5APV A;  1L0N G;  3L73 J;  1KZU B;  1BCC D;  2HFE D;  2W6A A;  2HYN A;  3RBZ A;  2ZJS E;  3G71 P;  1L0L G;  2L5G B;  1L0N E;  1FZF A;  3S1K A;  4GKG A;  4WY4 C;  2FYN B;  2IYO A;  5CCG C;  2WSF H;  1LTJ C;  4H44 D;  4Z1M H;  1LJ2 A;  1LTI C;  2POH A;  2WPQ A;  3AEB C;  3B71 A;  3H1L J;  2JKV A;  2QM8 A;  3IF4 A;  1JM0 A;  1K05 A;  1KB9 I;  1OXZ A;  1QLE D;  3H1J D;  3Q2Y A;  2D2C C;  4XFJ A;  1SQX J;  3I56 P;  3MHV A;  3TNU A;  2FYU G;  4HH2 A;  2NRG A;  3M9Q A;  1M1J C;  3A3Y B;  3A5T A;  4XA4 A;  1JY3 P;  1KYO D;  1Q2N A;  2H7H A;  2N9Y B;  1ZW0 A;  1RF1 A;  3GHG C;  4PV1 C;  2OYI C;  2IX7 C;  3A0B E;  3H1L E;  3D70 A;  2Q3E A;  1URQ B;  1ZV8 A;  1T3U A;  2HR3 A;  2P7J A;  1YJ9 P;  2JWD A;  4U7J A;  3TGU D;  1NKZ B;  4UB6 H;  3U1C A;  1AJY A;  3OAK A;  3VMX A;  1Y47 A;  4JF7 A;  3VTP C;  4JYC A;  3H25 A;  1QGK B;  2QVA A;  4ASW A;  2N1T D;  1RQV A;  3QWO C;  3R4Y A;  1S9K E;  3CCE P;  1SS1 A;  2Y9Z A;  1VQM P;  3II6 A;  1IC2 A;  3NMD A;  2QA4 P;  1VQ6 P;  1YBK A;  4EOT A;  1KIL B;  5AVZ B;  2OYO A;  3H1J E;  3V2P A;  3KYQ A;  2OTL P;  2H89 C;  1JMM A;  3L35 A;  4H0L D;  3JSV C;  2K88 A;  3GLM A;  4I1L A;  3N7N A;  3RK3 C;  4K3A A;  4ZNC A;  3M0D A;  1RY3 A;  1SQB K;  1BGY D;  1X79 B;  1RE3 A;  4NPF X;  5BU8 B;  1VQP P;  1YJW P;  1EQ7 A;  3N4X A;  1LP1 B;  2LKM A;  4L76 A;  1EZV G;  1NU1 J;  1VDF A;  3AE6 C;  3RK3 B;  1VQO P;  2CPS A;  2B87 B;  4RES B;  4W7Z A;  1GD2 E;  1KTM A;  5E79 E;  2FFD C;  2IZ1 A;  4I7Z B;  1FDM A;  3G6E P;  2QJY C;  3V2N A;  1M1J B;  3HUS C;  3H1I J;  4GT1 A;  2XKM A;  2KLU A;  4KHX A;  2HPC B;  2C0W A;  4U3F G;  3GHG B;  4PV1 B;  4W80 A;  3L75 G;  4JPZ B;  1FBM A;  5AW6 B;  3JCU E;  1L0N K;  4UB6 E;  2NPS A;  1BE3 J;  1QL2 A;  1IFD A;  2FXM A;  1U7M A;  1SQX E;  2IDB A;  3KHU A;  3Q5R A;  1T2K C;  1L0L K;  1G2C B;  1OW8 A;  4WY4 A;  2XZR A;  3A0B H;  3TSI A;  2Q9I A;  1CW5 A;  1P84 H;  1SQP D;  1IFN A;  2ZXX A;  3M9H A;  2K1A A;  1W2E A;  3CXH I;  3GHG A;  1GW3 A;  3RBX A;  4DCK A;  