5APWA

Sequence matkdd inserted between gcn4 adaptors - structure t6
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
67
structure length
67
Chain Sequence
GHMKQLEDKVEELLSKVYHLENEVARLKKLMATKDDMKQLEDKVEELLSKVYHLENEVARLKKLVGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title alpha / beta coiled coils.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords GENERAL CONTROL PROTEIN GCN4
total genus 30
structure length 67
sequence length 67
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5apwA00
1IO4A 5AVRB 2QM7A 2C9LY 1MV8A 3A3YB 4C7NB 3HTKA 5APXA 3KDPB 1OXZA 1DH3A 2WT7B 5AW8B 2WPSA 5APTA 1JUNA 5AW1B 1SP4A 3V4WA 4AUWA 2Z5HA 2R3CA 2W27A 5AW3B 3VMYA 2E42A 5AVWB 3VTPC 5APVA 1GD2E 5APYA 1T2KD 1FOSE 1NAFA 2WWWA 1KQLA 4M3LA 1GU4A 1H88A 1HJBA 5APSA 3MGNA 3VN0A 2WT7A 2KP8A 1OWAA 3M0DA 2XU6A 4JYCA 4C46A 3L36A 2YNYA 2YO2A 3HE4B 4GT1A 1FOSF 4I2LC 3V5BA 5AVYB 5AW6B 1X8YA 5AW0B 1J2JB 4I6MC 3V4QA 1HUCA 1A02F 5AW2B 1GZLA 2R5BA 5AW9B 3MD0A 1YYCA 4LC1A 1HWTC 2C9NY 2P2UA 3UIAA 3L37A 3I5CA 4AQRD 3HE5A 3M91A 3NTNA 2Q3IA 3TNUB 3B8EB 3T97A 4KHXA 2R32A 5AVTB 4AYCA 1A02J 2N9BA 1T2KC 5AVUB 3P7KA 1S9KD 2P67A 4B86A 2E43A 2WPQA 1CSBA 3NXSA 5AW5B 3VYIA 5CMZA 2ZFCA 4XE5B 2Q7CA 3P8MC 1CI6A 3NFQA 3TYYA 1GU5A 2IPPA 5AVZB 1GTWA 3M9BA 1FAVA 1SLQA 2WPRA 4DZOA 5AW7B 2YO3A 5AVQB 2QM8A 3A2AA 5AW4B 3M9HA 1MUUA 2P7JA 2XZRA 3OAKA 2JJLA 2VRSA 4EOTA 2H7HA 5APUA 1CI6B 3KQGA 1NWQA 5AVVB 4RESB 3A7OA 3A5TA 2W6AA 3VMXA 3VMZA 1GK6A 5AVSB 3IR9A 3TK1A 3HE5B 2WTYA 3TNUA 1CZQA 2R5DA 5APWA 4HYTB 1S9KE 3L35A 2Z5IA 3O8ZA 2Q5UA 4GKGA 4C7NA 5AVXB 2BASA 3HE4A 1H89A 5APQA 2ZXEB 1GK4A 3LIEA 3M0AA 3SWFA 1JNMA 1MFZA 3NMDA 2XV5A 1G2CB 3LIDA 1H8AA 4JYBA 3P32A 1HBWA 3M06A
chains in the Genus database with same CATH superfamily
2O3JA 1IO4A 1LP1B 1D7MA 1OVVA 5AVRB 3V2QA 1DIPA 1GMJA 4PV1D 2FKWB 2QM7A 2A45I 5BU8B 1GL2B 1E79H 1HTLC 4C7NB 2E74B 2Y0CA 2C9LY 2CPBA 2YMYA 1NH4A 4ZKPA 3RK2C 4BWNA 3CCLP 3AE1C 5APTA 3HRNA 1JUNA 2PGDA 1KV4A 1BE3G 1SFCC 1LTSC 1VL2A 3MP7B 2RMZA 1BE3D 3CCMP 2R3CA 5AW3B 2FYNB 2KNCB 1FU1A 3AE9C 3QWOC 2E42A 5AVWB 3L70D 2KYVA 5KKZC 1AVOA 1SFCA 2ITAA 2JR8A 2KB7P 2M8RA 2YXRB 5CHXA 2OYIB 1GD2E 2WWWA 1KQLA 2FXPA 3L74E 2SPZA 2GM4A 3AEAC 1Y8AA 3P8CD 4U3FD 4H44B 5K5GB 4D6TE 5KLIB 5CCGC 1NHLA 1OX3A 4WY4B 2KP8A 2LR2A 2FYZA 3R2PA 3RK2B 4BRYB 3II6A 3BCCG 5CCGA 3H1HG 1FJPA 4KJMA 3V2PA 3BATA 3L36A 1SVFA 3RL0B 3HE4B 4GT1A 3V5BA 4N6JA 1LTJC 4OGQD 5AW6B 5CCHA 3A0BE 1K73Q 2NPSB 3L72D 1EZVI 5KKZB 2OYIA 2QVAA 2POHA 5AW9B 1ZMEC 2W83C 5CCHC 3H1IG 3MD0A 2OTLP 1YYCA 2Q3EA 3BCCE 4LC1A 1HWTC 1RF1B 2FFDA 1AQ5A 2Y0DA 3AE5C 3CL3D 3L37A 4PD4D 4WY4A 4BRYA 1KTMA 1JB0J 2Q3IA 5BVZA 5E79H 1K8AQ 1VQ9P 3H1LG 3Q2YA 1KD1Q 3CD6P 4O9BA 2R32A 1EZVG 3PJSK 1TU3F 1T3UA 1M90Q 2R3SA 2WPVB 3BCCJ 3L72J 3P8CE 3USSA 4HB1A 1KZUB 1NTZK 2Q6QA 1LT1A 5AVUB 3V6IA 1M56D 2D2CD 2O1KA 1KB9I 2Z4EA 2E43A 3L72G 4CPGA 3L73D 2IZ1A 3H1JE 1NU1E 1FE6A 1SQPJ 2R44A 1Q90D 3L73G 1L0LG 3NXSA 3RBXA 3TGUD 2FYNC 1VQLP 1VQ6P 2ZFCA 5KTBA 1N86A 2C0WA 1EDJA 2FYUG 3GHGC 4U3FJ 3L72E 4WBAA 1WRGA 3RL0C 2WITA 1KB9E 1M1JC 5AVZB 1GL2C 3Q5SA 2E75D 1SQVK 2ZJSE 2ZT9D 2H88C 2CPSA 1BE3E 3L71D 2AEMA 3M9BA 4UB8H 5KJ7A 1NU1D 1BCCE 1AVYA 1JY3N 1NTZE 2QM8A 1XTCC 1NYHA 2HFED 5AW4B 2UWJE 3M9HA 4EYYQ 1KQSO 2P7JA 3M9QA 2OYHA 2P1JA 2Y0EA 3FWLA 3RGUA 1JMMA 3N4XA 2YIUB 3V2NA 3ABVC 2H89C 1L4AA 2RH0A 1KILA 4GOFA 3EFFK 5AVVB 2K9YA 3AEDC 2IYPA 2J58A 1IK9A 1NTZJ 2W6AA 1PPJG 3MTUE 4K3AA 1VDFA 4Y99C 3A5TA 3Q1MA 3TK1A 3BRVB 3A0HH 1JTHB 3CC4P 4EDFA 1FZGA 1N7SC 2MKVA 1BDCA 3HD7D 1OZHA 1SQXE 5CJ4A 1KILD 1PPJE 3EWKA 1BSNA 3KPEA 3G4SP 1YI2P 2OYHB 4L75A 2BCCD 1ZLLA 2M3BA 4DT0A 3G6EP 2BCCG 1JOCA 1GW4A 3H1IE 3B5ND 4Z1MH 1KILB 1LWUC 2WSEJ 3GW6A 1FDIA 2KUBA 2QJYB 3LIEA 3M0AA 3H25A 1URQD 1OMIA 3B4SA 2IBZE 3NMDA 2KZJA 5L8RJ 3OJAB 2M3EA 2XV5A 1OW8A 2I1JA 4I7ZB 2KS1B 4UB6E 3CCRP 3H1LD 3LIDA 1HVVA 2WQYC 4JYBA 4NPEA 1NOHA 3MUDC 2WSEH 1UIXA 2GUSA 1H89A 4GDOA 4HJGH 1PGPA 1YQ4C 1BGYE 2OTKE 1URQA 1RE3C 2JWDA 5B66E 1LJ2A 2KOGA 3A3YB 3CWBJ 3HTKA 3L74G 3L70E 4GIFA 5APXA 3MHVA 3AEEC 1DH3A 1SQQG 4IOIH 1L0LJ 5H2FE 1NTKG 2QJKC 1RQUA 2WPSA 2YMKA 5CCGD 5AW1B 1KILE 