5APWA

Sequence matkdd inserted between gcn4 adaptors - structure t6
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
67
structure length
67
Chain Sequence
GHMKQLEDKVEELLSKVYHLENEVARLKKLMATKDDMKQLEDKVEELLSKVYHLENEVARLKKLVGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title alpha / beta coiled coils.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords GENERAL CONTROL PROTEIN GCN4
total genus 30
structure length 67
sequence length 67
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5apwA00
3HE4A 1KQLA 1J2JB 3P32A 5AW2B 2WPSA 5APQA 5AVRB 2C9LY 1A02F 3V4QA 1FOSF 2C9NY 1SLQA 1GK4A 1X8YA 3TK1A 2XZRA 2BASA 2Q5UA 1MV8A 4DZOA 1T2KC 1OXZA 5AVVB 3NXSA 4I2LC 2WT7A 5AW0B 4C7NA 2R3CA 5AVQB 1CI6B 3M9HA 3A3YB 2YO2A 2IPPA 5APXA 2YNYA 2KP8A 3L36A 4C46A 2QM8A 2WTYA 1GU4A 1FOSE 2E42A 1G2CB 3NFQA 3TNUB 1OWAA 1H88A 2ZFCA 4GKGA 1GK6A 3HE4B 3LIDA 3VYIA 1H89A 4I6MC 1CI6A 5APVA 3A5TA 4C7NB 1CSBA 3T97A 3OAKA 3O8ZA 5AW5B 3P8MC 3V5BA 3V4WA 3SWFA 1GTWA 5CMZA 2P67A 1T2KD 2E43A 1S9KD 3HE5B 2P7JA 3TYYA 1A02J 5AVSB 3VMZA 5AVWB 2WPQA 2YO3A 3M06A 3L35A 4GT1A 5AW8B 1HUCA 1JNMA 1YYCA 3HE5A 2R5BA 5AVXB 3NMDA 4EOTA 1HJBA 2JJLA 4M3LA 4JYBA 1GU5A 3A2AA 2P2UA 3M0AA 2WWWA 5AW6B 1S9KE 3MD0A 1SP4A 1NAFA 2N9BA 5AW7B 4B86A 2R5DA 3L37A 3LIEA 5APTA 2R32A 2Q3IA 2Z5IA 3UIAA 3I5CA 1FAVA 4HYTB 3MGNA 4JYCA 3NTNA 3M91A 1GZLA 3B8EB 3M0DA 3VN0A 3VMYA 5APWA 1HBWA 3P7KA 1IO4A 3KQGA 3VTPC 1NWQA 5APYA 4AYCA 2WT7B 1GD2E 5APSA 5AW4B 2W6AA 1MUUA 5AVYB 2WPRA 3KDPB 1JUNA 5AVTB 5AW9B 2W27A 4LC1A 4AQRD 2XU6A 4RESB 1MFZA 3HTKA 3VMXA 5AW1B 3TNUA 1CZQA 3A7OA 5AVZB 5APUA 4AUWA 2H7HA 1HWTC 4XE5B 5AVUB 2VRSA 2QM7A 3IR9A 3M9BA 5AW3B 4KHXA 1H8AA 2ZXEB 2Q7CA 1DH3A 2XV5A 2Z5HA
chains in the Genus database with same CATH superfamily
2QG4A 1L0NG 3BCCD 1JM0A 1K8AQ 3VOPA 1LTJC 1NH4A 1BCCG 1URQB 5CCGA 1N7LA 5AW2B 3CCJP 5APQA 1NVOA 2FXOA 2KSJA 3AE1C 1BCCJ 1FDOA 3F89A 3PRJA 4L76A 4N6JA 1FZBA 2QA4P 1L0NK 2C9NY 3AE5C 1JY2N 1GK4A 3BATA 1HGVA 2V4HA 4U7JA 3FWNA 3TK1A 2E5TA 3L70J 4HJGH 1PFIA 2BASA 2M3EA 3TGUG 2Q5UA 1HTLC 1IFPA 1GW3A 2Q6QA 2XKMA 1VQLP 3CC7P 4I2LC 3AE7C 1HWTC 2ZT9D 5AW0B 1M1JB 1SQVE 2I1KA 1FJPA 2OYIC 1CI6B 5CCGD 1ZLLA 2K88A 1KFNA 2BCCG 3A3YB 3BRVB 1M8OB 2IPPA 3KZIH 1M7LA 1NTKG 2KP8A 1KD1Q 4MN4C 3RL0D 3PHLA 3OW2O 1JO5A 1FZCA 2Q9IA 2I1JA 1PPJD 1SQPJ 1AFOA 5H2FE 5BU5A 4GKGA 1QEXA 1NTKK 3VYIA 1OVVA 1VQ6P 4I6MC 2BCCJ 3KYQA 1JNMA 1EDIA 1P84D 3GW6A 4HH2A 4W7ZA 2BCCE 4N3YB 4C7NB 4WY4B 5TISH 2DW3A 2M0BA 2RMZA 1BGYJ 2WSFJ 4IFDK 3V4WA 2GM4A 2E76B 3L4FA 2FYUD 1GTWA 1AV1A 2KUBA 2OQQA 4BXLA 1DD4A 4RJTA 4BWNA 2ZYAA 1AJYA 3L71G 3D6YA 1A02J 1RF1B 1J1EB 4GODA 3L72E 1DEBA 1PP9G 3L73E 1RE3A 2FFDA 1VQ8P 2YO3A 1FZAA 1KC8Q 3EWKA 1HVVA 3L35A 3RGUA 2LKMA 1IFDA 1LTIC 1M57D 1PP9J 2A06G 2H89C 3A0BE 3HE5A 2R5BA 4GT1A 4JBZA 1BGYD 4JQ0D 3C8VA 2KNCB 5AVXB 1BDCA 3H1KG 1M1JA 2KK7A 2YKPA 4M3LA 1IJDB 2W8ZA 3L72G 1VF5C 4H13B 3WUUA 1JOCA 1FE6A 2P2UA 5AW6B 2P10A 1EC5A 3CCLP 1S9KE 1VDFA 4NPFX 2KYVA 2R3SA 3AEBC 1GL2C 3CCUP 1SP4A 5AW7B 1PL5A 4IL6E 4B86A 2R5DA 3H1KJ 2AXTH 2B88A 1IFNA 4H44C 4K35A 1L0LD 2PGDA 4PD4D 1FBMA 2ZYGA 3LW5H 4PJ0E 4WB4A 2B9BA 1LT1A 1EQ7A 1VQ4P 4U3FE 2FYNC 2KLUA 2JP3A 2OTKE 2NZ2A 1LTGC 3W68A 4EDFA 1LWUC 1IK7A 4H13C 1ZW0A 1GZLA 1RF1A 3MIWA 1SVFA 1SQVK 3M0DA 5CHXA 2IYPA 3AE4C 3VMYA 3VN0A 1EDJA 2HLOA 2A45H 3I55P 1Z56A 5GTIH 4DOJA 2R44A 4RKUJ 3A0HH 5APSA 1J1EC 3CCEP 2RH0A 1DX7A 3TF5A 3CWBG 1MUUA 4IOIH 1X22A 4RO0A 4U3FG 3Q5PA 2BEZF 3KDPB 3SWYA 3KXDA 1R8EA 1LT9A 4GIFA 5AVTB 5AW9B 3S1KA 1SQVD 4LC1A 4AQRD 2NPSB 2MKVA 2YXQB 2UWJE 4RESB 4YXWH 1WT6A 2FYNB 1S4XA 4R4MA 1LTBC 4UB6E 1NTMD 2FFDB 1PZQA 4BRYA 3B5NA 1LTSC 2J5UA 3OJAB 4IL6H 1PGPA 4KT0J 4OGQC 2YIUB 4U3FJ 1L0NJ 4UB8H 4C7RA 2AXCA 3L71J 1KB9D 2N1TA 2VRSA 2IBZD 4WY4C 4XE5B 3G3ZA 1Y8AA 2D2CC 5TJHA 2OYHC 1NJIQ 4KHXA 3HD7B 2W83C 1H8AA 5KAIE 1VQOP 3RK3D 2Q7CA 1DH3A 1SQPE 1NKNA 1IFJA 4WY4A 1SFCC 1YI2P 3L70G 3HUSA 5L8RJ 1ZRTD 4OGQD 4W7YA 1YJ9P 1FZGA 2N1TB 1NU1K 1SQXK 3V2RA 2IZ0A 2Q3EA 1LWUB 3L72D 2LXCB 3MUDC 4NPDA 2C9LY 5DJTB 2QJKC 3CI9A 1L4AA 1NTKJ 3RL0g 2KLVA 2NPSA 1FOSF 3L70E 1EZVE 1PPJE 2XZRA 4CPGA 1OX3A 3FXDA 1MV8A 2B87A 