1SFC B;  2K9J A;  2XU6 A;  4DZO A;  4DT0 A;  1J1E C;  1SFC D;  1SQB D;  2AEF A;  4GDO A;  3L74 E;  3O6Q A;  3SWK A;  1LTB C;  1OIP A;  1OW6 A;  1S1C X;  1NU1 D;  1M57 D;  1LWU C;  2KS1 A;  2KSE A;  2YO3 A;  4YXD C;  1S5L X;  2JR8 A;  1J2J B;  3HE4 A;  1VF5 D;  3MIW A;  4PD4 H;  1S5L E;  1T2K D;  5CCG A;  1IK9 A;  3BAS A;  2C9N Y;  4WVZ A;  3OW2 O;  5KJ7 A;  1OFC X;  2KUB A;  4N3Y B;  5APU A;  3CMA P;  1EDJ A;  3H6P A;  5AVV B;  1NHL A;  3L37 A;  5L8R J;  3AE1 C;  3V2R A;  1A02 F;  3V4W A;  5DJU B;  1W5C E;  3NXS A;  5AW2 B;  1L0N J;  1XTG B;  1ZOY C;  1VQK P;  5C39 A;  2WSE J;  2Q7C A;  5CBN A;  1JTH A;  2W8Z A;  4H0L C;  3B8E B;  3RK3 D;  3CPW O;  3AED C;  1NTK E;  3H1H J;  5AW7 B;  3IFM A;  1OMI A;  2ZXE B;  3H32 A;  3NFQ A;  5AVY B;  5TJH A;  1KYO H;  3PJS K;  3IR9 A;  1SQP E;  3D6Z A;  2KNC A;  1KFN A;  4BRY A;  3EQ2 A;  1FZC A;  1SLQ A;  4H44 C;  1GK6 A;  1VF5 B;  5CJ0 A;  1SQB G;  5BVZ A;  1JTH B;  2J58 A;  1BCC J;  3H1I G;  3RL0 B;  1FZG A;  1EC5 A;  1M8O B;  3GG2 A;  1HTL C;  3H1J G;  2ZT9 B;  3JCU H;  2V7Q H;  3MUD A;  1KIL D;  2IYP A;  4R4M A;  5AW8 B;  3AE7 C;  1YJN P;  1GW4 A;  3MP7 B;  1YQ4 C;  2K9Y A;  4TLF A;  4GOF A;  2HG5 D;  2OTK E;  2HOD B;  2WIT A;  2Y0C A;  5KLI C;  1IFP A;  1LP1 A;  2W6B A;  3L75 E;  5APY A;  3A0H E;  1SQB E;  2FXO A;  4OVN F;  2K9J B;  1ZR4 A;  3RL0 g;  3OA7 A;  1IK7 A;  1TU3 F;  1NAF A;  2L91 A;  2PFX A;  4N6J A;  4AUW A;  5GTH E;  3ABV C;  2JWA A;  4H13 D;  1K04 A;  4BWN A;  2AXT E;  2O01 J;  2N9B A;  1HGV A;  1P84 E;  2KS1 B;  3AE3 C;  3L74 J;  4TT3 H;  5KKZ C;  1ZRT E;  3B5N D;  2QEX P;  2KIK A;  1NWQ A;  3TGU E;  2YKQ A;  1KMI Z;  1UII A;  1PPJ E;  2WT7 B;  4Y99 C;  1K8A Q;  3P8M C;  2GM4 A;  3EFF K;  4M3L A;  3T97 B;  2FYZ A;  3RK2 C;  1FU1 A;  1S9K D;  2OYH A;  2ZYA A;  2IBZ D;  2WPR A;  3L73 D;  3SFE C;  1YYC A;  5KTB A;  1U7J A;  1BGY G;  1KIL E;  1T8Z A;  1YTZ I;  2CPB A;  1P84 I;  2R3C A;  3V4Q A;  5E79 H;  2H43 A;  3VMA A;  1JY2 O;  3MUD C;  2FYU D;  1N7S A;  