5AW9B

Kinetics by x-ray crystallography: native e2.mgf42-.2k+ crystal for rb+ bound crystals
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
total genus 51
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw9B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw9B02
3L36A 4RESB 2Z5HA 1G2CB 3LIEA 5AVUB 5CMZA 5AW1B 5AVTB 2WT7A 4AYCA 2R32A 1OXZA 2WPQA 3NMDA 3M91A 5AW8B 3HE5B 3I5CA 1MUUA 1OWAA 3VYIA 5APQA 1T2KD 3M9HA 4B86A 5APTA 4KHXA 1H8AA 3NXSA 4EOTA 3UIAA 5AW5B 1CI6B 1X8YA 2JJLA 3KQGA 1IO4A 1S9KD 3L35A 3KDPB 3P7KA 4I6MC 5AW3B 1GD2E 1GZLA 2WPRA 2C9LY 2E42A 5AVZB 5AW6B 1NWQA 1YYCA 3A2AA 3HE4B 4C46A 1MFZA 2R5DA 2XU6A 3NFQA 5AVSB 1GU4A 3MD0A 1JNMA 2IPPA 1H88A 2W6AA 3VMZA 2VRSA 3A7OA 5AW7B 2QM7A 4LC1A 1HBWA 2Q3IA 1SP4A 2YNYA 3TNUB 5APSA 1GK4A 3TK1A 3V4WA 1HJBA 2XV5A 5APWA 1JUNA 3M0DA 1T2KC 2YO3A 3MGNA 1KQLA 1HUCA 2WPSA 3T97A 2XZRA 5AW9B 3B8EB 4C7NB 3TYYA 5APVA 1CI6A 4XE5B 1CSBA 2P7JA 1FOSE 4AUWA 5APYA 3SWFA 2E43A 1J2JB 1FOSF 4HYTB 3VMXA 2C9NY 1SLQA 4I2LC 5AVWB 2WWWA 5APXA 1S9KE 1FAVA 5AVRB 3HE4A 1H89A 3NTNA 1A02F 3L37A 3P32A 2P2UA 2H7HA 1MV8A 1HWTC 4GKGA 1A02J 2R5BA 2WT7B 2N9BA 2R3CA 2BASA 2P67A 3V4QA 3M06A 3O8ZA 1GK6A 3OAKA 3HE5A 5AVVB 3V5BA 2KP8A 5AW4B 5AVQB 2W27A 3VTPC 2ZFCA 1GTWA 3TNUA 3P8MC 5AW2B 2ZXEB 1NAFA 4M3LA 2WTYA 4RETB 2YO2A 5AW0B 1GU5A 3WGVB 1CZQA 2Z5IA 3VMYA 2QM8A 4C7NA 2Q5UA 5AVYB 3LIDA 3VN0A 4AQRD 5AVXB 4JYCA 3A3YB 3M9BA 1DH3A 5APUA 3M0AA 3A5TA 2Q7CA 4DZOA 4GT1A 3HTKA 3IR9A 3WGUB 4JYBA
chains in the Genus database with same CATH superfamily
4ACPA 2H8PB 4K3JH 2HMID 1K4DB 3K4AA 1VA9A 4GFTB 2WVSA 3JWDC 2VLJE 2YN5A 3VGAC 2PPDA 3UO1H 1GZQA 4MXVF 3CFCL 4XNQA 4UBDD 2MQ0A 4G8EA 5E5MA 5EPMA 2K9YA 3Q01A 3BJLA 3PXJA 1S7QB 2DBLH 2GUOA 3MV7D 4DQAA 3N9GH 2YAPA 5KS9A 3IGLA 4W70A 5KJ7D 5DUML 1CGYA 4D3CL 1J10A 1N5AA 2HX7A 1Q9LB 3QDJB 1QFPA 3KHQA 1B3JA 1FHGA 4GUPB 4Y2LA 5HDOA 2ZAEB 2HFEB 2HFGH 5IROA 4OZFB 1M42A 3BZFA 4L4TD 4FZ8H 3CXFA 1UD4A 4M6AA 1G7JB 3HS9A 4N2OA 1WT5C 1DSFL 1X3DA 4PR5A 3AEBC 1YNTF 1KV7A 4GI9A 1KENL 5JW4Q 3X14B 1JIBA 2WUBH 4XX1G 1KYUA 4JDEB 3UJJH 4KITB 3AEGC 4HGWB 1KLUB 3RL0g 4YSSA 3ECBA 1N0XH 1WP6A 2WUCH 1OTTC 1OY3B 3QI9B 5CZRA 2NY7H 2JQMA 1OKEA 3D39A 1JXGA 3MJ6A 3NQKA 3V7MA 5MP6L 2R0ZH 4KC3B 1QVFO 1P84H 1Y18B 4PGBB 1HCZA 3LIZA 2EUWA 5KAIH 4YHLL 4PJIA 4WTQA 1L4AA 1MCDA 4NQDE 4NN7B 1W6LA 3LB6D 5HYSG 2HG0A 1WZKA 3KJ6L 1SJHA 1XXDC 3SYQA 4QRPA 4EXPX 1Y47A 4PYHA 2KZJA 1RF1B 2AQQA 4U4BA 5HSFA 1SQPE 1H9DA 1S4IA 5HVHB 4PRPB 3K46A 3VXUE 4L23A 3O6QB 2BSRA 3NTNA 1HEHC 2EYSA 2P2UA 4GDOA 4QOKD 5C3TA 4OJAA 1YUKB 2Z65C 15C8L 4JDZB 3RTLA 3CLFH 2BVOB 2X3AA 4MX7A 1OZUA 1KSRA 4NC0B 3X11B 1BQSA 2JIXA 3VQ1C 3TBCA 3VD2A 2XN1A 2X2HA 5F7HA 3V2QA 5DJ8A 4PGCA 5A16B 2KKQA 1BF5A 1G1IA 3H6AA 4KDTC 3EYVA 4WCYL 4XGZA 1ETJA 3NG5A 1GGIL 4Z76B 1Q9OA 2Y9YA 2NY1C 1S9WB 2IZ1A 3RJDA 3VFPB 3B71A 4JFYB 4PJGA 3CC4P 1SM3H 4OVVA 2P44B 4EUPB 2V2XB 3ZDZE 2EC8A 2VJ8A 4JO3H 5GRXG 1T1ZA 2FUTA 3ZR6A 1CICC 4EI0A 4AGNA 2V7QJ 1M9WA 1ZA3B 4IGBC 5JYLA 4K2UL 4LCCB 1DJYA 2YSSA 4HC1H 4XMWA 2HXAA 3OKMA 2EJ1A 2JV6A 4AGMA 4PJCB 4RDQF 3AB0C 3LIEA 2D3LA 1U3NA 1DLFL 1KCRL 2VN7A 3NFPB 5D2LF 4TKWA 4ZOBA 2BWDA 2YAFA 5MERA 3BO8A 2CO6A 3VGFA 1SQVG 3N04A 4R5VA 4S0SD 5E2TL 1IGYA 3BLPX 5EC1B 1HDMA 2EDEA 2DM2A 3CXHK 4FHKA 4Y8DC 1V3KA 2M1KA 3R8QA 1MCIA 2CNYA 4M7ZB 3LPWA 2ZQKA 1QAWA 1TCRA 1OCZB 2K6YA 3G5XB 5E2UH 5GS1B 2FIKA 4N86A 4JO2L 4X6BA 2XWJB 1ZN5A 4J8QA 2VISA 4XPHH 4YJZL 1A7PH 1O9VA 2B2XH 1BD2D 1OAYL 1D2PA 2FECL 4N2KA 4G3YL 4EDXA 3ULSB 1U7JA 5H37H 5FDWA 4ODSL 1EZVY 1DFBL 4EEEA 1QNIA 2EXSA 2PYEB 1LWUA 4WTZA 2AABH 4J3OH 3MRQB 1EAJA 1YYML 1BQRA 1CE1H 3CUPA 2IPKB 2ATPA 4U6HA 5DEGA 3Q3GA 1D5BB 1OEZW 1TJIL 1AKPA 3M6DA 3O3EB 4UWQB 5BVZA 2WAQA 3IJEB 2VL5A 4MA7L 3BXNB 1X22A 3UAJA 4L29A 5E8OA 2WWKT 2DQHL 4AGOA 3OBAA 3DGCR 4JKPL 4BSWB 3SZ6A 4WGKA 1IAIL 4ZZKA 3QE5A 1NSNL 2H1PH 2IDUA 3SSUA 1ETZA 2ZKMX 1EDKA 3HRPA 2MWCA 4KI1A 2LABA 4N4YB 4KVPA 3IF1B 5IEHA 5KYYA 3PGCB 1DEDA 2BNRE 2ESVA 3Q2NA 3JCUH 3B7YA 2IH8A 3QK0A 4PCTA 3RIFK 4AVHA 3L4CA 2DWEA 4NDMB 4OCRL 4OLWL 5BXFA 4YWGH 3HD7A 1PIXA 4PTUB 3QAQA 4GKOA 1T5XB 1YN6A 5KVDE 5A7EA 3TF5A 1DVFD 1RIUL 1X4XA 1FLRL 2VDLB 1LE5A 4EIJA 2CLVA 4XWOC 1DBAH 1GIGH 5FLUA 1YEWA 1C12A 1JN6A 5HYJB 1LTGC 1GYWA 3POCA 5AOJA 3E6FB 3EJYD 3HAEH 3CFJA 5BW7C 4NRYA 4N90D 3GRWH 3MR9B 1T1WA 1NGQL 4ZPTB 1MWOA 1HILA 1JWSB 1U36A 1U8QB 2BVPA 4LSPL 2XU9A 4EE2A 3CFUA 4OZ4B 3MJ8B 4E9WA 3QG6B 1NPUA 3QXDA 4YSEA 5GS0D 3HNVH 1A3ZA 7PCYA 3QRGL 3BRGC 2YQGA 1UWXH 1UURA 3WN5C 3MLVL 1F41A 1L3WA 3HBZA 1S7XA 2FGWH 1YNKH 5L4MA 5E6IC 1G5AA 4XNMA 2BP0A 2KQMA 2WLZA 5CINH 4B3VA 1NLBH 3B2VH 3HPLB 3E1RA 2HMIC 4AZ8A 2ZOKA 6PCYA 3SO3B 3E80A 4X4MA 4UTBA 4A2GA 2IH1A 2GJZB 3RVXC 2IWEA 3N2JA 1MAJA 2J8OA 3S9DB 1AR1D 3CCUP 2FX8H 1JPGA 4U1LA 5G2NA 3FO1A 2HLOA 1EUUA 5D6DA 2DMBA 3DX2A 5CSGA 3SGEI 3W9DA 1LO2L 1IBGH 3CPLB 1MFDH 3L4XA 4ICXA 3LIUA 4LARH 3VWJA 1WFUA 5CCGE 1IC7H 2MCG1 3HE7B 2CK0H 5A6IA 2WBJC 2FNWA 4WO0A 1UWGH 1QLEL 3LMJH 5ES4B 1T3FA 3RL0D 1B3IA 4OZIE 2VLKE 5ICUA 