2NPSA

Crystal structure of the early endosomal snare complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
63
structure length
63
Chain Sequence
RNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Vesicle-associated membrane protein 4
publication title Early endosomal SNAREs form a structurally conserved SNARE complex and fuse liposomes with multiple topologies
pubmed doi rcsb
source organism Mus musculus
total genus 28
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2006-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2npsA00
1KILC 3PP5A 2NPSA 5KJ7D 4WY4B 1JTHB 5CCGC 3RL0B 3RK3D 3RK2B 3B5NC 2WZ7A 5CCHA 1L4AD 2PP6A 1URQC 1T3JA 4WY4A 2NPSD 1JTHA 4W80A 3RK2D 1SFCC 1KILB 3HD7A 4N78E 1GL2A 5KJ7C 1N7SA 3RK3C 1XTGB 3TSIA 3VOPA 2XDJA 4LGDE 4W7ZA 3HD7B 5CCHD 1GL2B 1N7SB 2M8RA 2N1TA 2HG5D 3B5NB 3HTKB 4OH8B 4WY4D 1L4AC 2N1TB 3RL0D 1NHLA 1KILA 2NPSC 3HD7D 3RK2C 3KYQA 1GL2D 2YMYA 3P8CE 1N7SD 5CCGA 2KOGA 3B5NA 2N1TD 3RK3B 2HFED 2H8PD 5CCHC 1URQA 1KILD 4W7YA 1SFCA 4WY4C 1URQB 3RL0C 1L4AB 5CCGD 5KJ7A 1SFCB 3HD7C 2NPSB 1GL2C 1N7SC 3M0DC 3B5ND 4JF7A 1URQD 2N1TC 1HVVA 1L4AA 1SFCD
chains in the Genus database with same CATH superfamily
2R44A 1NTZG 3L36A 1P84D 3MGNA 1Y47A 3RK2B 4M3LA 2E43A 1CI6B 1FZBA 2KUBA 2Q1KA 2B87B 2RH0A 1SQBK 4IFFA 1VQ6P 3MP7B 1S9KD 2A45H 3G9RA 2HR3A 1OW8A 4OGQD 3LIDA 4YXDC 2HYNA 3CX5E 4DCKA 2QE7H 1VQLP 4W7ZA 2IX7C 2LKMA 3KQGA 4OH8B 2CK3H 1BSNA 3H25A 3CC4P 3HUSA 3H1JD 4GOFA 1QL1A 4EI2A 1FZEA 1NU1J 1KQGB 2YO3A 1WMKA 1NTMG 2R3CA 5C39A 2FFDB 4GOEA 1K05A 1QGKB 1VF5C 2I1JA 5AW4B 5CCHC 4DT0A 2WPRA 4L74A 1G1IA 3G4SP 1FZCB 1EZVE 2BASA 2A06G 3N7NA 1VQ9P 1VQOP 3CXHE 1Q81Q 2KYVA 2QM8A 1X8YA 1FDOA 4K35A 2FKWB 1AFOA 2JWAA 1BCCJ 1JOCA 1SQPG 1HVVA 1KORA 1JY2O 1VQKP 1L4AA 1NOHA 1YYCA 3CWBE 4BXLA 3FGAD 2C0XA 1LJ2A 1X79B 1T2KC 1SQQK 4YPCA 3H1HD 2K9JA 4LC1A 2WPVB 1ZLLA 1YI2P 1HBWA 1LTJA 2BCCD 1JTHA 4H13B 3MIWA 3RK2D 1K04A 3Q1MA 3FXDA 3PH0A 4YTPC 3IR9A 1LWUA 3P8CD 2E75D 1N7SA 3TYYA 1QX8A 3M9BA 4AYCA 1M1JC 3SFDC 3HTKB 3H1IG 1SQQG 1IFJA 1KILA 1P84I 1KV4A 2H43A 5GTIE 1BGYG 2GUSA 3M06A 1DH3A 1FE6A 4I7ZC 2OYHA 1OMIA 3CXHH 3HRNA 2ZVOB 1NGMB 1OVRA 4NPDA 4PD4D 1AA0A 1SQXD 1PGOA 1PP9D 3H6PA 1OFCX 2M5AA 4RO0A 2I8DA 3L71J 3L75E 4KT0J 3V2NA 5APYA 1JNMA 3RL0B 4ZMDA 3A2AA 5K5GB 4EOTA 5KLVD 3CWBJ 1H88A 1M7LA 2R5BA 2ZVNB 2H89C 1G2CB 1JMBA 3H1KG 3TGUG 4WY4A 4W80A 4H44C 1SQVG 2WT7B 1L0NE 2KLVA 4U3FE 3A5TA 1GL2B 4H13D 2FXPA 3F89A 5KLIB 3L72E 3Q5SA 5AVUB 2HPCA 1L4AC 2PAJA 5GTIH 1USDA 1JCCA 1FDIA 1LTGC 4JYCA 2P7JA 3RK3E 2QIWA 2JJLA 5KTBA 2H7HA 1GTWA 1KB9E 1GMJA 4Y99C 2ZYGA 2XZRA 4GODA 2E42A 2YKPA 3AE4C 1LTJC 5AVYB 2BEZF 1LTIC 1LWUC 4ZKUA 3A0BE 3E7KA 2JO1A 1N7SC 2JKVA 1RE3A 3CMAP 4JF7A 1NU1D 2O1KA 1PPJE 5B5EE 3GW6A 3L73G 1W2BO 1S5LE 1KILC 1N73B 3L70E 3CC7P 1VQ4P 3AE9C 4OWFA 1LTBC 1Z56A 3B4SA 3L75J 2HODB 2OYHC 1BSHA 1IFIA 3HE5A 3NMDA 1BCCD 1PFIA 3H32A 1YITP 3KHUA 5L8RJ 3CD6P 4PD4I 3VYIA 1KQLA 1AV1A 2Q3IA 4L75A 5H2FE 1X0TA 2N1TA 2WMMA 5KKZC 1L0NJ 2DW3A 1JCDA 1Y9BA 1KB9H 3L72J 2WTYA 1GL2D 2P58A 3L74G 3JC22 3B5NA 3GF7A 2KSEA 1QVFO 3PHLA 3A0BH 2GUVA 4WY4C 1K8AQ 5CCGD 3EWKA 2YKOA 4PV1C 1M1KQ 1H89A 5AW6B 2Q3EA 5B5EH 1S5LH 2W6JH 1BE3E 2YNYA 2M3EA 2QJKC 3M91A 3BCCE 2OYIB 3AE8C 1NJIQ 1A02J 1JY3P 2QJPC 3HE4B 3L70J 2LXCB 3H1HG 1Q86Q 1FZGA 1L2PA 3D6YA 2IFNA 1EZVD 2NPSD 3RBZA 2XV5A 3ITKA 1NTZE 5H2FH 3CXHD 2QJYC 5APVA 3V6IA 5TISE 2E74B 3L71D 4GDOA 3MTUE 1RE3C 3EQ2A 1JUNA 2JDIH 1EDJA 3V4WA 3Q5RA 3CWBD 4NPEA 3T97B 3WU2E 1PV3A 1T3UA 3U1AA 4BRYB 1GZLA 1KFMA 2D2CC 3SFEC 4R4MA 2ZFCA 4R4LA 2KS1B 1VQ5P 3VMZA 2IZ0A 3CCMP 1NTME 1UIIA 4JYBA 4I1LA 3F5HA 2WITA 1USEA 1LP1A 1L0LK 2IYOA 2N1TC 1SQXG 2RKLA 1VF5B 2Q7CA 1ZN5A 3FWLA 3TNUB 1IJDB 2ZT9C 1QLED 2A06E 5AVZB 3C8VA 1BE3J 1LGHB 1M8OB 4K3AA 3GG2A 1MFZA 4WB4A 3KPEA 3B5NC 3O6QB 4QMAA 3BCCJ 5TISH 1TU3F 1NWQA 1FDMA 1LNQA 1L0LG 3PRJA 2M0BA 3L4FA 1JO5A 5AW2B 2P67A 2QRXA 3CCUP 1FOSF 1QL2A 2Y0DA 3WU2H 5APWA 2Y0CA 3AE1C 