2Q1K A;  3H1H G;  1Y9B A;  2PRR A;  2SPZ A;  3LW5 H;  1PP9 G;  4HYT B;  1YQ3 C;  2GUS A;  1NU1 G;  2GUV A;  1L4A A;  3D71 A;  1NTK J;  3WMM 0;  1M56 D;  1OWA A;  2AXT H;  4EDF A;  3Q1M A;  3D6Y A;  1YHQ P;  3L73 E;  3L70 J;  5AVR B;  3PLN A;  4KT0 J;  5AW3 B;  1IFJ A;  1PL5 A;  2N1T B;  2FYN C;  2QJK B;  2QJK C;  2RMZ A;  3FX0 A;  1JY2 N;  2WPS A;  2ZYG A;  5AW5 B;  2WMM A;  3A0H H;  1J1D B;  4HJG H;  1NTM E;  2KZI A;  2FFD B;  3IAO A;  1FZC C;  1ZRT D;  2QRX A;  1URQ D;  1KYO I;  3HUS B;  2WT7 A;  5KAI H;  1RE3 C;  1MZ9 A;  1L0N D;  3U1A A;  3WUU A;  2B88 A;  5CCH A;  2WVR A;  1VQ9 P;  2FY8 A;  1NJI Q;  4MN4 C;  3K5B A;  1NU1 K;  2K37 A;  2OYH C;  2PP6 A;  2H88 C;  1EDI A;  1DX7 A;  1K9M Q;  2FYU E;  4H44 B;  2PGD A;  3WUV A;  1OVR A;  4ZKU A;  1EZV I;  2KSJ A;  1RF0 A;  4JQ0 D;  3C8V A;  1FZB A;  3LID A;  3WU2 E;  1KYO E;  3TK1 A;  3CCV P;  1GL2 C;  1LT9 C;  2O1J A;  3BRT B;  1BE3 G;  1L4A B;  2QG4 A;  3H1K E;  1L4A C;  3CL3 D;  5CBO A;  2WTY A;  3GMA A;  1UIX A;  4OWF A;  1QVG O;  2Y0D A;  1M90 Q;  1N7S C;  1GDT A;  2N1T A;  2B9B A;  2O01 H;  2P67 A;  3I5C A;  5CCH D;  2OTJ P;  1NH4 A;  2A06 E;  4LC1 A;  1GTW A;  1SQP J;  3KPE A;  1KQG B;  1URQ C;  1KOR A;  4D6T G;  2KP8 A;  3H1K J;  4UB8 E;  1FC2 C;  5AW1 B;  1PV3 A;  1G1J A;  1KB9 E;  3L72 J;  3TNU B;  1SQQ G;  2W27 A;  1H8A A;  1USD A;  1S5L H;  5BU5 A;  1FZA A;  3CI9 A;  1SVF A;  1RHZ B;  4PD4 E;  3Q3D A;  2XND H;  1H88 A;  1NU1 E;  3AE5 C;  1LTA C;  1VPC A;  2B89 A;  3BRV B;  3V6I A;  3RK2 D;  1ZR2 A;  2IBZ I;  4H13 C;  1FZE A;  2E76 C;  2YIU B;  1NTZ E;  2OGU A;  4RKU J;  1SQP G;  1RF1 B;  1SQV J;  2M3B A;  3HD7 C;  3RL0 D;  3BVH A;  4RO0 A;  1BDD A;  1NTK G;  2BAS A;  3BCC E;  1NTM G;  5CHX A;  1N73 B;  4PD4 I;  2FFD A;  1KV4 A;  1FE6 A;  1GU5 A;  1PGJ A;  2XDJ A;  1X9V A;  1JCC A;  1SQQ K;  3CWB G;  1NO4 A;  3H1L D;  4I2L C;  3W68 A;  1Q7Y Q;  1NTZ J;  3ITK A;  5CMZ A;  3VOP A;  4D6T J;  2OYH B;  4OGQ B;  1MFT A;  1HBW A;  2OQQ A;  1OX3 A;  2QJY B;  