5APWA

Sequence matkdd inserted between gcn4 adaptors - structure t6
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
67
structure length
67
Chain Sequence
GHMKQLEDKVEELLSKVYHLENEVARLKKLMATKDDMKQLEDKVEELLSKVYHLENEVARLKKLVGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title alpha / beta coiled coils.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords GENERAL CONTROL PROTEIN GCN4
total genus 30
structure length 67
sequence length 67
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5apwA00
2WTYA 1FOSE 4AQRD 3P7KA 2P67A 2ZFCA 5AW9B 1KQLA 1NAFA 1IO4A 1A02F 3VN0A 3A3YB 1S9KE 3P8MC 4DZOA 2E42A 3V4WA 2W6AA 3M0AA 1OXZA 5APWA 2Q5UA 3VTPC 3IR9A 5AW1B 3L36A 2XU6A 2YO3A 1GD2E 2QM7A 5APTA 1FAVA 3KQGA 1X8YA 3HE5A 2Q7CA 3NFQA 3VYIA 1FOSF 2P7JA 3MD0A 3TNUA 1T2KC 3KDPB 5AW2B 2W27A 1T2KD 2WPQA 3TYYA 3L37A 4JYCA 3V5BA 3M9BA 2BASA 5APVA 5AVXB 3LIDA 3TNUB 5AVYB 2YNYA 2XZRA 2KP8A 2N9BA 4KHXA 1HWTC 3I5CA 1GZLA 2JJLA 4B86A 2XV5A 3MGNA 3A5TA 1MFZA 1S9KD 2WPSA 2C9NY 3M0DA 5AVSB 5AW3B 4C46A 5AW4B 3M9HA 2IPPA 3NMDA 4XE5B 1DH3A 1SLQA 1HUCA 3VMZA 3VMXA 3HE4B 2R3CA 3NTNA 5APXA 1J2JB 1GU5A 1H88A 4GT1A 4EOTA 5AVUB 3HTKA 5AVZB 5APSA 5APUA 2VRSA 1G2CB 2WT7A 2YO2A 5AW0B 2WT7B 1HJBA 3P32A 2H7HA 1GK6A 4HYTB 2Z5HA 2C9LY 1H8AA 3B8EB 1YYCA 1JUNA 2Q3IA 2R5DA 4JYBA 1NWQA 3HE4A 3M06A 1MV8A 3OAKA 4I6MC 1JNMA 3L35A 2Z5IA 2R32A 5AW7B 5AVTB 2QM8A 5APQA 2ZXEB 4GKGA 4RESB 3VMYA 5AVVB 4AUWA 2E43A 1OWAA 4C7NB 4M3LA 1MUUA 1CI6B 3HE5B 3M91A 3V4QA 3A2AA 3LIEA 1HBWA 2WWWA 5CMZA 5AVQB 4AYCA 5AW5B 1GK4A 3UIAA 1H89A 1SP4A 2R5BA 2WPRA 3O8ZA 3T97A 1CI6A 4I2LC 5AW6B 1GTWA 5APYA 5AVWB 1GU4A 1A02J 2P2UA 3A7OA 3NXSA 4C7NA 3TK1A 3SWFA 1CSBA 4LC1A 5AW8B 5AVRB 1CZQA
chains in the Genus database with same CATH superfamily
3CC2P 2OYHC 3AE6C 1FOSE 1DEBA 1EDIA 1PGOA 1SQBJ 2P67A 3P7KA 3AEEC 5AW9B 1EC5A 5KJ7C 3BRVB 1SFCA 1N7SD 1HJ0A 1AQTA 2WVRA 3P8MC 1OIPA 1NU1D 3PRJA 1LWUC 1RHZB 1SQVE 1WRGA 1Q2NA 2E5YA 2O01J 5H2FH 5APWA 1BCCJ 3D71A 1K9MQ 5DJTB 3RGUA 3VTPC 4EYYQ 2QSIA 1M7LA 1KILE 3H1JD 2E75C 3MTUE 2WMMA 1PPJG 3L36A 3BASA 3RK3E 3CCQP 3OW2O 4WY4D 2XU6A 4WVZA 2A06G 2YO3A 1NAYA 2LXBA 1EZVE 2QM7A 1URQD 4WBAA 1IFJA 1LT9B 2OYHB 1X0TA 2P7JA 5CCGA 1GDTA 2OYIA 1NTKJ 3L71E 3VMAA 1FU1A 2I8DA 1LTJC 3H1JE 5AW2B 2YIUC 1JEKA 1SQVJ 3RK3D 4DOJA 1Q90D 2W27A 1JM0A 5H2FE 3TGUD 3CCUP 1BDDA 2WPQA 2K9YA 3H1KD 1KYOH 3M9BA 1LT1A 1PGQA 1IZNB 4R4LA 5APVA 3LIDA 4O9BA 1KQFB 2FFDA 1FJPA 1PL5A 1LTAC 1LTJB 1W5CE 2YNYA 2IFMA 2XZRA 5AVYB 2KP8A 2OYIB 1R8EA 3S1KA 3L74J 1J1EB 3USSA 3CX5D 4JPZB 4LGDE 4OGQB 1LTTC 2JP3A 3Q3DA 3HUSB 3M0DC 1FZBA 1FZEA 1OW7A 2XV5A 3H1KE 1BCCD 3FWNA 3PTZA 1QLED 1TU3F 2UWJE 3L73D 5CCHA 1WMKA 1JY2O 3FGAD 3JSVC 4GOEA 3TDKA 3CCLP 1QVFO 3HD7D 1JY3N 4PJ0E 3HUSC 2I1JA 3AE2C 2NPSD 1U7MA 4C46A 1Q86Q 3M9HA 4L73A 1VQMP 1FZFA 4KJMA 1LWUB 1DH3A 3VMZA 1G1JA 1IC2A 2C0XA 1NTZD 4PD4I 2R3CA 2N1TC 1OVUA 2PGDA 2K1AA 1URQC 2OTKE 4EOTA 1PPJD 4PD4D 2A45H 2Y9YA 4Y28J 4YPCA 5KLVG 2KIKA 4GIFA 4DCKA 2OYIC 1DD3A 4L74A 1VQ9P 1JB0J 3MUDC 4UB8H 2N1TB 1SQPG 3GLMA 2OGUA 3PH0A 1NTMD 1J1DC 1P84D 4N6JA 2RH0A 2A06E 1YJWP 2Z5HA 3F5HA 1NYHA 1GW4A 1KMIZ 1H8AA 1JUNA 2J5UA 1R5SA 4WB4A 2R5DA 5CHXA 3N7NA 3AE9C 4ASVA 3M06A 4H44B 4W80A 2O1JA 2QA4P 1YJ9P 1NTME 1P84E 5CCHD 3Q5PA 4NPFX 3L72D 5B5EH 2P58A 4ZKUA 3OA7A 1RY3A 1ZMEC 1VQPP 3CWBJ 1EQ7A 1KB9I 3TSIA 2D2CB 2H8PD 1NTZG 1LNQA 3CCVP 2E76B 4WWIA 1E5WA 1JTHA 1L0NG 1GW3A 3QWOC 2JO1A 2BCCG 2IBZD 1GMJA 2LXCB 2NRGA 3L70J 3MHVA 1BGYJ 2W8ZA 1KILA 2FYUG 3L72E 4IFMA 3RL0C 4C7NB 1SQXD 3D6YA 3CMAP 1EDLA 2IBZI 1XTCC 4M3LA 1YITP 1KFMA 1MUUA 2PP6A 1U7JA 1AFOA 4U3FE 3E1RA 3V4QA 2KLUA 2E74B 2ZYAA 5GTIH 1LGHB 1YTZI 1R5LA 1SVFA 2KB7P 3B5NA 1K73Q 2I1KA 2Y0DA 3BCCG 3ZDMA 1NTKD 1VL2A 4YXWH 5B66E 1SP4A 1SQBD 2R5BA 2ZJSE 2CPBA 3RK2C 4D6TG 1NJIQ 1JY3P 1RQUA 1IK9A 2JWDA 1P84I 3CLQA 3O8ZA 5GTHH 3Q5RA 1LTSC 2YIUB 5KAFE 2OYHA 1YHQP 3L4FA 3GG2A 5BU8B 2O01N 1GU4A 1A02J 1G1IA 3A7OA 4OWFA 1ZXGA 2MKVA 2E76C 5L8RJ 4C7NA 2D2CC 3U1CA 3FX0A 4HH2A 1Y9BA 1VF5D 1EZVD 1HGVA 1J1DB 3WUVA 2ZT9B 4U3FG 4AQRD 1KQLA 4ZKPA 3L71D 3W67A 1KB9D 1EZVI 1IO4A 1A02F 1L0LD 3A3YB 3VOPA 1RE4A 3RK3B 3L75G 