4JHAH 5TISE 4TNWK 2X4PB 32C2B 2B59B 3C8KB 5DJ2A 2VXUL 1OM9A 4Q6IA 4TN9A 1XTGB 3MFGB 2J8UE 1OB1A 1QRKA 2UWEA 1JBJA 3ITKA 2WYHA 4YBLC 2Q6WA 5C0FB 2ZCLL 1QMUA 5GGSA 3GJEA 2VDQL 2ICEA 1XR9B 2AKRB 4L9LA 3DOSB 3NCJH 3ARYA 4QRTB 3CQFA 4X8XA 1J48A 2Y36H 2ZXQA 3W39B 3V6FB 4C7NB 4D8PB 1RUKL 2BIMA 5F9OL 3WHXB 4ENEC 3CMAP 3X2QB 5IG7A 3MBEC 3MUGB 3SCMA 4PRNA 2NY4D 4OD1H 4NAMA 5JPNC 4DOJA 1L0XA 1BFSA 2HRPL 3CTTA 1WFOA 3SOBH 1HGZA 3EYUL 2LE9A 2NY6C 3BQUB 5C8JA 3VXUB 1AQMA 3KPLB 1EHAA 4BWNA 4HJJH 3T65A 4MCNA 2OK0H 2YLHA 1I8LC 4GKZB 4BUHA 2N0KA 4JY6B 4HT1H 2YLKA 3R19A 1S9XA 4L1HA 3DVGB 2J5LC 3F7LA 1T7YA 1E4XH 4UANA 1AMYA 2VE6A 5KS9E 4FQLL 4FFZL 1IGML 4ODTL 4R8WL 3UJIL 2X0UA 1XSJA 5F88A 2VRQA 3QUYB 1OF2A 5EMYA 5DC9B 3B9KA 4ZUSA 4GG6F 2OARA 2J2ZA 4JR9L 2J1YA 1DBJH 5IJDC 3EO0B 4PJ7B 1QR1A 4KJPD 5CP7A 1EO7A 1MHPL 4KH9A 3GHGA 1MCRA 1VPOL 5D96C 5IFHH 3V8OA 3U4BH 2O61A 5C0GB 1MJUH 3ALWA 3QNZB 4AE1A 3P4NA 3D39E 1JPTL 3M0DC 4F9PC 1R3KA 1VFUA 2UZPA 3KLHC 1CWVA 4QXVA 2E76D 3HE6B 4UDUB 2H3NA 4WHYG 1QL2A 2IBZE 2Y1ZA 2PW2A 2X4NA 3B8YA 3JWDL 3NBNA 3GI8L 3MXVL 3TN0D 4PJIE 2K8QA 5D7KE 2VLLB 4N24A 3PREA 1M57D 3LRGA 3SZKC 1KACB 1T03L 1IL1B 4YDVA 3UIAA 3OX8B 3PL6C 2YKLL 4ILDA 4PJ5B 4QRPE 1TLKA 4IL6E 1CTNA 4WTWA 1G1CA 4PRHA 2O01N 2YHGA 4ZFOB 4A7QA 3NGBB 3ZE1E 1AQDB 3VXPB 3FQTB 5D6CB 3SDAD 1PZ2A 2IV8A 1JMXA 5HDWA 4XNYL 1OM3H 3LKNA 4EZJA 3D50A 2QHRL 1LHZA 2A0LD 1H88A 4QHKI 2DWYA 1T22B 3IVKB 4GBXC 1QKZH 1NOHA 2AJZA 5BUGA 2DJUA 4BINA 4ELKB 4ASVA 4LFHD 3PWNB 1Z3GH 2X7LB 2AJ3A 1HBWA 4FNUA 5B3JF 1OHQA 2VR8A 1O6TA 2GSMB 3EZJB 4GI6A 5HYSA 3HPJB 3SFDC 2DAVA 3SBWC 1SUJA 2PO6C 1ZLDA 2AQ1A 8CGTA 5EA0H 2BHUA 5D1XD 2BEQD 5F7DA 4KJMA 2XWEA 4PJGE 5A3IC 43CAA 2E5EA 3ESPA 5F3FA 1GMIA 4MMYA 4U1KB 1G7IB 2DYPA 2P26A 1OVUA 1I3UA 2VGLM 1KTLA 4ZAKC 1PZCA 2ALWA 2UXVA 3G5VB 4NQUA 1T1YB 1B90A 2P5WD 3F7PC 4KFMA 5KBMA 4IOIH 1U30A 2GBAA 4JFPB 4LAJH 2OCJA 1SLQA 3N50A 3RZWA 2G60L 1JGDB 4XCFL 4I3RH 4XH2A 4NQED 4HCGA 3I6GA 3T77B 3H7BA 4LLVA 2E74B 4PD4I 5ERWA 3D18B 5HI4D 4DHLA 2FJHB 2MOVA 4WUKL 4GIFA 3ECVA 3RGVB 3ARDD 3JSSA 2BNRB 5AOZA 3US1A 1QHOA 3MLYL 4D6TE 3VGGA 2R4RL 3CFEA 1YIJP 4HG4J 3KLAA 3TVMD 1L9NA 2PPEA 3B5TA 4N22A 1KCWA 4ALAH 2SEBB 4TTDC 1QFUL 4IMLB 3BE1H 1BG9A 4K3DL 3PHLA 5FGRA 2ZKYA 5DVLA 1T21A 3ETBJ 4CN6A 1NMAL 3IGAB 2EYTA 1RPUA 4QD2E 2GK2A 1DVFC 2R29H 1VERA 1RZGA 1SQPK 1J8KA 3CIAA 1I9IH 4LPWA 4OFDA 4OLZH 4HWBL 4NJAL 5CUSH 4ELMB 3X3GH 4JCWA 4GOSA 4G7RB 5DMIH 4DZBA 1AVYA 4L74A 3SGKA 3EJYC 2KS1A 2X6VA 3HIZA 1TETL 1YAZA 2MHAB 1CD8A 3N44B 3P0VH 5EH1A 4H0LB 1KCVL 4K23H 2H6UA 1D5IL 1RUQH 3WTSA 2EILB 3Q9PA 5KVFH 2F54A 4XBPA 4HCRA 3PDDA 3HC0A 1GYCA 4OUUA 5EOQL 4H44B 2HT3C 4GKNB 2DJSA 4X5PA 5J13C 3EGXA 1I8AA 4YSPA 3CI9A 2H3XC 4G8AC 2WPQA 2ZAGA 3VFNB 4PJ8C 4O02B 2ZSVB 4UM9B 1SQ2N 2CLZA 3MJ9A 3V0VA 3TGUD 4PUBH 4WO4D 3A4DA 2ICWI 3VXMB 4ZMZA 3KDPB 3AU1A 3P7KA 2JI3A 2YPVH 1FNSL 4P05A 5DJZB 5C0AD 2F15A 3W0WB 2MNWA 4MS6A 2ZPKL 1UHVA 1FZOB 3HOGA 4NSKA 4OFPA 2A1WH 4GMTH 2ESVE 5DS8B 2IPPA 3OKNA 4K5MA 2RHEA 4XBMA 4S2SB 4XMVA 3UG5A 3UCQA 2QEJA 4JDTH 1E8WA 3WFBL 4HZLA 2BW5A 3WIAA 2MOQA 3S0PA 1NTMG 2WKOF 1YEGH 4OZIB 4CMHC 2VLKB 1CL7L 4X6FB 3NCWA 4YLBA 1BSNA 1LYQA 5KEZA 3ROOA 5FA3B 4CDGC 2ED7A 2X0VA 5T3XL 1HFUA 4ZMYA 4DCKA 1OT2A 1N2RA 1N6VA 2ZCKH 3CVHL 3AWFA 3CFKA 3OF6A 5FHAH 3VSTA 1ZS8A 5INCB 1WZ1L 4WY7H 2OTJP 1W6WA 5DD0H 3T97A 1A7NL 2BIIA 1ZLEA 2KZ1B 2AERT 1FNEA 5CBAB 1RK1A 1I3GL 3NCCB 1J1OL 4NXSA 1AD0A 1IFIA 3QCUL 3DRQA 4A6YH 1SF3A 4ZS6D 1JZ2A 3EOBA 2EDXA 2FATH 4NT6B 1UENA 5J89A 2BFGA 1CO1A 1H6UA 2NY4C 4NZRL 4RGOL 1JZDC 1B88A 4YK4C 3SDXA 1JMZA 1GZQB 4XNQB 5E5MB 4QKXB 5EPMB 4G8EB 1MFMA 3CWBE 5F3BA 4X4ME 2BP5M 4K8RH 3GZPA 4TUOB 2GUOB 1KDIA 3OB8A 4XFJA 4NIYE 4AXWB 5I73B 2W27A 1N5AB 4HDIA 4LVNC 1SQQJ 1IBZA 3BVUA 3T0ED 1VQNP 4JG0H 2VMCA 3BZFB 3HBQA 4E9XA 5I16A 1YJDC 3L7FA 4NKIL 4M29A 3NFNA 5E56A 4PR5B 1M3JA 2ALAA 5IJBC 5DC4B 4PJBA 2RA1A 4ODXB 3ECBB 4WI2A 4WFFE 3BP4A 3Q1SL 3U2JA 1T89C 2H3KA 5EF0A 2RMNA 3UPCA 5K9KA 1NAYA 3DKHA 2NYKA 5D7JD 2PF6A 4DGIL 1VQKP 3D39B 1U3HB 5KSAB 3T4AA 3ML9A 1ZLLA 2UWEE 3KGTA 1YMHB 3EO1A 4U6YA 1U4EA 4L3CB 2D2OA 1EHKB 3CSPA 3TJEH 1J1PH 4PJIB 4UNUA 1MWAH 4X50A 4QR7A 4TULL 5DMKB 5DVMA 4TNWF 2EIEA 3GHBH 4NUJA 4LSQL 4J6RL 3TN0C 2OZ4H 1SJHB 3HUSA 1QWNA 2ZUVA 3B5NC 2MKVA 1JY2O 2KZIA 2H0JA 3DPDA 2X44D 3IFNL 5DCCA 2Y5QA 3S98A 5CD3B 25C8H 2OL3L 3ZE1B 1KXVC 1T0PB 4ZYKA 4DTGL 4UIMA 3SKOA 2EYSB 3MCLL 3VXTB 1IGCH 4KXZH 4WWKD 2BRQA 3EH5B 5CHXA 1V7MH 3MTUE 3KYAA 4MWFA 4MX7B 3AADB 1N2DC 4WKZA 3GBDA 2JIXB 5KG9A 4MMXB 1UADC 2A0LC 4F7CA 5A2FA 3FPYA 1LT1A 1F58H 3V4VA 4K5OA 2O5XH 4LPCA 1T5KA 2OKMA 3B34A 4PGCB 4G6KH 4JFDA 4ODVL 3L4ZA 4QUOA 1PSKH 1Z9OA 2JH2A 4LOFA 4FNLL 3EYVB 3H1IE 2GSIA 5IB3A 2O6DA 2QQNH 4PJGB 4R97B 3MRNB 4ES8A 4J39A 3WJMB 3AACA 3GLMA 1SJXA 3VW3L 5D1XC 4QJ5B 3VRJA 1T1ZB 1RQVA 2HYNA 3P4OA 3VFWA 1EJOL 3Q8AA 1EGJA 1MCWW 3NPSB 4EMZA 4H88H 1IQWH 5IQ7L 3UL4A 2YSSB 2WWWA 5E9DD 3MHZA 3JV5A 3VDBA 3CZJA 1CFMA 5MEOA 4HOXA 3VQLA 2DLTA 2YAEA 2Z7YA 2E27L 1WE5A 2YMXH 4P23D 