5AW9B

Kinetics by x-ray crystallography: native e2.mgf42-.2k+ crystal for rb+ bound crystals
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 51
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw9B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw9B02
5AW4B 2BASA 5APUA 3TNUA 3M06A 5AVRB 3V4QA 5AW0B 1OXZA 2YO3A 2Q5UA 3NTNA 3MD0A 3T97A 1CSBA 4RESB 2WT7A 4AUWA 5AW1B 3VMZA 3P8MC 2C9LY 1S9KD 1GU5A 4JYBA 4C46A 3IR9A 1NAFA 3NFQA 1H88A 3SWFA 2ZXEB 3L35A 3NMDA 3HE5A 3TK1A 4KHXA 5CMZA 2XV5A 1KQLA 2N9BA 5AVSB 1MUUA 5APXA 3A5TA 4I6MC 3I5CA 2Z5IA 4RETB 3P32A 2XZRA 5AVUB 5APWA 1GU4A 1A02F 1JNMA 4AYCA 3B8EB 1HWTC 3M9HA 3O8ZA 1SP4A 5APSA 3M91A 2P2UA 5APTA 5APYA 1T2KD 1MV8A 5APQA 4XE5B 1IO4A 1GK4A 3M9BA 1MFZA 5AW9B 3V4WA 4DZOA 4B86A 2E43A 5AVVB 1SLQA 2P7JA 2YO2A 1GZLA 4C7NB 1HJBA 3A7OA 1HBWA 1CI6B 3M0DA 2E42A 3HE4B 4GKGA 4AQRD 3WGVB 3UIAA 3A3YB 1FOSF 3VYIA 5AW3B 2R3CA 4GT1A 5AW8B 3VMXA 1A02J 3WGUB 1H8AA 2QM7A 2WPQA 2H7HA 2WTYA 1YYCA 4LC1A 3LIEA 3P7KA 1CZQA 3VN0A 5AVTB 2IPPA 3TNUB 2KP8A 2P67A 5AW2B 5AVQB 1GTWA 3TYYA 3VMYA 2Q7CA 1H89A 3L36A 5AW7B 4EOTA 5APVA 2WPRA 2R32A 2WT7B 3KDPB 1X8YA 5AVZB 4I2LC 1NWQA 1S9KE 1FOSE 4HYTB 3LIDA 5AVXB 1GD2E 2WPSA 2JJLA 2Q3IA 2R5BA 2XU6A 3L37A 2C9NY 3MGNA 2W6AA 2Z5HA 3HE5B 3HTKA 3NXSA 3KQGA 2W27A 5AVYB 3OAKA 3VTPC 4C7NA 1GK6A 1DH3A 1G2CB 4JYCA 1J2JB 1CI6A 2YNYA 3V5BA 2QM8A 1JUNA 3HE4A 3A2AA 5AVWB 2R5DA 2VRSA 2WWWA 1HUCA 2ZFCA 1T2KC 1FAVA 1OWAA 4M3LA 5AW6B 3M0AA 5AW5B
chains in the Genus database with same CATH superfamily
3AEGC 5F88B 4LESA 1JXKA 4PGEB 5JOPD 2WYIA 1G6VK 4F37K 4DUXA 4F9PC 5A2BA 1ET7A 2P43B 4OKDA 4W1TA 2CK0L 1X5AA 5DZPA 3FBQA 3PDOB 2K7QA 5DS2A 5IVXA 1GC1H 2XBDA 3PQYD 2ARWA 3SBWA 3ARQA 3GTTA 4I1PA 5IB1A 5EORL 1NL0H 3IPEA 5AENA 4CN1A 2L5GB 3T6QC 5DR5H 3EQ2A 3QXTA 4GT7A 1QR1A 