2ZYDA 4PV1B 4TLFA 3VN0A 2K9JA 1M1JA 3KXDA 4LLHA 1ZN5A 2POHA 1KZUB 3V2PA 3M0AA 2GUVA 4I7ZC 1IJDB 2YXQB 1K8AQ 1U57A 5KAIH 3CXHI 3H1JG 3R4YA 1VQOP 2AEMA 5AW1B 3PP5A 2QEXP 2FYUD 2HFED 2IZ1A 1UIXA 2FYNC 3H1HG 3Q5SA 3CXHD 1AJYA 3C8VA 1KQGB 2L5GB 1DX7A 3VYIA 1Q81Q 1FAVA 1VPCA 1BCCE 1SQPD 1ZW0A 2CPSA 3HE5A 3ITKA 1LP1B 1FOSF 1J1EC 1MZ9A 1PPJE 2Q6QA 1SQXK 2RN0A 2Y0EA 3O6QA 3TNUA 3U1AA 1T2KC 1H0TA 2Y9ZA 2O1KA 3AE8C 4HKZH 4EIJA 2HODA 1IFDA 2KZJA 2QJKB 1JOCA 3AE1C 3E1IA 3H6PA 4UB6H 4JYCA 3TYYA 1T2KD 1VQLP 1M1JB 3EFGA 4L75A 5AVXB 2M3EA 3H1LJ 1QGKB 3L75D 4BXLA 3Q1MA 1VQ7P 1JY2P 3QH9A 1OZHA 1KB9H 2ZVOB 1SFCD 1L0LK 3B5NC 4W7ZA 4XA4A 1BGYD 1AVYA 1T8ZA 1HWTC 3KPEA 4HJGH 2JJLA 2IBZG 3BATA 4GOFA 3TF5A 3ABVC 1NU1J 1URQB 2FYNB 2N1TD 3AECC 3M9QA 3MIWA 4PJ0H 5AW3B 3CCRP 2B87B 2RKLA 2JEEA 1NHLA 2KLVA 2NPSB 5KKZC 4IL6X 2WSEJ 2IBZE 5AW4B 4WY4A 3AEBC 4XE5B 1M8OB 2E75B 2IPPA 5EFWB 2FFDB 3V2RA 1EDKA 3HE4B 3W68A 1VF5C 1NTKG 3AEGC 3KZIE 1ZOYC 5APXA 4Z1MH 3B5NB 2WPVB 1J2JB 1QX8A 2YMYA 3H1ID 2Q9IA 2IYOA 3HTKA 1NU1G 3PHLA 1S3JA 1M1JC 2QVAA 1LT9A 5DJUB 1HGZA 3H32B 3L73G 1YJNP 2P10A 2YO2A 1SQBE 5AW0B 2GUSA 2MJZA 3B5ND 3H1LE 1KILB 1GK6A 3MZWB 2PRRA 2OARA 1N7LA 1FDOA 2IFNA 2C9LY 3B8EB 5KJ7D 1Q82Q 1BSHA 3E7KA 5CJ0A 4NPDA 5E79H 1OFCX 3EWKA 2HPCB 1ZV8A 3SWKA 5GTHE 5KAIE 2V4HA 2QJPB 4I6MC 3L35A 3PLNA 3V2NA 3AE7C 3B4SA 4PD4H 1IFMA 3G4SP 1N73B 2QJYC 1X79B 3RL0D 1SQPJ 1L0NJ 2E74C 5APQA 2WSFJ 3V6IA 2WQYC 4ZNCA 4PV1C 1Y47A 2FXMA 3WMM0 2KSEA 2OQQA 3H1HJ 4N78D 3H1IJ 2A06D 1OWAA 4H44C 2BEZF 1VQ5P 2E43A 1N7SB 1FDMA 1L4AC 1JY3O 1SQPK 1YI2P 1EXJA 3D70A 3BVHA 3HE5B 2XKMA 3M91A 3TGUE 2J58A 2ZAEB 3L70E 3LIEA 1JCDA 4PD4E 4EI2A 1ZRTD 2WWWA 1S5LX 5CMZA 5KAFH 1L0LE 1LTIC 1KORA 1H89A 1RE4C 1FJKA 2BCCJ 2R3SA 4W7YA 4A7PA 2QRXA 1L2PA 1LWUA 1VQKP 5K5GB 1BE3E 1BSNA 2D2CD 2FKWB 1KTMA 4MN4C 3FXDA 5AW6B 1M56D 1GTWA 3GW6A 5APYA 5AVWB 3G3ZA 1FZCB 4DJGA 3CD6P 4U7JA 1LTGC 4KT0J 2Z4EA 3B71A 1S5LE 3L73E 4LC1A 1PP9J 1EXIA 3HUSA 1CZQA 4U3FD 1SQPE 1KD1Q 1Z56A 3SWYA 1RF1B 2ZFCA 4D6TJ 1VQ6P 1NAFA 1EDJA 1KILD 3JCUH 2YKQA 2KNCB 3KZIH 1NTKE 3L71J 4OGQD 4DZOA 1NTZE 1FC2C 3V4WA 3A0HE 1OXZA 4Y99B 2Q5UA 4BRYA 1K05A 1USDA 1SQBK 1P84H 2FXOA 1NTMG 1MFTA 1NTKK 3KYQA 2FYUJ 1W2EA 3V2QA 5TISH 1ZR2A 2K3RA 5CBOA 5C39A 3HD7A 4IOIH 1KN7A 3CPWO 2FBWC 2PAJA 2QE7H 3CI9A 3L74E 3RBXA 1GD2E 2B89A 2KXPB 2V7QH 3KQGA 1X8YA 2O3JA 3NFQA 1N8RQ 3BRTB 5TISE 1M90Q 3IF4A 1UIIA 2B87A 5CCHC 2FYUK 4GODA 3KDPB 1PGJA 1QL1A 1WT6A 4L76A 3CCJP 2KOGA 1YQ4C 3A0HH 3CX5E 2OTJP 1SQQE 3GHGA 2OYOA 3GHGB 1JCCA 3L37A 1VQ4P 3PJSK 3V5BA 3MP7B 3JCUE 1DD4A 1HH0A 1KYOE 1PV3A 5CBNA 2KZIA 3WUTA 2K88A 3CCEP 1NH4A 4XFJA 1Y8AA 1FBMA 1SQVK 2AXCA 3KHUA 4KHXA 2FFDC 3AEDC 2ZXXA 1GZLA 3CCMP 1SQQG 2WSCJ 1VF5B 2WITA 3MGNA 1S4XA 1MFZA 3AE5C 4CPGA 3BCCJ 2YKPA 1S9KD 2IDBA 1M1KQ 1M57D 2C9NY 1IK7A 3M0DA 2KSJA 1ZP0C 3P8CE 5AVSB 3Q2YA 1NTMK 2A45I 3C1LA 3H1KG 4GDOA 1JMBA 1IFPA 2FYZA 2M5AA 3R2PA 2JDIH 5BU5A 3I56P 1YIJP 1HUCA 3AEFC 2ITAA 3RL0g 3HD7C 3VMXA 1KQSO 3JC22 4Y99C 1NU1E 1K04A 1PZQA 3SFEC 3D6ZA 4YTPC 1SQVG 1NTMJ 2IZ0A 4GT1A 5AVUB 2FY8A 3L70D 1YBKA 2ZVNB 2KK7A 4C7RA 5CCGC 2LKMA 1G2CB 2WT7A 1FZCA 2WT7B 3L71G 1HTLC 3L74D 3P32A 2H7HA 2YXRB 4N78E 4HYTB 3AE3C 4OGQC 3SSUA 1EZVG 2H88C 1LT9C 1L4AA 2Y0CA 1OVRA 5E79E 2Q3IA 1FZCC 2LR2A 4JYBA 1NWQA 2CK3H 3CMEP 4R4MA 4H0LB 5B66H 1QVGO 2O01H 1NVOA 1OX3A 1SS1A 3H1IG 3OAKA 1JNMA 2C0WA 2QIWA 2XDJA 3BCCE 1OW8A 3H1IE 3GMAA 1AA0A 2M5AB 2Q1KA 2R32A 3RL0B 5AW7B 1SQQJ 5AVTB 3G9RA 2HLOA 4WY4C 1GL2A 4IL6E 1JY2N 1N86A 5KLIB 1N2DC 1PP9G 3CXHE 1NOHA 5TJHA 2AEJA 4OH8B 3VMYA 5AVVB 1KFNA 2ZT9C 3TGUG 4AUWA 2KS1B 3G71P 2BCCE 3CX5H 3L75J 4JQ0D 1SQQK 4WY4B 3RK2D 3H1KJ 1CI6B 2QJYB 1BCCG 4JBZA 3K5BA 2W83C 1DIPA 3S4RA 1RF0C 1X22A 3AE4C 1BE3G 1AQ5A 5AVQB 1JMMA 1VQ8P 4AYCA 1T3JA 5AW5B 3UIAA 3CCSP 2B88A 1NTZK 2WPRA 1RF1C 1JTHB 1L0LG 1L4AD 1W2BO 1S72P 1BGYE 1CI6A 2FXPA 4H44D 4I2LC 5KLVD 5M1BA 1USEA 3H25A 5BVZA 1VQNP 2E74D 1RH5B 2KS1A 3GHGC 4PV1D 2AEFA 1NKZB 1HVVA 1FZAA 3CWBG 3SFDC 1NTZJ 2M8RA 3AEAC 2A45G 4RKUJ 5AVRB 4IFFA 5AW8B 2HR3A 1BE3J 4N3YB 1GL2B 1AV1A 1XTGB 2XNDH 5KLVE 2DW3A 2WTYA 3A0BE 4BRYB 1S1CX 2QG4A 4RJTA 3O6QB 4H0LC 