5APWA

Sequence matkdd inserted between gcn4 adaptors - structure t6
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
67
structure length
67
Chain Sequence
GHMKQLEDKVEELLSKVYHLENEVARLKKLMATKDDMKQLEDKVEELLSKVYHLENEVARLKKLVGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords GENERAL CONTROL PROTEIN GCN4
publication title alpha / beta coiled coils.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 30
structure length 67
sequence length 67
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5apwA00
5AVVB 2ZXEB 1CI6B 3V4QA 3MD0A 3V5BA 4AUWA 5APVA 1DH3A 3MGNA 5APQA 4B86A 1GD2E 3NFQA 3B8EB 3TYYA 1CI6A 3M0DA 1A02F 4KHXA 5AW5B 3HE4A 2W27A 4RESB 5CMZA 1S9KE 1GU4A 3NMDA 1HUCA 5APYA 2C9NY 1GK6A 5AVRB 3HE5B 4I2LC 2BASA 3TNUB 3OAKA 3NTNA 5APTA 5APWA 2ZFCA 3M9BA 4DZOA 1J2JB 1T2KD 2R5DA 1YYCA 5AVSB 1MV8A 3LIEA 2E43A 4C7NA 2R32A 3UIAA 4AQRD 1H89A 3HE4B 5APXA 1HJBA 2E42A 2WWWA 5AVTB 5AVWB 3P7KA 3M9HA 2R5BA 4HYTB 1GTWA 3A3YB 2R3CA 2WPRA 1MFZA 2Q5UA 1CZQA 2W6AA 3VMYA 5AVQB 1T2KC 2XZRA 1FOSE 5AW0B 2QM7A 2Z5IA 3IR9A 1MUUA 2KP8A 4C46A 2QM8A 2WT7A 1A02J 2YO3A 3KDPB 3NXSA 4C7NB 3KQGA 1OXZA 4GT1A 3L37A 1KQLA 4I6MC 1SLQA 2IPPA 4XE5B 1HBWA 3A7OA 1JNMA 2Q7CA 1OWAA 2WPSA 1FOSF 2P2UA 5AW3B 2C9LY 3T97A 4EOTA 5AW8B 1H8AA 1X8YA 3VTPC 3VN0A 5AW2B 1GU5A 1HWTC 3V4WA 3L36A 2YO2A 2Q3IA 3M06A 4GKGA 4JYCA 2P67A 2XV5A 1NAFA 5AW1B 1NWQA 5AW9B 2WT7B 4AYCA 5AW7B 5AVXB 2YNYA 1S9KD 5AW6B 1H88A 3VYIA 3L35A 5AVUB 5APSA 1SP4A 2P7JA 3HTKA 2WTYA 5APUA 1GZLA 1FAVA 1CSBA 4M3LA 2VRSA 5AVYB 3M0AA 4LC1A 3P32A 3VMZA 3A5TA 3M91A 3LIDA 2XU6A 2Z5HA 2N9BA 3VMXA 2H7HA 3O8ZA 3TK1A 3P8MC 2WPQA 1JUNA 5AW4B 1IO4A 4JYBA 2JJLA 3HE5A 5AVZB 3TNUA 3SWFA 1G2CB 1GK4A 3I5CA 3A2AA
chains in the Genus database with same CATH superfamily
1FDMA 1LT9A 1LGHB 2PFXA 1G2CA 5APVA 1DH3A 3M0DA 1LTGC 3FWLA 1SQBD 4HB1A 4W7YA 1NTZG 2C9NY 2WSEH 1GK6A 1KYOE 1OIPA 1NU1G 2WSFH 1W2BO 2KNCA 1IFPA 1L4AC 3HD7B 1ZRTD 2W6JH 3TSIA 4WY4D 2RN0A 5GTHH 1NJIQ 1YHQP 3JCUE 4WBAA 1WMKA 1S5LH 4XE5B 3MTUE 3A7OA 2I8DA 3H1LJ 3CCUP 1L0LD 1H0TB 3C8VA 1X8YA 1X0TA 1J1DC 3N4XA 1MZ9A 1YQ4C 1FZEA 2A06E 4PJ0E 1VQ4P 2QSIA 1X9VA 2YNYA 1HJ0A 1DD3A 2W6BA 3Q3DA 5APSA 1PPJE 4WWIA 2O01N 1VPCA 1SQBE 2KS1B 2JWAA 2PGDA 5KAIH 4PD4D 3D6ZA 2DW3A 1NTKJ 3JSVC 1VQ5P 3C1LA 3H1HE 2AEFA 1ZOYC 1ZRTE 3AE9C 1PGPA 1NTMJ 3A0BE 3GW6A 5BU5A 2OYHC 3BCCG 4H0LC 1IZNB 3USSA 2L91A 2YKQA 2B9BA 1M8OB 3HRNA 2WMMA 2QE7H 2QJKB 1EZVI 3L74D 1GTWA 1KFMA 1SQBK 3AE7C 5KLVG 3IR9A 1VQMP 4Y99B 2KP8A 2XKMA 2E75D 2FXOA 1FOSF 1EXJA 1J1EB 2KUBA 4N6JA 1UIXA 2OTKE 3AE2C 1RF1C 1NAFA 5AW1B 3IAOA 1KYOI 1KFNA 4OH8B 3L35A 1L0LG 2YMKA 1NU1J 5GTIH 3T97B 1GZLA 3V6IA 1CSBA 5CCGA 3FGAD 3L73D 2KK7A 1VQ7P 2AXTE 3VMZA 2OYIB 2K3RA 2C0XA 3L72D 1U7MA 2H7HA 1K04A 1EC5A 2WSCJ 2RH0A 2NPSA 3CCJP 5L8RJ 3GHGB 2ZYDA 3I5CA 3L75E 2E76C 1NVOA 2I1KA 2FKWB 2OTLP 1BGYD 2WSCH 1S2EA 4QMAA 1MKMA 3O6QA 3B4SA 5TJHA 3HE5B 2Q9IA 3ZDMA 2M5AA 4LGDE 2JP3A 1PP9J 3B5NB 3L70D 4O9BA 1TU3F 3HUSA 1LP1A 2ZYAA 2WWWA 2NPSD 4HYTB 4NPEA 2OGUA 2XZRA 3CXHD 3CI9A 3E7KA 3L73E 5CJ4A 3L74G 1M1KQ 1LT9C 5B5EH 4WY4C 3OW2O 1JTHB 1AVYA 2QRXA 1G1IA 3JCUH 1N86A 3M0DC 3KZIE 1YQ3C 2O1KA 2KSJA 2H8PD 1P84D 1KTMA 2NZ2A 1FC2C 1VF5D 1Z56A 3M0AA 1LTBC 2YIUC 1OW7A 1VQ6P 1N7SA 1Y8AA 5KLVJ 2GUVA 3GLMA 3AE1C 3CX5D 5AVZB 3TF5A 1RE4A 3JC22 3L72G 2QJPC 3H25A 1BSHA 1SQXG 1E5WA 1GMJA 1L0LJ 1N7SD 1BE3D 1M1JA 1BGYG 1KILA 2KOGA 2QEXP 3S1KA 1EDLA 1SQQD 5KJ7A 2P10A 3M9HA 3RL0D 5AVQB 1JM0A 1Q7YQ 1K73Q 2E74B 2KLUA 3L70G 3P8CD 5H2FH 1N73A 4C7NB 3KDPB 3CCQP 3KQGA 3TDKA 2C0WA 2NRGA 2B89A 2IFMA 1LWUB 4UB8E 3V4WA 1SQPE 3CX5E 1KILD 2FXMA 1OMIA 2E75C 5KJ7D 1BDCA 4PD4H 1YI2P 3HTKA 1U57A 2HR3A 2KLVA 2CPSA 4U3FD 4JF7A 5AVYB 4K35A 1PL5A 5KTBA 3A0HE 1GW3A 2OYIC 1T3UA 3RGUA 3PJSK 1FZBA 1BE3E 2JJLA 1KV4A 2QJYB 1LTJB 2K9JA 1SQQE 2ZXEB 2ZAEB 3KXDA 3L74J 4L74A 4AUWA 3MGNA 2G8YA 1LT1A 3P8CE 1NKNA 1YYCA 3CWBD 4IOIH 4OGQB 3M9QA 2E42A 4UB6H 1S3JA 1RF1A 1MFZA 1EZVD 1R5LA 4ZKPA 2ZT9B 2JR8A 2P1JA 2KI7B 3AE5C 2NPSC 2FYUD 4D6TD 4YPCA 3H1ID 2WPSA 3L72J 1K05A 3VMAA 1GU5A 1HWTC 1SQQK 1S72P 1KB9H 2Z4EA 1SQXJ 1GL2D 5AVUB 1KYOD 2HLOA 3D71A 3WUVA 5APUA 1BGYJ 