3TGU G;  3B5N B;  3KDP B;  4AYC A;  2W90 A;  4IFD K;  1JY2 P;  3KXD A;  4GOE A;  2P58 A;  4ZKP A;  1VQ8 P;  3P8C D;  1HWT C;  1LTG C;  1S2E A;  1EDK A;  1LNQ A;  4JYB A;  1SQQ D;  1X22 A;  1ZN5 A;  2WWW A;  4C7R A;  4D6T E;  3HTK B;  3CWB E;  3KQG A;  1SQB J;  1G2C A;  3CCS P;  3CC4 P;  3AEG C;  1HJ0 A;  3B5N C;  5APW A;  1DD3 A;  2M8R A;  5KLV J;  1KN7 A;  2KYV A;  2R5B A;  2IBZ G;  1RH5 B;  3FGA D;  2J59 M;  3AEE C;  4N78 E;  4DJG A;  3CCR P;  1CZQ A;  5TIS H;  5M1B A;  2ZYD A;  1BDC A;  1S3J A;  3HD7 D;  1HH0 A;  4Y99 B;  1X8Y A;  2WPV B;  1R5L A;  1KIL C;  3CX5 I;  3P7K A;  5KJ7 C;  4YPC A;  5APX A;  2ZVN B;  2JDI H;  1HGZ A;  1EZV D;  2QSI A;  3VP8 A;  3FXE A;  3ZDM A;  5K5G B;  1DH3 A;  2E74 B;  2P2U A;  2NZ2 A;  3RGU A;  1GMJ A;  4IL6 E;  3H1K G;  1URQ A;  1J1E B;  1JCD A;  1JNM A;  2LXB A;  1MV8 A;  1SQQ E;  2Q5U A;  3CXH E;  3U59 A;  3A7O A;  3WUT A;  3VN0 A;  2ZVO B;  3P8C E;  4HKZ H;  3RL0 C;  1JY3 N;  3PRJ A;  1SQV D;  2KOG A;  1R5S A;  1YIT P;  1SQV G;  3BAT A;  1OVU A;  2E74 C;  3LIE A;  1SFC A;  1Y8A A;  3CX5 E;  5KLV D;  5APS A;  3VP9 A;  4PJ0 E;  3UIA A;  1G1I A;  1EXJ A;  2BEZ F;  1LTS C;  1N73 A;  2M5A A;  3Q5P A;  1XTC C;  3O6Q B;  4A7P A;  1BSN A;  2W6J H;  1PP9 J;  3CX5 H;  3PP5 A;  4ZMD A;  3H1I E;  3V2Q A;  1ZXG A;  1CI6 B;  3A2A A;  4GIF A;  4IFM A;  3CC7 P;  1SQP K;  3AE8 C;  3KZI E;  2FXP A;  1CSB A;  1PZQ A;  3L71 G;  3L4F A;  1L0L D;  4I7Z C;  4K35 A;  1W2B O;  2WSC J;  1NTK K;  4DOJ A;  1VF5 C;  1NTM K;  2IZ0 A;  2A45 H;  1BE3 E;  2M5A B;  3BCC D;  5KAF H;  2MJZ A;  4WY4 B;  2KI7 B;  2WQY C;  5APQ A;  1NTZ G;  2Q6Q A;  3L71 J;  1NTZ D;  3L73 G;  2E75 D;  4C46 A;  4Y28 J;  5AW9 B;  2Y0E A;  5B66 E;  3CME P;  2JJL A;  3G4S P;  2HLO A;  1NTM D;  1GL2 D;  3JC2 2;  2I1K A;  3M9B A;  3L36 A;  1YI2 P;  2I8D A;  1T6A A;  3S4R A;  2BCC D;  1JMB A;  4N78 D;  1NAY A;  2KZJ A;  2PAJ A;  3RK2 B;  5CCH C;  1M7L A;  1N7S D;  3HE4 B;  1KB9 D;  1SFC C;  1NOH A;  1PIX A;  3CX5 D;  3USS A;  1N7S B;  