4H13B 1RE3C 1SQBG 2HG5D 1LTBC 2NPSC 3LW5J 5KKZB 1YQ3C 2K37A 2V7QJ 3IFMA 3S9OA 4D6TD 1S9KE 3L73J 5KLVK 2E42A 2W6JH 2SPZA 3BCCD 4UB6E 1BE3D 2W6AA 1PIXA 4IL6H 3T97B 2ZT9D 3FXEA 3G6EP 3IR9A 1D7MA 1DEEG 3N4XA 2K9JB 1NO4A 5KLIC 5KLVJ 3H1LD 3H1LG 5APTA 3L74G 1G2CA 1L0ND 3IAOA 2Q7CA 3CWBD 2BCCD 3F89A 3MD0A 3II6A 3L72J 2WSSH 3RBZA 3RK3C 4BWNA 2R44A 3RK2B 4U3FJ 2BASA 4YXDC 3TNUB 1FZGA 1NU1K 3H32A 2GM4A 1SQXJ 1YTZT 1RF0A 1H0TB 1SQXG 2N9BA 3HTKB 1N7SA 2E75D 2W90A 2XNXA 3I5CA 1QEXA 1MKMA 1SFCC 2IYPA 3IN6A 4JF7A 2KUBA 2JKVA 4I7ZB 3WU2E 2G3AA 2P1JA 5KJ7A 2WPSA 4EDFA 2NZ2A 1X9VA 2H89C 4H13C 1L0LJ 4ASWA 1N7SC 2ZYGA 3WU2H 1FS0E 1N73A 1GL2C 2G8YA 2M0BA 2QJKC 2PFXA 2M3BA 3NMDA 4DT0A 1OW6A 1PGPA 4B86A 1GL2D 1SLQA 1URQA 1SQXE 3CX5I 3GF7A 4QMAA 2HPCA 4K3AA 2QJPC 4H13D 5GTIE 3NTNA 1QL2A 4ZMDA 2WSFH 1GU5A 1N73C 1H88A 4OVNF 2IX7C 5AVZB 1Q7YQ 5APSA 1NGMB 1HF9A 1IFIA 1VDFA 2N9YB 5APUA 2VRSA 3A0BH 3C9IA 1SQQD 1HJBA 2YKOA 5KTBA 1KV4A 1SFCB 2J59M 3EQ2A 3LW5H 3HD7B 2HYNA 3P8CD 3MUDA 1KC8Q 3H1HE 3CWBE 1PFIA 3CC7P 2KI7B 1KYOD 2RMZA 3OJAB 1YYCA 1FE6A 3HE4A 5B5EE 3CC4P 1MV8A 1NKNA 1KYOI 1SQVD 1FDIA 1OMIA 2N1TA 3TGUJ 1BDCA 2Z5IA 2B9BA 2KNCA 3H1HD 3L75E 2NPSA 4K35A 1RE3A 2QM8A 2W6BA 4UB8E 1KB9E 1RF1A 1L4AB 2AXTH 2JR8A 2JWAA 2Q3EA 2ZXEB 2E76D 4I1LA 1LJ2A 1RQVA 2L91A 1AVOA 1OVVA 1ZRTE 2WSCH 3H1JJ 4GKGA 4RESB 4TT3H 2OTLP 1JO5A 3VP8A 1CW5A 3FWLA 3HRNA 2AXTE 1L0NK 2WSEH 3WUUA 1ZLLA 2KYVA 1PP9E 2WZ7A 3CXHH 1S2EA 1E79H 2FYUE 3L72G 3A2AA 3U59A 4RO0A 1ZR4A 3GF3A 1KILC 1S5LH 3EFFK 1HBWA 4H0LD 1BGYG 1T3UA 1L0NE 1GK4A 2E5TA 2HODB 4D6TE 5CJ4A 1IFNA 1T6AA 3T97A 4HB1A 2H43A 4IFDK 1PP9D 3VP9A 1LP1A 5CCGD 1LTJA 2P2UA 3I55P 3NXSA 3TK1A 3SWFA 2YMKA 1CSBA 3L70G 4NPEA 2BEQD 2GA1A 3CL3D 3A5TA
chains in the Genus database with same CATH topology
2OYHC 1FOSE 1DEBA 3P7KA 2P67A 5AW9B 5KJ7C 3BRVB 1SFCA 1N7SD 3P8MC 1LWUC 1WRGA 5APWA 3VTPC 1M7LA 3MTUE 3L36A 3BASA 4WY4D 2XU6A 2YO3A 2QM7A 1URQD 4WBAA 1IFJA 1LT9B 2OYHB 2P7JA 5CCGA 1GDTA 2OYIA 1FU1A 4DOJA 1LTJC 3RK3D 5AW2B 2W27A 2WPQA 3M9BA 1FJPA 5APVA 2FFDA 3LIDA 4O9BA 2OYIB 1LTAC 1LTJB 5AVYB 2YNYA 2IFMA 2XZRA 2KP8A 1J1EB 4LGDE 1LTTC 3HUSB 3M0DC 1FZBA 1FZEA 2XV5A 5CCHA 1JY2O 3HD7D 1JY3N 4C46A 3HUSC 2I1JA 2NPSD 3M9HA 1FZFA 1DH3A 1LWUB 3VMZA 1G1JA 1IC2A 2C0XA 2R3CA 2N1TC 1URQC 4EOTA 2A45H 2OYIC 4GIFA 2N1TB 4N6JA 1J1DC 2Z5HA 1GW4A 1H8AA 1JUNA 4WB4A 5CHXA 2R5DA 3N7NA 3M06A 4W80A 2O1JA 5CCHD 4ZKUA 3OA7A 1RY3A 3TSIA 1EQ7A 2H8PD 1E5WA 1JTHA 1GW3A 4IFMA 1KILA 3RL0C 4C7NB 1XTCC 4M3LA 1KFMA 1MUUA 2PP6A 1AFOA 3V4QA 1LGHB 1YTZI 1SVFA 2KB7P 3B5NA 2I1KA 1SP4A 2R5BA 3RK2C 2CPBA 1JY3P 1IK9A 3O8ZA 3CLQA 1LTSC 2OYHA 3L4FA 5BU8B 1GU4A 1A02J 1G1IA 3A7OA 4C7NA 3U1CA 4HH2A 1HGVA 1J1DB 4AQRD 1KQLA 4ZKPA 1IO4A 1A02F 3VOPA 3A3YB 3VN0A 1RE4A 3RK3B 4LLHA 1M1JA 3V2PA 1ZN5A 2POHA 1KZUB 3M0AA 2GUVA 1IJDB 5AW1B 3PP5A 2HFED 2L5GB 1DX7A 3VYIA 1FAVA 1VPCA 2CPSA 3HE5A 1FOSF 1J1EC 1MZ9A 1SQXK 3TNUA 3U1AA 1T2KC 2O1KA 4EIJA 2HODA 1IFDA 1T2KD 1JOCA 3TYYA 3E1IA 3H6PA 4JYCA 1M1JB 3EFGA 5AVXB 1JY2P 3B5NC 4XA4A 1SFCD 1L0LK 4W7ZA 1T8ZA 1HWTC 3KPEA 2JJLA 3BATA 1URQB 3M9QA 2N1TD 3MIWA 5AW3B 2JEEA 1NHLA 2KLVA 2NPSB 5AW4B 4WY4A 4XE5B 2IPPA 2FFDB 3V2RA 3HE4B 5APXA 3B5NB 1J2JB 2YMYA 3HTKA 1M1JC 1LT9A 1HGZA 3H32B 2YO2A 5AW0B 2GUSA 2MJZA 3B5ND 1KILB 1GK6A 2OARA 1N7LA 2IFNA 2C9LY 3B8EB 5KJ7D 5CJ0A 2HPCB 1ZV8A 4I6MC 3L35A 3V2NA 1IFMA 1N73B 1X79B 3RL0D 5APQA 2FXMA 3WMM0 4N78D 2E43A 1OWAA 1N7SB 1FDMA 1L4AC 1JY3O 1SQPK 3BVHA 3HE5B 2XKMA 3M91A 2J58A 3LIEA 1JCDA 2WWWA 5CMZA 1LTIC 1H89A 1RE4C 1FJKA 4W7YA 1LWUA 2FKWB 5AW6B 1GTWA 5APYA 5AVWB 3G3ZA 1FZCB 1LTGC 2Z4EA 4LC1A 3HUSA 1CZQA 1Z56A 3SWYA 1RF1B 2ZFCA 1NAFA 1KILD 2YKQA 4DZOA 3V4WA 1OXZA 4Y99B 2Q5UA 1SQBK 1NTKK 3KYQA 1W2EA 3V2QA 1ZR2A 3HD7A 2PAJA 3CI9A 1GD2E 3KQGA 1X8YA 3NFQA 3BRTB 5CCHC 2FYUK 3KDPB 1QL1A 1WT6A 2KOGA 3GHGA 3GHGB 3L37A 1JCCA 3V5BA 1HH0A 1NH4A 2GM4A 1FBMA 1SQVK 4KHXA 2FFDC 1GZLA 2WITA 3MGNA 1MFZA 2YKPA 1S9KD 2C9NY 3M0DA 2KSJA 3P8CE 5AVSB 1NTMK 2A45I 2FYZA 3R2PA 5BU5A 1HUCA 3HD7C 3VMXA 4Y99C 4GT1A 5AVUB 4C7RA 5CCGC 2LKMA 1G2CB 2WT7A 1FZCA 2WT7B 3P32A 1HTLC 2H7HA 4N78E 4HYTB 1LT9C 1L4AA 2Q3IA 1FZCC 