1WT6A 3RK3B 1SQVE 1GL2B 2R44A 2FFDB 1Q86Q 3L70J 1VF5C 1HVVA 4U3FG 2FBWC 1NGMB 3E1RA 3V5BA 1X79B 3RK2B 1IK7A 3B8EB 1NH4A 1A02F 4JPZB 2A45I 3OJAB 1OW6A 1NTZE 3NMDA 2E5YA 3HD7A 4H44D 1PGQA 1IC2A 5AVRB 4W7ZA 3CX5I 2FYUE 3OAKA 1IFNA 2A06D 4D6TE 5BVZA 3KPEA 1HF9A 4H44B 2XNDH 1FE6A 3CXHH 4WY4A 4AQRD 3ITKA 2H43A 1PPJD 2IYPA 3KHUA 2WSFJ 3P7KA 3G3ZA 1RY3A 2IBZG 5TISH 1H0TA 3RK3E 4BWNA 1N7SC 4YTPC 3CWBG 1UIIA 4GOFA 2GM4A 2K88A 2FYNB 2YO3A 3H1HD 3HD7D 3RL0C 1RE4C 2LR2A 4JBZA 1EZVG 1IJDB 1JY2P 2KS1A 1P84H 3CD6P 1BDDA 2WT7B 3U1CA 3H1IG 4WVZA 1M57D 4DT0A 5B66H 2HODB 2FYUK 1M1JC 1NOHA 1W5CE 1KILC 4H13B 1JY3P 3GG2A 3RBXA 5KJ7C 4EIJA 5DJTB 1SFCB 4IFDK 2GUSA 1G2CB 1N73C 1PP9G 3MZWB 3MHVA 1NO4A 3MD0A 3L71E 3A0HH 4ASVA 1KQGB 1RQUA 1AQTA 1HUCA 4BXLA 4I2LC 3FX0A 5AVSB 4DOJA 3AEDC 1PGOA 2R32A 2KSEA 1N2DC 2BCCE 4DCKA 2R5BA 1JCCA 3VMYA 1ZR2A 2Z5IA 1ZXGA 1ZLLA 4RKUJ 3SSUA 1KQLA 1PPJG 4U3FJ 1OWAA 1SQBG 4OVNF 1KD1Q 3T97A 3L75D 3L36A 2P67A 1SS1A 4I7ZC 2OYIA 3H1HG 2MKVA 1AFOA 1H88A 2QIWA 3PP5A 2HYNA 1FJPA 3N7NA 1EDJA 2WITA 3H1KD 3GHGA 1URQD 1QL2A 3WMM0 2K37A 2WVRA 1GL2C 3G6EP 1URQB 4TLFA 1S1CX 1QLED 4I1LA 3CWBJ 2FXPA 3HE5A 1QGKB 1BCCE 3SWFA 1FBMA 1JEKA 2OQQA 2D2CB 3AECC 2J5UA 3B5NA 1CI6A 3AEAC 5AW5B 3OA7A 3PLNA 3AE8C 5APYA 2WQYC 3CC2P 4HH2A 3TNUB 3H1IJ 5CBOA 3NTNA 1LTAC 1L0NE 1T2KD 1MFTA 1LNQA 5KLIC 2R3SA 2G3AA 1OVUA 4H44C 4YXWH 1XTCC 1JTHA 2WPRA 2Q3EA 4HJGH 2WPVB 3B5ND 4RJTA 4GODA 3TGUD 2POHA 3H1KE 1OXZA 1JMMA 3EFGA 2FYNC 5AW3B 3VOPA 1USEA 3VN0A 1PIXA 2YO2A 1KYOH 4GKGA 3SFDC 2XV5A 1NWQA 3U1AA 4AYCA 3HD7C 4WB4A 3WU2E 3Q1MA 4N78E 2N1TB 4EYYQ 1T8ZA 2P7JA 1FAVA 3CCEP 1FS0E 1L0NK 4GOEA 3CC7P 1JCDA 3Q5RA 4A7PA 1SVFA 2V4HA 2H88C 3P8MC 4JYBA 3R2PA 3H32B 1DIPA 1PV3A 5E79E 3H1JD 1SQBJ 5APQA 4IL6E 4PJ0H 3TYYA 4KHXA 4U7JA 3TGUE 2PRRA 3H1HJ 3SWKA 4KT0J 1QVGO 2OTJP 1HTLC 3LW5J 1SQPD 3S4RA 4BRYB 3L73G 4C7NA 4GIFA 1OVVA 1LWUA 4PV1B 2R3CA 3LW5H 2ZVNB 1IFJA 1JB0J 5KKZB 4EDFA 3G4SP 2P2UA 1FZCB 3FXDA 3A0BH 4XA4A 3VTPC 3AEGC 1GDTA 3ABVC 2E74D 3H1LD 2QJKC 1KORA 3SWYA 3WUUA 5CBNA 1FZFA 3H1JE 2AEJA 4RO0A 4Y99C 2WTYA 1OX3A 3EFFK 3AEBC 1LTJA 2KYVA 4M3LA 1FJKA 2VRSA 3PH0A 1Q81Q 2Z5HA 4DJGA 1J1EC 2N9BA 2E5TA 2KZIA 3WUTA 1ZMEC 1URQC 5GTHE 2ZVOB 3VP8A 3A2AA 5AVVB 1L4AB 2BEZF 1GD2E 1S5LE 1S9KE 1GU4A 1NTMD 1YTZT 1DEBA 2PP6A 5APTA 2YKPA 2UWJE 2YMYA 4R4LA 2RMZA 3L75J 2OYOA 2AXTH 1QL1A 3H1LE 2A45G 3HE4B 3GHGC 2W90A 1SQVD 2ZJSE 1T2KC 1KN7A 1SQPG 5AW0B 2Y0EA 5KAIE 1YJ9P 4OGQD 1NKZB 4C46A 2QM8A 3W67A 2B87B 1XTGB 1SQPK 1H8AA 2ZT9D 1GL2A 3B5NC 4W80A 1KC8Q 1VQKP 4JYCA 2FFDA 1NTKE 3GMAA 5AVXB 1BE3G 1NTZD 3HTKB 2IYOA 4HKZH 2HFED 3AE3C 2ITAA 3L73J 2J58A 1SQQG 3I55P 2CK3H 1NU1D 2OYHB 1QX8A 3PTZA 4H0LB 3P32A 1NTME 4KJMA 3WU2H 3LIDA 1YJNP 1IO4A 3RK3D 2XNXA 4Z1MH 3V4QA 4B86A 3KZIH 3B71A 1OZHA 3TGUJ 2YKOA 3D70A 1PFIA 3EQ2A 4ASWA 2K1AA 3RK2D 2HPCB 2J59M 1LJ2A 1DD4A 1HH0A 2E43A 1M56D 4LLHA 5GTIE 2IBZE 2CPBA 3A3YB 3CL3D 1GW4A 1CZQA 3PHLA 2JO1A 1NTMK 1EDIA 1MUUA 2BEQD 1YJWP 2WT7A 1RF0A 1NU1E 4L73A 3II6A 2C9LY 4EOTA 2HODA 2Q3IA 3L71D 1SQVK 3BCCD 1SFCA 2E74C 2E76B 3AEFC 1EDKA 1DEEG 2IZ1A 3M91A 2XU6A 3CMAP 1LWUC 2BCCD 3VMXA 1SQPJ 3TK1A 2FY8A 2QA4P 3QH9A 2W8ZA 2FYUG 5KLVD 4D6TG 4Y28J 3AEEC 1NTZK 4UB8H 2A45H 4H13D 1PP9E 4L76A 3AE6C 3CLQA 1NU1K 3CX5H 3KYQA 1LTSC 1SFCD 5B5EE 5CMZA 1KMIZ 3V2RA 1LTTC 1BE3J 3Q2YA 1LT9B 4WY4B 4DZOA 1L2PA 1BSNA 1SQQJ 3SFEC 3UIAA 1H89A 1M7LA 5APXA 1Q82Q 2QJYC 1HGVA 1LTJC 2Y0CA 3EWKA 3MUDA 2GA1A 2YXQB 2JDIH 1FOSE 2Q1KA 3BCCE 2AEMA 1ZN5A 1AV1A 1A02J 1JY2N 2IPPA 2KNCB 2YIUB 3Q5SA 1HBWA 1JNMA 1BCCD 3IN6A 5AW2B 4OGQC 1T6AA 3CCSP 1K8AQ 2A06G 5KLVE 5AW9B 1ZR4A 1URQA 1JMBA 1SP4A 2ZT9C 1JY3N 1JOCA 5K5GB 2QJPB 2K9YA 1L0ND 3L71G 3BRTB 4IFMA 1EQ7A 3CCLP 3MP7B 2IBZI 3RL0g 2WPQA 5AW4B 2O3JA 1NHLA 3TNUA 1L0LE 1WRGA 2XDJA 2FYZA 1IK9A 5H2FE 1SQVJ 1RE3C 2BCCG 3NFQA 5CCHA 2I1JA 3RK3C 2LXBA 2FFDC 2D2CD 3D6YA 2O1JA 5KLVK 3LIEA 4N78D 3F5HA 2WZ7A 4PD4E 1OFCX 1USDA 2M8RA 5AVWB 2E75B 2PAJA 1NTZJ 2Q5UA 3RK2C 1D7MA 2HG5D 1S4XA 2FYUJ 2V7QJ 5CCHD 4D6TJ 3NXSA 4I6MC 3PRJA 1KB9D 2N1TA 2Q7CA 5AW8B 1L0LK 2Q6QA 2ZXXA 3G71P 1Y9BA 1Y47A 1AVOA 1JY2O 2V7QH 2QVAA 3L4FA 1SQXD 1BCCG 1FDOA 