2L5GB 3RBXA 4DZOA 1T2KC 1FJKA 1BCCE 2A45G 1JCCA 2JWAA 2M3BA 2XDJA 3NXSA 4YTPC 1IK9A 2BCCD 1FZFA 1GL2B 1Y47A 2K9JB 2M5AA 2ZT9B 3AECC 3CLQA 3L74D 5E79H 2YNYA 3H1IG 2K37A 2WTYA 1VPCA 1JB0J 1PV3A 3NFQA 1S72P 2YIUC 3B5ND 1OWAA 3CMAP 1H88A 4U3FD 1S5LX 2FYUK 3HTKB 1BE3D 3G4SP 3RK2B 3CWBJ 2IBZI 3WU2H 1VQ9P 1G1JA 3EQ2A 3A0BH 1SQVG 2IFMA 3L74E 3RK3C 3CX5I 4L73A 3G6EP 1IC2A 2ZJSE 2K9JA 2M5AB 3SWFA 1G1IA 1IFIA 1VQMP 1SQBD 2E43A 1Q7YQ 5B5EH 1EXJA 2B87B 3TYYA 1SFCB 3L74G 5KLVJ 1T6AA 1JMBA 1BSHA 3O6QB 4GOFA 1YQ4C 3CCRP 1Q86Q 1L4AB 2QRXA 3M06A 1USDA 3Q1MA 4JF7A 5AW8B 1HUCA 3RK3B 3I56P 1SQBE 3RL0C 4XFJA 2PP6A 4JPZB 1OVUA 1KFMA 2WSFH 2HPCB 1SQXJ 1LTAC 4JYBA 2GUSA 4OGQB 1NTZE 3H25A 3HUSB 2ZT9C 2WWWA 3ZDMA 2Y9YA 1N7SC 1PP9E 3M0DC 4UB6H 5CBOA 2MJZA 1JY2P 3MD0A 1SS1A 3HRNA 3AEGC 1J1DC 1NAFA 1S5LE 3AEDC 2A06E 3L75E 3B71A 4LGDE 1SQBG 3L37A 3LIEA 3RBZA 3QH9A 1OW6A 1S5LH 2HYNA 1VF5D 1Q2NA 2N1TC 2R32A 2Q3IA 2Z5IA 3BCCE 2PFXA 1NTZG 1YHQP 2ZVNB 1OMIA 3ITKA 1MKMA 1DEEG 4HYTB 5GTIE 2L91A 3B5NB 2Z4EA 4AUWA 1VQ5P 1OW8A 1N86A 3H1ID 4OWFA 5K5GB 3L75G 3NTNA 3PH0A 2K9YA 1BGYG 1N7SD 3V6IA 3GMAA 1FDMA 3B8EB 1KILC 1NTZJ 3KZIE 2HFED 3CWBD 3KQGA 3VTPC 5CBNA 2E76D 5APYA 3D6ZA 1LTTC 1WRGA 2E76C 2PAJA 3AEFC 3CXHE 1L0LE 4H0LD 4PD4E 2AXTE 4GOEA 2WPRA 1L4AC 4WWIA 3U59A 1E5WA 1QVFO 3H1HJ 1BGYE 2W27A 4QMAA 1LWUA 2XU6A 4Y99B 5CCHC 2O3JA 5CCHD 1K9MQ 2WSCH 4D6TJ 2I8DA 2NRGA 1CZQA 1RE4A 2GA1A 2LR2A 3CXHH 2ZYDA 1PGJA 1URQA 3GHGA 3H1JJ 5AVZB 2J59M 5KLVK 3PLNA 1KB9I 2QJPB 1SFCD 4H0LB 1L0LG 2H88C 1SQBJ 3M9BA 5AVUB 5TISE 1N73A 1AVOA 1NTKD 1RQVA 1KQGB 1Y9BA 3SSUA 1WMKA 1KQFB 4DJGA 1XTGB 2OYHA 2FKWB 4XA4A 1L0LK 2ITAA 1RF1C 2Z5HA 3OA7A 3GHGC 5KKZB 3K5BA 2WPVB 3B5NC 1SQQK 3H1JD 2H7HA 4H44B 1KQLA 2KNCA 3GF7A 1RHZB 2FY8A 3MZWB 1NYHA 1T8ZA 3L73D 1GMJA 4IFFA 5GTHH 2WPSA 1VQNP 1PGOA 4DT0A 3V4QA 2AEJA 1A02F 4D6TD 2OTLP 1H0TB 3L74J 1FDIA 1SLQA 1IZNB 3Q2YA 1VF5B 4N78D 3JCUE 3L71D 1X79B 1LP1B 1X9VA 3CCQP 1SQPD 1JY3P 4IL6X 1SQQG 3HUSC 1NU1J 1OXZA 2K1AA 3GF3A 5AVVB 3WUVA 2WT7A 4EIJA 1MFTA 5KKZC 1KYOI 2NPSC 1U7JA 2R3CA 1RY3A 3M9HA 3WU2E 2FBWC 3WMM0 4ZKPA 1GU4A 3L36A 2LXBA 2C0XA 1ZMEC 2Y0CA 2QE7H 1EZVG 1PPJG 1G2CB 2E75C 1S1CX 3TNUB 1GDTA 3PTZA 3AEAC 1EDLA 2QEXP 2ZFCA 1RE4C 3L70D 1ZR4A 2ZAEB 1GK6A 1Q90D 3HE4B 1R5SA 3LIDA 1H89A 2HODB 1L2PA 3AE8C 2CPBA 3AE3C 1GL2A 1P84I 1ZOYC 2O01J 1BCCD 3GLMA 2V7QJ 3H1IE 5KJ7D 3V2QA 3C9IA 1NHLA 3O8ZA 3V5BA 2YXRB 3HD7D 2QSIA 3HD7C 4Y28J 3R4YA 3G9RA 1BE3J 1RF0A 4NPEA 5CMZA 1HJ0A 5KLIB 3Q3DA 1T2KD 2KZIA 2JWDA 1SQXD 5KAFE 3SWKA 3CMEP 1L0LJ 1ZP0C 3HE5B 1QLED 3H1LJ 5AVSB 1KORA 3E7KA 1JCDA 1OIPA 3KHUA 2WPQA 3U1CA 2FFDC 2A06D 1HH0A 5CCHA 3KPEA 1NTME 5DJUB 1NTMJ 1YYCA 4PV1B 3WUTA 3NMDA 2IFNA 1YJNP 3H1LG 1KB9E 3N4XA 2JJLA 2KZJA 1JY3O 4GDOA 4ZMDA 5KAIH 2YMYA 2NPSD 3CD6P 5KLVD 3M0AA 1HGZA 1VQ7P 2RN0A 5KTBA 1DD3A 1VQKP 3USSA 2M8RA 2C0WA 2WMMA 1NTMG 1GL2D 2SPZA 1VL2A 3FXEA 1N7SA 3QWOC 4ASWA 3IAOA 2HPCA 1AQTA 1NAYA 2G8YA 1KILD 1R5LA 3CXHI 4PD4I 2CPSA 3P8CE 3AE9C 2IBZG 3RK2C 3TGUJ 4BRYB 1H0TA 5B66H 1YJWP 3UIAA 3VP8A 1URQC 1FAVA 2JEEA 3MGNA 2H43A 1YBKA 1SQQD 2FXPA 2KSEA 1NU1D 1LT9B 3O6QA 2WSCJ 3H1HG 3R2PA 1JTHA 2OTJP 1P84E 3IN6A 3M91A 4HKZH 5CJ0A 2N1TD 3GG2A 1N7SB 3VP9A 1KYOD 2HG5D 5APWA 4I7ZC 1HBWA 1Q82Q 1L0ND 3BCCG 2A45I 3E1IA 4ZKUA 1NWQA 1IO4A 4AYCA 2OYHB 4HB1A 1P84H 5AW4B 1SQQJ 3AEEC 3S4RA 2W6AA 2D2CD 2E5YA 3SFDC 5AVYB 1PGQA 3H1HE 1N73B 1W2EA 4LLHA 3C1LA 4PJ0H 1ZR2A 1KYOE 3PJSK 4H13D 4L75A 3L72J 4L74A 2XNXA 3GHGB 3U1AA 1MFZA 3HTKA 1BSNA 3VMXA 3TGUD 1NTZD 5AW1B 1AVYA 2YKQA 1AQ5A 1OZHA 4PV1D 1K73Q 5EFWB 1FZCC 3CCSP 2WITA 3H1IJ 1DIPA 2J58A 2P58A 4TT3H 2QVAA 1FZEA 5AW3B 4A7PA 1U57A 3FX0A 1S3JA 1T3UA 3CCMP 1KMIZ 1HF9A 3II6A 2IZ1A 4D6TE 2ZXEB 1NTMK 2POHA 5GTHE 2Y0DA 2XV5A 3H6PA 2W90A 1ZXGA 3EFFK 2JR8A 4Y99C 5E79E 3AE6C 1UIXA 3HE4A 1SQBK 1W2BO 2FYUE 3H1LD 1AA0A 1J2JB 3P32A 2WQYC 4D6TG 1RQUA 5AVRB 5C39A 1Q81Q 1G2CA 1SQVJ 1LT9C 3MUDA 3N7NA 1RE3C 4UB8E 5KAFH 2OYIA 3CX5E 1KQSO 1BDDA 1NTKE 1X8YA 3EFGA 2ZVOB 1KYOH 1KILB 1PIXA 2IX7C 3CX5H 3RL0B 3MHVA 2AEFA 2FYUG 1NU1G 1JY3N 2ZXXA 1JEKA 3H32A 3HD7A 2WVRA 4C7NA 5M1BA 5AVQB 1EXIA 3BVHA 2GUVA 1EZVD 2YO2A 3T97B 