2Y72A 1AOHA 2CO2A 2DTMH 2QVIA 4NKMB 4KMTL 3BO8B 5MERB 2OFQA 1T1XA 2VRAA 1IGYB 2WPGA 3MOAH 3V4PL 4ZNCA 3RG1C 1HDMB 3UGXA 4UDTA 3TA3A 2R59A 1GGUA 2ZFCA 2R39A 4XX1E 4YDKL 4E41D 1PKQA 1TCRB 4PRHE 2J6EA 1CR9H 1BEYH 3O3AB 2ZJSE 4EVNA 2YD0A 2BIPA 1HF9A 2FIKB 3R1GL 4P3CL 4X6BB 1E4WH 3U6RA 1AHWC 3D0VA 2AS5M 2VISB 2IJ0C 4OH8B 1NDTA 4Q8BA 4JREC 4EDXB 4KTYA 5FDWB 3LEVL 4CU8A 3CSGA 2I26N 3HFMH 3N3EA 1MAKA 3OB0H 1LWUB 2A74C 1JPFB 3NAAH 1IBBA 4APQA 1UKTA 4FQIL 4I48B 5JW3L 3FUKA 3BPNB 3CUPB 3KXDA 2PWGA 4U6HB 5DEGB 4ZW3A 1JGIA 3Q3GB 3T04D 3JT0A 1UD6A 5J3HC 5CCHD 2J43A 1TVBB 1KFAL 2IPTL 3FSOA 2G2PA 2VL5B 1IZJA 3CPUA 3CFTA 4Y4FD 2DTSA 5E24E 2QA4P 1XFPA 4L29B 2QFRA 3OV6A 1T8ZA 1LMIA 1ZRTE 2WQSA 3N55A 2YBRA 4XOBA 2BCMA 2IX7C 4ZX6A 3BEVA 3STZA 3KZ8A 4N0UA 3D6GA 2R0KH 1U8CA 1DL7L 4HJGH 1GZLA 1CXEA 1NGXB 2NQDA 1FZEA 3BSZH 3WFEL 1KILA 1E3XA 3MRDA 4D9QD 5FF6A 1EHLH 3FBQA 1TG8A 4DP7X 2YEVB 4OCSL 4J2XA 5IEHB 5KYYB 2KLVA 2EUVA 1JK8A 2ESVB 4H2CA 2FECI 2WQRA 4WTXA 2BOLA 3KPNB 3V0WL 5FO8A 1EMTL 3ZQ9A 3LKOA 3HD7B 4Z7WA 3O4OB 1KBGL 5TE7L 5FUCE 3CBRA 4JY5H 5E1IA 3ZKND 5I1IL 5F9WB 3BKYL 2LFEA 4H13D 4ODUA 2F7QA 5AOLA 1R33A 3TDKA 1LE5B 2CLVB 2JB6B 1F3RB 1EXUB 1SXCA 1C12B 1E8YA 1JN6B 3K6DA 2LOEA 4EYYQ 4X5RA 3BP5A 3CFJB 3JYCA 2N4IA 2VQ1A 3HMXA 3E2HC 4NRYB 1XBRA 2NNRA 1PLGH 1T1WB 3EZ8A 4LVEA 4DK5A 2BINA 1WTLA 4PG9B 1HILB 2BVPB 1CIUA 1OCWH 1T83A 1IAII 3EJJX 4G5AA 5DZVA 1SQVE 2ICCA 5IFAH 3LEXA 3QXDB 4MJHA 2F54E 5CEZD 2BRRL 3UYRH 1FO0A 5I24A 1H8OA 5DD1L 1WT6A 4JM2A 3RTQB 2R1XA 5JXAH 1S7XB 3R2PA 3QXWA 2ZXXA 3PP5A 2VW6A 3Q2YA 2J4WL 4XNMB 4ZS6C 2BP0B 4YHZH 3IETA 4B9ZA 3K2MC 3TNMB 2BSED 1KQSO 4WW2C 2FJFA 4ZD3H 3TIEA 5GS3A 4AZ8B 2ZOKB 4HIEA 2WNKA 1A7OH 3J7HA 4OGQB 3JC22 4JPVH 4YIQA 5D5MF 3ZN6A 1NCUA 4XAWH 3DTXA 3H3PL 1P4LA 2XXCB 1CPUA 3DO7A 1JPGB 1P9MA 1A3LH 3KDMA 3FO1B 3GZOA 3W9DB 4Y19D 2VZVA 3BN9D 2JWDA 3SDDD 1AGFA 1TYJA 3IJSB 4HPOH 3VWJB 3ZDZF 5AB2A 2Y07L 1HHJA 2XSKA 2X70A 1T03H 2BFVL 1UG9A 3C8HA 1E7UA 2WXGA 2Q7CA 1T3FB 2P49B 3ARGD 4NERA 1IBYA 4XPBL 2EDTA 4FFYL 1FZMA 3GSNH 1JY3P 1FN4A 5DJ2B 4C56A 4Q6IB 4BRJA 5J6HA 3QUMH 3LKSA 4Q0XH 3CZUB 5A2BA 3VP9A 2XWBA 4AYCA 3NRFA 4GSRA 1E4KC 2ADIB 2Q6WB 3U46A 3T1FA 5GGSB 2NY0D 3GJEB 5C2BL 1J1XH 4L9LB 3H1LJ 5E6YA 3UACA 2F1BA 5EOTA 1XV8A 4A2FA 1FGVH 1WG3A 1MKFA 1L9TA 1ONQA 2Q5BA 5IG7B 4HPHA 4LGDE 3SCMB 1YECH 4PRNB 2EDYA 2EH7L 3WXWL 1U8KA 3HNTH 1FORL 4QAWA 4X5XA 3VYNA 3EF4A 1JWUA 3PHAA 4AYID 1ACYH 5C8JB 4PW3A 2V17H 5EU4A 3SGJA 3QCTL 3T65B 3AXIA 2EVJA 2NY2D 3SDXE 2MNUA 4EQ3A 3NJNA 2HT2D 4FXGA 1G1KA 4TSBL 3EBIA 2A9DA 3K71A 5CBEA 4O5LH 2VE6B 4WWKC 1YC8A 3FB7A 4OM1H 4YVNA 3FT3A 2GK0A 3TCTA 1G7HA 2XXMB 2ZUYA 4KHXL 3WLBA 5F88B 5DURB 1OF2B 1TQUA 5DHVA 1KBBA 1FPTL 4IFDK 2NXYD 2OP4L 3B9KB 1RU9L 1HINL 2J2ZB 1JNJA 4NNYA 2AJUH 5I1EL 1NH4A 2XDHA 1I1AC 1QR1B 3L17A 4KPHH 2YD6A 4KO7A 5CP7B 3TBTA 1TQTA 4B53A 4I1PA 4PJBE 3ZL1A 3GHGB 2DIAA 1JHTB 5GTIH 4PMFA 2MQ3A 1KGIA 1GA2A 3ZL4H 4JHWH 4NZJA 1ZLSH 2O61B 1TU3F 1NMCB 3P4NB 4N0YH 3RIKA 2XV0A 5B3NA 2XWZA 1YVLA 3S8FB 2E8YA 5EN2A 3DGGA 2F53A 4LLDA 3SDCA 3SE8H 2H3NB 4C4KO 4EN3D 2OYOA 4HUUA 2PW2B 4UINH 3TFKD 3OAYH 4JFEA 5DFAA 4F57H 1KZYA 1MFCL 1NZRA 4DPAX 2F61A 2VUKA 3MLTB 4L4JA 4P23C 3WXVH 2JO1A 5JO5A 4OV5A 2A45G 4YDVB 1LTBC 1HHGA 3VMPA 1BBJA 3FMGL 3II6A 5A2AA 4UTCA 5B39G 2AJXL 1NMBH 4PRHB 4ES9A 3RI5K 4XN4A 1Q72H 3LHAA 4UNVA 2CIIA 5AKRA 1YJDL 1FNLA 5H8DA 1IFRA 4J28A 3SE9L 3KNBA 3HMWL 3LIDA 1BXVA 2XZAL 1ET7A 4HSAC 5CJXC 2AJZB 3UX9B 1E7VA 4HH2A 2QZ5A 4JGUA 3VWKD 3ZHDA 5APUA 2X28A 1Z9PA 3WO3B 1JZJA 1JWMB 2AJ3B 1BVOA 3HLAA 3PHSA 2VL4A 3Q5PA 2ROXA 3UC0L 4BWUA 1CF8L 1F56A 4X6DA 5HYSB 4JFDE 1SN0A 1W9XA 1ESOA 2E6JA 2VR7A 3ZU8A 4XXCC 3TNNA 2CK3H 3AITA 4Y7MA 4YC2B 5F7DB 2BOCA 4GW4A 1WITA 5FOBA 4PJFA 4AKQA 43CAB 1GS7A 2GAZA 4DETA 3GSOA 4MMYB 4UZUA 3V0AC 2DYPB 5IMLA 4G83A 1KTLB 3CC7P 1D5MB 1VZIA 3A24A 2A6KA 4JFZH 4JFTA 2WQYC 4PIRF 5IP4A 5GIRA 5FYLD 2VAAA 2VM4A 3I6GB 1KC5L 3H7BB 4RDBA 1DDHA 2Z0BA 2W83C 3DX1A 4LLVB 5ERWB 2E9BA 2NW3B 4MJIA 5DK3A 4HV8A 3T6XA 2XX0A 1SQBK 1NGZA 5FYKL 4JB9L 5TFSH 5ICXB 4OGZA 4JFQA 1FFPA 1LLAA 3CN4A 4S0HA 1BZQK 1XGQA 2V3EA 1ZHKB 3CFEB 3B9DA 2CJSA 3KLAB 3OJAB 3QNYA 4ZTPH 4XR8C 1IAIM 2GJ6D 4OZIF 3FCTB 1NEUA 1TPXC 3QORD 1PKQE 2ZXWB 3MNWB 1HCYA 1YLBB 3SPCA 1U33A 3D34A 3APCA 5FIEA 2J8UF 4ZUVB 2EYTB 3ESUF 1T2KC 4UB0H 3KW7A 3QAZB 1RZGB 4N8CL 2Z4TA 3GBMH 1WA0X 3ARFD 3SDYH 4WV1A 1LTSC 2UUDK 2A9AA 2IBGA 4DZBB 2CMRH 4M7LT 2Q7YA 2ZUTA 4JBSA 2VERN 3HNSL 1E28A 1S7UA 1KTBA 1QSED 1Z0NA 2ZOTA 3MBWB 1YZZA 1SQMA 1KIUA 2F54B 4J27A 2YZ1A 4XBPB 2NXZC 1YQ4C 2R0WL 3DJSA 2XACC 3HC0B 4OUUB 5KAFH 3WI9A 3P32A 2WPVB 3WCYA 5JHMA 4FYTA 4YPCA 4XT1C 2M5AA 4L5FH 1OZTG 1T2XA 4R5XA 1BIIA 2D7OA 2KZKA 2VC2H 4RGMC 1KPUB 1W15A 1E6JL 5JOFA 2WQAA 2DQFA 3DETC 5DGQA 3SE6A 2NY5H 1JV5A 4FKHA 1KIPA 4PRAA 2CLZB 3V0VB 5KS9F 1CZ8H 3MCYA 3NP4A 4ANWA 4PYGA 4N0UE 5A6LA 5EZOL 2FD6L 3PQYD 4QHMA 3L3GA 1KILE 5EHFA 5IHZA 3HUJF 4PJ9A 1D9KA 4NPFX 1JZ4A 1XDTT 4PS8A 2Q76B 1R9FA 2XZCH 1RVFH 4ZW8A 5I15H 3O2VH 3OKNB 1FE6A 2X1WL 3BWUF 