1VQNP 4R4MA 1ZV8A 3H32A 3L74E 1ZP0C 1ZW0A 2AXCA 1JY3O 2N1TD 3CCMP 1AA0A 5CCGD 2M3EA 4K3AA 4UB6E 4IL6X 3CC4P 1VL2A 1L0NG 4NPFX 1RF0C 4TT3H 3L75G 1CI6B 4BRYA 2Y9YA 3IFMA 3H6PA 2W27A 3FWNA 2LKMA 2RKLA 2SPZA 4RESB 5KAFE 4H13C 2MJZA 2NPSB 4L75A 1KB9E 5APWA 3H1KG 1PGJA 4JQ0D 1SFCC 3L72E 4XFJA 1HJBA 3L71J 3VP9A 1FZCA 3O6QB 3BVHA 2W6AA 3BCCJ 2Y0DA 1SQXE 4ZNCA 2N9YB 1VQPP 2QM7A 2M5AB 4YXDC 1EXIA 4GT1A 2LXCB 3L37A 1OW8A 1SLQA 3GF7A 1FDIA 1G1JA 3HUSB 4PV1D 1LP1B 1BGYE 2BCCJ 1FZGA 1CW5A 2KZJA 1VF5B 2JEEA 4N3YB 2L5GB 3QWOC 5AW7B 3L70E 3C9IA 1S9KD 3VYIA 1LTIC 4EI2A 5C39A 3BATA 3I56P 3F89A 3GF3A 1L4AA 4PD4I 2H89C 3CXHE 1IFIA 5EFWB 3TGUG 3MUDC 5TISE 4ZKUA 1S5LX 3A5TA 1SQXK 3V2PA 3IF4A 5M1BA 3FXEA 1VQLP 3CCRP 4ZMDA 2M0BA 1N7SB 2KXPB 3HE4A 3CPWO 5DJUB 1N8RQ 1AJYA 1FZAA 3BASA 1P84E 1L4AD 2ZYGA 3RL0B 2KB7P 1NTKD 3M9BA 1BCCJ 1YITP 1MV8A 1KZUB 4OWFA 2B87A 3BRVB 2D2CC 5B66E 2WSSH 3MIWA 1Q90D 1E79H 5CHXA 1R8EA 1RHZB 3H1JG 1L0NJ 1M1JB 1KILB 1K9MQ 1J1DB 1YBKA 2OARA 1RH5B 1AQ5A 2IZ0A 2OYHA 3M06A 5CCHC 1VQOP 1N73B 2IX7C 1DX7A 2W83C 1N7LA 3H1KJ 1X22A 1KB9I 1Q2NA 3CMEP 1VDFA 1PZQA 3R4YA 3RBZA 1RE3A 4LC1A 5CJ0A 1YTZI 3O8ZA 2IBZD 1JUNA 3CCVP 4H0LD 4MN4C 2HPCA 1IFDA 3H1LG 2O01J 2N1TC 5CCGC 1IFMA 2IDBA 3K5BA 1KILE 1QVFO 3S9OA 2QG4A 3E1IA 1JO5A 2BASA 2K9JB 1VQ9P 2ZFCA 1J2JB 2O01H 2R5DA 1KQFB 4U3FE 3U59A 3G9RA 4I7ZB 5KAFH 3AE4C 5AVTB 1W2EA 1FU1A 3CXHI 1OVRA 1M90Q 1NTKG 4IFFA 1U7JA 5E79H 2M3BA 1KQSO 4IL6H 1HGZA 1NTKK 1R5SA 1QEXA 1PP9D 4CPGA 1RF1B 4GDOA 3HUSC 1YIJP 1NTMG 3V2NA 3V2QA 1VQ8P 1T3JA 3CWBE 4PV1C 3Q5PA 1NYHA 1P84I 5AW6B 2JKVA 3W68A 4NPDA 4C7RA 2YXRB 5BU8B 2IFNA 1SQVG 2P58A 5KKZC 2JWDA 1EZVE 2KIKA 1NAYA 1FZCC 2E76D 5KLIB 2Y9ZA 1RQVA 2B88A 3H1IE 2WSEJ 3H1JJ 1GK4A
chains in the Genus database with same CATH topology
1FDMA 1LT9A 2XDJA 2FYZA 2ZXEB 1IK9A 1LGHB 1G2CA 4AUWA 5APVA 1DH3A 1RE3C 3MGNA 5APQA 3NFQA 3TYYA 5CCHA 3M0DA 1LTGC 4KHXA 2I1JA 3RK3C 4W7YA 3P8CE 2C9NY 2WSEH 1GK6A 2FFDC 1NKNA 2O1JA 1HTLC 1YYCA 5KLVK 3LIEA 2WSFH 4C7NA 4GIFA 4N78D 2WZ7A 3M9QA 2E42A 2M8RA 5AVWB 1LWUA 1L4AC 3HD7B 3TSIA 2R3CA 1RF1A 2PAJA 1MFZA 2Q5UA 4ZKPA 4WY4D 3RK2C 3LW5H 2P1JA 1IFJA 2HG5D 5CCHD 4WBAA 3NXSA 4I6MC 2NPSC 2N1TA 4XE5B 3MTUE 3A7OA 2Q7CA 2WPSA 2P2UA 1FZCB 4XA4A 5AW8B 1L0LK 1X8YA 3VTPC 1GU5A 1GDTA 1HWTC 1J1DC 1SQQK 3N4XA 1MZ9A 1FZEA 1JY2O 2Z4EA 3SWYA 1X9VA 2YNYA 1GL2D 1FZFA 3L4FA 2W6BA 5AVUB 5APSA 2HLOA 1ZV8A 4Y99C 2WTYA 3H32A 5APUA 1VPCA 1WT6A 1LTJA 3RK3B 1GL2B 2KYVA 4M3LA 1FJKA 2VRSA 2FFDB 2Z5HA 1J1EC 2N9BA 1JY3O 2N1TD 5CCGD 1URQC 1HVVA 3VP8A 3A2AA 1RF0C 5AVVB 1L4AB 1CI6B 3V5BA 1X79B 3RK2B 1GD2E 3B8EB 1NH4A 1A02F 2A45I 3IFMA 3OJAB 3H6PA 2W27A 2LKMA 4RESB 1S9KE 1GU4A 3NMDA 5BU5A 2OYHC 3HD7A 1IC2A 1YTZT 1DEBA 2MJZA 5AVRB 2NPSB 4W7ZA 2PP6A 2YKQA 3OAKA 1IFNA 5APTA 5APWA 5BVZA 3KPEA 2YKPA 3HRNA 2YMYA 1SFCC 4WY4A 1QL1A 4AQRD 2H43A 2A45G 3HE4B 1HJBA 3GHGC 3VP9A 3P7KA 3G3ZA 1RY3A 1FZCA 1GTWA 3BVHA 1KFMA 1SQBK 2W6AA 1T2KC 1N7SC 5AW0B 2QM7A 3IR9A 1NKZB 4Y99B 2KP8A 4C46A 2QM8A 2GM4A 2YO3A 4GT1A 3L37A 2XKMA 1SLQA 1XTGB 1SQPK 1G1JA 3HUSB 3HD7D 3RL0C 1RE4C 1FOSF 1J1EB 4N6JA 1H8AA 1IJDB 1JY2P 1GL2A 3B5NC 4W80A 1FZGA 1CW5A 4JYCA 2JEEA 1RF1C 4N3YB 2FFDA 1NAFA 5AW1B 2L5GB 2WT7B 3U1CA 5AW7B 5AVXB 3C9IA 3HTKB 1S9KD 1KFNA 4OH8B 3VYIA 3L35A 1LTIC 2HFED 2J58A 3BATA 1GZLA 2HODB 2FYUK 1CSBA 5CCGA 1M1JC 1NOHA 2OYHB 1L4AA 1KILC 1JY3P 3P32A 3VMZA 2OYIB 5KJ7C 1IFIA 3LIDA 2C0XA 4EIJA 2H7HA 4ZKUA 1SFCB 1IO4A 3RK3D 4IFDK 2XNXA 2NPSA 2GUSA 3A5TA 1G2CB 3GHGB 1N73C 3I5CA 1SQXK 3V2PA 1NO4A 3V4QA 3MD0A 4B86A 1N7SB 2I1KA 2FKWB 3HE4A 2YKOA 2WSCH 1HUCA 1PFIA 1FZAA 3HE5B 3BASA 3EQ2A 4I2LC 1L4AD 3RL0B 2Q9IA 2KB7P 3RK2D 2HPCB 3M9BA 2J59M 4LGDE 5AVSB 4DOJA 1HH0A 1MV8A 1KZUB 2E43A 3B5NB 2R32A 4O9BA 4LLHA 3HUSA 1N2DC 2WWWA 3BRVB 2NPSD 2CPBA 2R5BA 4HYTB 3A3YB 3CL3D 1JCCA 1GW4A 1CZQA 3VMYA 2XZRA 3MIWA 1ZR2A 3CI9A 2Z5IA 1NTMK 1MUUA 5CHXA 1ZLLA 2WT7A 1RF0A 1M1JB 1KQLA 1KILB 5CJ4A 1J1DB 1OWAA 1LT9C 4WY4C 3II6A 2OARA 2C9LY 3T97A 1JTHB 4EOTA 1AQ5A 1G1IA 2HODA 3L36A 1N86A 2Q3IA 2OYHA 3M06A 5CCHC 3M0DC 2P67A 1SQVK 2OYIA 1N73B 2IX7C 2O1KA 1DX7A 1AFOA 1H88A 3PP5A 2KSJA 1N7LA 1SFCA 2H8PD 