1ZRTD 3L75D 2E74D 1NTMK 3D71A 2YMYA 1VQNP 1EDIA 1NAFA 4OGQC 2KNCA 4D6TG 3D6ZA 3SWYA 1M1JB 2W6BA 3NFQA 3H1IE 1SQQE 1EZVI 3LW5H 2KLUA 2FY8A 3MD0A 3V4QA 3CXHI 2L91A 1K9MQ 2ZAEB 2R32A 3USSA 1DIPA 1EC5A 1L0ND 1BGYE 1SQPK 1R8EA 3L72D 1SQBJ 1SP4A 4I7ZB 3LW5J 5CBNA 4AUWA 1CSBA 1GK6A 1FJPA 1OWAA 3RK3D 4H0LB 2R5DA 1KB9D 2KIKA 2P1JA 3D70A 2IPPA 4UB8E 3AE7C 2AEFA 4N6JA 2PP6A 3CCJP 1GDTA 1GU5A 4EYYQ 3HUSB 3JCUE 4N78E 1HTLC 2XNXA 2RMZA 1QVGO 1YQ3C 1PPJD 3W67A 3H1KE 3CX5H 1NHLA 1NH4A 3L70D 1W5CE 5APQA 1JY3O 2I1KA 3L35A 3RK2C 1R5LA 2E75C 1T8ZA 2JP3A 2ZJSE 2IBZD 1S5LX 1AVOA 2H8PD 2W90A 1YTZI 3CCVP 1J1EC 1EXIA 2OGUA 1L4AB 4I6MC 2R3SA 3H1IJ 2UWJE 1SFCB 4GT1A 1IFMA 3MUDA 1SVFA 1AQTA 4CPGA 1PIXA 5AW7B 3C9IA 2H88C 4U7JA 3V2RA 2K9JB 1BGYJ 1ZXGA 3R4YA 1EQ7A 5DJUB 1R5SA 1LTJB 4UB8H 1JTHB 3Q5PA 2KXPB 1RQVA 1LWUB 2OARA 2E76B 1OIPA 1MFTA 3JCUH 2B9BA 3L73E 1SQVK 1T3JA 4H0LD 1MZ9A 4IOIH 3CCEP 1OX3A 3BRTB 3PTZA 3C1LA 3G71P 1J1DC 5CJ0A 1KILB 2FXOA 1GL2A 3L71G 2Z5HA 2B89A 2KZJA 3AEDC 1NTKK 3AE3C 1HH0A 2HG5D 1LP1B 1BE3D 3WUTA 2OYHB 3BRVB 1YIJP 2NRGA 3VP8A 1S9KE 1X22A 2QG4A 5CCGA 3BCCD 4DJGA 1JMMA 1PGJA 2Z5IA 3SSUA 1KB9I 1PZQA 2OQQA 2L5GB 3A7OA 1Q2NA 1IK9A 3S9OA 4H13C 3AEEC 3TDKA 1NTKG 5KKZB 1GK4A 3Q3DA 2WSCH 1URQB 1VPCA 2M5AB 3GF3A 1VQ7P 3L74E 2IFMA 2FYUK 1GW3A 3CPWO 1YTZT 3P32A 1N73A 1SFCD 2WSCJ 4RESB 4DOJA 1ZMEC 2NPSA 3G6EP 3KXDA 4A7PA 5KJ7D 4EDFA 4WY4B 1M57D 2RN0A 2IBZI 4EIJA 1WT6A 4PV1B 1M56D 3VTPC 4IFDK 2WSEH 2FYUG 1QEXA 1OVVA 2OYOA 2K3RA 2WSFH 3AECC 3QH9A 1FZFA 2GA1A 3H1LG 2HPCB 1SQBD 5AW9B 2E76D 1ZW0A 2FYNB 3L37A 3A3YB 3MUDC 2IYPA 3L73J 3VP9A 2M8RA 3H1HE 2QJPB 2WSEJ 2P10A 3OJAB 2WSFJ 3CI9A 1JY2N 3RL0D 2A06D 1DD4A 1KD1Q 3P8CE 2YIUC 2QJYB 3OA7A 3WMM0 5AVQB 4XFJA 3A0HE 4Z1MH 2O3JA 2Y0EA 5AW0B 3W68A 4U3FJ 1VQPP 3H1JG 1LT9B 4C7NA 5CHXA 2OTLP 5AW3B 1N2DC 1GL2C 5KLIC 4IFMA 1KYOE 2OTKE 2N9BA 3L72G 1URQD 2J5UA 3L74J 5APXA 1H8AA 4GKGA 5AW8B 2D2CB 4Y28J 4MN4C 1HWTC 2OYIA 1H0TA 3PP5A 5CBOA 3HE4A 2O01N 4HB1A 5CCGC 1YBKA 3CX5D 3EFFK 3H32B 2Z4EA 4ASWA 1T6AA 3EFGA 2V7QH 3AE6C 4JPZB 3CCSP 4JQ0D 1DEBA 1SQXE 3H1ID 5APUA 1JM0A 2MJZA 1OZHA 2ZXEB 2Y9ZA 2Q5UA 1IFNA 2CPBA 2YXQB 1XTCC 1BGYD 3FXEA 2V7QJ 3TSIA 1W2EA 4JBZA 2XDJA 1RF1A 3HD7B 1SLQA 2PGDA 2B88A 1FBMA 3B5NB 3AE2C 3BVHA 1N73C 1HGVA 1L0LE 2BCCG 4KJMA 2NPSC 3A0HH 1RY3A 1MUUA 2E5YA 2A45I 2IBZG 2QEXP 4WWIA 4HJGH 1KQSO 4ASVA 4W7YA 2QA4P 4C7RA 3TF5A 2W27A 1KYOH 4N78D 4DZOA 5APSA 4D6TE 1SQXK 2E5TA 3AEAC 3GMAA 2FYZA 3V2PA 3CCQP 2KI7B 2K37A 1BDCA 2IZ1A 3R2PA 1FOSE 3VMAA 4RKUJ 5KLVK 2FXMA 3GHGA 4IL6E 5AVWB 5B66E 2CPSA 1PP9G 2N9YB 1KILE 3K5BA 4L73A 2XNDH 1CI6A 5BU5A 1RQUA 1IZNB 1WRGA 5BVZA 2B87A 5AVXB 5KLVG 1GD2E 3PJSK 1BE3G 1SQPE 3NXSA 4LLHA 2OYIC 3HD7D 1HJBA 4TLFA 3CX5I 1L0LJ 1NTZJ 3P8MC 5GTHE 1RF0A 1PGPA 3L73D 5KAIE 2W6AA 3V5BA 2E74C 2PRRA 1RH5B 5E79E 2FFDA 1NU1K 3M0DC 1FC2C 1M90Q 2Q6QA 1YJNP 1RF1C 2E75B 3IF4A 1Q90D 1FZCA 2W8ZA 1JB0J 2WSSH 2KSJA 4D6TJ 4IL6H 1FU1A 5B66H 1J1EB 2J59M 2IDBA 3LIEA 4WBAA 1E5WA 4U3FD 4NPFX 2A45G 1NAYA 1NU1G 1NTMJ 1KFNA 1AJYA 1VQMP 1VL2A 1X9VA 1SQBG 3L74D 2KK7A 2C0WA 2YMKA 1VF5D 3RK3C 1XTGB 5CCHD 2KNCB 1NYHA 2WQYC 1VQ8P 3KDPB 1BCCG 1HJ0A 1LTSC 5AVTB 1OW7A 1U57A 1SQPJ 1YJWP 1J1DB 3L71E 3GHGC 5GTHH 1ZV8A 5KAIH 3HTKA 4XE5B 3WUUA 1KC8Q 5E79H 3TGUE 1SFCA 1G1JA 3E1IA 5KJ7A 1SQVE 1T2KD 4H44B 1N8RQ 1RE4C 2SPZA 3KZIE 1NO4A 3ABVC 3SWFA 1Q82Q 1NTKE 1E79H 1BDDA 1S4XA 2C9NY 1KTMA 1SQQJ 3N4XA 1JEKA 2LXBA 3VN0A 1RHZB 2WZ7A 5CJ4A 3CCLP 3RGUA 4C46A 3ZDMA 1RF0C 4Y99B 3BATA 1PL5A 1IC2A 2AXCA 3OW2O 5AVVB 3Q2YA 4HKZH 2FFDC 5DJTB 2Q9IA 2WWWA 1KYOD 5AW1B 3AEGC 1IK7A 1N7SB 1G2CA 3S4RA 2FYUE 1FZCC 1MV8A 2YKQA 1EZVG 3H1LE 2WT7A 4H0LC 2QVAA 2KP8A 1P84E 5EFWB 1YJ9P 2ZXXA 1NVOA 1LTTC 4RJTA 1UIXA 1URQA 2O01H 1ZRTE 1SS1A 2JEEA 3KZIH 3HUSC 2ZYAA 3CC2P 3CWBG 2K1AA 3FWNA 1S2EA 3TGUJ 3H1KJ 2YIUB 4BWNA 1KQFB 3E1RA 5CMZA 2O01J 1SQVJ 3IN6A 2ZYDA 3AE5C 1HUCA 1L0LD 1ZOYC 4H44D 1FAVA 5TJHA 1ZR4A 1NTZD 3H1JE 3WUVA 3CCRP 4HYTB 