4R4LA 1IFMA 1UIIA 5APXA 4C46A 2QM8A 1FOSE 4PD4H 1U7MA 5CCGC 1JTHB 2E42A 2FXMA 2K3RA 4I1LA 1URQD 3CC2P 3H1JG 4WBAA 1X0TA 2JKVA 2QJPC 3PP5A 1SQQE 2PRRA 2KXPB 1NU1E 3RK2D 2HR3A 2D2CB 4ZNCA 1FU1A 4N78E 1EZVI 4H0LC 3L71E 1QL1A 3TSIA 3VMAA 2B89A 2OYOA 2O01H 1CI6A 5APVA 3A5TA 2OYIB 3FWLA 5B66E 1CSBA 2KOGA 1YTZI 2IYOA 2JO1A 2KI7B 2P1JA 3L73G 2QJYC 3OAKA 5AW5B 3P8MC 3T97A 1YIJP 3RK3E 3H1JE 3D71A 2P67A 4I7ZB 2O1JA 1OW7A 1QX8A 3JSVC 4TLFA 5KLVE 1S9KD 3H1KE 1ZRTE 2P7JA 3BRTB 2WSEJ 5KJ7C 1KILA 1YQ3C 3VMZA 4WVZA 2RKLA 3L73J 5AVWB 4YXDC 5BVZA 1KB9H 2E74C 2E74D 2XNDH 3A0HE 1GW4A 1XTCC 2G3AA 1JY2O 1PP9D 2E75D 1ZN5A 1CW5A 4O9BA 2N9YB 1QL2A 5KJ7A 1LNQA 4EOTA 3S9OA 2V7QH 3IFMA 5KLVG 1HJBA 4W80A 1K05A 2OGUA 4K3AA 1NGMB 3CC4P 3D70A 1GU5A 1L4AD 2YKOA 3A2AA 1N2DC 1OVRA 2O01N 1BE3G 3V2PA 3TNUA 4KJMA 3E1RA 2W6JH 3M9QA 1EDKA 1FS0E 1MZ9A 2N9BA 3TDKA 4Z1MH 1VQPP 1KTMA 1SQXG 1M90Q 2FYUJ 5APTA 4IFMA 1D7MA 2KIKA 3H1LE 2AEMA 2HODA 1RH5B 3SFEC 1ZV8A 1LTJB 1S2EA 3JCUH 4PV1C 3I5CA 2JDIH 3LW5J 3CPWO 3Q5SA 1BE3E 3CWBE 1QVGO 1N8RQ 1KV4A 3CX5D 4JYCA 2CK3H 2KS1B 2FYZA 2O1KA 1JMMA 3CXHD 1YITP 1LGHB 3H32B 3G71P 1SQXE 2QJKB 3W67A 4H44D 1E79H 2Q1KA 2IBZE 3P7KA 1T3JA 2H8PD 1NTZK 1W5CE 3ABVC 2IDBA 4EYYQ 2WT7B 1GD2E 5BU8B 1RF0C 1K04A 1KILE 1SQPK 1YTZT 2Y0EA 3P8CD 1LP1A 5KLIC 1JUNA 3V2NA 2KS1A 2WSEH 2OARA 4WY4D 5B5EE 3MTUE 2BEQD 2Y9ZA 3AE2C 4OH8B 1TU3F 3CCVP 3B4SA 3CL3D 1USEA 1LTJA 1SQPG 4DCKA 2E74B 2YMKA 3BASA 3A7OA 1FZCB 2KB7P 5APUA 3FGAD 1LJ2A 2E75B 4ASVA 1SFCA 1QGKB 1NO4A 1L0NE 2QM7A 1KZUB 3IR9A 5CJ4A 2QJYB 2WSSH 3BCCJ 1NOHA 1M56D 1J1DB 2W6BA 5H2FH 1KN7A 1OFCX 1M1KQ 1NKZB 3Q5RA 3MP7B 2WZ7A 3H1HD 3L75J 2QIWA 3L75D 3F5HA 1N73C 3H1KD 3JC22 1FC2C 3IF4A 4EI2A 4YPCA 4OVNF 1M1JC 3TGUE
chains in the Genus database with same CATH topology
3VOPA 1LTJC 1NH4A 1URQB 5CCGA 1N7LA 5AW2B 5APQA 2KSJA 4N6JA 1FZBA 2C9NY 1L0NK 1JY2N 1GK4A 3BATA 1HGVA 3TK1A 2BASA 2Q5UA 1HTLC 1GW3A 2XKMA 4I2LC 5AW0B 1M1JB 2I1KA 1FJPA 2OYIC 1CI6B 1ZLLA 3A3YB 1KFNA 3BRVB 3V2PA 2IPPA 1M7LA 2KP8A 3RL0D 1JO5A 1FZCA 2Q9IA 2I1JA 1AFOA 5BU5A 4GKGA 1NTKK 3VYIA 4I6MC 3KYQA 3BVHA 4HH2A 4W7ZA 4C7NB 4N3YB 4WY4B 4IFDK 3V4WA 2GM4A 3L4FA 1GTWA 1A02J 1RF1B 1J1EB 1DEBA 1RE3A 2FFDA 2YO3A 1FZAA 1HVVA 3L35A 2LKMA 1IFDA 1LTIC 4GT1A 5CCGD 1JNMA 3HE5A 2R5BA 5AVXB 1M1JA 2YKPA 4M3LA 1IJDB 4ZKPA 1JOCA 5AW6B 2P2UA 1S9KE 1VDFA 2KYVA 1GL2C 1SP4A 5AW7B 4B86A 2R5DA 1IFNA 1FBMA 3LW5H 4WB4A 1EQ7A 1LTGC 1LWUC 1GZLA 3MIWA 1SVFA 1SQVK 3M0DA 5CHXA 3VMYA 3VN0A 2HLOA 2A45H 1Z56A 4DOJA 5APSA 1DX7A 1J1EC 1MUUA 3KDPB 3SWYA 1LT9A 4GIFA 5AVTB 5AW9B 4LC1A 4AQRD 2NPSB 4RESB 1WT6A 1LTBC 2FFDB 3B5NA 1LTSC 3OJAB 4C7RA 2H7HA 1HWTC 4XE5B 1RF1A 2N1TA 2VRSA 4WY4C 3G3ZA 2OYHC 4KHXA 3HD7B 1H8AA 3RK3D 2Q7CA 1DH3A 1NKNA 1IFJA 4WY4A 1SFCC 3HUSA 4W7YA 1FZGA 2N1TB 1NU1K 1SQXK 3V2RA 1LWUB 2C9LY 3CI9A 1L4AA 1FOSF 2KLVA 2NPSA 2XZRA 1MV8A 2L5GB 4DZOA 1T2KC 1FJKA 2A45G 1JCCA 2M3BA 2XDJA 3NXSA 1IK9A 1FZFA 1GL2B 3CLQA 2YNYA 2WTYA 1VPCA 3NFQA 3B5ND 1OWAA 1H88A 2FYUK 3HTKB 3RK2B 1G1JA 3EQ2A 2IFMA 3RK3C 1IC2A 3SWFA 1G1IA 1IFIA 2E43A 3TYYA 1SFCB 1L4AB 3M06A 4JF7A 5AW8B 1HUCA 3RK3B 3RL0C 2PP6A 1KFMA 2WSFH 2HPCB 1LTAC 4JYBA 2GUSA 3HUSB 2WWWA 3M0DC 1N7SC 2MJZA 1JY2P 3MD0A 3HRNA 4LGDE 1J1DC 1NAFA 3L37A 3LIEA 2HYNA 2N1TC 2R32A 2Q3IA 2Z5IA 4HYTB 2Z4EA 3B5NB 1N86A 3NTNA 1N7SD 1FDMA 3B8EB 1KILC 2HFED 3KQGA 3VTPC 5APYA 1LTTC 1WRGA 2PAJA 2WPRA 1L4AC 3U59A 1E5WA 2W27A 1LWUA 2XU6A 4Y99B 5CCHC 5CCHD 2WSCH 3TNUA 1CZQA 1RE4A 1URQA 3GHGA 5AVZB 4AUWA 2J59M 5KLVK 1SFCD 5AVUB 3M9BA 1N73A 1XTGB 2OYHA 2FKWB 4XA4A 1L0LK 1RF1C 2Z5HA 3OA7A 3GHGC 3B5NC 1SQQK 1KQLA 5CCHA 1T8ZA 4IFFA 2WPSA 1A02F 3V4QA 1SLQA 4N78D 1X79B 1X9VA 1JY3P 3HUSC 1OXZA 5AVVB 2WT7A 4EIJA 2R3CA 2NPSC 3M9HA 1RY3A 3WMM0 1GU4A 3L36A 2C0XA 1G2CB 3TNUB 1GDTA 2ZFCA 1RE4C 1ZR4A 1GK6A 3HE4B 3LIDA 1H89A 2HODB 2CPBA 5KJ7D 1GL2A 3V2QA 3C9IA 1NHLA 3O8ZA 3V5BA 3HD7D 3HD7C 1RF0A 5CMZA 1T2KD 3HE5B 5AVSB 1JCDA 2WPQA 3U1CA 2FFDC 1HH0A 3KPEA 1YYCA 3NMDA 2IFNA 3N4XA 2JJLA 1JY3O 2YMYA 2NPSD 3M0AA 1HGZA 5KTBA 2M8RA 2C0WA 1GL2D 1N7SA 2HPCA 1KILD 2CPSA 3P8CE 3RK2C 3UIAA 3VP8A 1URQC 1FAVA 2JEEA 3MGNA 2H43A 1PFIA 1LT9B 