2HYNA 1FJPA 3N7NA 2WITA 1VDFA 3GHGA 1RE3A 1URQD 1QL2A 1Z56A 3WMM0 3M0AA 4LC1A 1LTBC 5CJ0A 3M91A 1GL2C 2XU6A 1N7SA 1YTZI 1LWUC 1URQB 3VMXA 3O8ZA 2GUVA 4I1LA 3TK1A 1JUNA 3HE5A 5AVZB 1NTZK 3SWFA 1FBMA 1RE4A 2A45H 2HPCA 1IFDA 2N1TC 3CLQA 3B5NA 5CCGC 1IFMA 1CI6A 1NU1K 3KYQA 1LTSC 5AW5B 1SFCD 3OA7A 5CMZA 5APYA 3E1IA 1JO5A 1E5WA 4HH2A 3V2RA 2BASA 1LTTC 3TNUB 3NTNA 1LT9B 4WY4B 1LTAC 2ZFCA 4DZOA 1J2JB 2O01H 2R5DA 1T2KD 1N7SD 1M1JA 3UIAA 1KILA 2KOGA 3U59A 1H89A 1M7LA 5APXA 5KJ7A 1HGVA 1LTJC 1XTCC 5AVTB 3M9HA 1JTHA 1W2EA 1FU1A 3RL0D 2WPRA 3MUDA 5AVQB 1FOSE 4IFFA 3B5ND 1ZN5A 3P8CD 1N73A 2POHA 1A02J 4C7NB 3KDPB 3KQGA 1OXZA 2M3BA 2C0WA 1JY2N 1HGZA 1JMMA 1NTKK 2IPPA 2IFMA 1HBWA 3EFGA 1JNMA 5AW3B 1LWUB 3VOPA 1RF1B 3VN0A 5AW2B 3HUSC 3V4WA 2YO2A 3V2NA 3V2QA 4GKGA 2XV5A 1NWQA 1T3JA 5AW9B 1KILD 3U1AA 4AYCA 1ZR4A 2FXMA 1URQA 3HD7C 4WB4A 5KJ7D 4N78E 5AW6B 2N1TB 1SP4A 1T8ZA 2P7JA 1JY3N 1JOCA 4C7RA 3HTKA 5BU8B 2KLVA 1FAVA 2IFNA 2CPSA 1L0NK 4JF7A 5AVYB 3BRTB 4IFMA 1EQ7A 1JCDA 1FZCC 5KTBA 1GW3A 2OYIC 1T3UA 1SVFA 3P8MC 2WPQA 5AW4B 1FZBA 4JYBA 2JJLA 3R2PA 1NHLA 3H32B 3TNUA 1WRGA 1GK4A 1LTJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVV B;  2ZXE B;  1CI6 B;  3V4Q A;  3MD0 A;  3V5B A;  4AUW A;  5APV A;  1DH3 A;  3MGN A;  5APQ A;  4B86 A;  1GD2 E;  3NFQ A;  3B8E B;  3TYY A;  1CI6 A;  3M0D A;  1A02 F;  4KHX A;  5AW5 B;  3HE4 A;  2W27 A;  4RES B;  5CMZ A;  1S9K E;  1GU4 A;  3NMD A;  1HUC A;  5APY A;  2C9N Y;  1GK6 A;  5AVR B;  3HE5 B;  4I2L C;  2BAS A;  3TNU B;  3OAK A;  3NTN A;  5APT A;  5APW A;  2ZFC A;  3M9B A;  4DZO A;  1J2J B;  1T2K D;  2R5D A;  1YYC A;  5AVS B;  1MV8 A;  3LIE A;  2E43 A;  4C7N A;  2R32 A;  3UIA A;  4AQR D;  1H89 A;  3HE4 B;  5APX A;  1HJB A;  2E42 A;  2WWW A;  5AVT B;  5AVW B;  3P7K A;  3M9H A;  2R5B A;  4HYT B;  1GTW A;  3A3Y B;  2R3C A;  2WPR A;  1MFZ A;  2Q5U A;  1CZQ A;  2W6A A;  3VMY A;  5AVQ B;  1T2K C;  2XZR A;  1FOS E;  5AW0 B;  2QM7 A;  2Z5I A;  3IR9 A;  1MUU A;  2KP8 A;  4C46 A;  2QM8 A;  2WT7 A;  1A02 J;  2YO3 A;  3KDP B;  3NXS A;  4C7N B;  3KQG A;  1OXZ A;  4GT1 A;  3L37 A;  1KQL A;  4I6M C;  1SLQ A;  2IPP A;  4XE5 B;  1HBW A;  3A7O A;  1JNM A;  2Q7C A;  1OWA A;  2WPS A;  1FOS F;  2P2U A;  5AW3 B;  2C9L Y;  3T97 A;  4EOT A;  5AW8 B;  1H8A A;  1X8Y A;  3VTP C;  3VN0 A;  5AW2 B;  1GU5 A;  1HWT C;  3V4W A;  3L36 A;  2YO2 A;  2Q3I A;  3M06 A;  4GKG A;  4JYC A;  2P67 A;  2XV5 A;  1NAF A;  5AW1 B;  1NWQ A;  5AW9 B;  2WT7 B;  4AYC A;  5AW7 B;  5AVX B;  2YNY A;  1S9K D;  5AW6 B;  1H88 A;  3VYI A;  3L35 A;  5AVU B;  5APS A;  1SP4 A;  2P7J A;  3HTK A;  2WTY A;  5APU A;  1GZL A;  1FAV A;  1CSB A;  4M3L A;  2VRS A;  5AVY B;  3M0A A;  4LC1 A;  3P32 A;  3VMZ A;  3A5T A;  3M91 A;  3LID A;  2XU6 A;  2Z5H A;  2N9B A;  3VMX A;  2H7H A;  3O8Z A;  3TK1 A;  3P8M C;  2WPQ A;  1JUN A;  5AW4 B;  1IO4 A;  4JYB A;  2JJL A;  3HE5 A;  5AVZ B;  3TNU A;  3SWF A;  1G2C B;  1GK4 A;  3I5C A;  3A2A A; 
#chains in the Genus database with same CATH topology
 1FDM A;  1LT9 A;  1LGH B;  2PFX A;  1G2C A;  5APV A;  1DH3 A;  3M0D A;  1LTG C;  3FWL A;  1SQB D;  4HB1 A;  4W7Y A;  1NTZ G;  2C9N Y;  2WSE H;  1GK6 A;  1KYO E;  1OIP A;  1NU1 G;  2WSF H;  1W2B O;  2KNC A;  1IFP A;  1L4A C;  3HD7 B;  1ZRT D;  2W6J H;  3TSI A;  4WY4 D;  2RN0 A;  5GTH H;  1NJI Q;  1YHQ P;  3JCU E;  4WBA A;  1WMK A;  1S5L H;  4XE5 B;  3MTU E;  3A7O A;  2I8D A;  3H1L J;  3CCU P;  1L0L D;  1H0T B;  3C8V A;  1X8Y A;  1X0T A;  1J1D C;  3N4X A;  1MZ9 A;  1YQ4 C;  1FZE A;  2A06 E;  4PJ0 E;  1VQ4 P;  2QSI A;  1X9V A;  2YNY A;  1HJ0 A;  1DD3 A;  2W6B A;  3Q3D A;  5APS A;  1PPJ E;  4WWI A;  2O01 N;  1VPC A;  1SQB E;  2KS1 B;  2JWA A;  2PGD A;  5KAI H;  4PD4 D;  3D6Z A;  2DW3 A;  1NTK J;  3JSV C;  1VQ5 P;  3C1L A;  3H1H E;  2AEF A;  1ZOY C;  1ZRT E;  3AE9 C;  1PGP A;  1NTM J;  3A0B E;  3GW6 A;  5BU5 A;  2OYH C;  3BCC G;  4H0L C;  1IZN B;  3USS A;  2L91 A;  2YKQ A;  2B9B A;  1M8O B;  3HRN A;  2WMM A;  2QE7 H;  2QJK B;  1EZV I;  3L74 D;  1GTW A;  1KFM A;  1SQB K;  3AE7 C;  5KLV G;  3IR9 A;  1VQM P;  4Y99 B;  2KP8 A;  2XKM A;  2E75 D;  2FXO A;  1FOS F;  