4XMTA 3QEQD 3U7WH 2QVAA 1DQVA 2O6FA 4HZLB 4Z7WE 1LDPL 2Y7NA 3SDDC 4NUGL 1KFNA 4M5ZH 2NZ9C 5ECJE 2K1MA 2CRIA 5CZVH 1NKGA 4ADJA 1XSOA 4GAGL 3NEEA 1NC4A 2H6PA 3IU4L 1NANI 4DJMA 3KPPB 2F5AH 3DNKA 4P2YA 5IB5A 2V2TA 2RACA 1BZOA 4LVHB 2WYIA 1QWUA 3CFKB 2AXCA 1YO4A 4I9WD 2W9EH 1ZS8B 4KOBA 4P04A 5BS0A 4L8CA 1DBBL 1A6WH 3RWIA 3E7JA 3T97B 1E9QB 2V3FA 3GF8A 4G6FD 1FNEB 1K5NA 1RK1B 1XF3A 3A6CL 4F33A 1KGYE 4LOUC 1AD0B 4OIIL 1OP5H 4L3FA 1JI2A 4YXLH 3ABZA 3DRQB 2WQ8A 4QF1A 2W9DH 1KG0A 3GK8L 2CHDA 3EOBB 4BQ6A 3CU7A 3ILEA 3S96B 3ZE1F 2YPLD 4N78D 4QXUH 2VUOA 4HOZA 4ZMQA 3U1CA 3C6EA 5B7FA 4FQQA 3FYIB 4PCKA 2WXPA 3SDXB 4GINA 5JDSA 3TFBA 5AAMA 1X5HA 5F3BB 1AKJD 4BFBD 1ZE3C 4K3JL 5KSVA 2NY2C 3DDGA 1K73Q 1LP9A 3RX7A 1BVZA 4M1DH 4V1DD 5E8EA 4HDIB 5CIPH 4K3EL 3UO1L 2XV5A 2V6HA 3CXHD 1FC2D 3GSVA 3G3ZA 1DQLH 1L9OA 1NBCA 1ZXGA 2DBLL 3KWVA 3N9GL 1FZKA 5I16B 1URQA 1ECYA 3L7FB 2FFDA 1IVTA 5DVPA 4KTEL 4PJBB 1QRNA 2F5BL 4O2CA 5D71H 5E4OA 5TPWH 2D4DA 3SGDH 2ODHA 2H8PD 5K9KB 3S3CB 2H41A 4C56E 4Z3HA 4RSYA 1RXLA 5KTEH 3L4YA 1WBZA 2HA1A 4P4KA 2WUBL 3T4AB 1P69B 3DVNB 2ZOWA 3UJJL 4AQ1B 2VXSH 2NRDA 1TKWA 3L73J 1N0XL 3O6LH 3EO1B 4U6YB 4N2BA 1YEFH 3QUXA 2CUHA 1AI1H 1J0JA 1JNNH 3QDJD 5BUAA 1TR7A 2VSKB 1UTDA 2HFED 1URLA 1YG9A 4NUJB 5A2LH 3P73A 1GTWA 3CLEL 3NEXA 3HUSB 4OW6A 1GVIA 2EIDA 2O6EA 4HJ0C 4MB5A 1FE8H 5ESQA 2VDOL 4K9JA 5GZOC 2CO3A 3O6FC 1SQVK 5IJKC 3VAEA 1NCTA 1TZIB 1N67A 4K7PX 4ZYKB 4J3SA 3SYPA 1M7XA 3RY6C 3SKOB 3AGVA 3ULVF 5GSRB 4YSCA 1U91A 3QRBA 3QI9D 2ORBH 4OLYH 1U8NB 4OTXH 5GRJH 4MWFB 1MVFA 4KXAA 4WKZB 1QFWI 2UZXB 5KG9B 4NQCB 3WHE1 4F7CB 2IAMB 3V4VB 2XNAA 3EFOA 4U0RB 4BK5C 4YQXH 5L2KB 1RAMA 3O81A 4JFDB 4QHNB 4R7DA 5KWYC 2D03H 4MN4C 3POHA 1WD9A 1ZP0C 5GGQH 3EYQD 3L72J 2Q2EB 4EI5A 2OV0A 3KCWA 4MQTB 3VRJB 2HUHA 4GSDH 2C3WA 4E9VA 3P4OB 3UTOA 3VFWB 4PRPD 4Y99C 2R0LL 5JLZA 2CUAA 2OMXA 3ATAA 4NBYB 5GGVY 1S5IH 4FFZA 5MEPB 3S3PA 2KLTA 4E9TA 2XU6A 1GC1C 2F53E 4ERSH 5MEOB 4BFGA 3T1WA 1WAAA 3WN6A 2NY3B 2FXMA 3FCGA 4XN9A 4M5YH 2VXVL 1XEDA 5AKSA 4JFEE 1V55B 3RWJA 4RMSA 4JFFA 5AOMA 5CM1A 3DPBA 4UDTB 4PWKA 1R5SA 3TA3B 1JXFA 2PXYA 3L70G 1PKQB 3CCJP 3ZUNC 1KYOI 4EVNB 2DPKA 1N73A 3ASOB 2QLYA 2X6UA 3N1GC 3PP4H 4HS6A 4NJ9H 2SPZA 3CFMA 3C60B 1PZDA 3KL0A 3X13A 1MCOH 3D0VB 3D3VA 3FZUC 5A2JH 2WYTA 2R4SL 4CVXA 4Z95H 2ZAIA 3IFLL 2IQAA 1JUFA 1MVYA 1A6UH 1KBWA 1OAQL 2PMZA 4UT6A 5E2UL 3Q05A 4BV1A 3T2NH 4ZMNA 3WO4C 5C0NC 2FWUA 1CN4A 2WO4A 5IFJA 2E3VA 1OQOA 4X6DE 4XPHL 1A7PL 1BZDA 3WEBA 2B2XL 2VDMH 4APQB 2V4LA 1N8RQ 4LL9A 1H8NA 5G5DA 4ANUA 4UV7L 1G9MC 4DPRA 4PJFE 5B39A 4B95C 1KJ2H 2AABL 3E1F1 1CI3M 1WT5A 2QL1A 4UAOB 2JTDA 1MN4A 4MNHA 2EDQA 2C7UA 2YBRB 3OKKA 1IKFH 3BEVB 1UOWA 3STZB 5IHUH 2D3NA 3QRFM 1U8CB 2OYHB 2RIKA 3KYNB 3MRDB 5FF6B 1REIA 4MJIE 5TDNA 3U1AA 4P9HC 2VDNH 4E68A 3CVCA 3GLDA 4Z7QF 1JK8B 4M8UA 5HHOB 2PYED 4TQEL 2H1PL 4J23A 3L74D 1KGCD 4OR1A 1YJ9P 3CZFB 1Y6KR 5FO8B 3LKOB 4IRJC 4Z7WB 5BJTA 1M1SA 4E9SA 1QTPA 2C9XA 4BHUI 4MNGA 4W4OC 2BIHA 4QI3A 5D8JH 4XP6H 4YLCA 1HE8A 1RQ5A 2WT7A 1EFXB 2UWEF 5I1KL 4YWGL 2CO1A 1ID2A 3WIHA 4BBWA 1IFPA 4K8RC 3V6BR 1MNNA 3BP5B 1HIMH 1WRFA 3CX5I 2VQ1B 2Y3AA 2Y7MA 3FKUS 3STLA 3V10A 1SXBA 4UU9A 4F8OA 2Z1PA 1IARB 5CD5C 1DBAL 3L1GA 1GIGL 1R5WA 1VEPA 1SDDB 3DHPA 4QXTA 2QADB 3DECA 3LEXB 3P2BA 1U8JB 4HEMA 3GRWL 5HY9A 3TH4T 4S1QL 4LHQB 5HGBA 1J1DB 2ICWB 2V9UA 4RO0A 1DBMH 1FO0B 3QIUA 4H2AA 4KDTA 4O58L 3UJTH 1WUNT 4N3TA 2R1XB 3MRIB 4OM0H 4QHNA 2EDHA 4YVUA 4ZT1A 4XPTH 3N5AA 3O4LB 2YMKA 3HNVL 5BVPL 5JHLA 3IETB 5I6XB 1S3KH 4HWBA 3RGHA 2X1QA 2FJFB 3RURA 2ZYDA 3WDHA 1CXHA 1TNNA 5DR5H 1ZSDB 4YIQB 5HYJD 3KXFA 5JQ6H 2JWAA 3IM1A 3WNMA 3ZR5A 4JZJC 1XGZA 1J9CT 1P4LB 4M03A 2IANA 4Y9BA 1NLBL 5CINL 1EJ8A 5AWNH 3FL7A 3LN5A 2X3BA 4ONHA 3DJTA 4ORZC 1EQ7A 1YN7A 4MSWA 1NAML 2AANA 3A6OA 1RJZA 5IV2B 1AGFB 5IQ9B 2XPZA 1HHJB 4CN1A 1F4HA 2OMYA 2HX9A 2AEQL 6TAAA 4C8XA 4H7VA 4YX2L 1TZOA 3B3BA 1U57A 4WEBL 5J1AA 1HJCA 1ZGLM 3HZ3A 1MFDL 1NCWH 3M17A 1FZMB 1PD6A 4LARL 3MGTA 4C56B 1FAIH 2ZT9C 1KUMA 1YQVH 1UXWA 2CK0L 2BJML 3LKSB 4YEEA 2H47C 3AAZA 1UWGL 2XWBB 3LMJL 3U46B 3T1FB 4JHAL 4AEFA 5BS0E 2FBWC 5H94A 1VF5C 1J0ZA 2KPNA 5EOTB 4BCZA 2EDOA 3Q8EA 3RLSA 5EF3A 1AS7A 2CO4A 2IQ9H 1QFWM 2M3BA 1ONQB 3SE4A 2BHZA 1HL8A 1FL5A 2OTPA 2DM4A 3BKML 1U8KB 2IBZX 3QJXA 2KHAA 4X5XB 3HE7D 1JWUB 2FSEA 2NRGA 3IAOA 3A0OA 4J8RA 5GRUH 5I76B 1ILUA 4HIHA 4MNQA 3TP4A 2PP9A 5EU4B 2HLAB 3RL2A 5TH2A 2R27A 3CVHA 4OD1L 4F8PA 4MDIA 3MRHA 1MI5A 3NA9H 4MB1A 3UTQA 2EUXA 1SZNA 2IVFC 4FXGB 2WBWB 2XVKA 2D2CB 4JHZA 2CK2A 5CBEB 2NR6C 2G5UA 1LP9E 2MOGA 4X7SH 3FB7B 3FT3B 2GK0B 4NLHA 1W2BO 1G7HB 1HQ4A 3WLBB 3HHMA 2TRHA 5IR1A 1EQWA 1I1FB 1R6VA 5HHME 5FFOA 4B9FA 1E4XL 2Q8BH 4FFTA 2E7DA 4GAYA 3FU7A 3PLNA 4LK4A 2LU7A 4NNYB 1LT9C 3UP1A 3TBTB 4NN7C 1G0XA 1LO0H 1QRNE 1ZR2A 2XN2A 1SQPD 4JO8A 1KMIZ 1CLZL 2YRZA 3BQUD 4N9GA 4RBPK 3ASNB 4UUJA 3VXUD 3WSQH 4JGNA 2F1EA 5K39A 1AE6H 1NCHA 4GRLC 2DWTA 1IFDA 1RF1C 4GODA 1ZT7A 1FYHB 1ICTA 1XQ4A 2RQEA 3VSVA 1KYAA 5EN2B 3F12A 12E8H 3B9EA 2E46A 2E4FA 2F53B 3DGGB 4LLDB 3P1VA 2OMBA 1NCJA 