2DYPA 1IC0A 2F74B 4G6KH 4PVMA 5FYJE 1U8JB 4X80H 3TO4C 2VSCA 2AI0H 4FQQA 4YC2B 4EKJA 4KHXL 4LNRA 3G6AB 5KVGH 4WZ9A 3PHLA 5APXA 1AIFB 4WHYH 4YDKH 5KJ7C 3SDXE 4DQAA 1O9VA 1HX0A 1ULVA 3ZSTA 3BHBB 3CVCA 3B6SA 4JB9H 2EXWC 2NR6A 3DIFB 4XC3H 4A68A 3V8OA 4L4TE 3PV6A 4BQ6A 4TTGA 2BXYA 1A6VH 1Z56A 4PG2A 1QPPA 3BSZL 1OD7A 3EYUH 2Q6WB 4LSUH 3HI1A 4GBXD 2M2DA 4RIRB 4KI5E 1MJUH 4XMPH 5I16A 4JDTL 3D3VB 3I3BA 4RWYH 5CS7A 4YHKH 1YYLH 2KZJA 4MQSB 4X9BA 5CP7A 3BPNC 3O81A 1J0JA 5G4MA 1OAJA 1I7RA 5DQ9B 4FJYA 1H15B 3T3MF 5JMRA 2OR9L 2K78A 4WEBH 4IFMA 4QXTB 4XP4H 2HKHH 5CO1A 5C3LD 5KOMC 3T4YA 3KCWA 4B97A 2V7QH 2UWEB 3O3BA 4Z77B 3UC0H 4HUUB 1GC1L 4URTB 1SEBA 1F4YH 2JLLA 4QXGH 1SFCD 2GG1A 4XP1H 3HMXA 1ILSA 1NL0L 4PJ5B 3WIIH 2D2OA 5DR5L 2E56A 2JV6A 3K3QA 3ES6A 4G6KL 4HF5H 4R96B 2DBLH 4X80L 2AI0L 2OMUA 2O5XH 2QSTA 5IF0A 1FFOA 5F44A 1AHKA 4JFPA 4CBPA 5KVGL 4FYTA 4NQDE 4X50A 2YK1H 4YDKL 2BVOA 2E4TA 1U9KA 4KRPD 4JB9L 3K0YA 4WDIA 1N7SA 4DP1X 4NQEB 5AVYB 3ARGB 4XMKL 4F8QA 1QVFO 5C0BD 4NC2B 4XC3L 1X4ZA 3V0IA 2K45A 4H0LB 4ZTOH 2CO6B 1A6VL 3GINA 4U6VH 4LSUL 4IKLA 4MMXA 2BINA 2CCWA 3T0BA 1X79B 1MJUL 4XMPL 1DANT 4RWYL 3US0A 3RGVB 4YHKL 1USZA 2BH0A 3BQUB 2IYPA 3K5BA 1YYLL 4GBXC 3HUSB 4GFTB 4K3DH 2NZ2A 1G7IA 1R1CA 4L29A 4JS7A 3RJQB 4F7EB 2P8MB 2V4LA 4G6MH 3MRHA 4X9GA 4WEBL 3TF4A 2OXHA 2BVPA 4XP4L 3AT0A 2HKHL 2HLFD 4LCYA 3V8CA 4CAGA 5HDBF 2LVEA 5CBEA 3K0WA 3BVDB 3KPRE 4RBPH 3KLSA 1U8QA 2WWOA 2Y1ZA 4YMPA 1NJIQ 4LF3B 1AGCB 3P8MC 1S7WA 2IBZG 5E6YA 1J8HA 1F4YL 2H32H 2WMPA 4QXGL 4XP1L 3NIGB 1KV7A 2H5UA 3WIIL 5KVEH 4TNWK 3QWQB 3M9QA 1H9VA 2BOCA 3PXHA 4OKVB 1SFCC 2BVEA 3C5XA 4HF5L 2DBLL 1JMMA 1J0KA 1OSYA 1XH0A 2DW5A 2ZOLB 3QSKB 2ZX8A 1P5UA 4W4OC 1HHIB 2O5XL 4P5RA 3OB8A 4X98A 4IOIH 1FDIA 5F7NC 3PHAA 4POUB 3MHZA 2G2PA 4PB9H 1DQVA 1L5GB 4R3SB 3MRPB 2FYNB 4RGMC 3KPMA 1JNMA 