4JYBA 1NWQA 2O01H 3OAKA 1JNMA 2C0WA 2XDJA 3RL0B 2R32A 5AW7B 5AVTB 2HLOA 4WY4C 1GL2A 1JY2N 1N86A 1N2DC 1NOHA 4OH8B 3VMYA 5AVVB 1KFNA 4AUWA 1SQQK 4WY4B 3RK2D 1CI6B 1RF0C 1AQ5A 5AVQB 1JMMA 4AYCA 1T3JA 5AW5B 3UIAA 1NTZK 2WPRA 1RF1C 1JTHB 1L4AD 1CI6A 4I2LC 5BVZA 3GHGC 1NKZB 1HVVA 1FZAA 2M8RA 5AW8B 2A45G 5AVRB 4IFFA 4N3YB 1GL2B 1XTGB 2WTYA 1RE3C 2HG5D 1LTBC 2NPSC 3IFMA 1S9KE 5KLVK 2E42A 2W6AA 3IR9A 3N4XA 1NO4A 5APTA 2Q7CA 1G2CA 3MD0A 3II6A 3RK3C 3RK2B 2BASA 3TNUB 1FZGA 1NU1K 3H32A 1YTZT 1RF0A 2N9BA 3HTKB 1N7SA 3I5CA 4JF7A 2XNXA 1SFCC 4B86A 5KJ7A 2P1JA 2WPSA 1X9VA 1N7SC 1N73A 1GL2C 2M3BA 3NMDA 1GL2D 1SLQA 1URQA 2HPCA 3NTNA 1QL2A 2WSFH 1GU5A 1N73C 1H88A 2IX7C 5AVZB 5APSA 1IFIA 1VDFA 5APUA 2VRSA 3C9IA 1HJBA 2YKOA 5KTBA 1SFCB 2J59M 3EQ2A 3LW5H 3HD7B 2HYNA 3P8CD 3MUDA 1PFIA 3OJAB 1YYCA 3HE4A 1MV8A 1NKNA 2N1TA 2Z5IA 2NPSA 1RE3A 2QM8A 2W6BA 1RF1A 1L4AB 4I1LA 2ZXEB 4GKGA 4RESB 2WSCH 1JO5A 3VP8A 1CW5A 3HRNA 1L0NK 2WSEH 1ZLLA 2KYVA 2WZ7A 3U59A 1ZR4A 2Q9IA 3A2AA 1HBWA 1KILC 1T3UA 1GK4A 2HODB 5CJ4A 1IFNA 3T97A 2H43A 4IFDK 3VP9A 5CCGD 1LTJA 2P2UA 3NXSA 3TK1A 3SWFA 1CSBA 3CL3D 3A5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WTY A;  1FOS E;  4AQR D;  3P7K A;  2P67 A;  2ZFC A;  5AW9 B;  1KQL A;  1NAF A;  1IO4 A;  1A02 F;  3VN0 A;  3A3Y B;  1S9K E;  3P8M C;  4DZO A;  2E42 A;  3V4W A;  2W6A A;  3M0A A;  1OXZ A;  5APW A;  2Q5U A;  3VTP C;  3IR9 A;  5AW1 B;  3L36 A;  2XU6 A;  2YO3 A;  1GD2 E;  2QM7 A;  5APT A;  1FAV A;  3KQG A;  1X8Y A;  3HE5 A;  2Q7C A;  3NFQ A;  3VYI A;  1FOS F;  2P7J A;  3MD0 A;  3TNU A;  1T2K C;  3KDP B;  5AW2 B;  2W27 A;  1T2K D;  2WPQ A;  3TYY A;  3L37 A;  4JYC A;  3V5B A;  3M9B A;  2BAS A;  5APV A;  5AVX B;  3LID A;  3TNU B;  5AVY B;  2YNY A;  2XZR A;  2KP8 A;  2N9B A;  4KHX A;  1HWT C;  3I5C A;  1GZL A;  2JJL A;  4B86 A;  2XV5 A;  3MGN A;  3A5T A;  1MFZ A;  1S9K D;  2WPS A;  2C9N Y;  3M0D A;  5AVS B;  5AW3 B;  4C46 A;  5AW4 B;  3M9H A;  2IPP A;  3NMD A;  4XE5 B;  1DH3 A;  1SLQ A;  1HUC A;  3VMZ A;  3VMX A;  3HE4 B;  2R3C A;  3NTN A;  5APX A;  1J2J B;  1GU5 A;  1H88 A;  4GT1 A;  4EOT A;  5AVU B;  3HTK A;  5AVZ B;  5APS A;  5APU A;  2VRS A;  1G2C B;  2WT7 A;  2YO2 A;  5AW0 B;  2WT7 B;  1HJB A;  3P32 A;  2H7H A;  1GK6 A;  4HYT B;  2Z5H A;  2C9L Y;  1H8A A;  3B8E B;  1YYC A;  1JUN A;  2Q3I A;  2R5D A;  4JYB A;  1NWQ A;  3HE4 A;  3M06 A;  1MV8 A;  3OAK A;  4I6M C;  1JNM A;  3L35 A;  2Z5I A;  2R32 A;  5AW7 B;  5AVT B;  2QM8 A;  5APQ A;  2ZXE B;  4GKG A;  4RES B;  3VMY A;  5AVV B;  4AUW A;  2E43 A;  1OWA A;  4C7N B;  4M3L A;  1MUU A;  1CI6 B;  3HE5 B;  3M91 A;  3V4Q A;  3A2A A;  3LIE A;  1HBW A;  2WWW A;  5CMZ A;  5AVQ B;  4AYC A;  5AW5 B;  1GK4 A;  3UIA A;  1H89 A;  1SP4 A;  2R5B A;  2WPR A;  3O8Z A;  3T97 A;  1CI6 A;  4I2L C;  5AW6 B;  1GTW A;  5APY A;  5AVW B;  1GU4 A;  1A02 J;  2P2U A;  3A7O A;  3NXS A;  4C7N A;  3TK1 A;  3SWF A;  1CSB A;  4LC1 A;  5AW8 B;  5AVR B;  1CZQ A; 
#chains in the Genus database with same CATH topology
 3CC2 P;  2OYH C;  3AE6 C;  1FOS E;  1DEB A;  1EDI A;  1PGO A;  1SQB J;  2P67 A;  3P7K A;  3AEE C;  5AW9 B;  1EC5 A;  5KJ7 C;  3BRV B;  1SFC A;  1N7S D;  1HJ0 A;  1AQT A;  2WVR A;  3P8M C;  1OIP A;  1NU1 D;  3PRJ A;  1LWU C;  1RHZ B;  1SQV E;  1WRG A;  1Q2N A;  2E5Y A;  2O01 J;  5H2F H;  5APW A;  1BCC J;  3D71 A;  1K9M Q;  5DJT B;  3RGU A;  3VTP C;  4EYY Q;  2QSI A;  1M7L A;  1KIL E;  3H1J D;  2E75 C;  3MTU E;  2WMM A;  1PPJ G;  3L36 A;  3BAS A;  3RK3 E;  3CCQ P;  3OW2 O;  4WY4 D;  2XU6 A;  4WVZ A;  2A06 G;  2YO3 A;  1NAY A;  2LXB A;  1EZV E;  2QM7 A;  1URQ D;  4WBA A;  1IFJ A;  1LT9 B;  2OYH B;  1X0T A;  2P7J A;  5CCG A;  1GDT A;  2OYI A;  1NTK J;  3L71 E;  3VMA A;  1FU1 A;  2I8D A;  1LTJ C;  3H1J E;  5AW2 B;  2YIU C;  1JEK A;  1SQV J;  3RK3 D;  4DOJ A;  1Q90 D;  2W27 A;  1JM0 A;  5H2F E;  3TGU D;  3CCU P;  1BDD A;  2WPQ A;  2K9Y A;  3H1K D;  1KYO H;  3M9B A;  1LT1 A;  1PGQ A;  1IZN B;  4R4L A;  5APV A;  3LID A;  4O9B A;  1KQF B;  2FFD A;  1FJP A;  1PL5 A;  1LTA C;  1LTJ B;  1W5C E;  2YNY A;  2IFM A;  2XZR A;  5AVY B;  2KP8 A;  2OYI B;  1R8E A;  3S1K A;  