4AQRD 2BEQD 1NTKJ 1OVUA 3AEFC 1OXZA 1CZQA 3S1KA 1KZUB 1L4AD 3M0AA 3IFMA 4PJ0E 2AEJA 1SFCC 2V4HA 1IFPA 5KJ7C 4D6TD 2HODA 1U7MA 1MKMA 4LGDE 2KZIA 2XU6A 1EDLA 2XKMA 4ZKPA 1P84H 2MKVA 2FYUJ 2QJKB 3KYQA 1N7SD 3MZWB 1NTMD 4XA4A 2E76C 3B8EB 3CL3D 3TK1A 1AVYA 2KOGA 3H1LJ 2AXTE 3I56P 2VRSA 2Y9YA 5KAFE 3PLNA 2J58A 4UB6E 1LT9A 1KILD 4I2LC 3L75G 4IL6X 2BCCE 3RL0C 1L0NK 3GLMA 3O8ZA 2NPSB 1KYOI 1NKNA 2WPQA 2IBZE 4O9BA 3CLQA 1SQPD 2M3BA 2P2UA 1NKZB 1ZP0C 1VDFA 2K9YA 5AW5B 1S3JA 4OVNF 2KB7P 3RL0g 1JY3N 2PFXA 3RBXA 4WVZA 1L0NG 1FJKA 4PJ0H 3AEBC 2WVRA 3QWOC 3H1JJ 4U3FG 2POHA 1DX7A 1URQC 3II6A 3P7KA 3HE5B 3HD7A 1IFDA 3BASA 4N3YB 1A02F 2GM4A 4PD4E 3OAKA 1S1CX 2G8YA 1SQQD 5BU8B 1PP9E 4HH2A 3FX0A 4WY4D 2N1TB 1U7JA 1KN7A 2AXTH 1JY2P 5KAFH 2ZT9B 4PV1D 3VMYA 4UB6H 1K73Q 2JR8A 3M0DA 1AQ5A 1HF9A 4C7NB 5KLVE 1HGZA 2FBWC 2HFED 3T97A 1PPJG 2FYNC 3L70G 3H1HJ 2HLOA 1KMIZ 2LR2A 1H0TB 2WPSA 4GIFA 4BRYA 2NZ2A 2BCCJ 4TT3H 1J2JB 5AVSB 2KS1A 1N7LA 2JWDA 1IO4A 3SWKA 1N86A 1EXJA 3I55P 3B71A 2YO2A 1Y8AA 1LT1A 5AVRB 3TNUA 3JSVC 4OGQB 5CCHA 2QM7A 1RF1B 3MHVA 3TGUD 3H1KD 1LT9C 1S72P 3M9HA 4PD4H 4L76A 4YXWH 3CMEP 1SQVD 4KHXA 1FZAA 2OTJP 1YHQP 1YQ4C 3O6QA 1GW4A 3VOPA 3NTNA 3V2QA 1OW6A 2D2CD 1NU1E 2QSIA 2C9LY 1NTKD 3U59A 1ZR2A 2K88A 3U1CA 2AEMA 2O1JA 1SQBE 1SQXJ 1PP9J 3VMXA 3M9QA 3UIAA 1RE4A 2N1TD 3RK3B 1FS0E 3I5CA 3IAOA 1CW5A 5M1BA 1D7MA 1NTZK 2ZT9D 1LTAC 1DEEG 5KLVJ 1EDKA 2ITAA 1BCCE 3G3ZA 3HD7C 5APTA 3BCCG 1Q7YQ 1GU4A 1DD3A 3B5ND 1M1JA 3GHGB 4ZNCA 1PGQA 2FYUD 4B86A 2G3AA 2W83C 3H1LD 2YXRB
chains in the Genus database with same CATH topology
2NPSA 3L36A 3M91A 5KJ7D 4WY4B 2C9NY 3N4XA 3MGNA 2OYIB 3RK2B 1A02J 3VN0A 1JY3P 4M3LA 4EIJA 1WT6A 3HE4B 2E43A 1CI6B 2WZ7A 5CJ4A 1FZGA 1FZBA 3VTPC 4IFDK 2WSEH 4C46A 1RF0C 4Y99B 2IFNA 3BATA 1SQBK 2WSFH 1IC2A 2NPSD 4IFFA 1FZFA 2XV5A 1S9KD 2HPCB 2A45H 5APVA 5AVVB 5AW9B 3LIDA 2FFDC 2HYNA 3L37A 3A3YB 2Q9IA 3MTUE 1RE3C 2WWWA 3EQ2A 5AW1B 1JUNA 4W7ZA 3VP9A 2IX7C 1N7SB 2M8RA 1G2CA 3OJAB 2LKMA 1FZCC 3KQGA 3V4WA 4OH8B 3CI9A 1MV8A 1JY2N 3RL0D 2YKQA 3HUSA 2WT7A 1QL1A 1FZEA 2KP8A 3P8CE 2YO3A 1T3UA 2R3CA 3U1AA 1LTTC 2FFDB 3OA7A 3WMM0 5AVQB 2I1JA 1GZLA 1KFMA 5AW4B 5CCHC 2WPRA 1URQA 1G1IA 2O01H 2ZFCA 5AW0B 1FZCB 2BASA 2JEEA 3HUSC 3N7NA 3VMZA 1LT9B 4C7NA 5CHXA 5AW3B 1N2DC 4JYBA 1GL2C 2KYVA 2QM8A 1X8YA 4I1LA 4IFMA 2WITA 2FKWB 1AFOA 5CMZA 2N9BA 1URQD 1JOCA 1L0LK 2N1TC 2Q7CA 1HVVA 5APXA 1ZN5A 1H8AA 3TNUB 1JY2O 4GKGA 1IJDB 1L4AA 1NOHA 5AW8B 1HUCA 1YYCA 1HWTC 1FAVA 2OYIA 1ZR4A 3PP5A 5AVZB 4HYTB 4AQRD 3HE4A 5CCGC 2C0XA 3H32B 1LGHB 2Z4EA 1X79B 1MFZA 1T2KC 1SQQK 3EFGA 4WB4A 3KPEA 3B5NC 1DEBA 1OXZA 1CZQA 5APUA 4LC1A 1KZUB 1L4AD 2MJZA 3M0AA 3IFMA 1ZLLA 1NWQA 1HBWA 1LTJA 1FDMA 2ZXEB 1JTHA 3MIWA 3RK2D 1SFCC 2Q5UA 1IFNA 3IR9A 1LWUA 3L4FA 3P8CD 2CPBA 5KJ7C 1N7SA 1XTCC 2HODA 3TYYA 1JO5A 5AW2B 2P67A 3M9BA 4AYCA 3TSIA 1W2EA 1M1JC 2XDJA 4LGDE 1RF1A 1FOSF 3HD7B 1QL2A 5APWA 2XU6A 1SLQA 2XKMA 4ZKPA 3B5NB 1FBMA 3HTKB 3BVHA 1N73C 1HGVA 1IFJA 1KILA 1NTMK 2NPSC 3KYQA 1RY3A 1MUUA 2YMYA 1N7SD 4XA4A 2H43A 1NAFA 3B8EB 3CL3D 2GUSA 3M06A 3TK1A 2KOGA 1DH3A 2A45I 2VRSA 2OYHA 3SWYA 1M1JB 2J58A 2W6BA 3NFQA 3HRNA 3LW5H 1LT9A 1KILD 4W7YA 4I2LC 4C7RA 3MD0A 3V4QA 2W27A 3RL0C 1L0NK 2R32A 4N78D 4DZOA 3O8ZA 5APSA 2NPSB 1NKNA 1SQXK 2WPQA 1SQPK 4O9BA 3CLQA 2FYZA 1SP4A 3V2PA 2M3BA 2P2UA 4AUWA 1CSBA 3H6PA 1NKZB 1VDFA 5AW5B 3R2PA 3V2NA 1FOSE 5APYA 1JNMA 1GK6A 5KLVK 2FXMA 2KB7P 1FJPA 1JY3N 3RL0B 1OWAA 3GHGA 3RK3D 3A2AA 2R5DA 4EOTA 1FJKA 5AVWB 1H88A 2P1JA 2IPPA 2POHA 1M7LA 2R5BA 1DX7A 2CPSA 4N6JA 2PP6A 1URQC 3II6A 1G2CB 4WY4A 4W80A 1GDTA 3P7KA 1GU5A 3HE5B 3HUSB 2WT7B 3HD7A 4N78E 1IFDA 1CI6A 3BASA 4N3YB 5BU5A 1WRGA 1HTLC 2XNXA 1A02F 2GM4A 2KLVA 5BVZA 3OAKA 5AVXB 1GD2E 3A5TA 1GL2B 5AVUB 5BU8B 4HH2A 3NXSA 4WY4D 2HPCA 1L4AC 2N1TB 2PAJA 1NHLA 1NH4A 4LLHA 1JCCA 2OYIC 1JY2P 5APQA 1JY3O 2I1KA 1LTGC 3HD7D 3L35A 3RK2C 1HJBA 3VMYA 4JYCA 2P7JA 3M0DA 1AQ5A 2JJLA 1T8ZA 5KTBA 4C7NB 2H7HA 1GTWA 1HGZA 