1SP4A 2ZAEB 2E75B 2LXCB 1IFIA 2KIKA 1BGYJ 4I7ZC 2A06E 3B5NB 3H1HD 3W67A 2FYUJ 3AE6C 3VTPC 1LTTC 1USEA 4OWFA 3SSUA 1VQ5P 2W8ZA 5APYA 1T2KD 1RE4C 1N73B 2OYOA 1NAFA 1NKNA 3AE3C 4PD4I 4W7YA 5KLVK 1VQPP 1H88A 5APSA 3HTKB 1VQOP 2QE7H 1BGYG 2CK3H 5KJ7D 1XTGB 2PAJA 4JF7A 2KSJA 2OGUA 3HD7C 2PFXA 2OYIC 1PP9E 1ZR2A 3Q3DA 1LTIC 2HODA 2YNYA 2B87B 4H44D 4PD4E 3JCUH 2O01J 2QG4A 1RQVA 3L4FA 1FOSF 1W5CE 2XNXA 5AVYB 1S3JA 3Q5PA 1KORA 3EFGA 1IC2A 3K5BA 1A02F 5GTIE 5GTIH 2HR3A 1NTMJ 1GZLA 3GG2A 1K05A 2R5BA 1JEKA 1L0LK 2XKMA 2NRGA 3CLQA 3TF5A 2IYOA 2QEXP 2K9JB 3FX0A 5KAIE 2JEEA 2ZVNB 4ZKUA 1OIPA 1KFNA 4WVZA 1X9VA 4C7RA 4AQRD 3CX5E 3W68A 3HE5A 3JCUE 1OVRA 2L5GB 3HD7A 4H0LD 1YJWP 3B8EB 3T97A 1BE3J 1M8OB 1SQBE 2V7QJ 2LKMA 4U7JA 2ZVOB 3TGUG 5KJ7C 1SS1A 1NTKK 5AVTB 1JY2P 3RL0D 3KXDA 4PV1B 4AYCA 1S4XA 2B89A 1NWQA 1VF5D 1L0ND 2P67A 4RJTA 4B86A 1DEEG 1OW7A 3E7KA 3N7NA 1BCCD 1IZNB 1JCDA 2WPQA 3VYIA 5AW5B 3CI9A 2YKPA 3B5NC 1YTZI 3HD7B 3L73E 4PJ0H 3CCVP 3FXDA 3T97B 1IFJA 4K35A 1DD4A 5EFWB 3TYYA 1GU5A 1FZEA 2IPPA 3AE4C 3JC22 1SQXJ 1LTJB 3IAOA 3VP8A 3Q5RA 1FAVA 5B66H 2D2CC 1SQVD 2M5AB 2YO3A 2O01N 4YXWH 1T8ZA 1MUUA 2JWAA 3CCSP 3OAKA 2ZYGA 3U1AA 4PJ0E 2NPSA 2BEQD 1QGKB 3QH9A 2VRSA 4EOTA 4UB6H 1AJYA 5KLVG 1J1EB 2WZ7A 5APUA 1HJBA 1GDTA 4ASVA 1NTKJ 2IZ0A 1QEXA 3E1IA 5C39A 2A45G 3L75J 1VF5B 3V2RA 3A7OA 2FBWC 3A0BH 5M1BA 3WU2E 2QA4P 3IR9A 1LTJA 1KMIZ 1EZVE 4PV1C 1P84H 2JKVA 2N1TD 4OGQB 1G1JA 1LWUA 1JY2N 2R5DA 3H1JD 4EIJA 2I1KA 5GTHE 5BU5A 2FFDB 2WVRA 2Z5IA 4U3FG 2HG5D 3H1HE 3SFDC 4GKGA 3GLMA 1EDIA 4L76A 1S5LH 5AVXB 3S4RA 4D6TD 3CXHD 4YXDC 1LT9A 1W2BO 1VQKP 5KLVD 3TSIA 1EZVD 3MUDA 5APQA 1SQXK 2ZXEB 2QJPC 1Q7YQ 4D6TJ 1K04A 1M1JB 4ZNCA 5CCHD 1N8RQ 1NTZG 1Q2NA 2IFMA 2P58A 2WSSH 2QSIA 1OFCX 1G2CB 1KILC 1LWUB 2HYNA 3L75G 3TDKA 3P32A 2QRXA 3RK3C 3O6QA 5TISE 4L73A 1RH5B 1E5WA 1ZRTE 2V7QH 3M0DC 4UB8E 3D6YA 1MV8A 1EQ7A 4GOEA 3PLNA 1OXZA 3H1KJ 1FZFA 1DD3A 1KB9H 2N1TB 2Y9ZA 3BRTB 1BCCG 2WSCH 5CJ0A 2G8YA 5AW8B 1MZ9A 1M1JA 3AECC 4WWIA 3SFEC 1AFOA 1HF9A 4Y99B 3V4WA 5B5EH 1FDOA 1L4AB 1Y47A 2I8DA 1L4AD 2YXQB 1G2CA 2Z5HA 4N3YB 4JBZA 1ZRTD 2W27A 4W80A 3VMYA 2P10A 2K37A 1SQVJ 1OW6A 4HKZH 2QJKB 4IFFA 3CXHH 3F5HA 3H1KE 5APVA 3WUVA 1AA0A 3CX5H 1RY3A 1VF5C 2M0BA 3FXEA 4IL6H 1FOSE 2HPCA 4M3LA 1JTHA 4KT0J 1SQVG 1LT9C 3VP9A 4DJGA 3B71A 2W6BA 1L2PA 2NZ2A 1KFMA 2N1TA 3FWNA 3VN0A 1S1CX 1SQBJ 1KYOE 2IDBA 1MFTA 2ZYDA 1URQC 3H6PA 4H13B 3M0DA 2XU6A 4N78D 3JSVC 5E79E 3CPWO 2FXMA 4C46A 1IFDA 2J59M 1S5LX 2JDIH 2KZIA 2QIWA 3HUSB 2YO2A 1P84D 3IF4A 3WUUA 2LXBA 1SQXG 2E5TA 2FXOA 3TGUE 1JY3O 1M57D 1X8YA 3L74D 3CWBG 3PTZA 2NPSD 2ZYAA 1KYOI 4IL6X 4WY4C 1HJ0A 1QL2A 3G3ZA 1SFCD 1KB9D 2QJPB 3GF3A 5AW2B 1FS0E 1FC2C 3AE7C 1IJDB 1PGOA 3H1ID 1SQQK 2C9NY 1P84E 2P2UA 2IBZI 3C8VA 3I5CA 2V4HA 1URQB 3GMAA 3TNUB 1ZV8A 3HUSA 1LNQA 2RKLA 3CWBE 4KHXA 4OVNF 1YJ9P 3CX5I 3MZWB 1KQFB 3CMAP 1NTMD 2B9BA 2Q1KA 4W7ZA 2A06G 2N1TC 4IFMA 3RK2D 1WMKA 3FGAD 1U7MA 4XA4A 3L74J 5H2FH 1AV1A 1NVOA 3GHGB 3P7KA 1S9KD 1T2KC 1RF0C 3SWKA 3B5NA 3CMEP 1NTKE 1L4AC 2FYUE 2IFNA 2KLVA 4H0LC 1SQQE 1FJKA 1PPJD 2Q7CA 3H1KG 1R5LA 1L0NK 4LGDE 1PP9D 3CCJP 4ZMDA 2PP6A 3AEFC 1NAYA 1Y9BA 3ITKA 1X79B 1GTWA 1GW3A 1LP1A 1T6AA 1EXIA 1DX7A 1VQ4P 3L71G 1GL2A 1SLQA 2HODB 2WPRA 1SQQJ 3H1HJ 1NTMG 3LW5J 5AW7B 1BGYD 1Z56A 1U7JA 1N7LA 2XZRA 3WUTA 3C1LA 1PFIA 3OA7A 1RF1A 2E5YA 2H43A 2H7HA 4WY4D 1L0LD 2E76C 5DJUB 4RESB 4WB4A 1M1KQ 1FZCA 3CC7P 1SFCB 1GK6A 2AEJA 1EC5A 1QLED 2OARA 1MKMA 3HE5B 4JQ0D 4Y28J 5AVSB 1H0TA 4QMAA 1CZQA 5APWA 4H13C 2D2CB 2WSFJ 1SQPK 2IBZD 5DJTB 1LTGC 4NPDA 3HUSC 1YQ3C 1IK7A 1PV3A 3L35A 1EXJA 3O8ZA 1ZW0A 2E74C 1KC8Q 2G3AA 4U3FE 2FFDC 3HE4A 1SQQD 1J1EC 5KLVJ 1N2DC 3D6ZA 4PD4H 1YTZT 1LTAC 3I55P 1MFZA 2XDJA 4R4MA 1ZP0C 1FZCB 3C9IA 1YBKA 2BCCJ 2E76D 1L0NG 1H0TB 1PP9J 1VPCA 2NPSC 5CBNA 1HBWA 2XNDH 3AE2C 4A7PA 2MJZA 5KLVE 2KSEA 2A06D 3CCQP 1PGJA 1EDLA 2ZT9C 2DW3A 2M5AA 4H44C 1L0NJ 3KDPB 1T3JA 5KLIC 4ASWA 5B5EE 2Y9YA 1RF1C 3RK3B 2WT7B 2WSFH 3EQ2A 3L70G 3H1JG 2IX7C 1SQPG 3AEBC 3PH0A 3R4YA 4DCKA 1RE4A 1N73C 4TLFA 1JCCA 1QL1A 2O1JA 3L75E 1FDMA 1FZAA 1BDDA 2BEZF 2E76B 1HGVA 1NU1J 1AQTA 1L0NE 1SQPE 1USDA 3IFMA 5TISH 1OVUA 3L71J 