3L74 J;  1J1E B;  3USS A;  3CX5 D;  4JPZ B;  4LGD E;  4OGQ B;  1LTT C;  2JP3 A;  3Q3D A;  3HUS B;  3M0D C;  1FZB A;  1FZE A;  1OW7 A;  2XV5 A;  3H1K E;  1BCC D;  3FWN A;  3PTZ A;  1QLE D;  1TU3 F;  2UWJ E;  3L73 D;  5CCH A;  1WMK A;  1JY2 O;  3FGA D;  3JSV C;  4GOE A;  3TDK A;  3CCL P;  1QVF O;  3HD7 D;  1JY3 N;  4PJ0 E;  3HUS C;  2I1J A;  3AE2 C;  2NPS D;  1U7M A;  4C46 A;  1Q86 Q;  3M9H A;  4L73 A;  1VQM P;  1FZF A;  4KJM A;  1LWU B;  1DH3 A;  3VMZ A;  1G1J A;  1IC2 A;  2C0X A;  1NTZ D;  4PD4 I;  2R3C A;  2N1T C;  1OVU A;  2PGD A;  2K1A A;  1URQ C;  2OTK E;  4EOT A;  1PPJ D;  4PD4 D;  2A45 H;  2Y9Y A;  4Y28 J;  4YPC A;  5KLV G;  2KIK A;  4GIF A;  4DCK A;  2OYI C;  1DD3 A;  4L74 A;  1VQ9 P;  1JB0 J;  3MUD C;  4UB8 H;  2N1T B;  1SQP G;  3GLM A;  2OGU A;  3PH0 A;  1NTM D;  1J1D C;  1P84 D;  4N6J A;  2RH0 A;  2A06 E;  1YJW P;  2Z5H A;  3F5H A;  1NYH A;  1GW4 A;  1KMI Z;  1H8A A;  1JUN A;  2J5U A;  1R5S A;  4WB4 A;  2R5D A;  5CHX A;  3N7N A;  3AE9 C;  4ASV A;  3M06 A;  4H44 B;  4W80 A;  2O1J A;  2QA4 P;  1YJ9 P;  1NTM E;  1P84 E;  5CCH D;  3Q5P A;  4NPF X;  3L72 D;  5B5E H;  2P58 A;  4ZKU A;  3OA7 A;  1RY3 A;  1ZME C;  1VQP P;  3CWB J;  1EQ7 A;  1KB9 I;  3TSI A;  2D2C B;  2H8P D;  1NTZ G;  1LNQ A;  3CCV P;  2E76 B;  4WWI A;  1E5W A;  1JTH A;  1L0N G;  1GW3 A;  3QWO C;  2JO1 A;  2BCC G;  2IBZ D;  1GMJ A;  2LXC B;  2NRG A;  3L70 J;  3MHV A;  1BGY J;  2W8Z A;  1KIL A;  2FYU G;  3L72 E;  4IFM A;  3RL0 C;  4C7N B;  1SQX D;  3D6Y A;  3CMA P;  1EDL A;  2IBZ I;  1XTC C;  4M3L A;  1YIT P;  1KFM A;  1MUU A;  2PP6 A;  1U7J A;  1AFO A;  4U3F E;  3E1R A;  3V4Q A;  2KLU A;  2E74 B;  2ZYA A;  5GTI H;  1LGH B;  1YTZ I;  1R5L A;  1SVF A;  2KB7 P;  3B5N A;  1K73 Q;  2I1K A;  2Y0D A;  3BCC G;  3ZDM A;  1NTK D;  1VL2 A;  4YXW H;  5B66 E;  1SP4 A;  1SQB D;  2R5B A;  2ZJS E;  2CPB A;  3RK2 C;  4D6T G;  1NJI Q;  1JY3 P;  1RQU A;  1IK9 A;  2JWD A;  1P84 I;  3CLQ A;  3O8Z A;  5GTH H;  3Q5R A;  1LTS C;  2YIU B;  5KAF E;  2OYH A;  1YHQ P;  3L4F A;  3GG2 A;  5BU8 B;  2O01 N;  1GU4 A;  1A02 J;  1G1I A;  3A7O A;  4OWF A;  1ZXG A;  2MKV A;  2E76 C;  5L8R J;  4C7N A;  2D2C C;  3U1C A;  3FX0 A;  4HH2 A;  1Y9B A;  1VF5 D;  1EZV D;  1HGV A;  1J1D B;  3WUV A;  2ZT9 B;  4U3F G;  4AQR D;  1KQL A;  4ZKP A;  3L71 D;  3W67 A;  1KB9 D;  1EZV I;  1IO4 A;  1A02 F;  1L0L D;  3A3Y B;  3VOP A;  1RE4 A;  3RK3 B;  3L75 G;  2ZYD A;  4PV1 B;  4TLF A;  3VN0 A;  2K9J A;  1M1J A;  3KXD A;  4LLH A;  1ZN5 A;  2POH A;  1KZU B;  3V2P A;  3M0A A;  2GUV A;  4I7Z C;  1IJD B;  2YXQ B;  1K8A Q;  1U57 A;  5KAI H;  3CXH I;  3H1J G;  3R4Y A;  1VQO P;  2AEM A;  5AW1 B;  3PP5 A;  2QEX P;  2FYU D;  2HFE D;  2IZ1 A;  1UIX A;  2FYN C;  3H1H G;  3Q5S A;  3CXH D;  1AJY A;  3C8V A;  1KQG B;  2L5G B;  1DX7 A;  3VYI A;  1Q81 Q;  1FAV A;  1VPC A;  1BCC E;  1SQP D;  1ZW0 A;  2CPS A;  3HE5 A;  3ITK A;  1LP1 B;  1FOS F;  1J1E C;  1MZ9 A;  1PPJ E;  2Q6Q A;  1SQX K;  2RN0 A;  2Y0E A;  3O6Q A;  3TNU A;  3U1A A;  1T2K C;  1H0T A;  2Y9Z A;  2O1K A;  3AE8 C;  4HKZ H;  4EIJ A;  2HOD A;  1IFD A;  2KZJ A;  2QJK B;  1JOC A;  3AE1 C;  3E1I A;  3H6P A;  4UB6 H;  4JYC A;  3TYY A;  1T2K D;  1VQL P;  1M1J B;  3EFG A;  4L75 A;  5AVX B;  2M3E A;  3H1L J;  1QGK B;  3L75 D;  4BXL A;  3Q1M A;  1VQ7 P;  1JY2 P;  3QH9 A;  1OZH A;  1KB9 H;  2ZVO B;  1SFC D;  1L0L K;  3B5N C;  4W7Z A;  4XA4 A;  1BGY D;  1AVY A;  1T8Z A;  1HWT C;  3KPE A;  4HJG H;  2JJL A;  2IBZ G;  3BAT A;  4GOF A;  3TF5 A;  3ABV C;  1NU1 J;  1URQ B;  2FYN B;  2N1T D;  3AEC C;  3M9Q A;  3MIW A;  4PJ0 H;  5AW3 B;  3CCR P;  2B87 B;  2RKL A;  2JEE A;  1NHL A;  2KLV A;  2NPS B;  5KKZ C;  4IL6 X;  2WSE J;  2IBZ E;  5AW4 B;  4WY4 A;  3AEB C;  4XE5 B;  1M8O B;  2E75 B;  2IPP A;  5EFW B;  2FFD B;  3V2R A;  1EDK A;  3HE4 B;  3W68 A;  1VF5 C;  1NTK G;  3AEG C;  3KZI E;  1ZOY C;  5APX A;  4Z1M H;  3B5N B;  2WPV B;  1J2J B;  1QX8 A;  2YMY A;  3H1I D;  2Q9I A;  2IYO A;  3HTK A;  1NU1 G;  3PHL A;  1S3J A;  1M1J C;  2QVA A;  1LT9 A;  5DJU B;  1HGZ A;  3H32 B;  3L73 G;  1YJN P;  2P10 A;  2YO2 A;  1SQB E;  5AW0 B;  2GUS A;  2MJZ A;  3B5N D;  3H1L E;  1KIL B;  1GK6 A;  3MZW B;  2PRR A;  2OAR A;  1N7L A;  1FDO A;  2IFN A;  2C9L Y;  3B8E B;  5KJ7 D;  1Q82 Q;  1BSH A;  3E7K A;  5CJ0 A;  4NPD A;  5E79 H;  1OFC X;  3EWK A;  2HPC B;  1ZV8 A;  3SWK A;  5GTH E;  5KAI E;  2V4H A;  2QJP B;  4I6M C;  3L35 A;  3PLN A;  3V2N A;  3AE7 C;  3B4S A;  4PD4 H;  1IFM A;  3G4S P;  1N73 B;  2QJY C;  1X79 B;  3RL0 D;  1SQP J;  1L0N J;  2E74 C;  5APQ A;  2WSF J;  3V6I A;  2WQY C;  4ZNC A;  4PV1 C;  1Y47 A;  2FXM A;  3WMM 0;  2KSE A;  2OQQ A;  3H1H J;  4N78 D;  3H1I J;  2A06 D;  1OWA A;  4H44 C;  2BEZ F;  1VQ5 P;  2E43 A;  1N7S B;  1FDM A;  1L4A C;  1JY3 O;  1SQP K;  1YI2 P;  1EXJ A;  3D70 A;  3BVH A;  3HE5 B;  2XKM A;  3M91 A;  3TGU E;  2J58 A;  2ZAE B;  3L70 E;  3LIE A;  1JCD A;  4PD4 E;  4EI2 A;  1ZRT D;  2WWW A;  1S5L X;  5CMZ A;  5KAF H;  1L0L E;  1LTI C;  1KOR A;  1H89 A;  1RE4 C;  1FJK A;  2BCC J;  2R3S A;  4W7Y A;  4A7P A;  2QRX A;  1L2P A;  1LWU A;  1VQK P;  5K5G B;  1BE3 E;  1BSN A;  2D2C D;  2FKW B;  1KTM A;  4MN4 C;  3FXD A;  5AW6 B;  1M56 D;  1GTW A;  3GW6 A;  5APY A;  5AVW B;  3G3Z A;  1FZC B;  4DJG A;  3CD6 P;  4U7J A;  1LTG C;  4KT0 J;  2Z4E A;  3B71 A;  1S5L E;  3L73 E;  4LC1 A;  1PP9 J;  1EXI A;  3HUS A;  1CZQ A;  4U3F D;  1SQP E;  1KD1 Q;  1Z56 A;  3SWY A;  1RF1 B;  2ZFC A;  4D6T J;  1VQ6 P;  1NAF A;  1EDJ A;  1KIL D;  3JCU H;  2YKQ A;  2KNC B;  3KZI H;  1NTK E;  3L71 J;  4OGQ D;  4DZO A;  1NTZ E;  1FC2 C;  3V4W A;  3A0H E;  1OXZ A;  4Y99 B;  2Q5U A;  4BRY A;  1K05 A;  1USD A;  1SQB K;  1P84 H;  2FXO A;  1NTM G;  1MFT A;  1NTK K;  3KYQ A;  2FYU J;  1W2E A;  3V2Q A;  5TIS H;  1ZR2 A;  2K3R A;  5CBO A;  5C39 A;  3HD7 A;  4IOI H;  1KN7 A;  3CPW O;  2FBW C;  2PAJ A;  2QE7 H;  3CI9 A;  3L74 E;  3RBX A;  1GD2 E;  2B89 A;  2KXP B;  2V7Q H;  3KQG A;  1X8Y A;  2O3J A;  3NFQ A;  1N8R Q;  3BRT B;  5TIS E;  1M90 Q;  3IF4 A;  1UII A;  2B87 A;  5CCH C;  2FYU K;  4GOD A;  3KDP B;  1PGJ A;  1QL1 A;  1WT6 A;  4L76 A;  3CCJ P;  2KOG A;  1YQ4 C;  3A0H H;  3CX5 E;  2OTJ P;  1SQQ E;  3GHG A;  2OYO A;  3GHG B;  1JCC A;  3L37 A;  1VQ4 P;  3PJS K;  3V5B A;  3MP7 B;  3JCU E;  1DD4 A;  1HH0 A;  1KYO E;  1PV3 A;  5CBN A;  2KZI A;  3WUT A;  2K88 A;  3CCE P;  1NH4 A;  4XFJ A;  1Y8A A;  1FBM A;  1SQV K;  2AXC A;  3KHU A;  4KHX A;  2FFD C;  3AED C;  2ZXX A;  1GZL A;  3CCM P;  1SQQ G;  2WSC J;  1VF5 B;  2WIT A;  3MGN A;  1S4X A;  1MFZ A;  3AE5 C;  4CPG A;  3BCC J;  2YKP A;  1S9K D;  2IDB A;  1M1K Q;  1M57 D;  2C9N Y;  1IK7 A;  3M0D A;  2KSJ A;  1ZP0 C;  3P8C E;  5AVS B;  3Q2Y A;  1NTM K;  2A45 I;  3C1L A;  3H1K G;  4GDO A;  1JMB A;  1IFP A;  2FYZ A;  2M5A A;  3R2P A;  2JDI H;  5BU5 A;  3I56 P;  1YIJ P;  1HUC A;  3AEF C;  2ITA A;  3RL0 g;  3HD7 C;  3VMX A;  1KQS O;  3JC2 2;  4Y99 C;  1NU1 E;  1K04 A;  1PZQ A;  3SFE C;  3D6Z A;  4YTP C;  1SQV G;  1NTM J;  2IZ0 A;  4GT1 A;  5AVU B;  2FY8 A;  3L70 D;  1YBK A;  2ZVN B;  2KK7 A;  4C7R A;  5CCG C;  2LKM A;  1G2C B;  2WT7 A;  1FZC A;  2WT7 B;  3L71 G;  1HTL C;  3L74 D;  3P32 A;  2H7H A;  2YXR B;  4N78 E;  4HYT B;  3AE3 C;  4OGQ C;  3SSU A;  1EZV G;  2H88 C;  1LT9 C;  1L4A A;  2Y0C A;  1OVR A;  5E79 E;  2Q3I A;  1FZC C;  2LR2 A;  4JYB A;  1NWQ A;  2CK3 H;  3CME P;  4R4M A;  4H0L B;  5B66 H;  1QVG O;  2O01 H;  1NVO A;  1OX3 A;  1SS1 A;  3H1I G;  3OAK A;  1JNM A;  2C0W A;  2QIW A;  2XDJ A;  3BCC E;  1OW8 A;  3H1I E;  3GMA A;  1AA0 A;  2M5A B;  2Q1K A;  2R32 A;  3RL0 B;  5AW7 B;  1SQQ J;  5AVT B;  3G9R A;  2HLO A;  4WY4 C;  1GL2 A;  4IL6 E;  1JY2 N;  1N86 A;  5KLI B;  1N2D C;  1PP9 G;  3CXH E;  1NOH A;  5TJH A;  2AEJ A;  4OH8 B;  3VMY A;  5AVV B;  1KFN A;  2ZT9 C;  3TGU G;  4AUW A;  2KS1 B;  3G71 P;  2BCC E;  3CX5 H;  3L75 J;  4JQ0 D;  1SQQ K;  4WY4 B;  3RK2 D;  3H1K J;  1CI6 B;  2QJY B;  1BCC G;  4JBZ A;  3K5B A;  2W83 C;  1DIP A;  3S4R A;  1RF0 C;  1X22 A;  3AE4 C;  1BE3 G;  1AQ5 A;  5AVQ B;  1JMM A;  1VQ8 P;  4AYC A;  1T3J A;  5AW5 B;  3UIA A;  3CCS P;  2B88 A;  1NTZ K;  2WPR A;  1RF1 C;  1JTH B;  1L0L G;  1L4A D;  1W2B O;  1S72 P;  1BGY E;  1CI6 A;  2FXP A;  4H44 D;  4I2L C;  5KLV D;  5M1B A;  1USE A;  3H25 A;  5BVZ A;  