4XXDB 3U4BL 1EZLA 4NC2B 1MJUL 1IC5H 4DUWA 5F9AC 4JFEB 1OXYA 4ZTOH 4PI2A 1L7TL 1IAKA 4DSYA 1LNUB 3IJYA 5CILH 3QUYD 5JO5B 1WICA 3QISA 3BESR 3Q6GH 2B15A 2PTVA 4FFWD 1JDDA 4YHIA 5CEYA 3W9EA 1DQJA 1HHGB 2O5YH 4OIAA 1BBJB 4LLMA 2E5YA 2WLMA 4MVBD 1YEJH 4PGEA 2GHZA 2BSCA 1AJ7L 4NQSA 2CIIB 2WK2A 4L48A 1INEH 4RRPG 5B1JC 2ZD0A 4ATTA 5E6UB 1R5VA 4E0RA 1E9PB 3RK2B 3IDYB 3KNBB 3NTCL 1SLXA 5D7EA 1CFVL 2QDVA 1FIGH 2UUDH 4M5TA 2Z9TA 3JWNH 3HE6D 4PG2C 2VABA 4E9YA 2CALA 1H89A 4X6DB 3GMOA 2LTQC 4GAAA 1QKZL 3VFTB 1Z3RA 5BVJA 3OHMB 2VMJA 2BOCB 1IZNB 4GW4B 3U2IA 3NDYE 2B4CC 2X89A 5FOBB 3WJJC 4PJ5D 3QIWC 2IOOA 1I8MA 3QXTA 3GSOB 4KVNH 1UOKA 3L1FA 5IMLB 1Q86Q 1I9JH 2FEJA 5EA0L 3MJWA 4EBQL 2H1XA 1PEZA 1CE6B 2A6KB 4I8DA 4OLVH 3X1GA 2CA3A 5IOPA 5JYMA 3S4SG 1F97A 3DBXA 3GWJA 3WDJA 5HYEA 2VAAB 5GS1C 4XCYA 1C1EL 1WAAE 3VMYA 4JPSA 4MJIB 4CN4A 1JZHA 5ENWA 1NGZB 1EK3A 4TSAH 4NAJA 4JFQB 1FFPB 1AS8A 2X5PA 3QUKA 1XGQB 3QPKA 4I3RL 4KNSA 3UMTA 4HX1A 4JFFE 3BW9A 4JM0A 3MBEA 1E9OA 2W0PA 1EEUA 3M1CA 3ZY7A 3P9LA 4MXQC 5JPNA 3L5WA 1P1VA 2BNUA 3P2DA 5BQ7A 1ROWA 3VGEA 1OXZA 3QH3A 4XCCH 2A9NH 2ID5A 3ULUE 5JR1H 2D0FA 2C0XA 4LCYA 4ZXBC 3VFOB 3D3VE 3RIAK 5T1JA 3PV7A 3BE1L 2VN3A 4WV1B 1SOSA 3AFLA 3VH8G 3F6LA 4AMWA 3OR6B 5JQIB 2ZKHL 4HLZH 1N3NA 3WIFB 1JPEA 3VNZA 5DRWA 2Q7YB 2CGZA 2E74D 2XN9A 3IGKA 2R29L 4N68A 4QLRA 1E28B 1S7UB 5E2WH 3EBHA 3ILQD 3BCFA 5DD3L 4CSTA 5CUSL 3TO4C 2YIUB 4P4RA 1FFNA 3RGVD 2BNRD 5E79H 2ZP8A 3G9VA 3CFDA 3ME0A 3T0XA 3T0BA 5LDSA 1GC1L 1X6LA 3F7VA 4RX4D 5ICYA 1R0AH 4HHAA 4J4PC 4ORGA 4U49A 3GXNA 4NBXB 2M5AB 4X7CC 1CQYA 3P0VL 2B5IB 1BIIB 3VJ6B 5KVFL 2DQFB 1PP9J 3U30B 1RQUA 1JV5B 4ZQKB 4RMWA 5F97E 1KIPB 2IWKA 3S6CA 3V4UH 3BAWA 3E8VA 3DV6B 2VQTA 4NFDA 1D5RA 4QHMB 3L3GB 3T08A 1L0LJ 3M0DA 4BHUA 1CDUA 4F9PA 4Z0BH 3NSCA 4I2XA 3VI4A 4PJ9B 1D9KB 2K9UA 4A7PA 1TF4A 3GJFA 4PUBL 5EN3A 3X1EA 2IO5A 4H0LD 4N2MA 3CVDA 1UZ8A 1S5HA 3GNMH 2C9NY 2YPVL 3H9YA 2JJSA 8FABA 4H44D 2WD0A 3WNPA 3FTZA 2A1WL 2RFXA 4GMTL 3PL6A 4MNGE 4GMSH 5HTSA 5KOMC 3UZVB 1NGYA 3NJLA 1JTHA 1ZLUH 4KI5D 3C5ZA 1NC4B 2FYZA 1G9ML 1RJYA 2V2TB 2ENPA 4UM9D 5IB5B 3WEXA 1A7RH 2YIHA 5FYJL 1F90H 2ITFA 1YEGL 2CR6A 2FHFA 2V5YA 3KGUA 5I8OL 4L8CB 2AXWA 3ZO0A 3VB8A 5HDRA 3VXMD 4BSJA 4GBXA 3LPOA 3N91A 1L0QA 2JKJA 4DCQA 1GKEA 3M1OA 1XF3B 2Z6FA 4FQ1L 3W0WD 4DO4A 4F33B 2Q3XA 4F7TB 4HEME 1E8XA 2WTYA 1J8SA 3C08H 2GBTA 1HH9A 4N28A 4QF1B 3CZKA 3EBAA 2F68X 1X9QA 4WY7L 5DD0L 1RJLA 3SBRA 5CCGD 2DQUL 1PLBA 2PO6A 4I18A 4P9HL 1FNHA 2ZONA 1GGYA 5CFAA 5KKZB 2VLKD 5JDSB 1DH3A 1MCPL 4Y1AA 3KLKA 1U7MA 4KTDH 5KSVB 4XP5L 3ARRA 3KXFE 1T6BX 1LP9B 2DEXX 4WJKB 5TF0A 3REWA 5L7XL 2IANE 3HI6L 4OCXH 3BLKA 4PGZA 3GSVB 4PWEA 5I0ZA 1UM6H 4KZ0A 4K8RL 4GEJA 4E9RA 5HHMB 3FQXB 5I8CA 3FOMA 1URQB 4M93B 2ICES 2LAAA 5DZOA 3V5HB 3O8XA 1RLBA 5E8PA 2FFDB 1JMBA 3OAUL 1HNGA 4IMKA 1VQMP 3B7TA 4JG0L 1QRNB 1L7IL 2QPFA 1XD1A 5I6PA 2C9LY 1NEPA 4PJEF 1BCCJ 4X8GA 1MFZA 1WBZB 1NAKH 5J5EA 3BQUC 4FCAA 2FVNA 1U41A 2RTTA 3R7QA 3QDAA 1EXHA 3IAPA 3QUXB 2L5GB 3A7OA 5EEVA 3HC2A 5E8NA 5A43C 1SHWA 3H42H 3J2PA 4KKZA 4KVCL 4P5SA 4U2ZA 3P73B 2VW4A 2UYLA 1QLEB 1TZAA 1XVSA 4FFYA 1HGVA 1J1PL 2KIKA 3ARBB 1U2HA 3ATDA 4ODWA 1KULA 3GHBL 1NC2A 2WSCH 4MNQE 5FYLH 5T3XE 4YHYB 2OZ4L 1V27A 5JA9A 4JHVA 1U91B 1QPPA 2KYIA 4GT7A 1MI5E 2BVEA 3REVA 2VDQB 1B0RA 4MA1B 3U0TA 4TL4A 1CGUA 3UTZA 4ANXA 4PJ8A 4TQIA 1H6TA 1QEWA 2PCPB 1NGWB 25C8L 1DQTA 1U3HD 1J18A 3D39D 2R56L 4JZOA 5KSAD 2PKDA 3GQFA 4S11A 1KQGB 2XNAB 3DX9A 3LEYH 3EFOB 3FS9A 5I6OA 4AG4H 1A6ZA 2J58A 1V7ML 4LVOB 1JI1A 3US9A 2B39A 5D7KD 4R7DB 1ET8A 4N0CD 4RRPM 5EIVA 4ZBJA 1K4CA 1QW9A 3WTXA 1P84I 2DIEA 4G6KL 3CD6P 4EI5B 1JVLA 1PSKL 1USQA 4Y2DA 5I1LA 3VRLE 1AVOA 1TJMA 1ZWIA 5LWYL 3PXLA 3PAUA 5GJSH 2HKHH 2OMXB 2QQNL 4ETQA 5JLZB 5GRZA 4BJLA 1CLYH 3QEGH 2OMUB 2P24B 3NGBC 4FG6D 2EE6A 3S35X 4QXWA 4YDMA 1AZVA 2JIXD 3DBSA 4GSXA 3V79C 4H88L 1IJ9A 3FDWA 1IQWL 2K8MA 4U2YA 2YWZA 1ADWA 1GYUA 5IB2A 5B66E 1UA6H 3W2DH 4XP9L 4W9IC 3RWJB 1Z5YD 4Z7WF 4JFFB 3ET9F 2CPSA 2D31B 4XI5D 1DUYB 4G7VH 3WAKA 3DPBB 2YMXL 1Z56A 5K59F 1W0WA 4TNGA 2DTML 1FBMA 5KVGE 1UT1A 1YI2P 1A4KA 1N73B 2IDQA 2NY5C 2NYZA 5B5EH 4O9BA 3ESNA 3SO5A 4H0HB 4HS6B 5C97A 1VGKA 3RL1A 3MRFB 3X13B 5IK3B 4JO5A 4B97A 3IYLW 3D3VB 3FH7A 4NP9A 2G75A 2W94A 3VGAB 1X8YA 4LL4A 4CVXB 1OD7A 2IQAB 2A4CA 1XGRA 3P0YL 5IFJB 2EVIA 3DOHA 3X17A 5H37G 1DIPA 1NU1D 3BEWA 1JMMA 1YA5A 5FCSH 2X9ZA 4JM2F 4D6TD 4X6CA 4B9CA 5G5DB 1HC1A 1UYWH 3ILQC 4J3OG 3VFMA 4UTAH 3F00A 1KFMA 4M3JA 3RGVC 5B39B 2ZVOB 4AEEA 3LW5H 1VFOA 3ABGA 2I24N 4MA3A 4X83A 1OHZA 3H1KJ 2QT6A 2XQBH 4O4YL 4CVZA 4DWHA 2O1KA 1FHNA 1ZJBA 2C7UB 3OKKB 2AXHA 3PH0A 2WXIA 1T4KA 2WO2B 1N70A 5FUOH 3I50H 4Y4HA 2WPSA 3QB7C 4LNVA 5TDNB 5BV7H 4RZCA 3BATA 4MAYA 2VN5A 1FOSE 3RU8H 2R0KL 3D87B 1PQZA 2COVD 3EJZD 3QR1A 2XV3A 2Z92A 2YA0A 4KAQH 1FRGL 1EHLL 3RJOA 4ONFL 5BJTB 2YC1A 4H0LC 4RIRA 3RE0A 1EAPB 1JFQH 4F58H 4MNGB 2NCMA 1XGYL 2J88H 3B5NA 2P5EA 3UERA 1J12A 2WT7B 1TJHH 2Q0ZX 3BZ5A 4OCNC 3MNDA 2PYFA 2QPDB 2BASA 3S4SA 4H40A 1KXVA 2B4CL 1S5LE 5DD5H 4MS8C 5AYUH 