1SQXD 3G9RA 3H1IJ 1ZR4A 2IBZG 3AE8C 1Q86Q 1GU4A 2WSCJ 1VQNP 1NU1G 2K1AA 4N78E 2L91A 5CBOA 3MGNA 4IFDK 1BSHA 4DOJA 1ZXGA 2WT7A 1N7SD 3LW5H 1OWAA 2RN0A 4GODA 4XFJA 3U1CA 3CCUP 4JYCA 1UIIA 1SQPD 2AXTH 2OTJP 1BCCJ 3KZIH 2KI7B 1KYOD 3L73J 1LT9B 3PRJA 2E74D 1R8EA 3D71A 1S5LE 1GL2D 2N9YB 2PRRA 2A45H 2FY8A 2W6JH 4I2LC 1U57A 1YIJP 5AW0B 1J2JB 4I6MC 3V4QA 1HUCA 1Q82Q 1SQBD 3BCCD 1NGMB 1PZQA 1KQGB 4R4LA 3RBZA 3BVHA 2KLUA 4JPZB 4LLHA 4TT3H 3RL0g 1CW5A 1PIXA 2KK7A 2YIUC 1LTBC 3A0HE 3O6QB 3UIAA 3VOPA 1M7LA 3WU2H 3KZIE 3M91A 3E1RA 3NTNA 3U59A 1JY3P 2B88A 1ZN5A 2AXTE 3GF7A 3WMM0 1YHQP 4YPCA 3PHLA 1A02J 2HLOA 4NPFX 2N9BA 1PP9G 1NKZB 1N7SB 2Q9IA 4H13D 1R5SA 3H1KD 3H32B 2H8PD 1IFMA 2JO1A 1FZCC 3CX5D 4D6TG 1S72P 1J1DB 1DEBA 4MN4C 3CCEP 1YJNP 1SQVE 1CSBA 1VQ8P 1KYOH 5CMZA 1K9MQ 1FZBA 1QVFO 1FBMA 4XE5B 3RK3D 1RF0A 2HPCB 2KS1A 3P8MC 1CI6A 3H1LJ 1JY2O 3NFQA 1X22A 1IFPA 4IL6E 2FYUK 2ZT9B 2ZXXA 1NU1K 3CXHE 1NTMK 5TJHA 1YITP 3S1KA 3KYQA 1Q81Q 1JM0A 4RKUJ 3L70J 1N7SA 1WT6A 1EDKA 4DZOA 2FYUD 3H32A 5AVQB 3A2AA 3S9OA 4OH8B 1KN7A 1HH0A 1SQBG 1L0LE 2OQQA 3H1LE 5KAFE 2C0XA 4YTPC 4BXLA 1QVGO 3CXHI 2JJLA 2WMMA 1QX8A 1RHZB 4H0LB 3SWYA 2YKQA 3D70A 1JO5A 4L74A 3H1JJ 2BCCE 1CI6B 2QJYC 2YKOA 1S2EA 3KQGA 3KHUA 1JMBA 1IFNA 4EI2A 1SQBK 3OW2O 3CWBD 1W2EA 1VQMP 1HGZA 2J5UA 3MIWA 3VMXA 3VMZA 3ZDMA 1NTZD 2KXPB 2OYHC 1X0TA 5KAIH 2WTYA 1G1IA 1N73A 2K88A 3TNUA 3L75D 1ZOYC 3AEGC 1NTKD 2W90A 4HYTB 2AEFA 4RO0A 2JP3A 3F89A 3RK3E 3G71P 1S9KE 1P84I 1NJIQ 4I1LA 3BASA 1RE3A 2Q5UA 4C7NA 5KAFH 2B87A 2BASA 3GHGA 4OGQC 3I56P 1NO4A 2GA1A 3PP5A 1GK4A 2AXCA 3SWFA 1JNMA 1PGQA 3VMAA 2E75C 1VQ7P 2K3RA 1J1DC 3CC2P 1NTME 2GUVA 3IN6A 3L71E 5GTHH 1H8AA 1PL5A 2KNCA 2K9JA 4HH2A 2O01H 4AUWA 1LGHB 3TGUJ 3M06A
chains in the Genus database with same CATH topology
1IO4A 5AVRB 3V2QA 2FKWB 2QM7A 2A45I 5BU8B 1GL2B 1HTLC 4C7NB 2C9LY 2CPBA 2YMYA 1NH4A 4ZKPA 3RK2C 5APTA 3HRNA 1JUNA 1SFCC 1LTSC 2R3CA 5AW3B 2E42A 1FU1A 5AVWB 2KYVA 1SFCA 2KB7P 1GD2E 2M8RA 5CHXA 2OYIB 2WWWA 1KQLA 2GM4A 3P8CD 1RF1A 2FFDB 5CCGC 1NHLA 4WY4B 2KP8A 2FYZA 3R2PA 3RK2B 5CCGA 3II6A 1FJPA 3V2PA 3BATA 3L36A 1SVFA 3RL0B 3HE4B 4GT1A 3V5BA 4N6JA 1LTJC 5AW6B 5CCHA 2NPSB 2OYIA 2POHA 5AW9B 1DX7A 5CCHC 3MD0A 1YYCA 4LC1A 1HWTC 1RF1B 2FFDA 1AQ5A 3CL3D 3L37A 4WY4A 2Q3IA 5BVZA 2R32A 1T3UA 3P8CE 1KZUB 1NTZK 5AVUB 2O1KA 2Z4EA 2E43A 3NXSA 2ZFCA 5KTBA 1N86A 2C0WA 3GHGC 4WBAA 1WRGA 3RL0C 2WITA 1M1JC 5AVZB 1GL2C 1SQVK 2CPSA 3M9BA 5KJ7A 1JY3N 2QM8A 1XTCC 5AW4B 2HFED 3M9HA 2P7JA 3M9QA 2OYHA 2P1JA 1JMMA 3N4XA 3V2NA 1L4AA 1KILA 5AVVB 2J58A 1IK9A 2W6AA 3MTUE 3A5TA 1VDFA 4Y99C 3TK1A 3BRVB 1JTHB 1FZGA 1N7SC 3HD7D 5CJ4A 1KILD 3KPEA 2OYHB 1ZLLA 2M3BA 1JOCA 1GW4A 3B5ND 1KILB 1LWUC 3LIEA 3M0AA 1URQD 3NMDA 3OJAB 2XV5A 2I1JA 3LIDA 1HVVA 4JYBA 1NOHA 2WSEH 2GUSA 1H89A 1URQA 1RE3C 2KOGA 4GIFA 3A3YB 3HTKA 5APXA 1DH3A 2WPSA 5CCGD 5AW1B 1SP4A 1IFIA 3B5NB 3VTPC 1LTTC 5APYA 1T2KD 1RE4C 1N73B 1NAFA 1NKNA 4W7YA 5KLVK 1H88A 1HJBA 5APSA 3HTKB 5KJ7D 1XTGB 2PAJA 4JF7A 2KSJA 3HD7C 1ZR2A 1LTIC 2HODA 2YNYA 1FOSF 3L4FA 2XNXA 5AVYB 3EFGA 1IC2A 1A02F 1GZLA 2R5BA 2XKMA 1L0LK 3CLQA 2JEEA 4ZKUA 1KFNA 1X9VA 4C7RA 4AQRD 3HE5A 3HD7A 2L5GB 3B8EB 3T97A 2LKMA 5KJ7C 1NTKK 5AVTB 1JY2P 3RL0D 4AYCA 2P67A 4B86A 3N7NA 1JCDA 2WPQA 3VYIA 5AW5B 3CI9A 2YKPA 3B5NC 1YTZI 3HD7B 1IFJA 3TYYA 1GU5A 1FZEA 2IPPA 1LTJB 3VP8A 1FAVA 2YO3A 1T8ZA 1MUUA 3OAKA 3U1AA 2NPSA 1CW5A 2VRSA 4EOTA 1J1EB 2WZ7A 5APUA 1GDTA 3E1IA 2A45G 3V2RA 3A7OA 3IR9A 1LTJA 2N1TD 4EIJA 1G1JA 1LWUA 1JY2N 2R5DA 2I1KA 5BU5A 2Z5IA 2HG5D 4GKGA 4IFDK 5AVXB 1LT9A 3TSIA 3MUDA 5APQA 1SQXK 2ZXEB 1M1JB 5CCHD 2IFMA 1G2CB 1KILC 1LWUB 2HYNA 3P32A 3RK3C 1E5WA 3M0DC 1MV8A 1EQ7A 1OXZA 1FZFA 2N1TB 3BRTB 5CJ0A 2WSCH 5AW8B 1MZ9A 1M1JA 1AFOA 4Y99B 3V4WA 4AUWA 1L4AB 2Z5HA 4N3YB 1L4AD 4W80A 1G2CA 2W27A 3VMYA 4IFFA 5APVA 1RY3A 1FOSE 2HPCA 4M3LA 1JTHA 3VP9A 1LT9C 2W6BA 1KFMA 2N1TA 3VN0A 1URQC 3H6PA 4N78D 3M0DA 2XU6A 2FXMA 4C46A 1IFDA 2J59M 3HUSB 2YO2A 1JY3O 1X8YA 4WY4C 2NPSD 1QL2A 3G3ZA 1SFCD 5AW2B 1IJDB 1SQQK 2C9NY 2P2UA 3I5CA 1URQB 3TNUB 1ZV8A 3HUSA 4KHXA 4W7ZA 3RK2D 2N1TC 4IFMA 4XA4A 1T2KC 3GHGB 3P7KA 1S9KD 1RF0C 3B5NA 1L4AC 2IFNA 