2HFED 4Y99C 2H8PD 2XZRA 3P8MC 1RF0A 3T97A 2E42A 1YTZI 2YKPA 1J1EC 2W6AA 3V5BA 1LTJC 1L4AB 5AVYB 4I6MC 2HLOA 2FFDA 1LTIC 1LWUC 4ZKUA 1SFCB 1IFMA 3MUDA 2WPSA 4GT1A 1SVFA 1N7SC 1NU1K 3M0DC 4GIFA 1RE3A 4JF7A 5AW7B 1RF1C 3C9IA 2O1KA 1J2JB 5AVSB 1FZCA 1N7LA 2KSJA 1IO4A 3V2RA 1N86A 1EQ7A 1KILC 1N73B 1FU1A 1J1EB 1LTJB 2J59M 1JTHB 3LIEA 1LTBC 4WBAA 2YO2A 1Z56A 1E5WA 1LWUB 2OARA 2HODB 5AVRB 3TNUA 2OYHC 2A45G 5CCHA 1IFIA 2QM7A 1RF1B 3HE5A 3NMDA 1LT9C 3M9HA 1KFNA 1SQVK 1T3JA 1MZ9A 3BRTB 1PFIA 3H32A 1J1DC 1X9VA 5CJ0A 1KILB 1FZAA 4KHXA 1GL2A 3VYIA 1KQLA 2C0WA 3RK3C 1GW4A 1XTGB 2Z5HA 3VOPA 3NTNA 2Q3IA 3V2QA 5CCHD 1NTKK 2N1TA 1HH0A 2HG5D 2C9LY 2OYHB 3BRVB 3U59A 1ZR2A 1JCDA 3KDPB 3VP8A 1S9KE 3U1CA 2O1JA 1LTSC 1GL2D 5AVTB 5CCGA 2WTYA 1JMMA 1J1DB 2Z5IA 3M9QA 3UIAA 3VMXA 3GHGC 1RE4A 1ZV8A 3B5NA 3HTKA 2N1TD 4XE5B 3RK3B 3I5CA 2L5GB 3A7OA 1CW5A 1IK9A 1NTZK 1LTAC 2GUVA 1GK4A 1SFCA 2WSCH 4WY4C 1URQB 1VPCA 5CCGD 2YKOA 1G1JA 3E1IA 3G3ZA 5KJ7A 2IFMA 3HD7C 1T2KD 5APTA 1GU4A 5AW6B 1H89A 1RE4C 1GW3A 2FYUK 3B5ND 1M1JA 1NO4A 3GHGB 4B86A 1YTZT 3P32A 1N73A 3SWFA 2YNYA 1SFCD 4RESB 4DOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KIL C;  3PP5 A;  2NPS A;  5KJ7 D;  4WY4 B;  1JTH B;  5CCG C;  3RL0 B;  3RK3 D;  3RK2 B;  3B5N C;  2WZ7 A;  5CCH A;  1L4A D;  2PP6 A;  1URQ C;  1T3J A;  4WY4 A;  2NPS D;  1JTH A;  4W80 A;  3RK2 D;  1SFC C;  1KIL B;  3HD7 A;  4N78 E;  1GL2 A;  5KJ7 C;  1N7S A;  3RK3 C;  1XTG B;  3TSI A;  3VOP A;  2XDJ A;  4LGD E;  4W7Z A;  3HD7 B;  5CCH D;  1GL2 B;  1N7S B;  2M8R A;  2N1T A;  2HG5 D;  3B5N B;  3HTK B;  4OH8 B;  4WY4 D;  1L4A C;  2N1T B;  3RL0 D;  1NHL A;  1KIL A;  2NPS C;  3HD7 D;  3RK2 C;  3KYQ A;  1GL2 D;  2YMY A;  3P8C E;  1N7S D;  5CCG A;  2KOG A;  3B5N A;  2N1T D;  3RK3 B;  2HFE D;  2H8P D;  5CCH C;  1URQ A;  1KIL D;  4W7Y A;  1SFC A;  4WY4 C;  1URQ B;  3RL0 C;  1L4A B;  5CCG D;  5KJ7 A;  1SFC B;  3HD7 C;  2NPS B;  1GL2 C;  1N7S C;  3M0D C;  3B5N D;  4JF7 A;  1URQ D;  2N1T C;  1HVV A;  1L4A A;  1SFC D; 
#chains in the Genus database with same CATH topology
 2R44 A;  1NTZ G;  3L36 A;  1P84 D;  3MGN A;  1Y47 A;  3RK2 B;  4M3L A;  2E43 A;  1CI6 B;  1FZB A;  2KUB A;  2Q1K A;  2B87 B;  2RH0 A;  1SQB K;  4IFF A;  1VQ6 P;  3MP7 B;  1S9K D;  2A45 H;  3G9R A;  2HR3 A;  1OW8 A;  4OGQ D;  3LID A;  4YXD C;  2HYN A;  3CX5 E;  4DCK A;  2QE7 H;  1VQL P;  4W7Z A;  2IX7 C;  2LKM A;  3KQG A;  4OH8 B;  2CK3 H;  1BSN A;  3H25 A;  3CC4 P;  3HUS A;  3H1J D;  4GOF A;  1QL1 A;  4EI2 A;  1FZE A;  1NU1 J;  1KQG B;  2YO3 A;  1WMK A;  1NTM G;  2R3C A;  5C39 A;  2FFD B;  4GOE A;  1K05 A;  1QGK B;  1VF5 C;  2I1J A;  5AW4 B;  5CCH C;  4DT0 A;  2WPR A;  4L74 A;  1G1I A;  3G4S P;  1FZC B;  1EZV E;  2BAS A;  2A06 G;  3N7N A;  1VQ9 P;  1VQO P;  3CXH E;  1Q81 Q;  2KYV A;  2QM8 A;  1X8Y A;  1FDO A;  4K35 A;  2FKW B;  1AFO A;  2JWA A;  1BCC J;  1JOC A;  1SQP G;  1HVV A;  1KOR A;  1JY2 O;  1VQK P;  1L4A A;  1NOH A;  1YYC A;  3CWB E;  4BXL A;  3FGA D;  2C0X A;  1LJ2 A;  1X79 B;  1T2K C;  1SQQ K;  4YPC A;  3H1H D;  2K9J A;  4LC1 A;  2WPV B;  1ZLL A;  1YI2 P;  1HBW A;  1LTJ A;  2BCC D;  1JTH A;  4H13 B;  3MIW A;  3RK2 D;  1K04 A;  3Q1M A;  3FXD A;  3PH0 A;  4YTP C;  3IR9 A;  1LWU A;  3P8C D;  2E75 D;  1N7S A;  3TYY A;  1QX8 A;  3M9B A;  4AYC A;  1M1J C;  3SFD C;  3HTK B;  3H1I G;  1SQQ G;  1IFJ A;  1KIL A;  1P84 I;  1KV4 A;  2H43 A;  5GTI E;  1BGY G;  2GUS A;  3M06 A;  1DH3 A;  1FE6 A;  4I7Z C;  2OYH A;  1OMI A;  3CXH H;  3HRN A;  2ZVO B;  1NGM B;  1OVR A;  4NPD A;  4PD4 D;  1AA0 A;  1SQX D;  1PGO A;  1PP9 D;  3H6P A;  1OFC X;  2M5A A;  4RO0 A;  2I8D A;  3L71 J;  3L75 E;  4KT0 J;  3V2N A;  5APY A;  1JNM A;  3RL0 B;  4ZMD A;  3A2A A;  5K5G B;  4EOT A;  5KLV D;  3CWB J;  1H88 A;  1M7L A;  2R5B A;  2ZVN B;  2H89 C;  1G2C B;  1JMB A;  3H1K G;  3TGU G;  4WY4 A;  4W80 A;  4H44 C;  1SQV G;  2WT7 B;  1L0N E;  2KLV A;  4U3F E;  3A5T A;  1GL2 B;  4H13 D;  2FXP