4HSQA 3EGDA 3HLKA 2RR3A 5FWRA 3STLB 1N7MH 4UU9B 4PRIB 2D9QB 4WHCA 1N19A 1R5WB 3HI5H 2XN9E 1GH7A 2P42B 4WY4C 4QXTB 2QKIC 1UT9A 3MXWL 1OLLA 5KLVG 3I9PA 2ESVD 1TTBA 4UOQA 3GLZA 1QUNA 5HGBB 3DLQR 3QR0A 3QIUB 3L73G 4WEUD 4W6WB 3WMSA 5EZLB 1GGBL 4LAQH 1E6OH 3HD7D 1UJTA 3G6DH 1RFDH 3IKCA 3Q48A 2CHZA 1KJ3H 4JM4H 5IFAL 5L8RJ 5CCGC 3FU9A 5AB0A 1GS8A 2C1OB 4XRCB 2F9BT 3UYRL 3HTKA 3BUQA 3ZTEA 2FYYA 1C16A 5AZ2H 5JXAL 1CICB 3VH8A 3KXFB 3MODH 2MQCA 3ZDYB 4IGBB 3OXRA 3BUTA 4ZFQA 3C6LA 4OZFH 3OZKA 4EIBA 2IANB 4YHZL 3LVEA 3NH7H 4I2XE 3VI4E 1NCDH 3LN5B 1H6EA 1A7OL 2V7NA 4ONHB 1EXGA 1YN7B 4JPVL 4MSWB 4W9LC 3UFIA 1EZSA 1RJZB 3KAAA 4KKQA 4XAWL 1KB9I 1SMOA 4RKUJ 1KTKE 1R3LA 4NAQA 4P5KA 1NTZJ 1CF1A 2OMYB 3RVUD 4U1JA 5EZJA 1A3LL 5DT1H 2OS7A 3DX0A 3GMRB 5DO2D 5CN2A 2WLLA 1M7DA 5J1AB 3RTQD 2I60L 1XTCC 2O72A 3M17B 2VB5A 4DOHB 4HPOL 4RDQG 3GF7A 2GCYA 2HN7A 3H55A 3PFQA 3RPIA 1SNRA 3RVTD 2YXRB 4AY0A 5CWSA 4R3SA 4GO8A 3AAZB 3NSFA 4AC2A 3FUIA 3CWBD 4OGQD 4U3FD 3L72G 2O5ZL 1MIML 5I5RA 3GSNL 3PRJA 1AHWA 4N20A 4DP1X 2Q3IA 1S7TA 4MD5A 1XCXA 3QUML 4Q0XL 1IUZA 3IT8D 3PV6B 4H8VA 3Q9QA 1MFBH 4FEIA 2QJDA 2FCBA 2DLIA 4ZO9A 1BXUA 1J1XL 1FV1A 2A74A 1FL5B 5CJQH 2OSYA 4ZS7H 3VWJD 5CHNA 4FS0A 2CM6A 5D70H 3EADA 2C3VB 2FSEB 3G6AA 3MRRA 4W9EC 4J8RB 5IROC 1FGVL 2FYUD 4NEHB 4MNQB 4HIHB 1K85A 5BO0D 1GCFA 2B0SL 1QNZH 3MLUH 2A6DB 3GD1C 3RL2B 5TH2B 2FXPA 4N2NA 1YECL 3CVHB 4WFFD 2ZAHA 2E43A 5HI5C 3AE4C 3MRHB 1MI5B 4MDIB 4HYTB 4NM4H 3BWUC 3UTQB 1JYVA 3HNTL 4Y1AE 3VI3A 1KCBA 3B37A 3GSQA 3X3GL 4XMPH 2V17L 2BSSA 2NNFA 3RNKA 4PVBA 1IC1A 2HJFA 3ZGHA 4OJDH 1HQ4B 4Y4FC 5JIKA 2Y6SD 3L54A 3VSUA 1MFAL 2EECA 5I28A 5IR1B 3O6MH 2Y9RT 3CVBA 2Y7LA 2JK5A 4O5LL 4PJFF 2YD2A 1EERB 3OLDA 3PNRB 4OGAD 5F7WC 4GAYB 3FU7B 4OM1L 3PJNA 4BFIA 1JZGA 1R75A 2YXMA 3SCMD 3WIIL 5K5GB 1L4AC 1TFHA 4LMQI 1ITBB 2GBVA 3R0NA 4LKCA 1PAMA 3I2CH 5GTHE 1H3UA 2BVTA 4IDLA 4D7PA 4N9GB 5MEQA 2AJUL 2FO8A 1ZT7B 3FSWA 3QZBA 1RPQA 1H3VA 1KPVB 4DP2X 1DO6A 3NCYS 2XN0A 3TH2T 2F8IA 3CD4A 2QM8A 3F12B 5TF1L 1PJ9A 4P48A 3NQIA 1BAFL 1QBLH 3MJGX 1MRDL 2GIYA 1ZLSL 3A3YB 1WIUA 4PLOB 4AEIH 2JCCA 4FG6C 4A2HA 5CZXD 4N0YL 3EJUA 3G71P 5LQBH 1IAKB 4UQ9A 5DURD 5KZCB 5CBOA 3SE8L 3W9EB 4YHIB 5CEYB 5SV4A 4ZNEA 3P9WB 2AEFA 1DQJB 2YFOA 3B9KD 1DHKA 3AQYA 4UINL 2EXWD 4LLMB 4MZIA 5HGDA 3RBGA 1NDGA 1WWAX 4PCYA 5I18H 1AYOA 4PGEB 2ED8A 1T66D 4UMSA 3WXVL 1L0YA 1UASA 1FA4A 5IESH 1WUZA 3P3TA 4NM8H 4Y28J 1R5VB 1BQ5A 4E0RB 3QZPA 5GS2H 4PLJD 2IGFH 2UXTA 2BSDA 4WW2A 4KKCD 1IEHA 4YHMH 2VABB 2VDPH 2XJKA 4PWIA 3Q7JA 3UAAA 5FCUL 1DVXA 5IVZA 4LO9A 3VD4A 1Z6JT 2OQJA 2DQCH 3BRFA 4Q9QH 3FUJA 1X5LA 3GMOB 4MHHG 1A66A 1UEMA 4BZ2H 2HAZA 4E36A 3HW7A 5BVJB 1FNGA 3ZT7A 5KW9L 1RHZB 4HGKC 4K07A 4L3EB 3TONA 1YQ3C 5E23A 5F89A 1SEQH 2UWJE 1PLCA 3PWPA 3LKPA 4PRHD 4XN8A 2WBJB 3VM5A 5ABZA 3PLYA 5LVEA 5IREA 3ESOA 4LESA 3K0YA 2CCLA 4QPEA 3NPZB 3DBXB 3ZSSA 5IB1A 4XCYB 4DEPB 1KY6A 4OLXH 3Q3DA 4QJ3B 2JJVA 3LQMA 4YBLB 1E4KA 4Q9RH 5APVA 5E0QA 3OQ3B 3ULVC 5JMOC 1G6VK 3P30H 4TLKA 4H8UA 4N5UA 3QUKB 4M6OH 2A6IA 4IS6A 2CHXA 1OAZL 1UB6A 2NZIA 3BW9B 3H3BC 4HX1B 3RWGA 3OQRA 2FNBA 1FGNL 3PE9A 2AEPH 3MBEB 3QHFH 1LWUC 4FG2A 5TFSL 1J9SA 3P9LB 5JPNB 7PAZA 1LILA 3L5WB 1OWRM 2BNUB 1DZBA 2V5SA 4JNXA 4MHHI 1FZJB 4Y5VC 4H8WH 4F2MB 2DYPD 2NY6B 4ZTPL 1H0TA 1QI3A 3OAKA 1ZRTD 2RN0A 3HE5A 1S3JA 4LRIA 4LCYB 2PWFA 4K7PL 3UAJC 1VIWA 1OAJA 1S72P 3EH1A 5CSBA 4DK6A 3OAZK 4HC1A 5B1AB 1N3NB 5DWUH 1Q1JL 5DRWB 3I55P 1W72L 3WNNA 4YLQT 3QPQD 1G6RH 2XN9B 1MG3C 4NPEA 3GHPA 5D7IA 1LP1B 4KV5F 5ISZA 4ZKUA 3QR2A 5JOEA 3SDYL 4P4RB 1EZUA 1FFNB 5F71A 2K9FB 1LEGB 3CFDB 1IGTA 3F7VB 5ICYB 4X6CE 5C9JA 1XIWA 4ORGB 4QNPF 4KRPC 5E9AA 2W91A 1LK3H 1FNAA 1ZSHA 3FF7A 3IDUA 3BVHA 4G7YL 4N2DA 3CSBA 1T80A 3UH8A 2YK1H 1I1AA 3TEZA 4WI6A 3CDCA 1NLDH 3OGOE 2QJKC 1HESA 2WB1A 3FN0L 4PB0L 4W9FC 4Y5XC 1GTFA 1LP9F 3ATEA 2Z5HA 2AW2A 2I25N 2LU3A 2VC2L 5CJ4A 4O00A 1QATA 4GW1B 4KZDH 4K55A 3BPLC 5K1VA 5HHPA 5IOKA 5F0JB 1IQDB 2NY5L 5C7XH 1ITCA 4B41A 4I2XB 1CGVA 5JOPE 3II2A 1Y9BA 4JKLA 4JDVA 4PY8J 5H37A 3GJFB 4M1CC 5APTA 1CZ8L 4YDJA 3TBSA 3NXSA 4BH7A 1PVHA 5DHYB 3TGUJ 2EDBA 5IW3A 5IT2L 1M90Q 1R8EA 1SQVD 1BVLA 2Q9OA 3AREA 2F54D 3IRZA 3G5WA 3Q44A 2NOYA 1NCCH 2JDIH 1BBDH 2CKBL 2CHNA 8FABB 5I30H 2W8CA 3CHQA 2RFXB 2O30A 3PL6B 1RVFL 2P5EE 3P2TA 1HL5A 2H2PC 4MRCA 1NGYB 1JTHB 1OIOA 4LZKA 2IIJA 2IH9A 3C5ZB 4HK3N 2CBPA 3CSYB 4F9LA 1RJYB 1NCGA 2WKLA 4IM8A 2XG4A 3WEXB 2Q86A 4I1LA 2J1WA 1UWYA 5GGRB 1K6QL 4WWID 3UGEA 5CZVL 2BCCD 1CU4L 2VTFA 1YNTA 3QO0B 4GBXB 5CJXA 1E30A 2DWXA 3CH1A 4DCQB 3WE6A 4AYBA 4KX9A 5DD5L 2B16A 2W9EL 1CYXA 2XZZA 4ZW7A 1CUOA 1ZTXH 1ZY9A 2MMXA 1RJLB 4BQCA 3P11H 4JAMA 3BKJH 1WS8A 5I1GL 2PO6B 4I18B 1X5JA 4WWPA 2AAAA 3H6JA 1BGYG 2Q20A 3CDGB 4HIIA 1BQHG 3VWJC 4YXLL 2BO0A 2W9DL 3BPCA 2X4OA 1AFOA 3S2AA 4QCIA 4Y1AB 1N64L 1XCQA 4ZAKB 3U9PL 4QXUL 3RQ3A 3FXIC 4FI8A 3HAEA 2JQAA 2UX6A 3OF6D 3REWB 4HG4K 1CFTA 4Q6IC 2VN6A 3GRWA 1ED3A 5FKAA 3T6QC 4WNJA 5LO7A 2YSTA 4BFOA 4NBZB 3PUUA 5HI3C 1CMOA 2C1PA 1XAUA 4EZKA 1E4JA 2NNCA 4X80L 3AE5C 2ICEC 3FOMB 4M1DL 