2KLVA 1FJKA 2Q7CA 1L0NK 4LGDE 2PP6A 1X79B 1GTWA 1GW3A 1GL2A 1SLQA 2HODB 2WPRA 5AW7B 1Z56A 1N7LA 2XZRA 1PFIA 3OA7A 2H43A 2H7HA 4WY4D 4RESB 4WB4A 1FZCA 1SFCB 1GK6A 5AVSB 2OARA 3HE5B 1CZQA 5APWA 1SQPK 1LTGC 3HUSC 3L35A 3O8ZA 2FFDC 3HE4A 1J1EC 1N2DC 1YTZT 1LTAC 1MFZA 2XDJA 1FZCB 3C9IA 1VPCA 2NPSC 1HBWA 2MJZA 3KDPB 1RF1C 1T3JA 3RK3B 2WT7B 2WSFH 3EQ2A 2IX7C 1RE4A 1N73C 1JCCA 1QL1A 2O1JA 1FDMA 1FZAA 4O9BA 1HGVA 3IFMA 1ZR4A 1GU4A 4N78E 3MGNA 4DOJA 2WT7A 1N7SD 3LW5H 1OWAA 3U1CA 4JYCA 1LT9B 1GL2D 4I2LC 2A45H 5AW0B 1J2JB 4I6MC 3V4QA 1HUCA 3BVHA 4LLHA 3VOPA 1LTBC 3UIAA 1M7LA 3M91A 3NTNA 3U59A 1JY3P 1ZN5A 3WMM0 1A02J 2HLOA 2N9BA 1NKZB 1N7SB 2Q9IA 3H32B 2H8PD 1IFMA 1FZCC 1J1DB 1DEBA 1CSBA 5CMZA 1FZBA 1FBMA 4XE5B 3RK3D 1RF0A 2HPCB 3P8MC 1CI6A 1JY2O 3NFQA 2FYUK 1NU1K 1NTMK 3KYQA 1N7SA 1WT6A 4DZOA 3H32A 5AVQB 3A2AA 4OH8B 1HH0A 2C0XA 2JJLA 3SWYA 2YKQA 1JO5A 1CI6B 2YKOA 3KQGA 1NWQA 2OYIC 1IFNA 1SQBK 1W2EA 1HGZA 3MIWA 3VMXA 2OYHC 3VMZA 1N73A 2WTYA 1G1IA 3TNUA 4HYTB 1S9KE 4I1LA 3BASA 1RE3A 2Q5UA 4C7NA 2BASA 3GHGA 1NO4A 3PP5A 1GK4A 3SWFA 1JNMA 1J1DC 2GUVA 1H8AA 4HH2A 2O01H 1LGHB 3M06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IO4 A;  5AVR B;  2QM7 A;  2C9L Y;  1MV8 A;  3A3Y B;  4C7N B;  3HTK A;  5APX A;  3KDP B;  1OXZ A;  1DH3 A;  2WT7 B;  5AW8 B;  2WPS A;  5APT A;  1JUN A;  5AW1 B;  1SP4 A;  3V4W A;  4AUW A;  2Z5H A;  2R3C A;  2W27 A;  5AW3 B;  3VMY A;  2E42 A;  5AVW B;  3VTP C;  5APV A;  1GD2 E;  5APY A;  1T2K D;  1FOS E;  1NAF A;  2WWW A;  1KQL A;  4M3L A;  1GU4 A;  1H88 A;  1HJB A;  5APS A;  3MGN A;  3VN0 A;  2WT7 A;  2KP8 A;  1OWA A;  3M0D A;  2XU6 A;  4JYC A;  4C46 A;  3L36 A;  2YNY A;  2YO2 A;  3HE4 B;  4GT1 A;  1FOS F;  4I2L C;  3V5B A;  5AVY B;  5AW6 B;  1X8Y A;  5AW0 B;  1J2J B;  4I6M C;  3V4Q A;  1HUC A;  1A02 F;  5AW2 B;  1GZL A;  2R5B A;  5AW9 B;  3MD0 A;  1YYC A;  4LC1 A;  1HWT C;  2C9N Y;  2P2U A;  3UIA A;  3L37 A;  3I5C A;  4AQR D;  3HE5 A;  3M91 A;  3NTN A;  2Q3I A;  3TNU B;  3B8E B;  3T97 A;  4KHX A;  2R32 A;  5AVT B;  4AYC A;  1A02 J;  2N9B A;  1T2K C;  5AVU B;  3P7K A;  1S9K D;  2P67 A;  4B86 A;  2E43 A;  2WPQ A;  1CSB A;  3NXS A;  5AW5 B;  3VYI A;  5CMZ A;  2ZFC A;  4XE5 B;  2Q7C A;  3P8M C;  1CI6 A;  3NFQ A;  3TYY A;  1GU5 A;  2IPP A;  5AVZ B;  1GTW A;  3M9B A;  1FAV A;  1SLQ A;  2WPR A;  4DZO A;  5AW7 B;  2YO3 A;  5AVQ B;  2QM8 A;  3A2A A;  5AW4 B;  3M9H A;  1MUU A;  2P7J A;  2XZR A;  3OAK A;  2JJL A;  2VRS A;  4EOT A;  2H7H A;  5APU A;  1CI6 B;  3KQG A;  1NWQ A;  5AVV B;  4RES B;  3A7O A;  3A5T A;  2W6A A;  3VMX A;  3VMZ A;  1GK6 A;  5AVS B;  3IR9 A;  3TK1 A;  3HE5 B;  2WTY A;  3TNU A;  1CZQ A;  2R5D A;  5APW A;  4HYT B;  1S9K E;  3L35 A;  2Z5I A;  3O8Z A;  2Q5U A;  4GKG A;  4C7N A;  5AVX B;  2BAS A;  3HE4 A;  1H89 A;  5APQ A;  2ZXE B;  1GK4 A;  3LIE A;  3M0A A;  3SWF A;  1JNM A;  1MFZ A;  3NMD A;  2XV5 A;  1G2C B;  3LID A;  1H8A A;  4JYB A;  3P32 A;  1HBW A;  3M06 A; 
#chains in the Genus database with same CATH topology
 2O3J A;  1IO4 A;  1LP1 B;  1D7M A;  1OVV A;  5AVR B;  3V2Q A;  1DIP A;  1GMJ A;  4PV1 D;  2FKW B;  2QM7 A;  2A45 I;  5BU8 B;  1GL2 B;  1E79 H;  1HTL C;  4C7N B;  2E74 B;  2Y0C A;  2C9L Y;  2CPB A;  2YMY A;  1NH4 A;  4ZKP A;  3RK2 C;  4BWN A;  3CCL P;  3AE1 C;  5APT A;  3HRN A;  1JUN A;  2PGD A;  1KV4 A;  1BE3 G;  1SFC C;  1LTS C;  1VL2 A;  3MP7 B;  2RMZ A;  1BE3 D;  3CCM P;  2R3C A;  5AW3 B;  2FYN B;  2KNC B;  1FU1 A;  3AE9 C;  3QWO C;  2E42 A;  5AVW B;  3L70 D;  2KYV A;  5KKZ C;  1AVO A;  1SFC A;  2ITA A;  2JR8 A;  2KB7 P;  2M8R A;  2YXR B;  5CHX A;  2OYI B;  1GD2 E;  2WWW A;  1KQL A;  2FXP A;  3L74 E;  2SPZ A;  2GM4 A;  3AEA C;  1Y8A A;  3P8C D;  4U3F D;  4H44 B;  5K5G B;  4D6T E;  5KLI B;  5CCG C;  1NHL A;  1OX3 A;  4WY4 B;  2KP8 A;  2LR2 A;  2FYZ A;  3R2P A;  3RK2 B;  4BRY B;  3II6 A;  3BCC G;  5CCG A;  3H1H G;  1FJP A;  4KJM A;  3V2P A;  3BAT A;  3L36 A;  1SVF A;  3RL0 B;  3HE4 B;  4GT1 A;  3V5B A;  4N6J A;  1LTJ C;  4OGQ D;  5AW6 B;  5CCH A;  3A0B E;  1K73 Q;  2NPS B;  3L72 D;  1EZV I;  5KKZ B;  2OYI A;  2QVA A;  2POH A;  5AW9 B;  1ZME C;  2W83 C;  