A;  3F89 A;  5KLI B;  3L72 E;  3Q5S A;  5AVU B;  2HPC A;  1L4A C;  2PAJ A;  5GTI H;  1USD A;  1JCC A;  1FDI A;  1LTG C;  4JYC A;  2P7J A;  3RK3 E;  2QIW A;  2JJL A;  5KTB A;  2H7H A;  1GTW A;  1KB9 E;  1GMJ A;  4Y99 C;  2ZYG A;  2XZR A;  4GOD A;  2E42 A;  2YKP A;  3AE4 C;  1LTJ C;  5AVY B;  2BEZ F;  1LTI C;  1LWU C;  4ZKU A;  3A0B E;  3E7K A;  2JO1 A;  1N7S C;  2JKV A;  1RE3 A;  3CMA P;  4JF7 A;  1NU1 D;  2O1K A;  1PPJ E;  5B5E E;  3GW6 A;  3L73 G;  1W2B O;  1S5L E;  1KIL C;  1N73 B;  3L70 E;  3CC7 P;  1VQ4 P;  3AE9 C;  4OWF A;  1LTB C;  1Z56 A;  3B4S A;  3L75 J;  2HOD B;  2OYH C;  1BSH A;  1IFI A;  3HE5 A;  3NMD A;  1BCC D;  1PFI A;  3H32 A;  1YIT P;  3KHU A;  5L8R J;  3CD6 P;  4PD4 I;  3VYI A;  1KQL A;  1AV1 A;  2Q3I A;  4L75 A;  5H2F E;  1X0T A;  2N1T A;  2WMM A;  5KKZ C;  1L0N J;  2DW3 A;  1JCD A;  1Y9B A;  1KB9 H;  3L72 J;  2WTY A;  1GL2 D;  2P58 A;  3L74 G;  3JC2 2;  3B5N A;  3GF7 A;  2KSE A;  1QVF O;  3PHL A;  3A0B H;  2GUV A;  4WY4 C;  1K8A Q;  5CCG D;  3EWK A;  2YKO A;  4PV1 C;  1M1K Q;  1H89 A;  5AW6 B;  2Q3E A;  5B5E H;  1S5L H;  2W6J H;  1BE3 E;  2YNY A;  2M3E A;  2QJK C;  3M91 A;  3BCC E;  2OYI B;  3AE8 C;  1NJI Q;  1A02 J;  1JY3 P;  2QJP C;  3HE4 B;  3L70 J;  2LXC B;  3H1H G;  1Q86 Q;  1FZG A;  1L2P A;  3D6Y A;  2IFN A;  1EZV D;  2NPS D;  3RBZ A;  2XV5 A;  3ITK A;  1NTZ E;  5H2F H;  3CXH D;  2QJY C;  5APV A;  3V6I A;  5TIS E;  2E74 B;  3L71 D;  4GDO A;  3MTU E;  1RE3 C;  3EQ2 A;  1JUN A;  2JDI H;  1EDJ A;  3V4W A;  3Q5R A;  3CWB D;  4NPE A;  3T97 B;  3WU2 E;  1PV3 A;  1T3U A;  3U1A A;  4BRY B;  1GZL A;  1KFM A;  2D2C C;  3SFE C;  4R4M A;  2ZFC A;  4R4L A;  2KS1 B;  1VQ5 P;  3VMZ A;  2IZ0 A;  3CCM P;  1NTM E;  1UII A;  4JYB A;  4I1L A;  3F5H A;  2WIT A;  1USE A;  1LP1 A;  1L0L K;  2IYO A;  2N1T C;  1SQX G;  2RKL A;  1VF5 B;  2Q7C A;  1ZN5 A;  3FWL A;  3TNU B;  1IJD B;  2ZT9 C;  1QLE D;  2A06 E;  5AVZ B;  3C8V A;  1BE3 J;  1LGH B;  1M8O B;  4K3A A;  3GG2 A;  1MFZ A;  4WB4 A;  3KPE A;  3B5N C;  3O6Q B;  4QMA A;  3BCC J;  5TIS H;  1TU3 F;  1NWQ A;  1FDM A;  1LNQ A;  1L0L G;  3PRJ A;  2M0B A;  3L4F A;  1JO5 A;  5AW2 B;  2P67 A;  2QRX A;  3CCU P;  1FOS F;  1QL2 A;  2Y0D A;  3WU2 H;  5APW A;  2Y0C A;  3AE1 C;  1ZRT D;  3L75 D;  2E74 D;  1NTM K;  3D71 A;  2YMY A;  1VQN P;  1EDI A;  1NAF A;  4OGQ C;  2KNC A;  4D6T G;  3D6Z A;  3SWY A;  1M1J B;  2W6B A;  3NFQ A;  3H1I E;  1SQQ E;  1EZV I;  3LW5 H;  2KLU A;  2FY8 A;  3MD0 A;  3V4Q A;  3CXH I;  2L91 A;  1K9M Q;  2ZAE B;  2R32 A;  3USS A;  1DIP A;  1EC5 A;  1L0N D;  1BGY E;  1SQP K;  1R8E A;  3L72 D;  1SQB J;  1SP4 A;  4I7Z B;  3LW5 J;  5CBN A;  4AUW A;  1CSB A;  1GK6 A;  1FJP A;  1OWA A;  3RK3 D;  4H0L B;  2R5D A;  1KB9 D;  2KIK A;  2P1J A;  3D70 A;  2IPP A;  4UB8 E;  3AE7 C;  2AEF A;  4N6J A;  2PP6 A;  3CCJ P;  1GDT A;  1GU5 A;  4EYY Q;  3HUS B;  3JCU E;  4N78 E;  1HTL C;  2XNX A;  2RMZ A;  1QVG O;  1YQ3 C;  1PPJ D;  3W67 A;  3H1K E;  3CX5 H;  1NHL A;  1NH4 A;  3L70 D;  1W5C E;  5APQ A;  1JY3 O;  2I1K A;  3L35 A;  3RK2 C;  1R5L A;  2E75 C;  1T8Z A;  2JP3 A;  2ZJS E;  2IBZ D;  1S5L X;  1AVO A;  2H8P D;  2W90 A;  1YTZ I;  3CCV P;  1J1E C;  1EXI A;  2OGU A;  1L4A B;  4I6M C;  2R3S A;  3H1I J;  2UWJ E;  1SFC B;  4GT1 A;  1IFM A;  3MUD A;  1SVF A;  1AQT A;  4CPG A;  1PIX A;  5AW7 B;  3C9I A;  2H88 C;  4U7J A;  3V2R A;  2K9J B;  1BGY J;  1ZXG A;  3R4Y A;  1EQ7 A;  5DJU B;  1R5S A;  1LTJ B;  4UB8 H;  1JTH B;  3Q5P A;  2KXP B;  1RQV A;  1LWU B;  2OAR A;  2E76 B;  1OIP A;  1MFT A;  3JCU H;  2B9B A;  3L73 E;  1SQV K;  1T3J A;  4H0L D;  1MZ9 A;  4IOI H;  3CCE P;  1OX3 A;  3BRT B;  3PTZ A;  3C1L A;  3G71 P;  1J1D C;  5CJ0 A;  1KIL B;  2FXO A;  1GL2 A;  3L71 G;  2Z5H A;  2B89 A;  2KZJ A;  3AED C;  1NTK K;  3AE3 C;  1HH0 A;  2HG5 D;  1LP1 B;  1BE3 D;  3WUT A;  2OYH B;  3BRV B;  1YIJ P;  2NRG A;  3VP8 A;  1S9K E;  1X22 A;  2QG4 A;  5CCG A;  3BCC D;  4DJG A;  1JMM A;  1PGJ A;  2Z5I A;  3SSU A;  1KB9 I;  1PZQ A;  2OQQ A;  2L5G B;  3A7O A;  1Q2N A;  1IK9 A;  3S9O A;  4H13 C;  3AEE C;  3TDK A;  1NTK G;  5KKZ B;  1GK4 A;  3Q3D A;  2WSC H;  1URQ B;  1VPC A;  2M5A B;  3GF3 A;  1VQ7 P;  3L74 E;  2IFM A;  2FYU K;  1GW3 A;  3CPW O;  1YTZ T;  3P32 A;  1N73 A;  1SFC D;  2WSC J;  4RES B;  4DOJ A;  1ZME C;  2NPS A;  3G6E P;  3KXD A;  4A7P A;  5KJ7 D;  4EDF A;  4WY4 B;  1M57 D;  2RN0 A;  2IBZ I;  4EIJ A;  1WT6 A;  4PV1 B;  1M56 D;  3VTP C;  4IFD K;  2WSE H;  2FYU G;  1QEX A;  1OVV A;  2OYO A;  2K3R A;  2WSF H;  3AEC C;  3QH9 A;  1FZF A;  2GA1 A;  3H1L G;  2HPC B;  1SQB D;  5AW9 B;  2E76 D;  1ZW0 A;  2FYN B;  3L37 A;  3A3Y B;  3MUD C;  2IYP A;  3L73 J;  3VP9 A;  2M8R A;  3H1H E;  2QJP B;  2WSE J;  2P10 A;  3OJA B;  2WSF J;  3CI9 A;  1JY2 N;  3RL0 D;  2A06 D;  1DD4 A;  1KD1 Q;  3P8C E;  2YIU C;  2QJY B;  3OA7 A;  3WMM 0;  5AVQ B;  4XFJ A;  3A0H E;  4Z1M H;  2O3J A;  2Y0E A;  5AW0 B;  3W68 A;  4U3F J;  1VQP P;  3H1J G;  1LT9 B;  4C7N A;  5CHX A;  2OTL P;  5AW3 B;  1N2D C;  1GL2 C;  5KLI C;  4IFM A;  1KYO E;  2OTK E;  2N9B A;  3L72 G;  1URQ D;  2J5U A;  3L74 J;  5APX A;  1H8A A;  4GKG A;  5AW8 B;  2D2C B;  4Y28 J;  4MN4 C;  1HWT C;  2OYI A;  1H0T A;  3PP5 A;  5CBO A;  3HE4 A;  2O01 N;  4HB1 A;  5CCG C;  1YBK A;  3CX5 D;  3EFF K;  3H32 B;  2Z4E A;  4ASW A;  1T6A A;  3EFG A;  2V7Q H;  3AE6 C;  4JPZ B;  3CCS P;  4JQ0 D;  1DEB A;  1SQX E;  3H1I D;  5APU A;  1JM0 A;  2MJZ A;  1OZH A;  2ZXE B;  2Y9Z A;  2Q5U A;  1IFN A;  2CPB A;  2YXQ B;  1XTC C;  1BGY D;  3FXE A;  2V7Q J;  3TSI A;  1W2E A;  4JBZ A;  2XDJ A;  1RF1 A;  3HD7 B;  1SLQ A;  2PGD A;  2B88 A;  1FBM A;  3B5N B;  3AE2 C;  3BVH A;  1N73 C;  1HGV A;  1L0L E;  2BCC G;  4KJM A;  2NPS C;  3A0H H;  1RY3 A;  1MUU A;  2E5Y A;  2A45 I;  2IBZ G;  2QEX P;  4WWI A;  4HJG H;  1KQS O;  4ASV A;  4W7Y A;  2QA4 P;  4C7R A;  3TF5 A;  2W27 A;  1KYO H;  4N78 D;  4DZO A;  5APS A;  4D6T E;  1SQX K;  2E5T A;  3AEA C;  3GMA A;  2FYZ A;  3V2P A;  3CCQ P;  2KI7 B;  2K37 A;  1BDC A;  2IZ1 A;  3R2P A;  1FOS E;  3VMA A;  4RKU J;  5KLV K;  2FXM A;  3GHG A;  4IL6 E;  5AVW B;  5B66 E;  2CPS A;  1PP9 G;  2N9Y B;  1KIL E;  3K5B A;  4L73 A;  2XND H;  1CI6 A;  5BU5 A;  1RQU A;  1IZN B;  1WRG A;  5BVZ A;  2B87 A;  5AVX B;  5KLV G;  1GD2 E;  3PJS K;  1BE3 G;  1SQP E;  3NXS A;  4LLH A;  2OYI C;  3HD7 D;  1HJB A;  4TLF A;  3CX5 I;  1L0L J;  1NTZ J;  3P8M C;  5GTH E;  1RF0 A;  1PGP A;  3L73 D;  5KAI E;  2W6A A;  3V5B A;  2E74 C;  2PRR A;  1RH5 B;  5E79 E;  2FFD A;  1NU1 K;  3M0D C;  1FC2 C;  1M90 Q;  2Q6Q A;  1YJN P;  1RF1 C;  2E75 B;  3IF4 A;  1Q90 D;  1FZC A;  2W8Z A;  1JB0 J;  2WSS H;  2KSJ A;  4D6T J;  4IL6 H;  1FU1 A;  5B66 H;  1J1E B;  2J59 M;  2IDB A;  3LIE A;  4WBA A;  1E5W A;  4U3F D;  4NPF X;  2A45 G;  1NAY A;  1NU1 G;  1NTM J;  1KFN A;  1AJY A;  1VQM P;  1VL2 A;  1X9V A;  1SQB G;  3L74 D;  2KK7 A;  2C0W A;  2YMK A;  1VF5 D;  3RK3 C;  1XTG B;  5CCH D;  2KNC B;  1NYH A;  2WQY C;  1VQ8 P;  3KDP B;  1BCC G;  1HJ0 A;  1LTS C;  5AVT B;  1OW7 A;  1U57 A;  1SQP J;  1YJW P;  1J1D B;  3L71 E;  3GHG C;  5GTH H;  1ZV8 A;  5KAI H;  3HTK A;  4XE5 B;  3WUU A;  1KC8 Q;  5E79 H;  3TGU E;  1SFC A;  1G1J A;  3E1I A;  5KJ7 A;  1SQV E;  1T2K D;  4H44 B;  1N8R Q;  1RE4 C;  2SPZ A;  3KZI E;  1NO4 A;  3ABV C;  3SWF A;  1Q82 Q;  1NTK E;  1E79 H;  1BDD A;  1S4X A;  2C9N Y;  1KTM A;  1SQQ J;  3N4X A;  1JEK A;  2LXB A;  3VN0 A;  1RHZ B;  2WZ7 A;  5CJ4 A;  3CCL P;  3RGU A;  4C46 A;  3ZDM A;  1RF0 C;  4Y99 B;  3BAT A;  1PL5 A;  1IC2 A;  2AXC A;  3OW2 O;  5AVV B;  3Q2Y A;  4HKZ H;  2FFD C;  5DJT B;  2Q9I A;  2WWW A;  1KYO D;  5AW1 B;  3AEG C;  1IK7 A;  1N7S B;  1G2C A;  3S4R A;  2FYU E;  1FZC C;  1MV8 A;  2YKQ A;  1EZV G;  3H1L E;  2WT7 A;  4H0L C;  2QVA A;  2KP8 A;  1P84 E;  5EFW B;  1YJ9 P;  2ZXX A;  1NVO A;  1LTT C;  4RJT A;  1UIX A;  1URQ A;  2O01 H;  1ZRT E;  1SS1 A;  2JEE A;  3KZI H;  3HUS C;  2ZYA