1VQN P;  2E74 D;  1RH5 B;  2KS1 A;  3GHG C;  4PV1 D;  2AEF A;  1NKZ B;  1HVV A;  1FZA A;  3CWB G;  3SFD C;  1NTZ J;  2M8R A;  3AEA C;  2A45 G;  4RKU J;  5AVR B;  4IFF A;  5AW8 B;  2HR3 A;  1BE3 J;  4N3Y B;  1GL2 B;  1AV1 A;  1XTG B;  2XND H;  5KLV E;  2DW3 A;  2WTY A;  3A0B E;  4BRY B;  1S1C X;  2QG4 A;  4RJT A;  3O6Q B;  4H0L C;  4H13 B;  1RE3 C;  1SQB G;  2HG5 D;  1LTB C;  2NPS C;  3LW5 J;  5KKZ B;  1YQ3 C;  2K37 A;  2V7Q J;  3IFM A;  3S9O A;  4D6T D;  1S9K E;  3L73 J;  5KLV K;  2E42 A;  2W6J H;  2SPZ A;  3BCC D;  4UB6 E;  1BE3 D;  2W6A A;  1PIX A;  4IL6 H;  3T97 B;  2ZT9 D;  3FXE A;  3G6E P;  3IR9 A;  1D7M A;  1DEE G;  3N4X A;  2K9J B;  1NO4 A;  5KLI C;  5KLV J;  3H1L D;  3H1L G;  5APT A;  3L74 G;  1G2C A;  1L0N D;  3IAO A;  2Q7C A;  3CWB D;  2BCC D;  3F89 A;  3MD0 A;  3II6 A;  3L72 J;  2WSS H;  3RBZ A;  3RK3 C;  4BWN A;  2R44 A;  3RK2 B;  4U3F J;  2BAS A;  4YXD C;  3TNU B;  1FZG A;  1NU1 K;  3H32 A;  2GM4 A;  1SQX J;  1YTZ T;  1RF0 A;  1H0T B;  1SQX G;  2N9B A;  3HTK B;  1N7S A;  2E75 D;  2W90 A;  2XNX A;  3I5C A;  1QEX A;  1MKM A;  1SFC C;  2IYP A;  3IN6 A;  4JF7 A;  2KUB A;  2JKV A;  4I7Z B;  3WU2 E;  2G3A A;  2P1J A;  5KJ7 A;  2WPS A;  4EDF A;  2NZ2 A;  1X9V A;  2H89 C;  4H13 C;  1L0L J;  4ASW A;  1N7S C;  2ZYG A;  3WU2 H;  1FS0 E;  1N73 A;  1GL2 C;  2G8Y A;  2M0B A;  2QJK C;  2PFX A;  2M3B A;  3NMD A;  4DT0 A;  1OW6 A;  1PGP A;  4B86 A;  1GL2 D;  1SLQ A;  1URQ A;  1SQX E;  3CX5 I;  3GF7 A;  4QMA A;  2HPC A;  4K3A A;  2QJP C;  4H13 D;  5GTI E;  3NTN A;  1QL2 A;  4ZMD A;  2WSF H;  1GU5 A;  1N73 C;  1H88 A;  4OVN F;  2IX7 C;  5AVZ B;  1Q7Y Q;  5APS A;  1NGM B;  1HF9 A;  1IFI A;  1VDF A;  2N9Y B;  5APU A;  2VRS A;  3A0B H;  3C9I A;  1SQQ D;  1HJB A;  2YKO A;  5KTB A;  1KV4 A;  1SFC B;  2J59 M;  3EQ2 A;  3LW5 H;  3HD7 B;  2HYN A;  3P8C D;  3MUD A;  1KC8 Q;  3H1H E;  3CWB E;  1PFI A;  3CC7 P;  2KI7 B;  1KYO D;  2RMZ A;  3OJA B;  1YYC A;  1FE6 A;  3HE4 A;  5B5E E;  3CC4 P;  1MV8 A;  1NKN A;  1KYO I;  1SQV D;  1FDI A;  1OMI A;  2N1T A;  3TGU J;  1BDC A;  2Z5I A;  2B9B A;  2KNC A;  3H1H D;  3L75 E;  2NPS A;  4K35 A;  1RE3 A;  2QM8 A;  2W6B A;  4UB8 E;  1KB9 E;  1RF1 A;  1L4A B;  2AXT H;  2JR8 A;  2JWA A;  2Q3E A;  2ZXE B;  2E76 D;  4I1L A;  1LJ2 A;  1RQV A;  2L91 A;  1AVO A;  1OVV A;  1ZRT E;  2WSC H;  3H1J J;  4GKG A;  4RES B;  4TT3 H;  2OTL P;  1JO5 A;  3VP8 A;  1CW5 A;  3FWL A;  3HRN A;  2AXT E;  1L0N K;  2WSE H;  3WUU A;  1ZLL A;  2KYV A;  1PP9 E;  2WZ7 A;  3CXH H;  1S2E A;  1E79 H;  2FYU E;  3L72 G;  3A2A A;  3U59 A;  4RO0 A;  1ZR4 A;  3GF3 A;  1KIL C;  1S5L H;  3EFF K;  1HBW A;  4H0L D;  1BGY G;  1T3U A;  1L0N E;  1GK4 A;  2E5T A;  2HOD B;  4D6T E;  5CJ4 A;  1IFN A;  1T6A A;  3T97 A;  4HB1 A;  2H43 A;  4IFD K;  1PP9 D;  3VP9 A;  1LP1 A;  5CCG D;  1LTJ A;  2P2U A;  3I55 P;  3NXS A;  3TK1 A;  3SWF A;  2YMK A;  1CSB A;  3L70 G;  4NPE A;  2BEQ D;  2GA1 A;  3CL3 D;  3A5T A; 
#chains in the Genus database with same CATH homology
 2OYH C;  1FOS E;  1DEB A;  3P7K A;  2P67 A;  5AW9 B;  5KJ7 C;  3BRV B;  1SFC A;  1N7S D;  3P8M C;  1LWU C;  1WRG A;  5APW A;  3VTP C;  1M7L A;  3MTU E;  3L36 A;  3BAS A;  4WY4 D;  2XU6 A;  2YO3 A;  2QM7 A;  1URQ D;  4WBA A;  1IFJ A;  1LT9 B;  2OYH B;  2P7J A;  5CCG A;  1GDT A;  2OYI A;  1FU1 A;  4DOJ A;  1LTJ C;  3RK3 D;  5AW2 B;  2W27 A;  2WPQ A;  3M9B A;  1FJP A;  5APV A;  2FFD A;  3LID A;  4O9B A;  2OYI B;  1LTA C;  1LTJ B;  5AVY B;  2YNY A;  2IFM A;  2XZR A;  2KP8 A;  1J1E B;  4LGD E;  1LTT C;  3HUS B;  3M0D C;  1FZB A;  1FZE A;  2XV5 A;  5CCH A;  1JY2 O;  3HD7 D;  1JY3 N;  4C46 A;  3HUS C;  2I1J A;  2NPS D;  3M9H A;  1FZF A;  1DH3 A;  1LWU B;  3VMZ A;  1G1J A;  1IC2 A;  2C0X A;  2R3C A;  2N1T C;  1URQ C;  4EOT A;  2A45 H;  2OYI C;  4GIF A;  2N1T B;  4N6J A;  1J1D C;  2Z5H A;  1GW4 A;  1H8A A;  1JUN A;  4WB4 A;  5CHX A;  2R5D A;  3N7N A;  3M06 A;  4W80 A;  2O1J A;  5CCH D;  4ZKU A;  3OA7 A;  1RY3 A;  3TSI A;  1EQ7 A;  2H8P D;  1E5W A;  1JTH A;  1GW3 A;  4IFM A;  1KIL A;  3RL0 C;  4C7N B;  1XTC C;  4M3L A;  1KFM A;  1MUU A;  2PP6 A;  1AFO A;  3V4Q A;  1LGH