1EXJ A;  1J1E B;  2KUB A;  4N6J A;  1UIX A;  2OTK E;  3AE2 C;  1RF1 C;  1NAF A;  5AW1 B;  3IAO A;  1KYO I;  1KFN A;  4OH8 B;  3L35 A;  1L0L G;  2YMK A;  1NU1 J;  5GTI H;  3T97 B;  1GZL A;  3V6I A;  1CSB A;  5CCG A;  3FGA D;  3L73 D;  2KK7 A;  1VQ7 P;  2AXT E;  3VMZ A;  2OYI B;  2K3R A;  2C0X A;  3L72 D;  1U7M A;  2H7H A;  1K04 A;  1EC5 A;  2WSC J;  2RH0 A;  2NPS A;  3CCJ P;  5L8R J;  3GHG B;  2ZYD A;  3I5C A;  3L75 E;  2E76 C;  1NVO A;  2I1K A;  2FKW B;  2OTL P;  1BGY D;  2WSC H;  1S2E A;  4QMA A;  1MKM A;  3O6Q A;  3B4S A;  5TJH A;  3HE5 B;  2Q9I A;  3ZDM A;  2M5A A;  4LGD E;  2JP3 A;  1PP9 J;  3B5N B;  3L70 D;  4O9B A;  1TU3 F;  3HUS A;  1LP1 A;  2ZYA A;  2WWW A;  2NPS D;  4HYT B;  4NPE A;  2OGU A;  2XZR A;  3CXH D;  3CI9 A;  3E7K A;  3L73 E;  5CJ4 A;  3L74 G;  1M1K Q;  1LT9 C;  5B5E H;  4WY4 C;  3OW2 O;  1JTH B;  1AVY A;  2QRX A;  1G1I A;  3JCU H;  1N86 A;  3M0D C;  3KZI E;  1YQ3 C;  2O1K A;  2KSJ A;  2H8P D;  1P84 D;  1KTM A;  2NZ2 A;  1FC2 C;  1VF5 D;  1Z56 A;  3M0A A;  1LTB C;  2YIU C;  1OW7 A;  1VQ6 P;  1N7S A;  1Y8A A;  5KLV J;  2GUV A;  3GLM A;  3AE1 C;  3CX5 D;  5AVZ B;  3TF5 A;  1RE4 A;  3JC2 2;  3L72 G;  2QJP C;  3H25 A;  1BSH A;  1SQX G;  1E5W A;  1GMJ A;  1L0L J;  1N7S D;  1BE3 D;  1M1J A;  1BGY G;  1KIL A;  2KOG A;  2QEX P;  3S1K A;  1EDL A;  1SQQ D;  5KJ7 A;  2P10 A;  3M9H A;  3RL0 D;  5AVQ B;  1JM0 A;  1Q7Y Q;  1K73 Q;  2E74 B;  2KLU A;  3L70 G;  3P8C D;  5H2F H;  1N73 A;  4C7N B;  3KDP B;  3CCQ P;  3KQG A;  3TDK A;  2C0W A;  2NRG A;  2B89 A;  2IFM A;  1LWU B;  4UB8 E;  3V4W A;  1SQP E;  3CX5 E;  1KIL D;  2FXM A;  1OMI A;  2E75 C;  5KJ7 D;  1BDC A;  4PD4 H;  1YI2 P;  3HTK A;  1U57 A;  2HR3 A;  2KLV A;  2CPS A;  4U3F D;  4JF7 A;  5AVY B;  4K35 A;  1PL5 A;  5KTB A;  3A0H E;  1GW3 A;  2OYI C;  1T3U A;  3RGU A;  3PJS K;  1FZB A;  1BE3 E;  2JJL A;  1KV4 A;  2QJY B;  1LTJ B;  2K9J A;  1SQQ E;  2ZXE B;  2ZAE B;  3KXD A;  3L74 J;  4L74 A;  4AUW A;  3MGN A;  2G8Y A;  1LT1 A;  3P8C E;  1NKN A;  1YYC A;  3CWB D;  4IOI H;  4OGQ B;  3M9Q A;  2E42 A;  4UB6 H;  1S3J A;  1RF1 A;  1MFZ A;  1EZV D;  1R5L A;  4ZKP A;  2ZT9 B;  2JR8 A;  2P1J A;  2KI7 B;  3AE5 C;  2NPS C;  2FYU D;  4D6T D;  4YPC A;  3H1I D;  2WPS A;  3L72 J;  1K05 A;  3VMA A;  1GU5 A;  1HWT C;  1SQQ K;  1S72 P;  1KB9 H;  2Z4E A;  1SQX J;  1GL2 D;  5AVU B;  1KYO D;  2HLO A;  3D71 A;  3WUV A;  5APU A;  1BGY J;  1WT6 A;  3RK3 B;  1SQV E;  1GL2 B;  2R44 A;  2FFD B;  1Q86 Q;  3L70 J;  1VF5 C;  1HVV A;  4U3F G;  2FBW C;  1NGM B;  3E1R A;  3V5B A;  1X79 B;  3RK2 B;  1IK7 A;  3B8E B;  1NH4 A;  1A02 F;  4JPZ B;  2A45 I;  3OJA B;  1OW6 A;  1NTZ E;  3NMD A;  2E5Y A;  3HD7 A;  4H44 D;  1PGQ A;  1IC2 A;  5AVR B;  4W7Z A;  3CX5 I;  2FYU E;  3OAK A;  1IFN A;  2A06 D;  4D6T E;  5BVZ A;  3KPE A;  1HF9 A;  4H44 B;  2XND H;  1FE6 A;  3CXH H;  4WY4 A;  4AQR D;  3ITK A;  2H43 A;  1PPJ D;  2IYP A;  3KHU A;  2WSF J;  3P7K A;  3G3Z A;  1RY3 A;  2IBZ G;  5TIS H;  1H0T A;  3RK3 E;  4BWN A;  1N7S C;  4YTP C;  3CWB G;  1UII A;  4GOF A;  2GM4 A;  2K88 A;  2FYN B;  2YO3 A;  3H1H D;  3HD7 D;  3RL0 C;  1RE4 C;  2LR2 A;  4JBZ A;  1EZV G;  1IJD B;  1JY2 P;  2KS1 A;  1P84 H;  3CD6 P;  1BDD A;  2WT7 B;  3U1C A;  3H1I G;  4WVZ A;  1M57 D;  4DT0 A;  5B66 H;  2HOD B;  2FYU K;  1M1J C;  1NOH A;  1W5C E;  1KIL C;  4H13 B;  1JY3 P;  3GG2 A;  3RBX A;  5KJ7 C;  4EIJ A;  5DJT B;  1SFC B;  4IFD K;  2GUS A;  1G2C B;  1N73 C;  1PP9 G;  3MZW B;  3MHV A;  1NO4 A;  3MD0 A;  3L71 E;  3A0H H;  4ASV A;  1KQG B;  1RQU A;  1AQT A;  1HUC A;  4BXL A;  4I2L C;  3FX0 A;  5AVS B;  4DOJ A;  3AED C;  1PGO A;  2R32 A;  2KSE A;  1N2D C;  2BCC E;  4DCK A;  2R5B A;  1JCC A;  3VMY A;  1ZR2 A;  2Z5I A;  1ZXG A;  1ZLL A;  4RKU J;  3SSU A;  1KQL A;  1PPJ G;  4U3F J;  1OWA A;  1SQB G;  4OVN F;  1KD1 Q;  3T97 A;  3L75 D;  3L36 A;  2P67 A;  1SS1 A;  4I7Z C;  2OYI A;  3H1H G;  2MKV A;  1AFO A;  1H88 A;  2QIW A;  3PP5 A;  2HYN A;  1FJP A;  3N7N A;  1EDJ A;  2WIT A;  3H1K D;  3GHG A;  1URQ D;  1QL2 A;  3WMM 0;  2K37 A;  2WVR A;  1GL2 C;  3G6E P;  1URQ B;  4TLF A;  1S1C X;  1QLE D;  4I1L A;  3CWB J;  