1N8R Q;  2KLV A;  1SQX D;  4C7N A;  5AVW B;  1NGM B;  1LWU A;  3M91 A;  3CD6 P;  2Z5I A;  1BSH A;  1NTZ K;  3R2P A;  1GL2 B;  1LT9 B;  1WT6 A;  2D2C B;  2Q3I A;  1Q82 Q;  1FJP A;  2WSF J;  2A06 G;  2E42 A;  1AQ5 A;  3QH9 A;  1D7M A;  2E75 B;  3CLQ A;  1IJD B;  1OVV A;  2YIU C;  1N2D C;  1M1J A;  2NPS D;  1KIL A;  2WSS H;  3T97 A;  4C7N B;  4IL6 X;  2HPC A;  3SWF A;  1BCC G;  1VQN P;  3LW5 J;  2KB7 P;  4WB4 A;  4WY4 D;  2RN0 A;  3C1L A;  3E1R A;  3OJA B;  3P32 A;  1N86 A;  2Z5H A;  4L73 A;  2AEM A;  3VYI A;  2JO1 A;  2E43 A;  3L70 D;  1YIJ P;  1FS0 E;  3AEA C;  2NPS B;  1NTM J;  3GF7 A;  1GK4 A;  1LTJ A;  2K3R A;  3F5H A;  3L70 G;  1PPJ G;  1P84 D;  1S72 P;  4RJT A;  4H0L B;  1LTT C;  2UWJ E;  3PTZ A;  4WBA A;  1DD4 A;  1Q90 D;  2ZT9 C;  2G3A A;  2D2C D;  1J1D C;  1SQV K;  3CWB D;  4YTP C;  3AEC C;  3NTN A;  2B87 A;  2WSE H;  4B86 A;  4H13 B;  1VL2 A;  1ZME C;  1DIP A;  1QL1 A;  1NVO A;  2AEJ A;  2GA1 A;  2LR2 A;  3BCC J;  2ITA A;  2N1T C;  3M06 A;  4IFF A;  1KQF B;  3CCM P;  1KQS O;  1Q81 Q;  4LGD E;  1L2P A;  3CCL P;  2FKW B;  2O01 N;  4U3F D;  5KLI B;  1RE4 A;  5B66 H;  1EDL A;  3GW6 A;  5AVU B;  4NPE A;  1HF9 A;  1JUN A;  3L75 J;  3FWL A;  3CCJ P;  1FZC B;  1KB9 H;  3EWK A;  4WWI A;  3W67 A;  2CK3 H;  4UB8 H;  1HUC A;  1SP4 A;  4W7Y A;  3TDK A;  2RH0 A;  2YO2 A;  2YMY A;  1MKM A;  4BXL A;  5CCG D;  5CJ4 A;  1VQ5 P;  1VQ7 P;  3S9O A;  1RF0 C;  2JEE A;  4U3F J;  1LT1 A;  2ZFC A;  1OW7 A;  1QEX A;  1Z56 A;  3IN6 A;  2OYI B;  3E1I A;  2ZT9 D;  3E7K A;  1AVO A;  3SWY A;  3G9R A;  3MTU E;  3CWB J;  4ASV A;  1R8E A;  3G3Z A;  2HOD A;  1FDI A;  2XNX A;  1VQL P;  2IFN A;  3VMY A;  5KLV E;  3RK3 E;  1LWU B;  1USE A;  2BCC E;  2I1J A;  2QJP B;  3FWN A;  3H1H E;  1JY3 O;  3PH0 A;  4I6M C;  2A45 G;  3EFG A;  4JBZ A;  1PPJ D;  2LXC B;  1S4X A;  5H2F H;  4NPD A;  5AVS B;  2BCC G;  2YNY A;  3MZW B;  3L72 D;  5GTI E;  2NPS C;  1BGY J;  3CXH H;  3L72 G;  4EIJ A;  1JEK A;  2AXC A;  2IPP A;  3F89 A;  4IL6 H;  1JOC A;  1BCC E;  