1FFPA 4QDGA 3O8ZA 4OUUB 2GY7B 1JGEA 1NTKG 2LU5A 4KRPC 1KV3A 5FDWA 3WUWA 4BFIA 1NU1G 4ZTOL 4U6VL 3H7BB 3VVVA 3IDXH 2J5LC 5MERB 5C07B 3F7VA 2P5EA 3MJ8B 1MHHA 3IE4A 2WZPA 5E9DD 1QO3A 2K6WA 1B4TA 4L4JA 2ZXBA 2HG5D 3BI9X 4A2GA 4LEOB 1QSFB 3F6JA 1SQ2N 4K3DL 3CXFA 3T5WA 1RI8A 1GJWA 4QAMB 2LGNA 5IKCA 4G6ML 5GTHE 2QLYA 4OCYH 4RH4A 4BH8B 4X5WA 4E5XG 3G5XB 1D7CA 1J7VR 2VQUA 4FTVD 4PJ7A 3W37A 1CS6A 1O6VA 3TZVA 1T6AA 5JOPE 1UWFA 3ULSB 3KPQB 1CDIA 5IMOB 3ZT7A 2HLFC 4BD4A 5E8NB 2BP5M 3MV8A 4DCQB 3EHBD 2PPFA 1XGPA 2QHLA 1EFXD 3PQYE 2VABB 5KVEL 2H8PA 5D7LD 1D2PA 3TPKA 3IETA 4PY7B 1L3NA 4JQIH 1R8EA 1JWUA 1YUHB 1HWHB 1Z5LB 2V5SA 1GAFH 1PLAA 2F7QA 4DUWA 5KLVD 3NESA 3FU7A 3D2UB 3ASWA 4PB9L 1ZVHA 2JCCE 2VITB 4HMCA 5TJWK 4MQTB 3DX0A 2J1WA 2IZ0A 3GJFH 2PWDA 3ARBB 2A7BA 1AV1A 1W0WB 2FIKA 4OCNC 1XDTT 3PL6A 3QPQD 5D1XD 3LMJL 3IDXL 2X1XR 1GGUA 3VQ2C 2YKQA 1ID2A 2I27N 3QEUB 3NN8A 2N7SA 3UJJL 1U58B 3LZPA 3PHQA 1BXUA 3QCTH 3DIDA 4P9HH 5INDB 1T83C 3QJFA 4GXFA 3DMMA 1SUHA 3MRDA 2APTA 2ZICA 4JKPH 1NAMH 4OF3A 2ZUQC 4XNMA 2J6EL 3N3EA 4OCYL 3GRBA 5D96C 3C8VA 1ZHLA 2CJTA 3CQFA 1Q9LB 1DX7A 5BCAA 3KGUA 4XO8A 1P5VA 1KBVA 1XCQA 3ZBMA 5T1MB 1RURH 5DC4B 3QXAB 3APDA 1HE7A 1MG2C 4ZX6A 4L8SB 2XNXA 3GS7A 3IYLW 4U1MB 2UXFA 3ARSA 4L2LA 3SCMD 4JQIL 3UOAB 4K9EC 3EHBC 4X5RA 2NYYD 3KJ4C 4RKUJ 3RLSA 2EYSB 1GAFL 4WK2B 3BE1H 1M7IA 1IUZA 4H26A 3BKMH 2C3VB 4TN9A 3B3IB 1SVZA 2UZPA 2DWEB 3ZZSA 4WWPA 3IGLA 3L71D 3CD4A 3DGGB 1KJMA 1F11A 3RY6C 4AQEA 5KTBA 3SPGA 1LT9C 3COOA 3L3IA 1GK4A 4MNQB 3LKPB 4X0NA 5C0BE 4IHOA 3P4MA 5CIPA 2VLJD 3MCKB 3BZEA 5CKAA 4APXA 3QCTL 1HNYA 5HDQL 1S5LX 4NQCA 2OV0A 4P9HL 1XGZA 1YEIH 1BBJB 1RLBA 3QPQC 4J12A 4QRAA 5D1XC 4HDIA 4F1ZA 1G84A 2ADGA 4JKPL 3LN9A 2EDXA 1NAML 4ADIA 3G9AB 3AT9A 1W80A 1ORSB 4LFHG 1MFDH 1T1WA 1WIPA 4KKBD 4PRBB 1GZQB 2XKUA 2VO8A 3KL5A 