2FXP A;  3HE5 A;  1QGK B;  1BCC E;  3SWF A;  1FBM A;  1JEK A;  2OQQ A;  2D2C B;  3AEC C;  2J5U A;  3B5N A;  1CI6 A;  3AEA C;  5AW5 B;  3OA7 A;  3PLN A;  3AE8 C;  5APY A;  2WQY C;  3CC2 P;  4HH2 A;  3TNU B;  3H1I J;  5CBO A;  3NTN A;  1LTA C;  1L0N E;  1T2K D;  1MFT A;  1LNQ A;  5KLI C;  2R3S A;  2G3A A;  1OVU A;  4H44 C;  4YXW H;  1XTC C;  1JTH A;  2WPR A;  2Q3E A;  4HJG H;  2WPV B;  3B5N D;  4RJT A;  4GOD A;  3TGU D;  2POH A;  3H1K E;  1OXZ A;  1JMM A;  3EFG A;  2FYN C;  5AW3 B;  3VOP A;  1USE A;  3VN0 A;  1PIX A;  2YO2 A;  1KYO H;  4GKG A;  3SFD C;  2XV5 A;  1NWQ A;  3U1A A;  4AYC A;  3HD7 C;  4WB4 A;  3WU2 E;  3Q1M A;  4N78 E;  2N1T B;  4EYY Q;  1T8Z A;  2P7J A;  1FAV A;  3CCE P;  1FS0 E;  1L0N K;  4GOE A;  3CC7 P;  1JCD A;  3Q5R A;  4A7P A;  1SVF A;  2V4H A;  2H88 C;  3P8M C;  4JYB A;  3R2P A;  3H32 B;  1DIP A;  1PV3 A;  5E79 E;  3H1J D;  1SQB J;  5APQ A;  4IL6 E;  4PJ0 H;  3TYY A;  4KHX A;  4U7J A;  3TGU E;  2PRR A;  3H1H J;  3SWK A;  4KT0 J;  1QVG O;  2OTJ P;  1HTL C;  3LW5 J;  1SQP D;  3S4R A;  4BRY B;  3L73 G;  4C7N A;  4GIF A;  1OVV A;  1LWU A;  4PV1 B;  2R3C A;  3LW5 H;  2ZVN B;  1IFJ A;  1JB0 J;  5KKZ B;  4EDF A;  3G4S P;  2P2U A;  1FZC B;  3FXD A;  3A0B H;  4XA4 A;  3VTP C;  3AEG C;  1GDT A;  3ABV C;  2E74 D;  3H1L D;  2QJK C;  1KOR A;  3SWY A;  3WUU A;  5CBN A;  1FZF A;  3H1J E;  2AEJ A;  4RO0 A;  4Y99 C;  2WTY A;  1OX3 A;  3EFF K;  3AEB C;  1LTJ A;  2KYV A;  4M3L A;  1FJK A;  2VRS A;  3PH0 A;  1Q81 Q;  2Z5H A;  4DJG A;  1J1E C;  2N9B A;  2E5T A;  2KZI A;  3WUT A;  1ZME C;  1URQ C;  5GTH E;  2ZVO B;  3VP8 A;  3A2A A;  5AVV B;  1L4A B;  2BEZ F;  1GD2 E;  1S5L E;  1S9K E;  1GU4 A;  1NTM D;  1YTZ T;  1DEB A;  2PP6 A;  5APT A;  2YKP A;  2UWJ E;  2YMY A;  4R4L A;  2RMZ A;  3L75 J;  2OYO A;  2AXT H;  1QL1 A;  3H1L E;  2A45 G;  3HE4 B;  3GHG C;  2W90 A;  1SQV D;  2ZJS E;  1T2K C;  1KN7 A;  1SQP G;  5AW0 B;  2Y0E A;  5KAI E;  1YJ9 P;  4OGQ D;  1NKZ B;  4C46 A;  2QM8 A;  3W67 A;  2B87 B;  1XTG B;  1SQP K;  1H8A A;  2ZT9 D;  1GL2 A;  3B5N C;  4W80 A;  1KC8 Q;  1VQK P;  4JYC A;  2FFD A;  1NTK E;  3GMA A;  5AVX B;  1BE3 G;  1NTZ D;  3HTK B;  2IYO A;  4HKZ H;  2HFE D;  3AE3 C;  2ITA A;  3L73 J;  2J58 A;  1SQQ G;  3I55 P;  2CK3 H;  1NU1 D;  2OYH B;  1QX8 A;  3PTZ A;  4H0L B;  3P32 A;  1NTM E;  4KJM A;  3WU2 H;  3LID A;  1YJN P;  1IO4 A;  3RK3 D;  2XNX A;  4Z1M H;  3V4Q A;  4B86 A;  3KZI H;  3B71 A;  1OZH A;  3TGU J;  2YKO A;  3D70 A;  1PFI A;  3EQ2 A;  4ASW A;  2K1A A;  3RK2 D;  2HPC B;  2J59 M;  1LJ2 A;  1DD4 A;  1HH0 A;  2E43 A;  1M56 D;  4LLH A;  5GTI E;  2IBZ E;  2CPB A;  3A3Y B;  3CL3 D;  1GW4 A;  1CZQ A;  3PHL A;  2JO1 A;  1NTM K;  1EDI A;  1MUU A;  2BEQ D;  1YJW P;  2WT7 A;  1RF0 A;  1NU1 E;  4L73 A;  3II6 A;  2C9L Y;  4EOT A;  2HOD A;  2Q3I A;  3L71 D;  1SQV K;  3BCC D;  1SFC A;  2E74 C;  2E76 B;  3AEF C;  1EDK A;  1DEE G;  2IZ1 A;  3M91 A;  2XU6 A;  3CMA P;  1LWU C;  2BCC D;  3VMX A;  1SQP J;  3TK1 A;  2FY8 A;  2QA4 P;  3QH9 A;  2W8Z A;  2FYU G;  5KLV D;  4D6T G;  4Y28 J;  3AEE C;  1NTZ K;  4UB8 H;  2A45 H;  4H13 D;  1PP9 E;  4L76 A;  3AE6 C;  3CLQ A;  1NU1 K;  3CX5 H;  3KYQ A;  1LTS C;  1SFC D;  5B5E E;  5CMZ A;  1KMI Z;  3V2R A;  1LTT C;  1BE3 J;  3Q2Y A;  1LT9 B;  4WY4 B;  4DZO A;  1L2P A;  1BSN A;  1SQQ J;  3SFE C;  3UIA A;  1H89 A;  1M7L A;  5APX A;  1Q82 Q;  2QJY C;  1HGV A;  1LTJ C;  2Y0C A;  3EWK A;  3MUD A;  2GA1 A;  2YXQ B;  2JDI H;  1FOS E;  2Q1K A;  3BCC E;  2AEM A;  1ZN5 A;  1AV1 A;  1A02 J;  1JY2 N;  2IPP A;  2KNC B;  2YIU B;  3Q5S A;  1HBW A;  1JNM A;  1BCC D;  3IN6 A;  5AW2 B;  4OGQ C;  1T6A A;  3CCS P;  1K8A Q;  2A06 G;  5KLV E;  5AW9 B;  1ZR4 A;  1URQ A;  1JMB A;  1SP4 A;  2ZT9 C;  1JY3 N;  1JOC A;  5K5G B;  2QJP B;  2K9Y A;  1L0N D;  3L71 G;  3BRT B;  4IFM A;  1EQ7 A;  3CCL P;  3MP7 B;  2IBZ I;  3RL0 g;  2WPQ A;  5AW4 B;  2O3J A;  1NHL A;  3TNU A;  1L0L E;  1WRG A;  2XDJ A;  2FYZ A;  1IK9 A;  5H2F E;  1SQV J;  1RE3 C;  2BCC G;  3NFQ A;  5CCH A;  2I1J A;  3RK3 C;  2LXB A;  2FFD C;  2D2C D;  3D6Y A;  2O1J A;  5KLV K;  3LIE A;  4N78 D;  3F5H A;  2WZ7 A;  4PD4 E;  