3R2PA 1JTHA 3M91A 5CJ0A 2N1TD 3VP9A 1N7SB 2HG5D 5APWA 1HBWA 3E1IA 1IO4A 2A45I 4ZKUA 1NWQA 4AYCA 2OYHB 5AW4B 2W6AA 5AVYB 1N73B 1W2EA 4LLHA 1ZR2A 2OYIB 3U1AA 2XNXA 3GHGB 1MFZA 3HTKA 3VMXA 5AW1B 2YKQA 1AQ5A 1FZCC 2WITA 2J58A 5AW3B 1FZEA 1T3UA 3II6A 2ZXEB 1NTMK 2POHA 2XV5A 3H6PA 4Y99C 3HE4A 1SQBK 1J2JB 3P32A 5AVRB 1G2CA 3MUDA 1LT9C 3N7NA 1RE3C 2OYIA 1X8YA 3EFGA 1KILB 2IX7C 3RL0B 1JY3N 3H32A 3HD7A 4C7NA 5AVQB 2GUVA 2YO2A 1IFMA 5APXA 4C46A 2QM8A 1FOSE 2E42A 5CCGC 1JTHB 2FXMA 4I1LA 1URQD 1FZCB 4WBAA 3PP5A 3RK2D 1FU1A 4N78E 1QL1A 3TSIA 2O01H 1CI6A 5APVA 3A5TA 1CSBA 2KOGA 1YTZI 2P1JA 3T97A 3OAKA 5AW5B 3P8MC 2P67A 2O1JA 1S9KD 2P7JA 3BRTB 5KJ7C 1KILA 3VMZA 5AVWB 5BVZA 1GW4A 1XTCC 1JY2O 1ZN5A 1CW5A 4O9BA 1QL2A 5KJ7A 4EOTA 3IFMA 1HJBA 4W80A 1GU5A 1L4AD 2YKOA 3A2AA 1N2DC 3M9QA 1MZ9A 2N9BA 5APTA 4IFMA 2HODA 1ZV8A 1LTJB 3I5CA 4JYCA 2FYZA 2O1KA 1JMMA 1LGHB 3H32B 3P7KA 1T3JA 2H8PD 1NTZK 2WT7B 1GD2E 5BU8B 1RF0C 1YTZT 1SQPK 3P8CD 1JUNA 3V2NA 2WSEH 2OARA 4WY4D 3MTUE 4OH8B 3CL3D 1LTJA 3BASA 3A7OA 2KB7P 5APUA 1SFCA 1NO4A 2QM7A 3IR9A 1KZUB 5CJ4A 1NOHA 1J1DB 2W6BA 1NKZB 2WZ7A 1N73C 1M1JC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HE4 A;  1KQL A;  1J2J B;  3P32 A;  5AW2 B;  2WPS A;  5APQ A;  5AVR B;  2C9L Y;  1A02 F;  3V4Q A;  1FOS F;  2C9N Y;  1SLQ A;  1GK4 A;  1X8Y A;  3TK1 A;  2XZR A;  2BAS A;  2Q5U A;  1MV8 A;  4DZO A;  1T2K C;  1OXZ A;  5AVV B;  3NXS A;  4I2L C;  2WT7 A;  5AW0 B;  4C7N A;  2R3C A;  5AVQ B;  1CI6 B;  3M9H A;  3A3Y B;  2YO2 A;  2IPP A;  5APX A;  2YNY A;  2KP8 A;  3L36 A;  4C46 A;  2QM8 A;  2WTY A;  1GU4 A;  1FOS E;  2E42 A;  1G2C B;  3NFQ A;  3TNU B;  1OWA A;  1H88 A;  2ZFC A;  4GKG A;  1GK6 A;  3HE4 B;  3LID A;  3VYI A;  1H89 A;  4I6M C;  1CI6 A;  5APV A;  3A5T A;  4C7N B;  1CSB A;  3T97 A;  3OAK A;  3O8Z A;  5AW5 B;  3P8M C;  3V5B A;  3V4W A;  3SWF A;  1GTW A;  5CMZ A;  2P67 A;  1T2K D;  2E43 A;  1S9K D;  3HE5 B;  2P7J A;  3TYY A;  1A02 J;  5AVS B;  3VMZ A;  5AVW B;  2WPQ A;  2YO3 A;  3M06 A;  3L35 A;  4GT1 A;  5AW8 B;  1HUC A;  1JNM A;  1YYC A;  3HE5 A;  2R5B A;  5AVX B;  3NMD A;  4EOT A;  1HJB A;  2JJL A;  4M3L A;  4JYB A;  1GU5 A;  3A2A A;  2P2U A;  3M0A A;  2WWW A;  5AW6 B;  1S9K E;  3MD0 A;  1SP4 A;  1NAF A;  2N9B A;  5AW7 B;  4B86 A;  2R5D A;  3L37 A;  3LIE A;  5APT A;  2R32 A;  2Q3I A;  2Z5I A;  3UIA A;  3I5C A;  1FAV A;  4HYT B;  3MGN A;  4JYC A;  3NTN A;  3M91 A;  1GZL A;  3B8E B;  3M0D A;  3VN0 A;  3VMY A;  5APW A;  1HBW A;  3P7K A;  1IO4 A;  3KQG A;  3VTP C;  1NWQ A;  5APY A;  4AYC A;  2WT7 B;  1GD2 E;  5APS A;  5AW4 B;  2W6A A;  1MUU A;  5AVY B;  2WPR A;  3KDP B;  1JUN A;  5AVT B;  5AW9 B;  2W27 A;  4LC1 A;  4AQR D;  2XU6 A;  4RES B;  1MFZ A;  3HTK A;  3VMX A;  5AW1 B;  3TNU A;  1CZQ A;  3A7O A;  5AVZ B;  5APU A;  4AUW A;  2H7H A;  1HWT C;  4XE5 B;  5AVU B;  2VRS A;  2QM7 A;  3IR9 A;  3M9B A;  5AW3 B;  4KHX A;  1H8A A;  2ZXE B;  2Q7C A;  1DH3 A;  2XV5 A;  2Z5H A; 
#chains in the Genus database with same CATH topology
 2QG4 A;  1L0N G;  3BCC D;  1JM0 A;  1K8A Q;  3VOP A;  1LTJ C;  1NH4 A;  1BCC G;  1URQ B;  5CCG A;  1N7L A;  5AW2 B;  3CCJ P;  5APQ A;  1NVO A;  2FXO A;  2KSJ A;  3AE1 C;  1BCC J;  1FDO A;  3F89 A;  3PRJ A;  4L76 A;  4N6J A;  1FZB A;  2QA4 P;  1L0N K;  2C9N Y;  3AE5 C;  1JY2 N;  1GK4 A;  3BAT A;  1HGV A;  2V4H A;  4U7J A;  3FWN A;  3TK1 A;  2E5T A;  3L70 J;  4HJG H;  1PFI A;  2BAS A;  2M3E A;  3TGU G;  2Q5U A;  1HTL C;  1IFP A;  1GW3 A;  2Q6Q A;  2XKM A;  1VQL P;  3CC7 P;  4I2L C;  3AE7 C;  1HWT C;  2ZT9 D;  5AW0 B;  1M1J B;  1SQV E;  2I1K A;  1FJP A;  2OYI C;  1CI6 B;  5CCG D;  1ZLL A;  2K88 A;  1KFN A;  2BCC G;  3A3Y B;  3BRV B;  1M8O B;  2IPP A;  3KZI H;  1M7L A;  1NTK G;  2KP8 A;  1KD1 Q;  4MN4 C;  3RL0 D;  3PHL A;  3OW2 O;  1JO5 A;  1FZC A;  2Q9I A;  2I1J A;  1PPJ D;  1SQP J;  1AFO A;  5H2F E;  5BU5 A;  4GKG A;  1QEX A;  1NTK K;  3VYI A;  1OVV A;  1VQ6 P;  4I6M C;  2BCC J;  3KYQ A;  1JNM A;  1EDI A;  1P84 D;  3GW6 A;  4HH2 A;  4W7Z A;  2BCC E;  4N3Y B;  4C7N B;  4WY4 B;  5TIS H;  2DW3 A;  2M0B A;  2RMZ A;  1BGY J;  2WSF J;  4IFD K;  3V4W A;  2GM4 A;  