1M7LA 5E8PB 2P10A 3H1LE 1F2XK 5K1JA 4XC3L 1SFCA 3BC9A 2GT9A 2X42A 2XNDH 3MTXA 5F93C 2X6AA 4R96A 4WDIA 2XUWA 2RB8A 1ZA6A 2ZYSA 4PLKC 2CDFA 1ZRUA 4I4WA 2WWMC 5AVYB 4P46A 3S37H 1SDYA 5TPWL 3JWNC 4N8UA 1N7SA 1TTGA 3NCBB 1AZZC 3CN3A 2W38A 3U1PA 3BLBA 3EGSA 1BLNA 5E8NB 5KTEL 2D73A 1HSBA 3O2DL 2BP8A 2UYLB 4WNQA 3L9YA 1E43A 4I7ZC 3O6LL 5CZXC 1WC7B 2MEJB 3H2QA 2ZG2A 1AI1L 4F8NA 1JNNL 3V6OA 5CCKH 3MBXL 5KBKA 1OWAA 4G7SB 1CCZA 5GZNC 1NC2B 3ULUF 5J13B 2EXWC 1KB5L 1TDQA 4TUUA 4X9IA 2DQEH 3F3HA 5D2LA 4FJ6A 1AIFA 4OIBA 3REVB 5JIIA 1B0RB 3USSA 3U0TB 3UTZB 3VI3E 4BFEA 4PJ8B 4D0BB 1QEWB 4AVIA 1XHHA 4JZOB 1FYTA 5FM5M 1ET5A 2OPCA 3FU6A 3VA6A 1EZVX 3QQ9D 3A2AA 1NTKD 1VDFA 1OTUD 3DX9B 2ORBL 3NCYP 4OLYL 3WU2E 1X6NA 3QC6X 4KKCC 1HEJC 3AU0A 5GRJL 2PUQT 3KPMA 2X2YA 3GMMA 5DHMC 3FT0A 2IDTA 1WK0A 2E56A 3A0BE 4KROC 4RQQA 4LLHA 3P3SA 3H25A 5EWIH 1HNFA 1PPIA 2YGNA 1H8LA 3MRJA 1AGEA 2VZOA 4Y2DB 5I1LB 1SDAB 1F1AA 3SWKA 1JZFA 1ZWIB 3C12A 2D03L 4ETQB 1WHPA 1N59A 2EEXA 4PHZA 4CMHB 4OZGA 4ZI8A 4G80B 4OJFH 4YFEA 4GSDL 2P8LB 2WOBA 4Z7NE 2A73A 3CXHI 1PP9G 4NQCD 3W11D 2IAMD 2JCCE 5GISH 4L18A 5SWSB 3VP8A 2VDKH 1JB0J 4P3DA 1S5IL 2O6PA 5FW7A 5IB2B 1O7DE 4IYKA 5L2KD 4TV3A 4JFDD 1AHKA 4I5BA 3JVFC 4OKVA 4ZNEE 5DEFB 4KXZI 3NIGE 1W0WB 3HR5A 1OW7A 1L0LG 1AC6A 2ZYIA 2BDNH 3LDBC 1YTZI 1PG7X 3KGSA 1V3LA 3LIZL 1LMKA 3HBGA 2ZWNA 1GK6A 5I74C 4IKNA 1OD9A 4CBPA 1RZKC 1VGKB 4K0OA 4XOEA 4ACTA 2FO1A 1RULH 1UH4A 3ZHLA 3RRQA 2Y7QB 1NCNA 1P84E 3DSNA 4NJ9L 4UQIM 2NY3D 2DLFL 5KAIE 4NRZA 3OWEA 3EH4B 3LSOA 5JIPA 3BEWB 3ABMB 1FG2A 4X6CB 3N1QC 4BGLA 1UACL 2C9UA 4RFOH 2P7TA 2WSPA 4ZTEA 5GRVL 3T2NL 3VFMB 4ZNCD 4HKBA 4LDEB 3TA3D 4MA3B 3ZT5A 5B21A 1A21A 1KPRA 2R9HC 1XO8A 3PWPE 4C54A 4QRQA 4WK2B 1MCKA 2EE0A 4IIZA 1FJ1A 1X5YA 1X5GA 4MXWL 2W6JH 4RISH 1KJ2L 3C60D 4GIOA 5T1MA 2WNXA 3D07A 4FQJH 1IK9A 4RZCB 4MAYB 2VMFA 1Z9LA 1H3PL 4FLQA 1OP3K 3BIKA 5IHUL 4K9EH 5DZAA 1PQZB 4YXKH 1FLTX 1P7KB 4Q74A 3WUVA 4APQD 3BFWA 2Z92B 3VTMA 5AVZB 2HTKD 5EO9A 2YC1B 3GBNL 3ZYZA 3NFSL 2VDNL 1OFCX 3B5NB 2P5EB 3P3UA 3MRLA 2YN3A 1INQA 2QMJA 4KKAD 5GZOA 4L1LA 4DIXA 4FRWA 3WS3B 3O6FA 4L0PB 5C0CA 1WISA 2PYFB 2VKXA 2X6MA 4KK8D 3FWLA 3KBFA 3S4SB 1Q9WA 1SF5A 4TF4A 3RY6A 5AAWC 4P5MA 4IOIA 1RIHH 1WAPA 2B1AH 4PP1C 3EGDB 1Z0MA 4D9RE 5IUCA 5LBSH 1UXMA 1OX3A 3LV3A 4QWWC 5DDHA 2PABA 4Z3TA 1S7WA 1KORA 4W4NA 1BCCG 1OP9A 5D7IE 5E03A 2XZQH 1W2KT 5ISZE 3EYFA 1HIML 3DTUB 2GSGB 5HHOD 1QUNB 1PX8A 3BZ4A 4HZ1A 4EI6A 3BD3A 3TYYA 3IKCB 3ULVL 1AZBA 4HS3A 3CX2A 2ZXDA 4CSSA 3LYRA 3ARZA 3EWKA 4KY1H 5L8KB 3NYKA 5J7CC 1EFXD 2FYYB 1C16B 1H3TA 3UJTL 5L9DH 1KNOA 4AQ8A 3VH8B 2R29A 4XPTL 4MKTA 1U2CA 4UZGA 3CL3D 4FABH 2VIRA 1NYHA 1S3KL 2EEBA 1NCAL 5KSBA 2V7NB 3BHBA 5FLVA 3C75A 2KP8A 4ZDHB 2QADD 2LXCB 2IADA 5I8KH 4P5KB 2WLIA 3A47A 4KJQD 5AWNL 4MXVE 1PFOA 1XGTA 3WUTA 5DA0B 5EZJB 4Z3IA 3EHBC 3L13A 4NOBA 1C5CH 2VSMB 2WLLB 1M7DB 4MGXA 3BRVB 1DDTA 3OGCA 3O4LD 2HN7B 3RPIB 2J72A 4TLFA 5F9JA 2YGVA 5CWSB 1QPKA 3UTTA 3FQ1A 2HH0H 4WEEA 2JKLA 4JFHE 1O75A 4LRNH 3ZE0F 4AW7A 4F92B 4GG6A 4UT7H 3TV3H 1NCWL 4PEEA 1AHWB 1JGUH 2FBJH 4KXBA 4DGVH 4AIEA 1S7TB 1YQVL 5DQDH 2IAAC 4JREB 2KMWA 3B2XA 4IL6H 2YPVA 2EH8L 4TNEA 4FNTA 1YNLL 2QIWA 1FV1B 2A74B 3JCUE 1RH5B 1HVXA 4BXSV 4U1HA 5CHNB 1NO4A 3KVPA 2CRYA 1IC4H 3CK0H 3L08A 2IQ9L 3F01A 3AE1C 2B20A 2X41A 3F6IA 1YRKA 2DW5A 1E2ZA 2ZUQC 2APFA 2RCSL 2K3RA 1Q9KA 3EDKA 3RWEB 2PAJA 1KB9E 4C56D 4CBZA 1BJ1H 2A4EA 3K1DA 3GSQB 2G3MA 1NEZG 2BSSB 2VDRH 3HG0A 3RNKB 3P4MA 2HJFB 3MD0A 1KMGA 3NA9L 1J0HA 3APNA 3T4AC 4BCXA 1FC1A 4QHLA 5H2FH 5KLVE 1EDHA 4FZEH 3QQ9C 3P4LA 4W7ZA 2JK5B 2KSEA 3PWVA 1SJEA 4F2EA 4X7SL 3L73E 4BFIB 1R3JA 3GRGA 3WKQA 4KKPA 1GL2A 1XSIA 2V9QA 3IDGB 1A22B 2PPAA 2X4QB 3QZNA 4GH7B 4LKCB 1NTMD 1BQHA 4UTBL 4IRJA 5AKTA 3HUSC 2Q8BL 2EKSB 1JUNA 3B8SA 3ZJAA 2MFNA 5MEQB 5TQ0L 2RALA 5TGBA 4L37A 4Z7VA 1Z9NA 4WI0A 1Y8AA 4KFZC 3ETBF 1IK7A 2D2CD 4HKJA 4GOFA 2GUYA 4YH6A 4DVBB 5IGXL 3WOVA 5JHDA 4KDVA 1JM0A 3H1KG 3DMMC 4Z7NB 5C2UB 1FOSF 2Z34A 3T3PB 1NINA 1AE6L 2JCCB 3K2KA 4FJZA 4PN6A 2JVUA 2EIZA 1BG1A 2N1TC 1DEEA 3RWDA 3NIFB 1I4FA 3FTXA 4RNRA 4NHCH 2GIXA 4U6VH 1TMCB 2C34A 4F8LA 2WVRA 1IC5L 3E3QC 1M56B 4MASA 1G7PA 1NDGB 3F8UB 4GQQA 3V6OE 4ZTOL 5J12B 2DM3A 3KPRB 4S1DD 5CILL 2O26U 5IWLA 1Y1DA 5J1SC 1QHPA 1BGXH 3JVGC 4LU5L 2O5YL 1DO5A 5D2LE 4LQFH 4TQ8A 1MPAH 1RKRA 3L72E 1TIUA 2R1WA 3MV01 4KRMB 3MRKA 4WW2B 1NAFA 1FYTE 4P2QA 4RJTA 4BKTC 2F53D 2OR7A 1OW8A 5BV7C 5DVNA 1JF1A 5IVZB 2YOCA 4ZFFA 1K2DA 3H1ZA 4JZJA 1L5GA 2OQJB 3PS6A 3QC5X 2EO7A 4JFED 5ESAB 1FIGL 2VDOB 3ECUA 4M56A 3S97C 3K7UA 1MWAA 2NY3C 1FNGB 2JKSA 1YEDB 1IFHH 2OZ4A 2IWGA 1EHNA 5F89B 2KXPB 4YDIL 3PWPB 3LKPB 1KT2A 3IS0X 3PFUA 4P9ML 5LAXA 5IY5B 5DJ0A 1GW0A 4JQXC 1M71A 3TA3C 3L71G 1NIEA 2LU5A 4OZGE 3GGWA 4L8SC 4XAKE 2D3VA 5DJYA 3IS1X 3RK2D 3D25A 1ZIAA 4E9LA 2H4EA 1NWPA 3VI4F 5IB1B 5C08A 4UT9H 3RPBA 1T2JA 1B4JL 1FDIA 3FCUB 4OLVL 5K69A 2IC2A 3PGFH 4A2MA 2XWCA 3FYEB 2A6IB 4IS6B 1BVKA 3VOPA 1UB6B 1V8HA 5HGAA 1XX9C 3IE4A 3NRQA 3RWGB 2WSCJ 4WW1A 2XYBA 4X4XA 2XCMC 1LWHA 1FDLH 4TSAL 