A;  3CC2 P;  3CWB G;  2K1A A;  3FWN A;  1S2E A;  3TGU J;  3H1K J;  2YIU B;  4BWN A;  1KQF B;  3E1R A;  5CMZ A;  2O01 J;  1SQV J;  3IN6 A;  2ZYD A;  3AE5 C;  1HUC A;  1L0L D;  1ZOY C;  4H44 D;  1FAV A;  5TJH A;  1ZR4 A;  1NTZ D;  3H1J E;  3WUV A;  3CCR P;  4HYT B;  4AQR D;  2BEQ D;  1NTK J;  1OVU A;  3AEF C;  1OXZ A;  1CZQ A;  3S1K A;  1KZU B;  1L4A D;  3M0A A;  3IFM A;  4PJ0 E;  2AEJ A;  1SFC C;  2V4H A;  1IFP A;  5KJ7 C;  4D6T D;  2HOD A;  1U7M A;  1MKM A;  4LGD E;  2KZI A;  2XU6 A;  1EDL A;  2XKM A;  4ZKP A;  1P84 H;  2MKV A;  2FYU J;  2QJK B;  3KYQ A;  1N7S D;  3MZW B;  1NTM D;  4XA4 A;  2E76 C;  3B8E B;  3CL3 D;  3TK1 A;  1AVY A;  2KOG A;  3H1L J;  2AXT E;  3I56 P;  2VRS A;  2Y9Y A;  5KAF E;  3PLN A;  2J58 A;  4UB6 E;  1LT9 A;  1KIL D;  4I2L C;  3L75 G;  4IL6 X;  2BCC E;  3RL0 C;  1L0N K;  3GLM A;  3O8Z A;  2NPS B;  1KYO I;  1NKN A;  2WPQ A;  2IBZ E;  4O9B A;  3CLQ A;  1SQP D;  2M3B A;  2P2U A;  1NKZ B;  1ZP0 C;  1VDF A;  2K9Y A;  5AW5 B;  1S3J A;  4OVN F;  2KB7 P;  3RL0 g;  1JY3 N;  2PFX A;  3RBX A;  4WVZ A;  1L0N G;  1FJK A;  4PJ0 H;  3AEB C;  2WVR A;  3QWO C;  3H1J J;  4U3F G;  2POH A;  1DX7 A;  1URQ C;  3II6 A;  3P7K A;  3HE5 B;  3HD7 A;  1IFD A;  3BAS A;  4N3Y B;  1A02 F;  2GM4 A;  4PD4 E;  3OAK A;  1S1C X;  2G8Y A;  1SQQ D;  5BU8 B;  1PP9 E;  4HH2 A;  3FX0 A;  4WY4 D;  2N1T B;  1U7J A;  1KN7 A;  2AXT H;  1JY2 P;  5KAF H;  2ZT9 B;  4PV1 D;  3VMY A;  4UB6 H;  1K73 Q;  2JR8 A;  3M0D A;  1AQ5 A;  1HF9 A;  4C7N B;  5KLV E;  1HGZ A;  2FBW C;  2HFE D;  3T97 A;  1PPJ G;  2FYN C;  3L70 G;  3H1H J;  2HLO A;  1KMI Z;  2LR2 A;  1H0T B;  2WPS A;  4GIF A;  4BRY A;  2NZ2 A;  2BCC J;  4TT3 H;  1J2J B;  5AVS B;  2KS1 A;  1N7L A;  2JWD A;  1IO4 A;  3SWK A;  1N86 A;  1EXJ A;  3I55 P;  3B71 A;  2YO2 A;  1Y8A A;  1LT1 A;  5AVR B;  3TNU A;  3JSV C;  4OGQ B;  5CCH A;  2QM7 A;  1RF1 B;  3MHV A;  3TGU D;  3H1K D;  1LT9 C;  1S72 P;  3M9H A;  4PD4 H;  4L76 A;  4YXW H;  3CME P;  1SQV D;  4KHX A;  1FZA A;  2OTJ P;  1YHQ P;  1YQ4 C;  3O6Q A;  1GW4 A;  3VOP A;  3NTN A;  3V2Q A;  1OW6 A;  2D2C D;  1NU1 E;  2QSI A;  2C9L Y;  1NTK D;  3U59 A;  1ZR2 A;  2K88 A;  3U1C A;  2AEM A;  2O1J A;  1SQB E;  1SQX J;  1PP9 J;  3VMX A;  3M9Q A;  3UIA A;  1RE4 A;  2N1T D;  3RK3 B;  1FS0 E;  3I5C A;  3IAO A;  1CW5 A;  5M1B A;  1D7M A;  1NTZ K;  2ZT9 D;  1LTA C;  1DEE G;  5KLV J;  1EDK A;  2ITA A;  1BCC E;  3G3Z A;  3HD7 C;  5APT A;  3BCC G;  1Q7Y Q;  1GU4 A;  1DD3 A;  3B5N D;  1M1J A;  3GHG B;  4ZNC A;  1PGQ A;  2FYU D;  4B86 A;  2G3A A;  2W83 C;  3H1L D;  2YXR B; 
#chains in the Genus database with same CATH homology
 2NPS A;  3L36 A;  3M91 A;  5KJ7 D;  4WY4 B;  2C9N Y;  3N4X A;  3MGN A;  2OYI B;  3RK2 B;  1A02 J;  3VN0 A;  1JY3 P;  4M3L A;  4EIJ A;  1WT6 A;  3HE4 B;  2E43 A;  1CI6 B;  2WZ7 A;  5CJ4 A;  1FZG A;  1FZB A;  3VTP C;  4IFD K;  2WSE H;  4C46 A;  1RF0 C;  4Y99 B;  2IFN A;  3BAT A;  1SQB K;  2WSF H;  1IC2 A;  2NPS D;  4IFF A;  1FZF A;  2XV5 A;  1S9K D;  2HPC B;  2A45 H;  5APV A;  5AVV B;  5AW9 B;  3LID A;  2FFD C;  2HYN A;  3L37 A;  3A3Y B;  2Q9I A;  3MTU E;  1RE3 C;  2WWW A;  3EQ2 A;  5AW1 B;  1JUN A;  4W7Z A;  3VP9 A;  2IX7 C;  1N7S B;  2M8R A;  1G2C A;  3OJA B;  2LKM A;  1FZC C;  3KQG A;  3V4W A;  4OH8 B;  3CI9 A;  1MV8 A;  1JY2 N;  3RL0 D;  2YKQ A;  3HUS A;  2WT7 A;  1QL1 A;  1FZE A;  2KP8 A;  3P8C E;  2YO3 A;  1T3U A;  2R3C A;  3U1A A;  1LTT C;  2FFD B;  3OA7 A;  3WMM 0;  5AVQ B;  2I1J A;  1GZL A;  1KFM A;  5AW4 B;  5CCH C;  2WPR A;  1URQ A;  1G1I A;  2O01 H;  2ZFC A;  5AW0 B;  1FZC B;  2BAS A;  2JEE A;  3HUS C;  3N7N A;  3VMZ A;  1LT9 B;  4C7N A;  5CHX A;  5AW3 B;  1N2D C;  4JYB A;  1GL2 C;  2KYV A;  2QM8 A;  1X8Y A;  4I1L A;  4IFM A;  2WIT A;  2FKW B;  1AFO A;  5CMZ A;  2N9B A;  1URQ D;  1JOC A;  1L0L K;  2N1T C;  2Q7C A;  1HVV A;  5APX A;  1ZN5 A;  1H8A A;  3TNU B;  1JY2 O;  4GKG A;  1IJD B;  1L4A A;  1NOH A;  5AW8 B;  1HUC A;  1YYC