2E76 B;  3L4F A;  2FYU D;  1GTW A;  1AV1 A;  2KUB A;  2OQQ A;  4BXL A;  1DD4 A;  4RJT A;  4BWN A;  2ZYA A;  1AJY A;  3L71 G;  3D6Y A;  1A02 J;  1RF1 B;  1J1E B;  4GOD A;  3L72 E;  1DEB A;  1PP9 G;  3L73 E;  1RE3 A;  2FFD A;  1VQ8 P;  2YO3 A;  1FZA A;  1KC8 Q;  3EWK A;  1HVV A;  3L35 A;  3RGU A;  2LKM A;  1IFD A;  1LTI C;  1M57 D;  1PP9 J;  2A06 G;  2H89 C;  3A0B E;  3HE5 A;  2R5B A;  4GT1 A;  4JBZ A;  1BGY D;  4JQ0 D;  3C8V A;  2KNC B;  5AVX B;  1BDC A;  3H1K G;  1M1J A;  2KK7 A;  2YKP A;  4M3L A;  1IJD B;  2W8Z A;  3L72 G;  1VF5 C;  4H13 B;  3WUU A;  1JOC A;  1FE6 A;  2P2U A;  5AW6 B;  2P10 A;  1EC5 A;  3CCL P;  1S9K E;  1VDF A;  4NPF X;  2KYV A;  2R3S A;  3AEB C;  1GL2 C;  3CCU P;  1SP4 A;  5AW7 B;  1PL5 A;  4IL6 E;  4B86 A;  2R5D A;  3H1K J;  2AXT H;  2B88 A;  1IFN A;  4H44 C;  4K35 A;  1L0L D;  2PGD A;  4PD4 D;  1FBM A;  2ZYG A;  3LW5 H;  4PJ0 E;  4WB4 A;  2B9B A;  1LT1 A;  1EQ7 A;  1VQ4 P;  4U3F E;  2FYN C;  2KLU A;  2JP3 A;  2OTK E;  2NZ2 A;  1LTG C;  3W68 A;  4EDF A;  1LWU C;  1IK7 A;  4H13 C;  1ZW0 A;  1GZL A;  1RF1 A;  3MIW A;  1SVF A;  1SQV K;  3M0D A;  5CHX A;  2IYP A;  3AE4 C;  3VMY A;  3VN0 A;  1EDJ A;  2HLO A;  2A45 H;  3I55 P;  1Z56 A;  5GTI H;  4DOJ A;  2R44 A;  4RKU J;  3A0H H;  5APS A;  1J1E C;  3CCE P;  2RH0 A;  1DX7 A;  3TF5 A;  3CWB G;  1MUU A;  4IOI H;  1X22 A;  4RO0 A;  4U3F G;  3Q5P A;  2BEZ F;  3KDP B;  3SWY A;  3KXD A;  1R8E A;  1LT9 A;  4GIF A;  5AVT B;  5AW9 B;  3S1K A;  1SQV D;  4LC1 A;  4AQR D;  2NPS B;  2MKV A;  2YXQ B;  2UWJ E;  4RES B;  4YXW H;  1WT6 A;  2FYN B;  1S4X A;  4R4M A;  1LTB C;  4UB6 E;  1NTM D;  2FFD B;  1PZQ A;  4BRY A;  3B5N A;  1LTS C;  2J5U A;  3OJA B;  4IL6 H;  1PGP A;  4KT0 J;  4OGQ C;  2YIU B;  4U3F J;  1L0N J;  4UB8 H;  4C7R A;  2AXC A;  3L71 J;  1KB9 D;  2N1T A;  2VRS A;  2IBZ D;  4WY4 C;  4XE5 B;  3G3Z A;  1Y8A A;  2D2C C;  5TJH A;  2OYH C;  1NJI Q;  4KHX A;  3HD7 B;  2W83 C;  1H8A A;  5KAI E;  1VQO P;  3RK3 D;  2Q7C A;  1DH3 A;  1SQP E;  1NKN A;  1IFJ A;  4WY4 A;  1SFC C;  1YI2 P;  3L70 G;  3HUS A;  5L8R J;  1ZRT D;  4OGQ D;  4W7Y A;  1YJ9 P;  1FZG A;  2N1T B;  1NU1 K;  1SQX K;  3V2R A;  2IZ0 A;  2Q3E A;  1LWU B;  3L72 D;  2LXC B;  3MUD C;  4NPD A;  2C9L Y;  5DJT B;  2QJK C;  3CI9 A;  1L4A A;  1NTK J;  3RL0 g;  2KLV A;  2NPS A;  1FOS F;  3L70 E;  1EZV E;  1PPJ E;  2XZR A;  4CPG A;  1OX3 A;  3FXD A;  1MV8 A;  2B87 A;  2L5G B;  3RBX A;  4DZO A;  1T2K C;  1FJK A;  1BCC E;  2A45 G;  1JCC A;  2JWA A;  2M3B A;  2XDJ A;  3NXS A;  4YTP C;  1IK9 A;  2BCC D;  1FZF A;  1GL2 B;  1Y47 A;  2K9J B;  2M5A A;  2ZT9 B;  3AEC C;  3CLQ A;  3L74 D;  5E79 H;  2YNY A;  3H1I G;  2K37 A;  2WTY A;  1VPC A;  1JB0 J;  1PV3 A;  3NFQ A;  1S72 P;  2YIU C;  3B5N D;  1OWA A;  3CMA P;  1H88 A;  4U3F D;  1S5L X;  2FYU K;  3HTK B;  1BE3 D;  3G4S P;  3RK2 B;  3CWB J;  2IBZ I;  3WU2 H;  1VQ9 P;  1G1J A;  3EQ2 A;  3A0B H;  1SQV G;  2IFM A;  3L74 E;  3RK3 C;  3CX5 I;  4L73 A;  3G6E P;  1IC2 A;  2ZJS E;  2K9J A;  2M5A B;  3SWF A;  1G1I A;  1IFI A;  1VQM P;  1SQB D;  2E43 A;  1Q7Y Q;  5B5E H;  1EXJ A;  2B87 B;  3TYY A;  1SFC B;  3L74 G;  5KLV J;  1T6A A;  1JMB A;  1BSH A;  3O6Q B;  4GOF A;  1YQ4 C;  3CCR P;  1Q86 Q;  1L4A B;  2QRX A;  3M06 A;  1USD A;  3Q1M A;  4JF7 A;  5AW8 B;  1HUC A;  3RK3 B;  3I56 P;  1SQB E;  3RL0 C;  4XFJ A;  2PP6 A;  4JPZ B;  1OVU A;  1KFM A;  2WSF H;  2HPC B;  1SQX J;  1LTA C;  4JYB A;  2GUS A;  4OGQ B;  1NTZ E;  3H25 A;  3HUS B;  2ZT9 C;  2WWW A;  3ZDM A;  2Y9Y A;  1N7S C;  1PP9 E;  3M0D C;  4UB6 H;  5CBO A;  2MJZ A;  1JY2 P;  3MD0 A;  1SS1 A;  3HRN A;  3AEG C;  1J1D C;  1NAF A;  1S5L E;  3AED C;  2A06 E;  3L75 E;  3B71 A;  4LGD E;  1SQB G;  3L37 A;  3LIE A;  3RBZ A;  3QH9 A;  1OW6 A;  1S5L H;  2HYN A;  1VF5 D;  1Q2N A;  2N1T C;  2R32 A;  2Q3I A;  2Z5I A;  3BCC E;  2PFX A;  1NTZ G;  1YHQ P;  2ZVN B;  1OMI A;  3ITK A;  1MKM A;  1DEE G;  4HYT B;  5GTI E;  2L91 A;  3B5N B;  2Z4E A;  4AUW A;  1VQ5 P;  1OW8 A;  1N86 A;  3H1I D;  4OWF A;  5K5G B;  3L75 G;  3NTN A;  3PH0 A;  2K9Y A;  1BGY G;  1N7S D;  3V6I A;  3GMA A;  1FDM A;  3B8E B;  1KIL C;  1NTZ J;  