1XCXA 3V10A 5HGBB 3W56A 5FO9B 1NTDA 5AG9A 1TT6A 2PP9A 2YR3A 5IJVB 1NJ9B 3DWTA 3NCBB 4P46A 3EJUA 4G80B 1LEGB 3UCQA 4ZX3A 4Q6KA 1RURL 2NSQA 1AAJA 3F7YA 5IEKB 4Z1PA 5IW6B 3PWUB 2E47A 1JF6A 1JPSH 1BQUA 1S9XA 1QW9A 4WVZA 4R97C 2V7NA 1HOCB 2ICEB 4JHBA 1SY6H 2JEEA 2YUXA 5EHFA 3EOTL 3SCMC 3BE1L 5D9SB 1TENA 1FO0A 1W6LA 3S97C 4AQAB 3BKML 3BYYA 2NYYC 3LKRB 3LV3B 3AE7C 2CR0A 2D0FA 4PJXF 4ELKB 4XB3A 2H3KA 1SJXA 5HHXH 3VQLA 1OW7A 3O6FD 2ZYIA 1E8XA 4EDXA 2OYLA 4A7QA 5AALA 4MSWB 2AITA 4DPCX 4U1KA 1JXGA 2O01J 1R3JB 3UTOA 3WO4B 3AECC 5IEHA 1AVAA 3GIZH 1TFHA 3DLQR 3PRJA 1YEIL 4RGNB 5T1LD 1NCUA 1VSCA 3HR5B 3P02A 3ZRFC 5E9DE 3K80A 5EOTA 3VXOB 2J3SA 3THMH 1MFDL 2JCWA 4CN6A 1P84D 1DVFD 2NDFA 3OHMB 4FL4C 4I9WD 5A3IC 1VIWA 4NZ8A 1XGTA 5GGTH 1ZANH 1T4KA 3D0LA 4KKBC 1ZS8B 1YEGH 4FTVE 1NBVH 3D85A 1PQZB 3SDDB 1X9RA 3HE5A 1T2JA 4UU9B 3P3SA 4FQXA 3H9SB 3HLAA 3C6LB 5D7IE 3L70G 2ZXGA 4XN1A 2DH2A 1JPSL 4AYID 5HYQB 1S5HB 2RGSA 5D7LE 4E9WA 1BD2B 1BVOA 1QZ1A 4N68A 3MA7B 1A6ZB 3VXQB 1SY6L 4AI7A 3KVPA 2PYEB 3VXRE 4W80A 3EGDA 4UQ3A 3NAAL 4PTUB 5LB1A 2AQQA 2DS4A 5KLVE 1T2KD 1HEHC 2QVKA 1ZIBA 2VUKA 4ZS6D 3AQYA 1TJXA 5H4ZA 4KH9A 5HHXL 1PZDA 1QFWM 5F71A 4HCRA 4Z7QB 5J11C 1FVDB 2WW8A 1B0IA 2FVNA 1BIIB 4ADGA 3O6FC 5LGHH 1JY2O 1JI1A 4P5KA 1EO8H 3GIZL 1R3HA 1JB0J 3BOVA 1H8LA 2V7HA 3SBWC 4N6RB 1Z0NA 5IUCA 5GGSA 1UVQB 1U8LB 2ZIDA 4N3YB 1UADC 1WFTA 1ZEAH 1UZ6E 3RGHA 3THML 1AQMA 3ULUH 5AVTB 5LNDA 3ZHLA 4U0RC 1G7HB 2VMCA 4XP6H 1A0QH 2FYYB 5GGTL 1ZANL 4XNZC 3LPPA 3SY0A 1DVFC 5FOBB 2V2XA 3NG5A 4GAJH 3BKJL 1NBVL 4FG2A 4KUCF 4FEMA 3S9OA 3ESUF 4J1UB 3U1SH 1IJDB 5HDOA 2B15A 4N2AA 1E67A 5KWYC 3N40F 3UXFA 3MGTA 4KITB 3EBHA 4P5SA 4PJGE 4HS3A 5IVOA 4E0RB 1WBXA 3V5HB 5HGGS 3NCEB 4JO5A 5FF6A 2OZ4A 4MWFB 4M7ZC 2XZZA 1WS7A 2F53A 1IX2A 2XVGA 4ZMAT 1UCBH 4MJHA 4MQXD 4EI5D 1MJJA 3DXAA 