4AQAA 3GO1H 4E42A 3HBPA 1T7ZA 3BSGA 3OTTA 3VX0A 4PQXA 2DRUA 5AG8A 3K5BA 2BLFA 4P2RB 3EG9B 2VUYA 1NTZG 3KVQA 4FADA 1LEIB 3TOPA 3GW6A 4WFED 2EEFA 4KK8C 3Q2WA 5CNHA 5AQ0A 3H1HJ 5LXGH 3PPSA 5DJDB 5JR1L 1G7LB 4BGDA 4LEBA 4MJID 5D7IB 1CBVH 3ARVA 5ISZB 4OGYL 5BZXA 2XICA 1I8KA 2ZJSL 2Q7AA 1IGTB 4FLRA 1KILC 4YNYA 1XIWB 5BRZB 5KBNC 3HKFA 1F1DA 2K7QA 3KWWA 4NO2A 5E2WL 2QHLA 1ADQH 3L5XH 3RKDD 3BWAA 1I1AB 1S9KE 1R0AL 1FL3A 2MKLC 5D1QA 2M83A 2Y0DA 2I07A 3B2UD 1PNDA 1SYVA 1XH0A 3TLRA 2YXVA 3U6XS 1QLRA 2R5BA 1FS0E 2J55A 3I9AA 3FAXA 5HHPB 3CHXA 3MGOA 5IJVA 2XIBA 5LLIC 2B89A 1ZOXA 3S5ZA 3FFCA 1DVSA 1F45A 3HC3H 1RZKL 4JDVB 2PPFA 3QHZH 3TBSB 3TTSA 2YUXA 4N3UA 3S35L 1A5FL 3WLWD 4BH7B 5BU8B 4IBZA 4LSUH 1BVLB 4UB8H 1HH6B 4AENA 4BWWA 3AREB 3L81A 4AH2A 1HXMA 5EBMA 1T83C 4Z0BL 1QSZA 3MI6A 3PJSB 1F4XH 4KJQC 4MZ3A 2Z5IA 1J1DC 2Q5UA 4CNIA 6FABH 4H8PA 1OAXH 4JM2C 5C0CE 2YAQA 4IQHA 3W56A 4F7MA 5B7MA 5K9JH 4HKZH 2XG4B 4Z8FH 5B1JA 3PP3H 1LO3L 2Q86B 3HVNA 2WZPD 1TFPA 5I6XC 2IH3A 3ZRFC 1YNTB 1AG0A 3G6JF 4HJGA 2FLMA 3CH1B 3BSZA 5J56B 3B7RL 1A3RH 1IEAA 3L2MA 3WE6B 4PJ9D 1D9KD 1A7RL 1QOKA 5FK9B 3LW5J 3L75J 1OK0A 4OB5L 3VYIA 3MLWH 1P9MC 2ITDA 1E40A 2VR4A 3DYPA 2OW7A 3L2LA 4JAMB 5CKGA 3FRUA 1MHEA 4G9FA 2EVGA 4M00A 3GEWB 4IW4C 2D4FA 1MY7A 3OL2A 4N2LA 1PS3A 3EFFB 4OQTH 4UQ2A 4HIIB 3TBWA 2JJLA 1D7MA 3WJJA 1F4YH 1FH5L 4RLDA 1T20B 2EEAA 2X4OB 3MV7A 1A7BA 5KJ7A 2XA3A 1XCQB 3TF4A 1Q2NA 1NC4D 1X79B 1TEGA 1L9QA 1U93A 1AO7A 2AVGA 3L4WA 1RZJH 4HCRL 4NUMA 5LCVH 4E5XG 1F5WA 1CFTB 4KRNA 4I0PC 5CGMA 4L4TA 5FKAB 3CQQA 3EXLA 5KSBE 2XX1A 3VYPA 1QLFB 3CZSA 4KTDL 5GHWH 4MMZA 2ZCHH 2C1PB 3RK3C 2WQXA 5DFWH 2KZBA 2FEDD 1IJNA 3WTTA 3SKUD 4GAJL 5KVFE 3LS4H 1WO2A 3ECWA 5E2VH 3KYOB 1C9SA 2D0HA 4FA7B 3IXTA 2BS9A 5HYQA 2OJZH 4PW4A 3ZRSA 5CLTA 1CK0H 4R96B 1FSKB 1XB6A 5F1OB 5HDBE 1HUCA 2EDNA 2HP4A 1H0DA 1ZA6B 4IK6A 4O51A 2CDFB 3HZVA 4I4WB 4NZUH 1BLIA 1F8TH 5KSUA 3UTTE 2Z31C 3MA9H 1OLZA 3SGJC 4GG6E 3IDXL 1FVCB 1NAMB 4ZXBA 5DMGD 3EGSB 2G30A 4M5SA 4WHDA 1NAKL 5E7FA 1HSBB 1AQKL 2XVBA 3HG2A 2BP8B 5IEKA 4WNQB 1T3JA 1KYDA 1RCYA 1GCYA 5HHMD 1E5BA 1PX4A 2I5YH 2NLJA 1URQD 4NN5C 2JJWA 2NXZB 1MFVA 4XO4A 3H56A 3VXNA 1S9YA 4J4PA 5FGBC 1QRND 1UATA 2KLRA 4RGMB 1N10A 1N8OE 4NNXA 5FYJE 5BOJA 5D72L 1P4UA 5D2LB 1AIFB 2CUIA 1Q0XH 3GSNA 2L0DA 2AJVH 1T7VA 2A9ML 4L1TA 5K9QI 3QUMA 3RPKA 3ZZLA 4MYWB 3BPOC 1MJ7H 4O2EA 4DVRL 5B7EA 1DZ0A 1UCBL 4W9JC 4V2BA 3QUXD 2WXKA 3SY0A 3SGDI 3KPMB 4QXGH 3SDCC 3GMMB 2CXKA 2BW4A 2WSKA 5EDSA 3WBDA 3EW3B 1H5BC 5KBPA 1H8SA 4XHQA 1QLED 1N0LA 2GQHA 1KN2H 4RQQB 4Y4KA 3Q2LA 4P3WA 5EEUA 1AGEB 1P7QA 3ARBD 1KBKA 4I3SH 2KDGA 4H8WC 3ULAB 4TLUA 4PI0A 1G9NC 2FX7L 4Z7VE 4PS3A 2WMMA 2BY1A 3A22A 3EJQA 1A4BA 4GSQA 4GFXA 4BZ1H 5CMAA 5JHDE 1I1CA 2MPAL 3QG7H 3N6YA 4LEEA 3TIDA 2AXFA 5F6HJ 4Z3EA 3U0WH 5GJSL 2HKHL 1GZHC 4B96A 5CEXB 4FQXC 3ZKMC 2R8SH 3LHPH 1CLYL 4K5NA 4K71C 4P3DB 3NEOA 3QEGL 4DKEH 3Q5OA 4I5BB 1NFIA 4EKJA 1C8PA 4OKVB 2XOTA 1JGEA 1K04A 5EZIH 2IFFH 1NCBH 3Q06A 1FZAA 3HR5B 2EP6A 3IPFA 1F3JA 2IBZG 3N7NA 3FK3A 4ZW5A 1PG7W 2Y2WA 4NWTH 3MFFA 4HAFA 4GXVL 4UAHA 3W2DL 4NO3A 4EI5D 1DJIA 3OW2O 2V8LA 2VNCA 2X3CA 1TXKA 2A38A 4YSOA 1DQDH 2RGSA 2NPSC 4PV1C 1VQ4P 3CVIL 3EDJA 4W9HC 4P2QE 1JZ3A 2YAOA 5DFVC 3DSNB 1FP5A 4JRFA 5IIEA 4C7RA 1LJMA 4YE4H 4CILA 3R4DA 3LSOB 2FL5B 4YS4A 1AYRA 1S5LX 3C87A 3LKRA 3PHOB 4XE5B 4W9DC 5A7BA 1TTUA 4JFFD 5K5YA 3D33A 1UCTA 2AEIT 5DTFB 4OD3H 4HJTA 1P1ZA 1UQSA 3OD3A 4HKBB 3LNEA 1KPRB 3U48A 5KAQF 4FXKA 3RVVC 2X2IA 4QRQB 1F2QA 3MNVA 1F6LL 2BWIA 4GXFA 4Q9BA 2WINA 3NCMA 5FC9A 1BCIA 1UYWL 3CSTA 5HP5A 1JCCA 5EOCL 1ACCA 4FQCL 1HKFA 1UEYA 1UWXK 3LD8C 1KXTA 3QQDB 4FTDA 2K9JB 4PS4H 5FOJA 5T1MB 2XQBL 3B2UC 3D3VD 2IBZI 4F91B 5C08E 4PY8I 4QAMB 4AC4A 3H32A 3DX7A 2YMOA 1WFJA 2C9AA 5DLMH 3UPRA 1PGJA 2WIIA 3O0RH 3BIKB 1R5IA 4U3CA 2A5UA 4XBGA 5FUOL 1KFGA 3I50L 2OMNA 2LGNA 4M7LL 1DQMH 5EO9B 5BV7L 4P2AA 3L48A 1I7TA 3UCRA 5D5MA 5I0WA 4CW1A 1CC3A 3FQNA 4FJYA 4HUWA 5I82A 2DH2A 4XC1L 5IF0A 1Q4NX 3OXSA 3T3MF 4KAQL 3O6FB 2C9PA 5C0CB 2NQ3A 2TAAA 1PJWA 1Q9WB 1VEMA 1HL4A 4P5MB 4IOIB 1KXQA 3X1FA 5I1CH 1OTTD 4RFEB 1Z5HA 1NBZA 1PP9E 1TJHL 4KK9C 2AFNA 3LV3B 5DDHB 3KWUA 1S7WB 4NKOA 5I5JA 1GSMA 3P77A 4YO0B 4D94A 4YDLC 4LBEB 1JDCA 5AYUL 1KTDA 3V5KB 1I9RH 1C5DA 4KGJA 4PM1A 2Q10A 3JBG7 1UD8A 4YE0A 5E94A 3C5SB 3BZ4B 1L0LE 3K72A 4PJ9C 1BM3H 1VADA 3HI5L 4XPFH 4EI6B 3LXCA 3MPCA 3WUWG 5EBWA 4HWZA 3K6SA 3IMSA 2XWDA 1SLVA 2BVUA 3O41A 5IBLC 2DD8H 3VI3F 3QZWG 4QTIH 5D1QE 1VFBA 4CA4A 5KYNA 2F7IA 3TZVC 2J57A 4LAQL 1E6OL 3G6DL 4FKKA 1RFDL 2DJ4A 1Q82Q 1KJ3L 1EDLA 1AD9A 2UY7A 4HJUA 5TQ2H 4C57C 1Y07A 4HIJA 4TS6A 2VIRB 2ETWA 3JWOH 3FFCE 3WE1A 1M05A 3QUZA 2VT0A 5ALBH 2X9WA 4PRID 5KSBB 1ZEAH 2GEEA 2WNWA 3BHBB 4OCWH 5AALA 7TAAA 3E8UL 5LXVA 3V52L 3NMEA 4EQ2A 4JE4B 4UQDA 3MODL 3C2AL 2F7RA 4PV8A 5I71B 2CJ3A 2IADB 2D7MA 2F19L 4K4KA 3UYPB 2WLIB 2ZOOA 3NH7L 1NCDL 2E9JA 3QIUD 2O6CA 3QULA 2B08A 2FEDC 2XPYA 1MAMH 1HE7A 3UBGA 4CGTA 1U8HA 2JELL 5LUMA 5T33L 1E5CA 2R2CA 2IG2L 2XG5A 3N1PC 2BEZF 4EPSA 1MCLA 1OW6A 5F9JB 2JKXA 5DT1L