3KZI E;  2HFE D;  3CWB D;  3KQG A;  3VTP C;  5CBN A;  2E76 D;  5APY A;  3D6Z A;  1LTT C;  1WRG A;  2E76 C;  2PAJ A;  3AEF C;  3CXH E;  1L0L E;  4H0L D;  4PD4 E;  2AXT E;  4GOE A;  2WPR A;  1L4A C;  4WWI A;  3U59 A;  1E5W A;  1QVF O;  3H1H J;  1BGY E;  2W27 A;  4QMA A;  1LWU A;  2XU6 A;  4Y99 B;  5CCH C;  2O3J A;  5CCH D;  1K9M Q;  2WSC H;  4D6T J;  2I8D A;  2NRG A;  1CZQ A;  1RE4 A;  2GA1 A;  2LR2 A;  3CXH H;  2ZYD A;  1PGJ A;  1URQ A;  3GHG A;  3H1J J;  5AVZ B;  2J59 M;  5KLV K;  3PLN A;  1KB9 I;  2QJP B;  1SFC D;  4H0L B;  1L0L G;  2H88 C;  1SQB J;  3M9B A;  5AVU B;  5TIS E;  1N73 A;  1AVO A;  1NTK D;  1RQV A;  1KQG B;  1Y9B A;  3SSU A;  1WMK A;  1KQF B;  4DJG A;  1XTG B;  2OYH A;  2FKW B;  4XA4 A;  1L0L K;  2ITA A;  1RF1 C;  2Z5H A;  3OA7 A;  3GHG C;  5KKZ B;  3K5B A;  2WPV B;  3B5N C;  1SQQ K;  3H1J D;  2H7H A;  4H44 B;  1KQL A;  2KNC A;  3GF7 A;  1RHZ B;  2FY8 A;  3MZW B;  1NYH A;  1T8Z A;  3L73 D;  1GMJ A;  4IFF A;  5GTH H;  2WPS A;  1VQN P;  1PGO A;  4DT0 A;  3V4Q A;  2AEJ A;  1A02 F;  4D6T D;  2OTL P;  1H0T B;  3L74 J;  1FDI A;  1SLQ A;  1IZN B;  3Q2Y A;  1VF5 B;  4N78 D;  3JCU E;  3L71 D;  1X79 B;  1LP1 B;  1X9V A;  3CCQ P;  1SQP D;  1JY3 P;  4IL6 X;  1SQQ G;  3HUS C;  1NU1 J;  1OXZ A;  2K1A A;  3GF3 A;  5AVV B;  3WUV A;  2WT7 A;  4EIJ A;  1MFT A;  5KKZ C;  1KYO I;  2NPS C;  1U7J A;  2R3C A;  1RY3 A;  3M9H A;  3WU2 E;  2FBW C;  3WMM 0;  4ZKP A;  1GU4 A;  3L36 A;  2LXB A;  2C0X A;  1ZME C;  2Y0C A;  2QE7 H;  1EZV G;  1PPJ G;  1G2C B;  2E75 C;  1S1C X;  3TNU B;  1GDT A;  3PTZ A;  3AEA C;  1EDL A;  2QEX P;  2ZFC A;  1RE4 C;  3L70 D;  1ZR4 A;  2ZAE B;  1GK6 A;  1Q90 D;  3HE4 B;  1R5S A;  3LID A;  1H89 A;  2HOD B;  1L2P A;  3AE8 C;  2CPB A;  3AE3 C;  1GL2 A;  1P84 I;  1ZOY C;  2O01 J;  1BCC D;  3GLM A;  2V7Q J;  3H1I E;  5KJ7 D;  3V2Q A;  3C9I A;  1NHL A;  3O8Z A;  3V5B A;  2YXR B;  3HD7 D;  2QSI A;  3HD7 C;  4Y28 J;  3R4Y A;  3G9R A;  1BE3 J;  1RF0 A;  4NPE A;  5CMZ A;  1HJ0 A;  5KLI B;  3Q3D A;  1T2K D;  2KZI A;  2JWD A;  1SQX D;  5KAF E;  3SWK A;  3CME P;  1L0L J;  1ZP0 C;  3HE5 B;  1QLE D;  3H1L J;  5AVS B;  1KOR A;  3E7K A;  1JCD A;  1OIP A;  3KHU A;  2WPQ A;  3U1C A;  2FFD C;  2A06 D;  1HH0 A;  5CCH A;  3KPE A;  1NTM E;  5DJU B;  1NTM J;  1YYC A;  4PV1 B;  3WUT A;  3NMD A;  2IFN A;  1YJN P;  3H1L G;  1KB9 E;  3N4X A;  2JJL A;  2KZJ A;  1JY3 O;  4GDO A;  4ZMD A;  5KAI H;  2YMY A;  2NPS D;  3CD6 P;  5KLV D;  3M0A A;  1HGZ A;  1VQ7 P;  2RN0 A;  5KTB A;  1DD3 A;  1VQK P;  3USS A;  2M8R A;  2C0W A;  2WMM A;  1NTM G;  1GL2 D;  2SPZ A;  1VL2 A;  3FXE A;  1N7S A;  3QWO C;  4ASW A;  3IAO A;  2HPC A;  1AQT A;  1NAY A;  2G8Y A;  1KIL D;  1R5L A;  3CXH I;  4PD4 I;  2CPS A;  3P8C E;  3AE9 C;  2IBZ G;  3RK2 C;  3TGU J;  4BRY B;  1H0T A;  5B66 H;  1YJW P;  3UIA A;  3VP8 A;  1URQ C;  1FAV A;  2JEE A;  3MGN A;  2H43 A;  1YBK A;  1SQQ D;  2FXP A;  2KSE A;  1NU1 D;  1LT9 B;  3O6Q A;  2WSC J;  3H1H G;  3R2P A;  1JTH A;  2OTJ P;  1P84 E;  3IN6 A;  3M91 A;  4HKZ H;  5CJ0 A;  2N1T D;  3GG2 A;  1N7S B;  3VP9 A;  1KYO D;  2HG5 D;  5APW A;  4I7Z C;  1HBW A;  1Q82 Q;  1L0N D;  3BCC G;  2A45 I;  3E1I A;  4ZKU A;  1NWQ A;  1IO4 A;  4AYC A;  2OYH B;  4HB1 A;  1P84 H;  5AW4 B;  1SQQ J;  3AEE C;  3S4R A;  2W6A A;  2D2C D;  2E5Y A;  3SFD C;  5AVY B;  1PGQ A;  3H1H E;  1N73 B;  1W2E A;  4LLH A;  3C1L A;  4PJ0 H;  1ZR2 A;  1KYO E;  3PJS K;  4H13 D;  4L75 A;  3L72 J;  4L74 A;  2XNX A;  3GHG B;  3U1A A;  1MFZ A;  3HTK A;  1BSN A;  3VMX A;  3TGU D;  1NTZ D;  5AW1 B;  1AVY A;  2YKQ A;  1AQ5 A;  1OZH A;  4PV1 D;  1K73 Q;  5EFW B;  1FZC C;  3CCS P;  2WIT A;  3H1I J;  1DIP A;  2J58 A;  2P58 A;  4TT3 H;  2QVA A;  1FZE A;  5AW3 B;  4A7P A;  1U57 A;  3FX0 A;  1S3J A;  1T3U A;  3CCM P;  1KMI Z;  1HF9 A;  3II6 A;  2IZ1 A;  4D6T E;  2ZXE B;  1NTM K;  2POH A;  5GTH E;  2Y0D A;  2XV5 A;  3H6P A;  2W90 A;  1ZXG A;  3EFF K;  2JR8 A;  4Y99 C;  5E79 E;  3AE6 C;  1UIX A;  3HE4 A;  1SQB K;  1W2B O;  2FYU E;  3H1L D;  1AA0 A;  1J2J B;  3P32 A;  2WQY C;  4D6T G;  1RQU A;  5AVR B;  5C39 A;  1Q81 Q;  1G2C A;  1SQV J;  1LT9 C;  3MUD A;  