1NKN A;  1PGQ A;  2YKP A;  3SFD C;  3AEF C;  1EZV E;  2BCC J;  2M0B A;  3MGN A;  5KAI E;  2E5Y A;  2QE7 H;  5KAF E;  1ZP0 C;  3M0A A;  3L70 E;  5KLV G;  5GTI H;  1PFI A;  1DEE G;  1IFI A;  1SQQ J;  3KZI H;  2H8P D;  3L75 D;  3L74 G;  5H2F E;  2W83 C;  2YXQ B;  3L74 D;  1H0T B;  3L71 D;  4L74 A;  4LLH A;  5AW4 B;  1IO4 A;  3H32 B;  4PD4 D;  1SQX K;  2RKL A;  5AVT B;  1GL2 A;  1LT9 A;  1GU4 A;  1U57 A;  3BCC G;  2R5D A;  1H89 A;  2E76 B;  3B5N A;  2YKO A;  1KD1 Q;  3HUS A;  1MFZ A;  1JB0 J;  4PJ0 H;  1N73 C;  4AQR D;  4KJM A;  4R4L A;  1QX8 A;  2C0X A;  2JP3 A;  3HD7 B;  4D6T D;  4OH8 B;  3B4S A;  3HE5 B;  1E5W A;  2KXP B;  4GOD A;  4OGQ C;  2DW3 A;  2E76 D;  1PP9 D;  5DJT B;  1WMK A;  2YMK A;  1A02 J;  3H1H D;  3TGU J;  1RQU A; 
#chains in the Genus database with same CATH homology
 3MD0 A;  4XE5 B;  1LTJ B;  1WRG A;  1MUU A;  2QM7 A;  4O9B A;  1YTZ T;  1ZLL A;  5APT A;  1KQL A;  1FAV A;  3HTK A;  1DEB A;  2OAR A;  3V5B A;  1L4A D;  1AFO A;  1RE4 C;  3O8Z A;  5AW0 B;  1N7L A;  1JO5 A;  2VRS A;  2Z4E A;  1GZL A;  1IFM A;  1KFM A;  1LGH B;  2WSC H;  1FOS F;  1FOS E;  1T3J A;  2R32 A;  5KLV K;  3TYY A;  2XV5 A;  3HD7 A;  2IFM A;  1FJK A;  2A45 I;  2WZ7 A;  2OYH B;  1AQ5 A;  3M0D C;  3HE5 A;  2FYU K;  2O1K A;  1HVV A;  3HRN A;  3VMZ A;  2P1J A;  1CI6 A;  5AVQ B;  2OYI A;  3C9I A;  1RF1 C;  5AVX B;  1HJB A;  5KJ7 D;  5APV A;  1KZU B;  2HFE D;  2W6A A;  2HYN A;  2L5G B;  4GKG A;  4WY4 C;  5CCG C;  2WSF H;  1LTJ C;  2POH A;  1LTI C;  2WPQ A;  4WBA A;  3N4X A;  2QM8 A;  1OXZ A;  4HH2 A;  3M9Q A;  1M1J C;  3A3Y B;  3A5T A;  4XA4 A;  1JY3 P;  2H7H A;  1RF1 A;  3GHG C;  2OYI C;  2IX7 C;  1URQ B;  1ZV8 A;  1T3U A;  2P7J A;  3U1C A;  1NKZ B;  3OAK A;  3VMX A;  4JF7 A;  3VTP C;  4JYC A;  2N1T D;  1S9K E;  3II6 A;  1IC2 A;  3NMD A;  4EOT A;  1KIL B;  5AVZ B;  3V2P A;  3KYQ A;  1JMM A;  3L35 A;  3RK3 C;  4I1L A;  3N7N A;  3M0D A;  1RY3 A;  1SQB K;  1X79 B;  1RE3 A;  5BU8 B;  1EQ7 A;  2LKM A;  1VDF A;  3RK3 B;  2CPS A;  4RES