1OFC X;  1USD A;  2M8R A;  5AVW B;  2E75 B;  2PAJ A;  1NTZ J;  2Q5U A;  3RK2 C;  1D7M A;  2HG5 D;  1S4X A;  2FYU J;  2V7Q J;  5CCH D;  4D6T J;  3NXS A;  4I6M C;  3PRJ A;  1KB9 D;  2N1T A;  2Q7C A;  5AW8 B;  1L0L K;  2Q6Q A;  2ZXX A;  3G71 P;  1Y9B A;  1Y47 A;  1AVO A;  1JY2 O;  2V7Q H;  2QVA A;  3L4F A;  1SQX D;  1BCC G;  1FDO A;  1VQN P;  4R4M A;  1ZV8 A;  3H32 A;  3L74 E;  1ZP0 C;  1ZW0 A;  2AXC A;  1JY3 O;  2N1T D;  3CCM P;  1AA0 A;  5CCG D;  2M3E A;  4K3A A;  4UB6 E;  4IL6 X;  3CC4 P;  1VL2 A;  1L0N G;  4NPF X;  1RF0 C;  4TT3 H;  3L75 G;  1CI6 B;  4BRY A;  2Y9Y A;  3IFM A;  3H6P A;  2W27 A;  3FWN A;  2LKM A;  2RKL A;  2SPZ A;  4RES B;  5KAF E;  4H13 C;  2MJZ A;  2NPS B;  4L75 A;  1KB9 E;  5APW A;  3H1K G;  1PGJ A;  4JQ0 D;  1SFC C;  3L72 E;  4XFJ A;  1HJB A;  3L71 J;  3VP9 A;  1FZC A;  3O6Q B;  3BVH A;  2W6A A;  3BCC J;  2Y0D A;  1SQX E;  4ZNC A;  2N9Y B;  1VQP P;  2QM7 A;  2M5A B;  4YXD C;  1EXI A;  4GT1 A;  2LXC B;  3L37 A;  1OW8 A;  1SLQ A;  3GF7 A;  1FDI A;  1G1J A;  3HUS B;  4PV1 D;  1LP1 B;  1BGY E;  2BCC J;  1FZG A;  1CW5 A;  2KZJ A;  1VF5 B;  2JEE A;  4N3Y B;  2L5G B;  3QWO C;  5AW7 B;  3L70 E;  3C9I A;  1S9K D;  3VYI A;  1LTI C;  4EI2 A;  5C39 A;  3BAT A;  3I56 P;  3F89 A;  3GF3 A;  1L4A A;  4PD4 I;  2H89 C;  3CXH E;  1IFI A;  5EFW B;  3TGU G;  3MUD C;  5TIS E;  4ZKU A;  1S5L X;  3A5T A;  1SQX K;  3V2P A;  3IF4 A;  5M1B A;  3FXE A;  1VQL P;  3CCR P;  4ZMD A;  2M0B A;  1N7S B;  2KXP B;  3HE4 A;  3CPW O;  5DJU B;  1N8R Q;  1AJY A;  1FZA A;  3BAS A;  1P84 E;  1L4A D;  2ZYG A;  3RL0 B;  2KB7 P;  1NTK D;  3M9B A;  1BCC J;  1YIT P;  1MV8 A;  1KZU B;  4OWF A;  2B87 A;  3BRV B;  2D2C C;  5B66 E;  2WSS H;  3MIW A;  1Q90 D;  1E79 H;  5CHX A;  1R8E A;  1RHZ B;  3H1J G;  1L0N J;  1M1J B;  1KIL B;  1K9M Q;  1J1D B;  1YBK A;  2OAR A;  1RH5 B;  1AQ5 A;  2IZ0 A;  2OYH A;  3M06 A;  5CCH C;  1VQO P;  1N73 B;  2IX7 C;  1DX7 A;  2W83 C;  1N7L A;  3H1K J;  1X22 A;  1KB9 I;  1Q2N A;  3CME P;  1VDF A;  1PZQ A;  3R4Y A;  3RBZ A;  1RE3 A;  4LC1 A;  5CJ0 A;  1YTZ I;  3O8Z A;  2IBZ D;  1JUN A;  3CCV P;  4H0L D;  4MN4 C;  2HPC A;  1IFD A;  3H1L G;  2O01 J;  2N1T C;  5CCG C;  1IFM A;  2IDB A;  3K5B A;  1KIL E;  1QVF O;  3S9O A;  2QG4 A;  3E1I A;  1JO5 A;  2BAS A;  2K9J B;  1VQ9 P;  2ZFC A;  1J2J B;  2O01 H;  2R5D A;  1KQF B;  4U3F E;  3U59 A;  3G9R A;  4I7Z B;  5KAF H;  3AE4 C;  5AVT B;  1W2E A;  1FU1 A;  3CXH I;  1OVR A;  1M90 Q;  1NTK G;  4IFF A;  1U7J A;  5E79 H;  2M3B A;  1KQS O;  4IL6 H;  1HGZ A;  1NTK K;  1R5S A;  1QEX A;  1PP9 D;  4CPG A;  1RF1 B;  4GDO A;  3HUS C;  1YIJ P;  1NTM G;  3V2N A;  3V2Q A;  1VQ8 P;  1T3J A;  3CWB E;  4PV1 C;  3Q5P A;  1NYH A;  1P84 I;  5AW6 B;  2JKV A;  3W68 A;  4NPD A;  4C7R A;  2YXR B;  5BU8 B;  2IFN A;  1SQV G;  2P58 A;  5KKZ C;  2JWD A;  1EZV E;  2KIK A;  1NAY A;  1FZC C;  2E76 D;  5KLI B;  2Y9Z A;  1RQV A;  2B88 A;  3H1I E;  2WSE J;  3H1J J;  1GK4 A; 
#chains in the Genus database with same CATH homology
 1FDM A;  1LT9 A;  2XDJ A;  2FYZ A;  2ZXE B;  1IK9 A;  1LGH B;  1G2C A;  4AUW A;  5APV A;  1DH3 A;  1RE3 C;  3MGN A;  5APQ A;  3NFQ A;  3TYY A;  5CCH A;  3M0D A;  1LTG C;  4KHX A;  2I1J A;  3RK3 C;  4W7Y A;  3P8C E;  2C9N Y;  2WSE H;  1GK6 A;  2FFD C;  1NKN A;  2O1J A;  1HTL C;  1YYC A;  5KLV K;  3LIE A;  2WSF H;  4C7N A;  4GIF A;  4N78 D;  2WZ7 A;  3M9Q A;  2E42 A;  2M8R A;  5AVW B;  1LWU A;  1L4A C;  3HD7 B;  3TSI A;  2R3C A;  1RF1 A;  2PAJ A;  1MFZ A;  2Q5U A;  4ZKP A;  4WY4 D;  3RK2 C;  3LW5 H;  2P1J A;  1IFJ A;  2HG5 D;  5CCH D;  4WBA A;  3NXS A;  4I6M C;  2NPS C;  2N1T A;  4XE5 B;  3MTU E;  3A7O A;  2Q7C A;  2WPS A;  2P2U A;  1FZC B;  4XA4 A;  5AW8 B;  1L0L K;  1X8Y A;  3VTP C;  1GU5 A;  1GDT A;  1HWT C;  1J1D C;  1SQQ K;  3N4X A;  1MZ9 A;  1FZE A;  1JY2 O;  2Z4E A;  3SWY A;  1X9V A;  2YNY A;  1GL2 D;  1FZF A;  3L4F A;  2W6B A;  5AVU B;  5APS A;  2HLO A;  1ZV8 A;  4Y99 C;  2WTY A;  3H32 A;  5APU A;  1VPC A;  1WT6 A;  1LTJ A;  3RK3 B;  1GL2 B;  2KYV A;  4M3L A;  1FJK A;  2VRS A;  2FFD B;  2Z5H A;  1J1E C;  2N9B A;  1JY3 O;  2N1T D;  5CCG D;  1URQ C;  1HVV