5CCH C;  3H1I G;  3MD0 A;  2OTL P;  1YYC A;  2Q3E A;  3BCC E;  4LC1 A;  1HWT C;  1RF1 B;  2FFD A;  1AQ5 A;  2Y0D A;  3AE5 C;  3CL3 D;  3L37 A;  4PD4 D;  4WY4 A;  4BRY A;  1KTM A;  1JB0 J;  2Q3I A;  5BVZ A;  5E79 H;  1K8A Q;  1VQ9 P;  3H1L G;  3Q2Y A;  1KD1 Q;  3CD6 P;  4O9B A;  2R32 A;  1EZV G;  3PJS K;  1TU3 F;  1T3U A;  1M90 Q;  2R3S A;  2WPV B;  3BCC J;  3L72 J;  3P8C E;  3USS A;  4HB1 A;  1KZU B;  1NTZ K;  2Q6Q A;  1LT1 A;  5AVU B;  3V6I A;  1M56 D;  2D2C D;  2O1K A;  1KB9 I;  2Z4E A;  2E43 A;  3L72 G;  4CPG A;  3L73 D;  2IZ1 A;  3H1J E;  1NU1 E;  1FE6 A;  1SQP J;  2R44 A;  1Q90 D;  3L73 G;  1L0L G;  3NXS A;  3RBX A;  3TGU D;  2FYN C;  1VQL P;  1VQ6 P;  2ZFC A;  5KTB A;  1N86 A;  2C0W A;  1EDJ A;  2FYU G;  3GHG C;  4U3F J;  3L72 E;  4WBA A;  1WRG A;  3RL0 C;  2WIT A;  1KB9 E;  1M1J C;  5AVZ B;  1GL2 C;  3Q5S A;  2E75 D;  1SQV K;  2ZJS E;  2ZT9 D;  2H88 C;  2CPS A;  1BE3 E;  3L71 D;  2AEM A;  3M9B A;  4UB8 H;  5KJ7 A;  1NU1 D;  1BCC E;  1AVY A;  1JY3 N;  1NTZ E;  2QM8 A;  1XTC C;  1NYH A;  2HFE D;  5AW4 B;  2UWJ E;  3M9H A;  4EYY Q;  1KQS O;  2P7J A;  3M9Q A;  2OYH A;  2P1J A;  2Y0E A;  3FWL A;  3RGU A;  1JMM A;  3N4X A;  2YIU B;  3V2N A;  3ABV C;  2H89 C;  1L4A A;  2RH0 A;  1KIL A;  4GOF A;  3EFF K;  5AVV B;  2K9Y A;  3AED C;  2IYP A;  2J58 A;  1IK9 A;  1NTZ J;  2W6A A;  1PPJ G;  3MTU E;  4K3A A;  1VDF A;  4Y99 C;  3A5T A;  3Q1M A;  3TK1 A;  3BRV B;  3A0H H;  1JTH B;  3CC4 P;  4EDF A;  1FZG A;  1N7S C;  2MKV A;  1BDC A;  3HD7 D;  1OZH A;  1SQX E;  5CJ4 A;  1KIL D;  1PPJ E;  3EWK A;  1BSN A;  3KPE A;  3G4S P;  1YI2 P;  2OYH B;  4L75 A;  2BCC D;  1ZLL A;  2M3B A;  4DT0 A;  3G6E P;  2BCC G;  1JOC A;  1GW4 A;  3H1I E;  3B5N D;  4Z1M H;  1KIL B;  1LWU C;  2WSE J;  3GW6 A;  1FDI A;  2KUB A;  2QJY B;  3LIE A;  3M0A A;  3H25 A;  1URQ D;  1OMI A;  3B4S A;  2IBZ E;  3NMD A;  2KZJ A;  5L8R J;  3OJA B;  2M3E A;  2XV5 A;  1OW8 A;  2I1J A;  4I7Z B;  2KS1 B;  4UB6 E;  3CCR P;  3H1L D;  3LID A;  1HVV A;  2WQY C;  4JYB A;  4NPE A;  1NOH A;  3MUD C;  2WSE H;  1UIX A;  2GUS A;  1H89 A;  4GDO A;  4HJG H;  1PGP A;  1YQ4 C;  1BGY E;  2OTK E;  1URQ A;  1RE3 C;  2JWD A;  5B66 E;  1LJ2 A;  2KOG A;  3A3Y B;  3CWB J;  3HTK A;  3L74 G;  3L70 E;  4GIF A;  5APX A;  3MHV A;  3AEE C;  1DH3 A;  1SQQ G;  4IOI H;  1L0L J;  5H2F E;  1NTK G;  2QJK C;  1RQU A;  2WPS A;  2YMK A;  5CCG D;  5AW1 B;  1KIL E;  1SP4 A;  2ZAE B;  2E75 B;  2LXC B;  1IFI A;  2KIK A;  1BGY J;  4I7Z C;  2A06 E;  3B5N B;  3H1H D;  3W67 A;  2FYU J;  3AE6 C;  3VTP C;  1LTT C;  1USE A;  4OWF A;  3SSU A;  1VQ5 P;  2W8Z A;  5APY A;  1T2K D;  1RE4 C;  1N73 B;  2OYO A;  1NAF A;  1NKN A;  3AE3 C;  4PD4 I;  4W7Y A;  5KLV K;  1VQP P;  1H88 A;  5APS A;  3HTK B;  1VQO P;  2QE7 H;  1BGY G;  2CK3 H;  5KJ7 D;  1XTG B;  2PAJ A;  4JF7 A;  2KSJ A;  2OGU A;  3HD7 C;  2PFX A;  2OYI C;  1PP9 E;  1ZR2 A;  3Q3D A;  1LTI C;  2HOD A;  2YNY A;  2B87 B;  4H44 D;  4PD4 E;  3JCU H;  2O01 J;  2QG4 A;  1RQV A;  3L4F A;  1FOS F;  1W5C E;  2XNX A;  5AVY B;  1S3J A;  3Q5P A;  1KOR A;  3EFG A;  1IC2 A;  3K5B A;  1A02 F;  5GTI E;  5GTI H;  2HR3 A;  1NTM J;  1GZL A;  3GG2 A;  1K05 A;  2R5B A;  1JEK A;  1L0L K;  2XKM A;  2NRG A;  3CLQ A;  3TF5 A;  2IYO A;  2QEX P;  2K9J B;  3FX0 A;  5KAI E;  2JEE A;  2ZVN B;  4ZKU A;  1OIP A;  1KFN A;  4WVZ A;  1X9V A;  4C7R A;  4AQR D;  3CX5 E;  3W68 A;  3HE5 A;  3JCU E;  1OVR A;  2L5G B;  3HD7 A;  4H0L D;  1YJW P;  3B8E B;  3T97 A;  1BE3 J;  1M8O B;  1SQB E;  2V7Q J;  2LKM A;  4U7J A;  2ZVO B;  3TGU G;  5KJ7 C;  1SS1 A;  1NTK K;  5AVT B;  1JY2 P;  3RL0 D;  3KXD A;  4PV1 B;  4AYC A;  1S4X A;  2B89 A;  1NWQ A;  1VF5 D;  1L0N D;  2P67 A;  4RJT A;  4B86 A;  1DEE G;  1OW7 A;  3E7K A;  3N7N A;  1BCC D;  1IZN B;  1JCD A;  2WPQ A;  3VYI A;  5AW5 B;  3CI9 A;  2YKP A;  3B5N C;  1YTZ I;  3HD7 B;  3L73 E;  4PJ0 H;  3CCV P;  3FXD A;  3T97 B;  1IFJ A;  4K35 A;  1DD4 A;  5EFW B;  3TYY A;  1GU5 A;  1FZE A;  2IPP A;  3AE4 C;  3JC2 2;  1SQX J;  1LTJ B;  3IAO A;  3VP8 A;  3Q5R A;  1FAV A;  5B66 H;  2D2C C;  1SQV D;  2M5A B;  2YO3 A;  2O01 N;  4YXW H;  1T8Z A;  1MUU A;  