B;  4W7Z A;  1GD2 E;  2FFD C;  1FDM A;  3V2N A;  1M1J B;  3HUS C;  2HPC B;  4GT1 A;  2XKM A;  4KHX A;  2C0W A;  3GHG B;  4W80 A;  5AW6 B;  1FBM A;  1L0N K;  2NPS A;  1T2K C;  1QL2 A;  1IFD A;  2FXM A;  1GDT A;  1L0L K;  1G2C B;  4WY4 A;  2XZR A;  3TSI A;  2Q9I A;  1CW5 A;  1IFN A;  3M9H A;  3GHG A;  1W2E A;  2OYI B;  4DZO A;  1GW3 A;  1FJP A;  1SFC B;  2XU6 A;  1J1E C;  1SFC D;  1LTB C;  2YO3 A;  1LWU C;  1J2J B;  3HE4 A;  3MIW A;  1T2K D;  5CCG A;  1IK9 A;  3BAS A;  2C9N Y;  5KJ7 A;  4N3Y B;  5APU A;  3H6P A;  5AVV B;  1NHL A;  3L37 A;  3V2R A;  1A02 F;  3NXS A;  5AW2 B;  1XTG B;  2Q7C A;  1JTH A;  3RK3 D;  3B8E B;  5AW7 B;  3IFM A;  2ZXE B;  3H32 A;  3NFQ A;  5AVY B;  3IR9 A;  1FZC A;  1KFN A;  3EQ2 A;  1SLQ A;  1GK6 A;  5CJ0 A;  5BVZ A;  1JTH B;  2J58 A;  3RL0 B;  1FZG A;  3MUD A;  1HTL C;  1KIL D;  5AW8 B;  1GW4 A;  2HG5 D;  2HOD B;  2WIT A;  2W6B A;  5APY A;  1ZR4 A;  3OA7 A;  1NAF A;  4N6J A;  4AUW A;  2N9B A;  1HGV A;  3B5N D;  1NWQ A;  2YKQ A;  2WT7 B;  4Y99 C;  3P8M C;  2GM4 A;  4M3L A;  2FYZ A;  3RK2 C;  1FU1 A;  1S9K D;  2OYH A;  2WPR A;  1YYC A;  5KTB A;  2CPB A;  1T8Z A;  1YTZ I;  2R3C A;  3V4Q A;  2H43 A;  1JY2 O;  1N7S A;  3LW5 H;  4HYT B;  2GUS A;  2GUV A;  1L4A A;  3WMM 0;  1OWA A;  5AVR B;  5AW3 B;  1IFJ A;  2N1T B;  1JY2 N;  2WPS A;  5AW5 B;  1J1D B;  2FFD B;  1FZC C;  1URQ D;  3HUS B;  2WT7 A;  1RE3 C;  1MZ9 A;  3U1A A;  5CCH A;  1NU1 K;  2OYH C;  2PP6 A;  1DX7 A;  4ZKU A;  2KSJ A;  1RF0 A;  3LID A;  1FZB A;  3TK1 A;  1GL2 C;  1LT9 C;  2O1J A;  3BRT B;  1L4A B;  2WTY A;  1L4A C;  3CL3 D;  1N7S C;  2N1T A;  2O01 H;  2P67 A;  3I5C A;  5CCH D;  1NH4 A;  4LC1 A;  3KPE A;  1URQ C;  2KP8 A;  5AW1 B;  1G1J A;  3TNU B;  2W27 A;  1H8A A;  5BU5 A;  1FZA A;  3CI9 A;  1SVF A;  1H88 A;  3BRV B;  1ZR2 A;  1LTA C;  1VPC A;  3RK2 D;  1FZE A;  1RF1 B;  3HD7 C;  2M3B A;  3RL0 D;  3BVH A;  2BAS A;  5CHX A;  1N73 B;  2FFD A;  1GU5 A;  2XDJ A;  1X9V A;  1JCC A;  1SQQ K;  1NO4 A;  4I2L C;  2C9L Y;  3VOP A;  5CMZ A;  1HBW A;  3B5N B;  3KDP B;  4AYC A;  4IFD K;  1JY2 P;  4ZKP A;  3P8C D;  1HWT C;  1LTG C;  4JYB A;  2WWW A;  1ZN5 A;  3HTK B;  3KQG A;  1G2C A;  3B5N C;  5APW A;  2M8R A;  2KYV A;  2R5B A;  2J59 M;  4N78 E;  1CZQ A;  3HD7 D;  1HH0 A;  4Y99 B;  1X8Y A;  1KIL C;  3P7K A;  5KJ7 C;  5APX A;  3VP8 A;  1HGZ A;  1DH3 A;  2P2U A;  1URQ A;  1J1E B;  1JCD A;  1JNM A;  3U59 A;  1MV8 A;  2Q5U A;  3A7O A;  3VN0 A;  1GTW A;  3P8C E;  3RL0 C;  1JY3 N;  2KOG A;  3BAT A;  3LIE A;  1SFC A;  5APS A;  3VP9 A;  3UIA A;  1G1I A;  1LTS C;  1N73 A;  1XTC C;  3PP5 A;  3V2Q A;  1CI6 B;  3A2A A;  4GIF A;  4IFM A;  1SQP K;  1CSB A;  3L4F A;  1NTK K;  4DOJ A;  1FZF A;  1NTM K;  2A45 H;  2MJZ A;  4WY4 B;  5APQ A;  4C46 A;  5AW9 B;  2JJL A;  2HLO A;  1GL2 D;  3M9B A;  2I1K A;  3L36 A;  4N78 D;  5CCH C;  2PAJ A;  3RK2 B;  1M7L A;  1N7S D;  3HE4 B;  1SFC C;  1NOH A;  1N7S B;  2KLV A;  4C7N A;  5AVW B;  1LWU A;  3M91 A;  2Z5I A;  1NTZ K;  3R2P A;  1GL2 B;  1LT9 B;  1WT6 A;  2Q3I A;  2E42 A;  3CLQ A;  1IJD B;  1N2D C;  1M1J A;  2NPS D;  1KIL A;  3T97 A;  2HPC A;  4C7N B;  3SWF A;  4WB4 A;  2KB7 P;  3V4W A;  3OJA B;  3P32 A;  1N86 A;  2Z5H A;  3VYI A;  2E43 A;  2NPS B;  1GK4 A;  1LTJ A;  1LTT C;  1J1D C;  1SQV K;  3NTN A;  4B86 A;  2WSE H;  1QL1 A;  4IFF A;  2N1T C;  3M06 A;  4LGD E;  2FKW B;  1RE4 A;  5AVU B;  1JUN A;  1FZC B;  1HUC A;  1SP4 A;  4W7Y A;  5CJ4 A;  2YO2 A;  2YMY A;  5CCG D;  1RF0 C;  2JEE A;  2ZFC A;  1Z56 A;  3E1I A;  3SWY A;  3MTU E;  3G3Z A;  2HOD A;  2XNX A;  2IFN A;  3VMY A;  1LWU B;  2I1J A;  4WY4 D;  1JY3 O;  4I6M C;  4C7R A;  2A45 G;  3EFG A;  5AVS B;  2YNY A;  2NPS C;  4EIJ A;  2IPP A;  1JOC A;  1NKN A;  2YKP A;  3MGN A;  3M0A A;  1PFI A;  1IFI A;  2H8P D;  4LLH A;  5AW4 B;  1IO4 A;  3H32 B;  1SQX K;  5AVT B;  1GL2 A;  1LT9 A;  1GU4 A;  1H89 A;  2R5D A;  1N73 C;  3B5N A;  2YKO A;  3HUS A;  1MFZ A;  4AQR D;  2C0X A;  3HD7 B;  4OH8 B;  3HE5 B;  1E5W A;  1A02 J;  3TNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...