3N7N A;  1RE3 C;  4UB8 E;  5KAF H;  2OYI A;  3CX5 E;  1KQS O;  1BDD A;  1NTK E;  1X8Y A;  3EFG A;  2ZVO B;  1KYO H;  1KIL B;  1PIX A;  2IX7 C;  3CX5 H;  3RL0 B;  3MHV A;  2AEF A;  2FYU G;  1NU1 G;  1JY3 N;  2ZXX A;  1JEK A;  3H32 A;  3HD7 A;  2WVR A;  4C7N A;  5M1B A;  5AVQ B;  1EXI A;  3BVH A;  2GUV A;  1EZV D;  2YO2 A;  3T97 B;  4R4L A;  1IFM A;  1UII A;  5APX A;  4C46 A;  2QM8 A;  1FOS E;  4PD4 H;  1U7M A;  5CCG C;  1JTH B;  2E42 A;  2FXM A;  2K3R A;  4I1L A;  1URQ D;  3CC2 P;  3H1J G;  4WBA A;  1X0T A;  2JKV A;  2QJP C;  3PP5 A;  1SQQ E;  2PRR A;  2KXP B;  1NU1 E;  3RK2 D;  2HR3 A;  2D2C B;  4ZNC A;  1FU1 A;  4N78 E;  1EZV I;  4H0L C;  3L71 E;  1QL1 A;  3TSI A;  3VMA A;  2B89 A;  2OYO A;  2O01 H;  1CI6 A;  5APV A;  3A5T A;  2OYI B;  3FWL A;  5B66 E;  1CSB A;  2KOG A;  1YTZ I;  2IYO A;  2JO1 A;  2KI7 B;  2P1J A;  3L73 G;  2QJY C;  3OAK A;  5AW5 B;  3P8M C;  3T97 A;  1YIJ P;  3RK3 E;  3H1J E;  3D71 A;  2P67 A;  4I7Z B;  2O1J A;  1OW7 A;  1QX8 A;  3JSV C;  4TLF A;  5KLV E;  1S9K D;  3H1K E;  1ZRT E;  2P7J A;  3BRT B;  2WSE J;  5KJ7 C;  1KIL A;  1YQ3 C;  3VMZ A;  4WVZ A;  2RKL A;  3L73 J;  5AVW B;  4YXD C;  5BVZ A;  1KB9 H;  2E74 C;  2E74 D;  2XND H;  3A0H E;  1GW4 A;  1XTC C;  2G3A A;  1JY2 O;  1PP9 D;  2E75 D;  1ZN5 A;  1CW5 A;  4O9B A;  2N9Y B;  1QL2 A;  5KJ7 A;  1LNQ A;  4EOT A;  3S9O A;  2V7Q H;  3IFM A;  5KLV G;  1HJB A;  4W80 A;  1K05 A;  2OGU A;  4K3A A;  1NGM B;  3CC4 P;  3D70 A;  1GU5 A;  1L4A D;  2YKO A;  3A2A A;  1N2D C;  1OVR A;  2O01 N;  1BE3 G;  3V2P A;  3TNU A;  4KJM A;  3E1R A;  2W6J H;  3M9Q A;  1EDK A;  1FS0 E;  1MZ9 A;  2N9B A;  3TDK A;  4Z1M H;  1VQP P;  1KTM A;  1SQX G;  1M90 Q;  2FYU J;  5APT A;  4IFM A;  1D7M A;  2KIK A;  3H1L E;  2AEM A;  2HOD A;  1RH5 B;  3SFE C;  1ZV8 A;  1LTJ B;  1S2E A;  3JCU H;  4PV1 C;  3I5C A;  2JDI H;  3LW5 J;  3CPW O;  3Q5S A;  1BE3 E;  3CWB E;  1QVG O;  1N8R Q;  1KV4 A;  3CX5 D;  4JYC A;  2CK3 H;  2KS1 B;  2FYZ A;  2O1K A;  1JMM A;  3CXH D;  1YIT P;  1LGH B;  3H32 B;  3G71 P;  1SQX E;  2QJK B;  3W67 A;  4H44 D;  1E79 H;  2Q1K A;  2IBZ E;  3P7K A;  1T3J A;  2H8P D;  1NTZ K;  1W5C E;  3ABV C;  2IDB A;  4EYY Q;  2WT7 B;  1GD2 E;  5BU8 B;  1RF0 C;  1K04 A;  1KIL E;  1SQP K;  1YTZ T;  2Y0E A;  3P8C D;  1LP1 A;  5KLI C;  1JUN A;  3V2N A;  2KS1 A;  2WSE H;  2OAR A;  4WY4 D;  5B5E E;  3MTU E;  2BEQ D;  2Y9Z A;  3AE2 C;  4OH8 B;  1TU3 F;  3CCV P;  3B4S A;  3CL3 D;  1USE A;  1LTJ A;  1SQP G;  4DCK A;  2E74 B;  2YMK A;  3BAS A;  3A7O A;  1FZC B;  2KB7 P;  5APU A;  3FGA D;  1LJ2 A;  2E75 B;  4ASV A;  1SFC A;  1QGK B;  1NO4 A;  1L0N E;  2QM7 A;  1KZU B;  3IR9 A;  5CJ4 A;  2QJY B;  2WSS H;  3BCC J;  1NOH A;  1M56 D;  1J1D B;  2W6B A;  5H2F H;  1KN7 A;  1OFC X;  1M1K Q;  1NKZ B;  3Q5R A;  3MP7 B;  2WZ7 A;  3H1H D;  3L75 J;  2QIW A;  3L75 D;  3F5H A;  1N73 C;  3H1K D;  3JC2 2;  1FC2 C;  3IF4 A;  4EI2 A;  4YPC A;  4OVN F;  1M1J C;  3TGU E; 
#chains in the Genus database with same CATH homology
 3VOP A;  1LTJ C;  1NH4 A;  1URQ B;  5CCG A;  1N7L A;  5AW2 B;  5APQ A;  2KSJ A;  4N6J A;  1FZB A;  2C9N Y;  1L0N K;  1JY2 N;  1GK4 A;  3BAT A;  1HGV A;  3TK1 A;  2BAS A;  2Q5U A;  1HTL C;  1GW3 A;  2XKM A;  4I2L C;  5AW0 B;  1M1J B;  2I1K A;  1FJP A;  2OYI C;  1CI6 B;  1ZLL A;  3A3Y B;  1KFN A;  3BRV B;  3V2P A;  2IPP A;  1M7L A;  2KP8 A;  3RL0 D;  1JO5 A;  1FZC A;  2Q9I A;  2I1J A;  1AFO A;  5BU5 A;  4GKG A;  1NTK K;  3VYI A;  4I6M C;  3KYQ A;  3BVH A;  4HH2 A;  4W7Z A;  4C7N B;  4N3Y B;  4WY4 B;  4IFD K;  3V4W A;  2GM4 A;  3L4F A;  1GTW A;  1A02 J;  1RF1 B;  1J1E B;  1DEB A;  1RE3 A;  2FFD A;  2YO3 A;  1FZA A;  1HVV A;  3L35 A;  2LKM A;  1IFD A;  1LTI C;  4GT1 A;  5CCG D;  1JNM A;  3HE5 A;  2R5B A;  5AVX B;  1M1J A;  2YKP A;  4M3L A;  1IJD B;  4ZKP A;  1JOC A;  5AW6 B;  2P2U A;  1S9K E;  1VDF A;  2KYV A;  1GL2 C;  1SP4 A;  5AW7 B;  4B86 A;  2R5D A;  1IFN A;  1FBM A;  3LW5 H;  4WB4 A;  1EQ7 A;  1LTG C;  1LWU C;  1GZL A;  3MIW A;  1SVF A;  1SQV K;  3M0D A;  5CHX A;  3VMY A;  3VN0 A;  2HLO A;  2A45 H;  1Z56 A;  4DOJ A;  5APS A;  1DX7 A;  1J1E C;  1MUU A;  3KDP B;  3SWY A;  1LT9 A;  4GIF A;  5AVT B;  5AW9 B;  4LC1 A;  4AQR D;  2NPS B;  4RES B;  1WT6 A;  1LTB C;  2FFD B;  3B5N A;  1LTS C;  3OJA B;  4C7R A;  2H7H A;  1HWT C;  4XE5 B;  1RF1 A;  2N1T A;  2VRS A;  4WY4 C;  3G3Z A;  2OYH C;  4KHX A;  3HD7 B;  1H8A A;  3RK3 D;  2Q7C A;  1DH3 A;  1NKN A;  1IFJ A;  4WY4 A;  1SFC C;  3HUS A;  4W7Y A;  1FZG A;  2N1T B;  1NU1 K;  1SQX K;  3V2R A;  1LWU B;  2C9L Y;  3CI9 A;  1L4A A;  1FOS F;  2KLV A;  2NPS A;  2XZR A;  1MV8 A;  2L5G B;  4DZO A;  1T2K C;  1FJK A;  2A45 G;  1JCC A;  2M3B A;  2XDJ A;  3NXS A;  1IK9 A;  1FZF A;  1GL2 B;  3CLQ A;  2YNY A;  2WTY A;  1VPC A;  3NFQ A;  3B5N D;  1OWA A;  1H88 A;  2FYU K;  3HTK B;  3RK2 B;  1G1J A;  3EQ2 A;  2IFM A;  3RK3 C;  1IC2 A;  3SWF A;  1G1I A;  1IFI A;  2E43 A;  3TYY A;  1SFC B;  1L4A B;  3M06 A;  4JF7 A;  5AW8 B;  1HUC A;  3RK3 B;  3RL0 C;  2PP6 A;  1KFM A;  2WSF H;  2HPC B;  1LTA C;  4JYB A;  2GUS A;  3HUS B;  2WWW A;  3M0D C;  1N7S C;  2MJZ A;  1JY2 P;  3MD0 A;  3HRN A;  4LGD E;  1J1D C;  1NAF A;  3L37 A;  3LIE A;  2HYN A;  2N1T C;  2R32 A;  2Q3I A;  2Z5I A;  4HYT B;  2Z4E A;  3B5N B;  1N86 A;  3NTN A;  1N7S D;  1FDM A;  3B8E B;  1KIL C;  2HFE D;  3KQG A;  3VTP C;  5APY A;  1LTT C;  1WRG A;  2PAJ A;  2WPR A;  1L4A C;  3U59 A;  1E5W A;  2W27 A;  1LWU A;  2XU6 A;  4Y99 B;  5CCH C;  5CCH D;  2WSC H;  3TNU A;  1CZQ A;  1RE4 A;  1URQ A;  3GHG A;  5AVZ B;  4AUW A;  2J59 M;  5KLV K;  1SFC D;  5AVU B;  3M9B A;  1N73 A;  1XTG B;  2OYH A;  2FKW B;  4XA4 A;  1L0L K;  1RF1 C;  2Z5H A;  3OA7 A;  3GHG C;  3B5N C;  1SQQ K;  1KQL A;  5CCH A;  1T8Z A;  4IFF A;  2WPS A;  1A02 F;  3V4Q A;  1SLQ A;  4N78 D;  1X79 B;  1X9V A;  1JY3 P;  3HUS C;  1OXZ A;  5AVV B;  2WT7 A;  4EIJ A;  2R3C A;  2NPS C;  3M9H A;  1RY3 A;  3WMM 0;  1GU4 A;  3L36 A;  2C0X A;  1G2C B;  3TNU B;  1GDT A;  2ZFC A;  1RE4 C;  1ZR4 A;  1GK6 A;  3HE4 B;  3LID A;  1H89 A;  2HOD B;  2CPB A;  5KJ7 D;  1GL2 A;  3V2Q A;  3C9I A;  1NHL A;  3O8Z A;  3V5B A;  3HD7 D;  3HD7 C;  1RF0 A;  5CMZ A;  1T2K D;  3HE5 B;  5AVS B;  1JCD A;  2WPQ A;  3U1C A;  2FFD C;  1HH0 A;  3KPE A;  1YYC A;  3NMD A;  2IFN A;  3N4X A;  2JJL A;  1JY3 O;  2YMY A;  2NPS D;  3M0A A;  1HGZ A;  5KTB A;  2M8R A;  2C0W A;  1GL2 D;  1N7S A;  2HPC A;  1KIL D;  2CPS A;  3P8C E;  3RK2 C;  3UIA A;  3VP8 A;  1URQ C;  1FAV A;  2JEE A;  3MGN A;  2H43 A;  1PFI A;  1LT9 B;  3R2P A;  1JTH A;  3M91 A;  5CJ0 A;  2N1T D;  3VP9 A;  1N7S B;  2HG5 D;  5APW A;  1HBW A;  3E1I A;  1IO4 A;  2A45 I;  4ZKU A;  1NWQ A;  4AYC A;  2OYH B;  5AW4 B;  2W6A A;  5AVY B;  1N73 B;  1W2E A;  4LLH A;  1ZR2 A;  2OYI B;  3U1A A;  2XNX A;  3GHG B;  1MFZ A;  3HTK A;  3VMX A;  5AW1 B;  2YKQ A;  1AQ5 A;  1FZC C;  2WIT A;  2J58 A;  5AW3 B;  1FZE A;  1T3U A;  3II6 A;  2ZXE B;  1NTM K;  2POH A;  2XV5 A;  3H6P A;  4Y99 C;  3HE4 A;  1SQB K;  1J2J B;  3P32 A;  5AVR B;  1G2C A;  3MUD A;  1LT9 C;  3N7N A;  1RE3 C;  2OYI A;  1X8Y A;  3EFG A;  1KIL B;  2IX7 C;  3RL0 B;  1JY3 N;  3H32 A;  3HD7 A;  4C7N A;  5AVQ B;  2GUV A;  2YO2 A;  1IFM A;  5APX A;  4C46 A;  2QM8 A;  1FOS E;  2E42 A;  5CCG C;  1JTH B;  2FXM A;  4I1L A;  1URQ D;  1FZC B;  4WBA A;  3PP5 A;  3RK2 D;  1FU1 A;  4N78 E;  1QL1 A;  3TSI A;  2O01 H;  1CI6 A;  5APV A;  3A5T A;  1CSB A;  2KOG A;  1YTZ I;  2P1J A;  3T97 A;  3OAK A;  5AW5 B;  3P8M C;  2P67 A;  2O1J A;  1S9K D;  2P7J A;  3BRT B;  5KJ7 C;  1KIL A;  3VMZ A;  5AVW B;  5BVZ A;  1GW4 A;  1XTC C;  1JY2 O;  1ZN5 A;  1CW5 A;  4O9B A;  1QL2 A;  5KJ7 A;  4EOT A;  3IFM A;  1HJB A;  4W80 A;  1GU5 A;  1L4A D;  2YKO A;  3A2A A;  1N2D C;  3M9Q A;  1MZ9 A;  2N9B A;  5APT A;  4IFM A;  2HOD A;  1ZV8 A;  1LTJ B;  3I5C A;  4JYC A;  2FYZ A;  2O1K A;  1JMM A;  1LGH B;  3H32 B;  3P7K A;  1T3J A;  2H8P D;  1NTZ K;  2WT7 B;  1GD2 E;  5BU8 B;  1RF0 C;  1YTZ T;  1SQP K;  3P8C D;  1JUN A;  3V2N A;  2WSE H;  2OAR A;  4WY4 D;  3MTU E;  4OH8 B;  3CL3 D;  1LTJ A;  3BAS A;  3A7O A;  2KB7 P;  5APU A;  1SFC A;  1NO4 A;  2QM7 A;  3IR9 A;  1KZU B;  5CJ4 A;  1NOH A;  1J1D B;  2W6B A;  1NKZ B;  2WZ7 A;  1N73 C;  1M1J C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...