2JWA A;  3CCS P;  3OAK A;  2ZYG A;  3U1A A;  4PJ0 E;  2NPS A;  2BEQ D;  1QGK B;  3QH9 A;  2VRS A;  4EOT A;  4UB6 H;  1AJY A;  5KLV G;  1J1E B;  2WZ7 A;  5APU A;  1HJB A;  1GDT A;  4ASV A;  1NTK J;  2IZ0 A;  1QEX A;  3E1I A;  5C39 A;  2A45 G;  3L75 J;  1VF5 B;  3V2R A;  3A7O A;  2FBW C;  3A0B H;  5M1B A;  3WU2 E;  2QA4 P;  3IR9 A;  1LTJ A;  1KMI Z;  1EZV E;  4PV1 C;  1P84 H;  2JKV A;  2N1T D;  4OGQ B;  1G1J A;  1LWU A;  1JY2 N;  2R5D A;  3H1J D;  4EIJ A;  2I1K A;  5GTH E;  5BU5 A;  2FFD B;  2WVR A;  2Z5I A;  4U3F G;  2HG5 D;  3H1H E;  3SFD C;  4GKG A;  3GLM A;  1EDI A;  4L76 A;  1S5L H;  5AVX B;  3S4R A;  4D6T D;  3CXH D;  4YXD C;  1LT9 A;  1W2B O;  1VQK P;  5KLV D;  3TSI A;  1EZV D;  3MUD A;  5APQ A;  1SQX K;  2ZXE B;  2QJP C;  1Q7Y Q;  4D6T J;  1K04 A;  1M1J B;  4ZNC A;  5CCH D;  1N8R Q;  1NTZ G;  1Q2N A;  2IFM A;  2P58 A;  2WSS H;  2QSI A;  1OFC X;  1G2C B;  1KIL C;  1LWU B;  2HYN A;  3L75 G;  3TDK A;  3P32 A;  2QRX A;  3RK3 C;  3O6Q A;  5TIS E;  4L73 A;  1RH5 B;  1E5W A;  1ZRT E;  2V7Q H;  3M0D C;  4UB8 E;  3D6Y A;  1MV8 A;  1EQ7 A;  4GOE A;  3PLN A;  1OXZ A;  3H1K J;  1FZF A;  1DD3 A;  1KB9 H;  2N1T B;  2Y9Z A;  3BRT B;  1BCC G;  2WSC H;  5CJ0 A;  2G8Y A;  5AW8 B;  1MZ9 A;  1M1J A;  3AEC C;  4WWI A;  3SFE C;  1AFO A;  1HF9 A;  4Y99 B;  3V4W A;  5B5E H;  1FDO A;  1L4A B;  1Y47 A;  2I8D A;  1L4A D;  2YXQ B;  1G2C A;  2Z5H A;  4N3Y B;  4JBZ A;  1ZRT D;  2W27 A;  4W80 A;  3VMY A;  2P10 A;  2K37 A;  1SQV J;  1OW6 A;  4HKZ H;  2QJK B;  4IFF A;  3CXH H;  3F5H A;  3H1K E;  5APV A;  3WUV A;  1AA0 A;  3CX5 H;  1RY3 A;  1VF5 C;  2M0B A;  3FXE A;  4IL6 H;  1FOS E;  2HPC A;  4M3L A;  1JTH A;  4KT0 J;  1SQV G;  1LT9 C;  3VP9 A;  4DJG A;  3B71 A;  2W6B A;  1L2P A;  2NZ2 A;  1KFM A;  2N1T A;  3FWN A;  3VN0 A;  1S1C X;  1SQB J;  1KYO E;  2IDB A;  1MFT A;  2ZYD A;  1URQ C;  3H6P A;  4H13 B;  3M0D A;  2XU6 A;  4N78 D;  3JSV C;  5E79 E;  3CPW O;  2FXM A;  4C46 A;  1IFD A;  2J59 M;  1S5L X;  2JDI H;  2KZI A;  2QIW A;  3HUS B;  2YO2 A;  1P84 D;  3IF4 A;  3WUU A;  2LXB A;  1SQX G;  2E5T A;  2FXO A;  3TGU E;  1JY3 O;  1M57 D;  1X8Y A;  3L74 D;  3CWB G;  3PTZ A;  2NPS D;  2ZYA A;  1KYO I;  4IL6 X;  4WY4 C;  1HJ0 A;  1QL2 A;  3G3Z A;  1SFC D;  1KB9 D;  2QJP B;  3GF3 A;  5AW2 B;  1FS0 E;  1FC2 C;  3AE7 C;  1IJD B;  1PGO A;  3H1I D;  1SQQ K;  2C9N Y;  1P84 E;  2P2U A;  2IBZ I;  3C8V A;  3I5C A;  2V4H A;  1URQ B;  3GMA A;  3TNU B;  1ZV8 A;  3HUS A;  1LNQ A;  2RKL A;  3CWB E;  4KHX A;  4OVN F;  1YJ9 P;  3CX5 I;  3MZW B;  1KQF B;  3CMA P;  1NTM D;  2B9B A;  2Q1K A;  4W7Z A;  2A06 G;  2N1T C;  4IFM A;  3RK2 D;  1WMK A;  3FGA D;  1U7M A;  4XA4 A;  3L74 J;  5H2F H;  1AV1 A;  1NVO A;  3GHG B;  3P7K A;  1S9K D;  1T2K C;  1RF0 C;  3SWK A;  3B5N A;  3CME P;  1NTK E;  1L4A C;  2FYU E;  2IFN A;  2KLV A;  4H0L C;  1SQQ E;  1FJK A;  1PPJ D;  2Q7C A;  3H1K G;  1R5L A;  1L0N K;  4LGD E;  1PP9 D;  3CCJ P;  4ZMD A;  2PP6 A;  3AEF C;  1NAY A;  1Y9B A;  3ITK A;  1X79 B;  1GTW A;  1GW3 A;  1LP1 A;  1T6A A;  1EXI A;  1DX7 A;  1VQ4 P;  3L71 G;  1GL2 A;  1SLQ A;  2HOD B;  2WPR A;  1SQQ J;  3H1H J;  1NTM G;  3LW5 J;  5AW7 B;  1BGY D;  1Z56 A;  1U7J A;  1N7L A;  2XZR A;  3WUT A;  3C1L A;  1PFI A;  3OA7 A;  1RF1 A;  2E5Y A;  2H43 A;  2H7H A;  4WY4 D;  1L0L D;  2E76 C;  5DJU B;  4RES B;  4WB4 A;  1M1K Q;  1FZC A;  3CC7 P;  1SFC B;  1GK6 A;  2AEJ A;  1EC5 A;  1QLE D;  2OAR A;  1MKM A;  3HE5 B;  4JQ0 D;  4Y28 J;  5AVS B;  1H0T A;  4QMA A;  1CZQ A;  5APW A;  4H13 C;  2D2C B;  2WSF J;  1SQP K;  2IBZ D;  5DJT B;  1LTG C;  4NPD A;  3HUS C;  1YQ3 C;  1IK7 A;  1PV3 A;  3L35 A;  1EXJ A;  3O8Z A;  1ZW0 A;  2E74 C;  1KC8 Q;  2G3A A;  4U3F E;  2FFD C;  3HE4 A;  1SQQ D;  1J1E C;  5KLV J;  1N2D C;  3D6Z A;  4PD4 H;  1YTZ T;  1LTA C;  3I55 P;  1MFZ A;  2XDJ A;  4R4M A;  1ZP0 C;  1FZC B;  3C9I A;  1YBK A;  2BCC J;  2E76 D;  1L0N G;  1H0T B;  1PP9 J;  1VPC A;  2NPS C;  5CBN A;  1HBW A;  2XND H;  3AE2 C;  4A7P A;  2MJZ A;  5KLV E;  2KSE A;  2A06 D;  3CCQ P;  1PGJ A;  1EDL A;  2ZT9 C;  2DW3 A;  2M5A A;  4H44 C;  1L0N J;  3KDP B;  1T3J A;  5KLI C;  4ASW A;  