A;  1HWT C;  1FAV A;  2OYI A;  1ZR4 A;  3PP5 A;  5AVZ B;  4HYT B;  4AQR D;  3HE4 A;  5CCG C;  2C0X A;  3H32 B;  1LGH B;  2Z4E A;  1X79 B;  1MFZ A;  1T2K C;  1SQQ K;  3EFG A;  4WB4 A;  3KPE A;  3B5N C;  1DEB A;  1OXZ A;  1CZQ A;  5APU A;  4LC1 A;  1KZU B;  1L4A D;  2MJZ A;  3M0A A;  3IFM A;  1ZLL A;  1NWQ A;  1HBW A;  1LTJ A;  1FDM A;  2ZXE B;  1JTH A;  3MIW A;  3RK2 D;  1SFC C;  2Q5U A;  1IFN A;  3IR9 A;  1LWU A;  3L4F A;  3P8C D;  2CPB A;  5KJ7 C;  1N7S A;  1XTC C;  2HOD A;  3TYY A;  1JO5 A;  5AW2 B;  2P67 A;  3M9B A;  4AYC A;  3TSI A;  1W2E A;  1M1J C;  2XDJ A;  4LGD E;  1RF1 A;  1FOS F;  3HD7 B;  1QL2 A;  5APW A;  2XU6 A;  1SLQ A;  2XKM A;  4ZKP A;  3B5N B;  1FBM A;  3HTK B;  3BVH A;  1N73 C;  1HGV A;  1IFJ A;  1KIL A;  1NTM K;  2NPS C;  3KYQ A;  1RY3 A;  1MUU A;  2YMY A;  1N7S D;  4XA4 A;  2H43 A;  1NAF A;  3B8E B;  3CL3 D;  2GUS A;  3M06 A;  3TK1 A;  2KOG A;  1DH3 A;  2A45 I;  2VRS A;  2OYH A;  3SWY A;  1M1J B;  2J58 A;  2W6B A;  3NFQ A;  3HRN A;  3LW5 H;  1LT9 A;  1KIL D;  4W7Y A;  4I2L C;  4C7R A;  3MD0 A;  3V4Q A;  2W27 A;  3RL0 C;  1L0N K;  2R32 A;  4N78 D;  4DZO A;  3O8Z A;  5APS A;  2NPS B;  1NKN A;  1SQX K;  2WPQ A;  1SQP K;  4O9B A;  3CLQ A;  2FYZ A;  1SP4 A;  3V2P A;  2M3B A;  2P2U A;  4AUW A;  1CSB A;  3H6P A;  1NKZ B;  1VDF A;  5AW5 B;  3R2P A;  3V2N A;  1FOS E;  5APY A;  1JNM A;  1GK6 A;  5KLV K;  2FXM A;  2KB7 P;  1FJP A;  1JY3 N;  3RL0 B;  1OWA A;  3GHG A;  3RK3 D;  3A2A A;  2R5D A;  4EOT A;  1FJK A;  5AVW B;  1H88 A;  2P1J A;  2IPP A;  2POH A;  1M7L A;  2R5B A;  1DX7 A;  2CPS A;  4N6J A;  2PP6 A;  1URQ C;  3II6 A;  1G2C B;  4WY4 A;  4W80 A;  1GDT A;  3P7K A;  1GU5 A;  3HE5 B;  3HUS B;  2WT7 B;  3HD7 A;  4N78 E;  1IFD A;  1CI6 A;  3BAS A;  4N3Y B;  5BU5 A;  1WRG A;  1HTL C;  2XNX A;  1A02 F;  2GM4 A;  2KLV A;  5BVZ A;  3OAK A;  5AVX B;  1GD2 E;  3A5T A;  1GL2 B;  5AVU B;  5BU8 B;  4HH2 A;  3NXS A;  4WY4 D;  2HPC A;  1L4A C;  2N1T B;  2PAJ A;  1NHL A;  1NH4 A;  4LLH A;  1JCC A;  2OYI C;  1JY2 P;  5APQ A;  1JY3 O;  2I1K A;  1LTG C;  3HD7 D;  3L35 A;  3RK2 C;  1HJB A;  3VMY A;  4JYC A;  2P7J A;  3M0D A;  1AQ5 A;  2JJL A;  1T8Z A;  5KTB A;  4C7N B;  2H7H A;  1GTW A;  1HGZ A;  2HFE D;  4Y99 C;  2H8P D;  2XZR A;  3P8M C;  1RF0 A;  3T97 A;  2E42 A;  1YTZ I;  2YKP A;  1J1E C;  2W6A A;  3V5B A;  1LTJ C;  1L4A B;  5AVY B;  4I6M C;  2HLO A;  2FFD A;  1LTI C;  1LWU C;  4ZKU A;  1SFC B;  1IFM A;  3MUD A;  2WPS A;  4GT1 A;  1SVF A;  1N7S C;  1NU1 K;  3M0D C;  4GIF A;  1RE3 A;  4JF7 A;  5AW7 B;  1RF1 C;  3C9I A;  2O1K A;  1J2J B;  5AVS B;  1FZC A;  1N7L A;  2KSJ A;  1IO4 A;  3V2R A;  1N86 A;  1EQ7 A;  1KIL C;  1N73 B;  1FU1 A;  1J1E B;  1LTJ B;  2J59 M;  1JTH B;  3LIE A;  1LTB C;  4WBA A;  2YO2 A;  1Z56 A;  1E5W A;  1LWU B;  2OAR A;  2HOD B;  5AVR B;  3TNU A;  2OYH C;  2A45 G;  5CCH A;  1IFI A;  2QM7 A;  1RF1 B;  3HE5 A;  3NMD A;  1LT9 C;  3M9H A;  1KFN A;  1SQV K;  1T3J A;  1MZ9 A;  3BRT B;  1PFI A;  3H32 A;  1J1D C;  1X9V A;  5CJ0 A;  1KIL B;  1FZA A;  4KHX A;  1GL2 A;  3VYI A;  1KQL A;  2C0W A;  3RK3 C;  1GW4 A;  1XTG B;  2Z5H A;  3VOP A;  3NTN A;  2Q3I A;  3V2Q A;  5CCH D;  1NTK K;  2N1T A;  1HH0 A;  2HG5 D;  2C9L Y;  2OYH B;  3BRV B;  3U59 A;  1ZR2 A;  1JCD A;  3KDP B;  3VP8 A;  1S9K E;  3U1C A;  2O1J A;  1LTS C;  1GL2 D;  5AVT B;  5CCG A;  2WTY A;  1JMM A;  1J1D B;  2Z5I A;  3M9Q A;  3UIA A;  3VMX A;  3GHG C;  1RE4 A;  1ZV8 A;  3B5N A;  3HTK A;  2N1T D;  4XE5 B;  3RK3 B;  3I5C A;  2L5G B;  3A7O A;  1CW5 A;  1IK9 A;  1NTZ K;  1LTA C;  2GUV A;  1GK4 A;  1SFC A;  2WSC H;  4WY4 C;  1URQ B;  1VPC A;  5CCG D;  2YKO A;  1G1J A;  3E1I A;  3G3Z A;  5KJ7 A;  2IFM A;  3HD7 C;  1T2K D;  5APT A;  1GU4 A;  5AW6 B;  1H89 A;  1RE4 C;  1GW3 A;  2FYU K;  3B5N D;  1M1J A;  1NO4 A;  3GHG B;  4B86 A;  1YTZ T;  3P32 A;  1N73 A;  3SWF A;  2YNY A;  1SFC D;  4RES B;  4DOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...