A;  3VP8 A;  3A2A A;  1RF0 C;  5AVV B;  1L4A B;  1CI6 B;  3V5B A;  1X79 B;  3RK2 B;  1GD2 E;  3B8E B;  1NH4 A;  1A02 F;  2A45 I;  3IFM A;  3OJA B;  3H6P A;  2W27 A;  2LKM A;  4RES B;  1S9K E;  1GU4 A;  3NMD A;  5BU5 A;  2OYH C;  3HD7 A;  1IC2 A;  1YTZ T;  1DEB A;  2MJZ A;  5AVR B;  2NPS B;  4W7Z A;  2PP6 A;  2YKQ A;  3OAK A;  1IFN A;  5APT A;  5APW A;  5BVZ A;  3KPE A;  2YKP A;  3HRN A;  2YMY A;  1SFC C;  4WY4 A;  1QL1 A;  4AQR D;  2H43 A;  2A45 G;  3HE4 B;  1HJB A;  3GHG C;  3VP9 A;  3P7K A;  3G3Z A;  1RY3 A;  1FZC A;  1GTW A;  3BVH A;  1KFM A;  1SQB K;  2W6A A;  1T2K C;  1N7S C;  5AW0 B;  2QM7 A;  3IR9 A;  1NKZ B;  4Y99 B;  2KP8 A;  4C46 A;  2QM8 A;  2GM4 A;  2YO3 A;  4GT1 A;  3L37 A;  2XKM A;  1SLQ A;  1XTG B;  1SQP K;  1G1J A;  3HUS B;  3HD7 D;  3RL0 C;  1RE4 C;  1FOS F;  1J1E B;  4N6J A;  1H8A A;  1IJD B;  1JY2 P;  1GL2 A;  3B5N C;  4W80 A;  1FZG A;  1CW5 A;  4JYC A;  2JEE A;  1RF1 C;  4N3Y B;  2FFD A;  1NAF A;  5AW1 B;  2L5G B;  2WT7 B;  3U1C A;  5AW7 B;  5AVX B;  3C9I A;  3HTK B;  1S9K D;  1KFN A;  4OH8 B;  3VYI A;  3L35 A;  1LTI C;  2HFE D;  2J58 A;  3BAT A;  1GZL A;  2HOD B;  2FYU K;  1CSB A;  5CCG A;  1M1J C;  1NOH A;  2OYH B;  1L4A A;  1KIL C;  1JY3 P;  3P32 A;  3VMZ A;  2OYI B;  5KJ7 C;  1IFI A;  3LID A;  2C0X A;  4EIJ A;  2H7H A;  4ZKU A;  1SFC B;  1IO4 A;  3RK3 D;  4IFD K;  2XNX A;  2NPS A;  2GUS A;  3A5T A;  1G2C B;  3GHG B;  1N73 C;  3I5C A;  1SQX K;  3V2P A;  1NO4 A;  3V4Q A;  3MD0 A;  4B86 A;  1N7S B;  2I1K A;  2FKW B;  3HE4 A;  2YKO A;  2WSC H;  1HUC A;  1PFI A;  1FZA A;  3HE5 B;  3BAS A;  3EQ2 A;  4I2L C;  1L4A D;  3RL0 B;  2Q9I A;  2KB7 P;  3RK2 D;  2HPC B;  3M9B A;  2J59 M;  4LGD E;  5AVS B;  4DOJ A;  1HH0 A;  1MV8 A;  1KZU B;  2E43 A;  3B5N B;  2R32 A;  4O9B A;  4LLH A;  3HUS A;  1N2D C;  2WWW A;  3BRV B;  2NPS D;  2CPB A;  2R5B A;  4HYT B;  3A3Y B;  3CL3 D;  1JCC A;  1GW4 A;  1CZQ A;  3VMY A;  2XZR A;  3MIW A;  1ZR2 A;  3CI9 A;  2Z5I A;  1NTM K;  1MUU A;  5CHX A;  1ZLL A;  2WT7 A;  1RF0 A;  1M1J B;  1KQL A;  1KIL B;  5CJ4 A;  1J1D B;  1OWA A;  1LT9 C;  4WY4 C;  3II6 A;  2OAR A;  2C9L Y;  3T97 A;  1JTH B;  4EOT A;  1AQ5 A;  1G1I A;  2HOD A;  3L36 A;  1N86 A;  2Q3I A;  2OYH A;  3M06 A;  5CCH C;  3M0D C;  2P67 A;  1SQV K;  2OYI A;  1N73 B;  2IX7 C;  2O1K A;  1DX7 A;  1AFO A;  1H88 A;  3PP5 A;  2KSJ A;  1N7L A;  1SFC A;  2H8P D;  2HYN A;  1FJP A;  3N7N A;  2WIT A;  1VDF A;  3GHG A;  1RE3 A;  1URQ D;  1QL2 A;  1Z56 A;  3WMM 0;  3M0A A;  4LC1 A;  1LTB C;  5CJ0 A;  3M91 A;  1GL2 C;  2XU6 A;  1N7S A;  1YTZ I;  1LWU C;  1URQ B;  3VMX A;  3O8Z A;  2GUV A;  4I1L A;  3TK1 A;  1JUN A;  3HE5 A;  5AVZ B;  1NTZ K;  3SWF A;  1FBM A;  1RE4 A;  2A45 H;  2HPC A;  1IFD A;  2N1T C;  3CLQ A;  3B5N A;  5CCG C;  1IFM A;  1CI6 A;  1NU1 K;  3KYQ A;  1LTS C;  5AW5 B;  1SFC D;  3OA7 A;  5CMZ A;  5APY A;  3E1I A;  1JO5 A;  1E5W A;  4HH2 A;  3V2R A;  2BAS A;  1LTT C;  3TNU B;  3NTN A;  1LT9 B;  4WY4 B;  1LTA C;  2ZFC A;  4DZO A;  1J2J B;  2O01 H;  2R5D A;  1T2K D;  1N7S D;  1M1J A;  3UIA A;  1KIL A;  2KOG A;  3U59 A;  1H89 A;  1M7L A;  5APX A;  5KJ7 A;  1HGV A;  1LTJ C;  1XTC C;  5AVT B;  3M9H A;  1JTH A;  1W2E A;  1FU1 A;  3RL0 D;  2WPR A;  3MUD A;  5AVQ B;  1FOS E;  4IFF A;  3B5N D;  1ZN5 A;  3P8C D;  1N73 A;  2POH A;  1A02 J;  4C7N B;  3KDP B;  3KQG A;  1OXZ A;  2M3B A;  2C0W A;  1JY2 N;  1HGZ A;  1JMM A;  1NTK K;  2IPP A;  2IFM A;  1HBW A;  3EFG A;  1JNM A;  5AW3 B;  1LWU B;  3VOP A;  1RF1 B;  3VN0 A;  5AW2 B;  3HUS C;  3V4W A;  2YO2 A;  3V2N A;  3V2Q A;  4GKG A;  2XV5 A;  1NWQ A;  1T3J A;  5AW9 B;  1KIL D;  3U1A A;  4AYC A;  1ZR4 A;  2FXM A;  1URQ A;  3HD7 C;  4WB4 A;  5KJ7 D;  4N78 E;  5AW6 B;  2N1T B;  1SP4 A;  1T8Z A;  2P7J A;  1JY3 N;  1JOC A;  4C7R A;  3HTK A;  5BU8 B;  2KLV A;  1FAV A;  2IFN A;  2CPS A;  1L0N K;  4JF7 A;  5AVY B;  3BRT B;  4IFM A;  1EQ7 A;  1JCD A;  1FZC C;  5KTB A;  1GW3 A;  2OYI C;  1T3U A;  1SVF A;  3P8M C;  2WPQ A;  5AW4 B;  1FZB A;  4JYB A;  2JJL A;  3R2P A;  1NHL A;  3H32 B;  3TNU A;  1WRG A;  1GK4 A;  1LTJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...