5B5E E;  2Y9Y A;  1RF1 C;  3RK3 B;  2WT7 B;  2WSF H;  3EQ2 A;  3L70 G;  3H1J G;  2IX7 C;  1SQP G;  3AEB C;  3PH0 A;  3R4Y A;  4DCK A;  1RE4 A;  1N73 C;  4TLF A;  1JCC A;  1QL1 A;  2O1J A;  3L75 E;  1FDM A;  1FZA A;  1BDD A;  2BEZ F;  2E76 B;  1HGV A;  1NU1 J;  1AQT A;  1L0N E;  1SQP E;  1USD A;  3IFM A;  5TIS H;  1OVU A;  3L71 J;  1SQX D;  3G9R A;  3H1I J;  1ZR4 A;  2IBZ G;  3AE8 C;  1Q86 Q;  1GU4 A;  2WSC J;  1VQN P;  1NU1 G;  2K1A A;  4N78 E;  2L91 A;  5CBO A;  3MGN A;  4IFD K;  1BSH A;  4DOJ A;  1ZXG A;  2WT7 A;  1N7S D;  3LW5 H;  1OWA A;  2RN0 A;  4GOD A;  4XFJ A;  3U1C A;  3CCU P;  4JYC A;  1UII A;  1SQP D;  2AXT H;  2OTJ P;  1BCC J;  3KZI H;  2KI7 B;  1KYO D;  3L73 J;  1LT9 B;  3PRJ A;  2E74 D;  1R8E A;  3D71 A;  1S5L E;  1GL2 D;  2N9Y B;  2PRR A;  2A45 H;  2FY8 A;  2W6J H;  4I2L C;  1U57 A;  1YIJ P;  5AW0 B;  1J2J B;  4I6M C;  3V4Q A;  1HUC A;  1Q82 Q;  1SQB D;  3BCC D;  1NGM B;  1PZQ A;  1KQG B;  4R4L A;  3RBZ A;  3BVH A;  2KLU A;  4JPZ B;  4LLH A;  4TT3 H;  3RL0 g;  1CW5 A;  1PIX A;  2KK7 A;  2YIU C;  1LTB C;  3A0H E;  3O6Q B;  3UIA A;  3VOP A;  1M7L A;  3WU2 H;  3KZI E;  3M91 A;  3E1R A;  3NTN A;  3U59 A;  1JY3 P;  2B88 A;  1ZN5 A;  2AXT E;  3GF7 A;  3WMM 0;  1YHQ P;  4YPC A;  3PHL A;  1A02 J;  2HLO A;  4NPF X;  2N9B A;  1PP9 G;  1NKZ B;  1N7S B;  2Q9I A;  4H13 D;  1R5S A;  3H1K D;  3H32 B;  2H8P D;  1IFM A;  2JO1 A;  1FZC C;  3CX5 D;  4D6T G;  1S72 P;  1J1D B;  1DEB A;  4MN4 C;  3CCE P;  1YJN P;  1SQV E;  1CSB A;  1VQ8 P;  1KYO H;  5CMZ A;  1K9M Q;  1FZB A;  1QVF O;  1FBM A;  4XE5 B;  3RK3 D;  1RF0 A;  2HPC B;  2KS1 A;  3P8M C;  1CI6 A;  3H1L J;  1JY2 O;  3NFQ A;  1X22 A;  1IFP A;  4IL6 E;  2FYU K;  2ZT9 B;  2ZXX A;  1NU1 K;  3CXH E;  1NTM K;  5TJH A;  1YIT P;  3S1K A;  3KYQ A;  1Q81 Q;  1JM0 A;  4RKU J;  3L70 J;  1N7S A;  1WT6 A;  1EDK A;  4DZO A;  2FYU D;  3H32 A;  5AVQ B;  3A2A A;  3S9O A;  4OH8 B;  1KN7 A;  1HH0 A;  1SQB G;  1L0L E;  2OQQ A;  3H1L E;  5KAF E;  2C0X A;  4YTP C;  4BXL A;  1QVG O;  3CXH I;  2JJL A;  2WMM A;  1QX8 A;  1RHZ B;  4H0L B;  3SWY A;  2YKQ A;  3D70 A;  1JO5 A;  4L74 A;  3H1J J;  2BCC E;  1CI6 B;  2QJY C;  2YKO A;  1S2E A;  3KQG A;  3KHU A;  1JMB A;  1IFN A;  4EI2 A;  1SQB K;  3OW2 O;  3CWB D;  1W2E A;  1VQM P;  1HGZ A;  2J5U A;  3MIW A;  3VMX A;  3VMZ A;  3ZDM A;  1NTZ D;  2KXP B;  2OYH C;  1X0T A;  5KAI H;  2WTY A;  1G1I A;  1N73 A;  2K88 A;  3TNU A;  3L75 D;  1ZOY C;  3AEG C;  1NTK D;  2W90 A;  4HYT B;  2AEF A;  4RO0 A;  2JP3 A;  3F89 A;  3RK3 E;  3G71 P;  1S9K E;  1P84 I;  1NJI Q;  4I1L A;  3BAS A;  1RE3 A;  2Q5U A;  4C7N A;  5KAF H;  2B87 A;  2BAS A;  3GHG A;  4OGQ C;  3I56 P;  1NO4 A;  2GA1 A;  3PP5 A;  1GK4 A;  2AXC A;  3SWF A;  1JNM A;  1PGQ A;  3VMA A;  2E75 C;  1VQ7 P;  2K3R A;  1J1D C;  3CC2 P;  1NTM E;  2GUV A;  3IN6 A;  3L71 E;  5GTH H;  1H8A A;  1PL5 A;  2KNC A;  2K9J A;  4HH2 A;  2O01 H;  4AUW A;  1LGH B;  3TGU J;  3M06 A; 
#chains in the Genus database with same CATH homology
 1IO4 A;  5AVR B;  3V2Q A;  2FKW B;  2QM7 A;  2A45 I;  5BU8 B;  1GL2 B;  1HTL C;  4C7N B;  2C9L Y;  2CPB A;  2YMY A;  1NH4 A;  4ZKP A;  3RK2 C;  5APT A;  3HRN A;  1JUN A;  1SFC C;  1LTS C;  2R3C A;  5AW3 B;  2E42 A;  1FU1 A;  5AVW B;  2KYV A;  1SFC A;  2KB7 P;  1GD2 E;  2M8R A;  5CHX A;  2OYI B;  2WWW A;  1KQL A;  2GM4 A;  3P8C D;  1RF1 A;  2FFD B;  5CCG C;  1NHL A;  4WY4 B;  2KP8 A;  2FYZ A;  3R2P A;  3RK2 B;  5CCG A;  3II6 A;  1FJP A;  3V2P A;  3BAT A;  3L36 A;  1SVF A;  3RL0 B;  3HE4 B;  4GT1 A;  3V5B A;  4N6J A;  1LTJ C;  5AW6 B;  5CCH A;  2NPS B;  2OYI A;  2POH A;  5AW9 B;  1DX7 A;  5CCH C;  3MD0 A;  1YYC A;  4LC1 A;  1HWT C;  1RF1 B;  2FFD A;  1AQ5 A;  3CL3 D;  3L37 A;  4WY4 A;  2Q3I A;  5BVZ A;  2R32 A;  1T3U A;  3P8C E;  1KZU B;  1NTZ K;  5AVU B;  2O1K A;  2Z4E A;  2E43 A;  3NXS A;  2ZFC A;  5KTB A;  1N86 A;  2C0W A;  3GHG C;  4WBA A;  1WRG A;  3RL0 C;  2WIT A;  1M1J C;  5AVZ B;  1GL2 C;  1SQV K;  2CPS A;  3M9B A;  5KJ7 A;  1JY3 N;  2QM8 A;  1XTC C;  5AW4 B;  2HFE D;  3M9H A;  2P7J A;  3M9Q A;  2OYH A;  2P1J A;  1JMM A;  3N4X A;  3V2N A;  1L4A A;  1KIL