B;  1YTZ I;  1SVF A;  2KB7 P;  3B5N A;  2I1K A;  1SP4 A;  2R5B A;  3RK2 C;  2CPB A;  1JY3 P;  1IK9 A;  3O8Z A;  3CLQ A;  1LTS C;  2OYH A;  3L4F A;  5BU8 B;  1GU4 A;  1A02 J;  1G1I A;  3A7O A;  4C7N A;  3U1C A;  4HH2 A;  1HGV A;  1J1D B;  4AQR D;  1KQL A;  4ZKP A;  1IO4 A;  1A02 F;  3VOP A;  3A3Y B;  3VN0 A;  1RE4 A;  3RK3 B;  4LLH A;  1M1J A;  3V2P A;  1ZN5 A;  2POH A;  1KZU B;  3M0A A;  2GUV A;  1IJD B;  5AW1 B;  3PP5 A;  2HFE D;  2L5G B;  1DX7 A;  3VYI A;  1FAV A;  1VPC A;  2CPS A;  3HE5 A;  1FOS F;  1J1E C;  1MZ9 A;  1SQX K;  3TNU A;  3U1A A;  1T2K C;  2O1K A;  4EIJ A;  2HOD A;  1IFD A;  1T2K D;  1JOC A;  3TYY A;  3E1I A;  3H6P A;  4JYC A;  1M1J B;  3EFG A;  5AVX B;  1JY2 P;  3B5N C;  4XA4 A;  1SFC D;  1L0L K;  4W7Z A;  1T8Z A;  1HWT C;  3KPE A;  2JJL A;  3BAT A;  1URQ B;  3M9Q A;  2N1T D;  3MIW A;  5AW3 B;  2JEE A;  1NHL A;  2KLV A;  2NPS B;  5AW4 B;  4WY4 A;  4XE5 B;  2IPP A;  2FFD B;  3V2R A;  3HE4 B;  5APX A;  3B5N B;  1J2J B;  2YMY A;  3HTK A;  1M1J C;  1LT9 A;  1HGZ A;  3H32 B;  2YO2 A;  5AW0 B;  2GUS A;  2MJZ A;  3B5N D;  1KIL B;  1GK6 A;  2OAR A;  1N7L A;  2IFN A;  2C9L Y;  3B8E B;  5KJ7 D;  5CJ0 A;  2HPC B;  1ZV8 A;  4I6M C;  3L35 A;  3V2N A;  1IFM A;  1N73 B;  1X79 B;  3RL0 D;  5APQ A;  2FXM A;  3WMM 0;  4N78 D;  2E43 A;  1OWA A;  1N7S B;  1FDM A;  1L4A C;  1JY3 O;  1SQP K;  3BVH A;  3HE5 B;  2XKM A;  3M91 A;  2J58 A;  3LIE A;  1JCD A;  2WWW A;  5CMZ A;  1LTI C;  1H89 A;  1RE4 C;  1FJK A;  4W7Y A;  1LWU A;  2FKW B;  5AW6 B;  1GTW A;  5APY A;  5AVW B;  3G3Z A;  1FZC B;  1LTG C;  2Z4E A;  4LC1 A;  3HUS A;  1CZQ A;  1Z56 A;  3SWY A;  1RF1 B;  2ZFC A;  1NAF A;  1KIL D;  2YKQ A;  4DZO A;  3V4W A;  1OXZ A;  4Y99 B;  2Q5U A;  1SQB K;  1NTK K;  3KYQ A;  1W2E A;  3V2Q A;  1ZR2 A;  3HD7 A;  2PAJ A;  3CI9 A;  1GD2 E;  3KQG A;  1X8Y A;  3NFQ A;  3BRT B;  5CCH C;  2FYU K;  3KDP B;  1QL1 A;  1WT6 A;  2KOG A;  3GHG A;  3GHG B;  3L37 A;  1JCC A;  3V5B A;  1HH0 A;  1NH4 A;  2GM4 A;  1FBM A;  1SQV K;  4KHX A;  2FFD C;  1GZL A;  2WIT A;  3MGN A;  1MFZ A;  2YKP A;  1S9K D;  2C9N Y;  3M0D A;  2KSJ A;  3P8C E;  5AVS B;  1NTM K;  2A45 I;  2FYZ A;  3R2P A;  5BU5 A;  1HUC A;  3HD7 C;  3VMX A;  4Y99 C;  4GT1 A;  5AVU B;  4C7R A;  5CCG C;  2LKM A;  1G2C B;  2WT7 A;  1FZC A;  2WT7 B;  3P32 A;  1HTL C;  2H7H A;  4N78 E;  4HYT B;  1LT9 C;  1L4A A;  2Q3I A;  1FZC C;  4JYB A;  1NWQ A;  2O01 H;  3OAK A;  1JNM A;  2C0W A;  2XDJ A;  3RL0 B;  2R32 A;  5AW7 B;  5AVT B;  2HLO A;  4WY4 C;  1GL2 A;  1JY2 N;  1N86 A;  1N2D C;  1NOH A;  4OH8 B;  3VMY A;  5AVV B;  1KFN A;  4AUW A;  1SQQ K;  4WY4 B;  3RK2 D;  1CI6 B;  1RF0 C;  1AQ5 A;  5AVQ B;  1JMM A;  4AYC A;  1T3J A;  5AW5 B;  3UIA A;  1NTZ K;  2WPR A;  1RF1 C;  1JTH B;  1L4A D;  1CI6 A;  4I2L C;  5BVZ A;  3GHG C;  1NKZ B;  1HVV A;  1FZA A;  2M8R A;  5AW8 B;  2A45 G;  5AVR B;  4IFF A;  4N3Y B;  1GL2 B;  1XTG B;  2WTY A;  1RE3 C;  2HG5 D;  1LTB C;  2NPS C;  3IFM A;  1S9K E;  5KLV K;  2E42 A;  2W6A A;  3IR9 A;  3N4X A;  1NO4 A;  5APT A;  2Q7C A;  1G2C A;  3MD0 A;  3II6 A;  3RK3 C;  3RK2 B;  2BAS A;  3TNU B;  1FZG A;  1NU1 K;  3H32 A;  1YTZ T;  1RF0 A;  2N9B A;  3HTK B;  1N7S A;  3I5C A;  4JF7 A;  2XNX A;  1SFC C;  4B86 A;  5KJ7 A;  2P1J A;  2WPS A;  1X9V A;  1N7S C;  1N73 A;  1GL2 C;  2M3B A;  3NMD A;  1GL2 D;  1SLQ A;  1URQ A;  2HPC A;  3NTN A;  1QL2 A;  2WSF H;  1GU5 A;  1N73 C;  1H88 A;  2IX7 C;  5AVZ B;  5APS A;  1IFI A;  1VDF A;  5APU A;  2VRS A;  3C9I A;  1HJB A;  2YKO A;  5KTB A;  1SFC B;  2J59 M;  3EQ2 A;  3LW5 H;  3HD7 B;  2HYN A;  3P8C D;  3MUD A;  1PFI A;  3OJA B;  1YYC A;  3HE4 A;  1MV8 A;  1NKN A;  2N1T A;  2Z5I A;  2NPS A;  1RE3 A;  2QM8 A;  2W6B A;  1RF1 A;  1L4A B;  4I1L A;  2ZXE B;  4GKG A;  4RES B;  2WSC H;  1JO5 A;  3VP8 A;  1CW5 A;  3HRN A;  1L0N K;  2WSE H;  1ZLL A;  2KYV A;  2WZ7 A;  3U59 A;  1ZR4 A;  2Q9I A;  3A2A A;  1HBW A;  1KIL C;  1T3U A;  1GK4 A;  2HOD B;  5CJ4 A;  1IFN A;  3T97 A;  2H43 A;  4IFD K;  3VP9 A;  5CCG D;  1LTJ A;  2P2U A;  3NXS A;  3TK1 A;  3SWF A;  1CSB A;  3CL3 D;  3A5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...