A;  5AVV B;  2J58 A;  1IK9 A;  2W6A A;  3MTU E;  3A5T A;  1VDF A;  4Y99 C;  3TK1 A;  3BRV B;  1JTH B;  1FZG A;  1N7S C;  3HD7 D;  5CJ4 A;  1KIL D;  3KPE A;  2OYH B;  1ZLL A;  2M3B A;  1JOC A;  1GW4 A;  3B5N D;  1KIL B;  1LWU C;  3LIE A;  3M0A A;  1URQ D;  3NMD A;  3OJA B;  2XV5 A;  2I1J A;  3LID A;  1HVV A;  4JYB A;  1NOH A;  2WSE H;  2GUS A;  1H89 A;  1URQ A;  1RE3 C;  2KOG A;  4GIF A;  3A3Y B;  3HTK A;  5APX A;  1DH3 A;  2WPS A;  5CCG D;  5AW1 B;  1SP4 A;  1IFI A;  3B5N B;  3VTP C;  1LTT C;  5APY A;  1T2K D;  1RE4 C;  1N73 B;  1NAF A;  1NKN A;  4W7Y A;  5KLV K;  1H88 A;  1HJB A;  5APS A;  3HTK B;  5KJ7 D;  1XTG B;  2PAJ A;  4JF7 A;  2KSJ A;  3HD7 C;  1ZR2 A;  1LTI C;  2HOD A;  2YNY A;  1FOS F;  3L4F A;  2XNX A;  5AVY B;  3EFG A;  1IC2 A;  1A02 F;  1GZL A;  2R5B A;  2XKM A;  1L0L K;  3CLQ A;  2JEE A;  4ZKU A;  1KFN A;  1X9V A;  4C7R A;  4AQR D;  3HE5 A;  3HD7 A;  2L5G B;  3B8E B;  3T97 A;  2LKM A;  5KJ7 C;  1NTK K;  5AVT B;  1JY2 P;  3RL0 D;  4AYC A;  2P67 A;  4B86 A;  3N7N A;  1JCD A;  2WPQ A;  3VYI A;  5AW5 B;  3CI9 A;  2YKP A;  3B5N C;  1YTZ I;  3HD7 B;  1IFJ A;  3TYY A;  1GU5 A;  1FZE A;  2IPP A;  1LTJ B;  3VP8 A;  1FAV A;  2YO3 A;  1T8Z A;  1MUU A;  3OAK A;  3U1A A;  2NPS A;  1CW5 A;  2VRS A;  4EOT A;  1J1E B;  2WZ7 A;  5APU A;  1GDT A;  3E1I A;  2A45 G;  3V2R A;  3A7O A;  3IR9 A;  1LTJ A;  2N1T D;  4EIJ A;  1G1J A;  1LWU A;  1JY2 N;  2R5D A;  2I1K A;  5BU5 A;  2Z5I A;  2HG5 D;  4GKG A;  4IFD K;  5AVX B;  1LT9 A;  3TSI A;  3MUD A;  5APQ A;  1SQX K;  2ZXE B;  1M1J B;  5CCH D;  2IFM A;  1G2C B;  1KIL C;  1LWU B;  2HYN A;  3P32 A;  3RK3 C;  1E5W A;  3M0D C;  1MV8 A;  1EQ7 A;  1OXZ A;  1FZF A;  2N1T B;  3BRT B;  5CJ0 A;  2WSC H;  5AW8 B;  1MZ9 A;  1M1J A;  1AFO A;  4Y99 B;  3V4W A;  4AUW A;  1L4A B;  2Z5H A;  4N3Y B;  1L4A D;  4W80 A;  1G2C A;  2W27 A;  3VMY A;  4IFF A;  5APV A;  1RY3 A;  1FOS E;  2HPC A;  4M3L A;  1JTH A;  3VP9 A;  1LT9 C;  2W6B A;  1KFM A;  2N1T A;  3VN0 A;  1URQ C;  3H6P A;  4N78 D;  3M0D A;  2XU6 A;  2FXM A;  4C46 A;  1IFD A;  2J59 M;  3HUS B;  2YO2 A;  1JY3 O;  1X8Y A;  4WY4 C;  2NPS D;  1QL2 A;  3G3Z A;  1SFC D;  5AW2 B;  1IJD B;  1SQQ K;  2C9N Y;  2P2U A;  3I5C A;  1URQ B;  3TNU B;  1ZV8 A;  3HUS A;  4KHX A;  4W7Z A;  3RK2 D;  2N1T C;  4IFM A;  4XA4 A;  1T2K C;  3GHG B;  3P7K A;  1S9K D;  1RF0 C;  3B5N A;  1L4A C;  2IFN A;  2KLV A;  1FJK A;  2Q7C A;  1L0N K;  4LGD E;  2PP6 A;  1X79 B;  1GTW A;  1GW3 A;  1GL2 A;  1SLQ A;  2HOD B;  2WPR A;  5AW7 B;  1Z56 A;  1N7L A;  2XZR A;  1PFI A;  3OA7 A;  2H43 A;  2H7H A;  4WY4 D;  4RES B;  4WB4 A;  1FZC A;  1SFC B;  1GK6 A;  5AVS B;  2OAR A;  3HE5 B;  1CZQ A;  5APW A;  1SQP K;  1LTG C;  3HUS C;  3L35 A;  3O8Z A;  2FFD C;  3HE4 A;  1J1E C;  1N2D C;  1YTZ T;  1LTA C;  1MFZ A;  2XDJ A;  1FZC B;  3C9I A;  1VPC A;  2NPS C;  1HBW A;  2MJZ A;  3KDP B;  1RF1 C;  1T3J A;  3RK3 B;  2WT7 B;  2WSF H;  3EQ2 A;  2IX7 C;  1RE4 A;  1N73 C;  1JCC A;  1QL1 A;  2O1J A;  1FDM A;  1FZA A;  4O9B A;  1HGV A;  3IFM A;  1ZR4 A;  1GU4 A;  4N78 E;  3MGN A;  4DOJ A;  2WT7 A;  1N7S D;  3LW5 H;  1OWA A;  3U1C A;  4JYC A;  1LT9 B;  1GL2 D;  4I2L C;  2A45 H;  5AW0 B;  1J2J B;  4I6M C;  3V4Q A;  1HUC A;  3BVH A;  4LLH A;  3VOP A;  1LTB C;  3UIA A;  1M7L A;  3M91 A;  3NTN A;  3U59 A;  1JY3 P;  1ZN5 A;  3WMM 0;  1A02 J;  2HLO A;  2N9B A;  1NKZ B;  1N7S B;  2Q9I A;  3H32 B;  2H8P D;  1IFM A;  1FZC C;  1J1D B;  1DEB A;  1CSB A;  5CMZ A;  1FZB A;  1FBM A;  4XE5 B;  3RK3 D;  1RF0 A;  2HPC B;  3P8M C;  1CI6 A;  1JY2 O;  3NFQ A;  2FYU K;  1NU1 K;  1NTM K;  3KYQ A;  1N7S A;  1WT6 A;  4DZO A;  3H32 A;  5AVQ B;  3A2A A;  4OH8 B;  1HH0 A;  2C0X A;  2JJL A;  3SWY A;  2YKQ A;  1JO5 A;  1CI6 B;  2YKO A;  3KQG A;  1NWQ A;  2OYI C;  1IFN A;  1SQB K;  1W2E A;  1HGZ A;  3MIW A;  3VMX A;  2OYH C;  3VMZ A;  1N73 A;  2WTY A;  1G1I A;  3TNU A;  4HYT B;  1S9K E;  4I1L A;  3BAS A;  1RE3 A;  2Q5U A;  4C7N A;  2BAS A;  3GHG A;  1NO4 A;  3PP5 A;  1GK4 A;  3SWF A;  1JNM A;  1J1D C;  2GUV A;  1H8A A;  4HH2 A;  2O01 H;  1LGH B;  3M06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...