3QUKA 1NOHA 4U4BA 1GZPA 4FDWA 2P9RA 5CINH 5JOFB 4GI8A 4XCNA 1T2KC 4ZS6C 4HGMA 3RL0B 3R4RA 4IRJA 2NZIA 2YRPA 3W5MA 3MBWB 4JCWA 1PCSA 3L72G 1IM9B 1P1VA 1RJZA 2PTUA 5LGHL 4HIPA 3E2HB 2JIXB 4LARH 3VI3A 2RJMA 4YVUA 2VLJE 5IREA 2OMNA 3FQWB 1XX9C 1M1JB 4OCSH 4MMZA 4N2NA 4XAWH 4IBLT 4U3FD 1ZEAL 4ODVH 4PV1D 3TN0D 1L0LD 3ULUL 4PJIE 3HVNA 4JM2B 2WBXA 4FI6A 4MA1B 4YXKH 2YEZA 4U31A 1WFUA 4XP6L 1A0QL 5D1QD 15C8H 3F6LA 3QO0B 3MR9A 4JAMA 2AXTE 3BX7C 3MGOB 5FKAA 1PLBA 4RFNB 1RJLA 3V0WH 5L2JA 4NRXA 1HXMB 3U1SL 3VDBA 3VFPB 4QHMB 2ADJB 2Q3AA 3F8UB 3CFEB 3CDZB 4R5TA 2Z5IA 2JQMA 3CTTA 5C3TA 4GSRA 3AG1B 1WYJA 2P5ED 3HA0A 1UIXA 2WZPD 3AUVA 3AMKA 4YDZA 1PDKB 1Y6KR 1K5WA 3DPBA 1I85C 2X6AA 4XVUD 4GAAA 2V2WA 1J9CT 1MV8A 1KNOB 1NICA 3D0VB 1UCBL 5ACLA 3JWDC 2QJPC 1ED3B 1K9TA 2X4NB 1NVOA 3VYNA 1DE4B 3UTZB 4FA7B 2DIAA 4ZNEA 4MYWB 5CINL 3QWRA 1EIBA 1UCTA 2L8AA 4U6YB 1X7QA 3A67H 4Y1SA 2Y2YA 1PL3A 1SQPG 3E7KA 4IK7A 4LARL 5IVXE 1EZVE 3IAGC 1OANA 2QRXA 3S37X 1MWAB 1K2DB 1VFBB 3U1AA 4BK8A 2WJ7A 2WLHA 3MRJA 4D8PB 4OCSL 2PGDA 1XMWA 2YA0A 1MY5A 1FBIH 4XAWL 3DX8A 3W9EB 3MXWH 4ODVL 1KFMA 1UWXK 1TTGA 2QTEA 4KKAD 4X99B 5ID0A 4QO1B 4N2LA 4I4WA 4YXKL 3VXNB 2P5PA 3CSGA 4GOEA 4PV1C 1P84E 4I9WE 3TN0C 15C8L 1QMUA 1XCTA 1X8YA 2XZCH 3C87A 2FSEB 4R4BB 3GMLA 4DKEH 1DVTA 2W60B 2ADIB 2F68X 2YZ1A 3PABB 4IBYA 5D1QC 3CCHB 3T3PE 3V0WL 4JANA 4EDWH 2NNAA 3FB8A 3IPFA 3RUGF 2MOGA 1NH4A 2E9IA 1MLBB 4FXTA 4KMQA 3Q5RA 4KQ4H 1BVZA 3VD9A 4CMMA 1RSYA 1ZMEC 3CC2P 2K9JB 2WQYC 2XV6B 2E5EA 5JTWA 3VFRB 4XVUC 4GNKB 3QXDB 1P4LA 3U2JA 3FQXB 2H1LM 1L0ND 3P4OB 1KTKE 3BVWA 2G5BB 1C12B 3SKNA 3D3VD 4LCVA 1L0QA 4MZRA 2NLJB 1QLEH 2XKSA 2HPOA 2XNDH 3A67L 3HVDA 2FXPA 1JHLH 5I74B 1BXVA 3LS5H 4JQ0D 4RMTA 3WDHA 2PAJA 1EH9A 2WVUA 3OKLB 3TNMB 1JZIA 4N8VA 4MD0A 3AY2A 1D5ZB 1Z5HA 2UV3A 4ZFZA 2W0FA 1BE3D 1EAOA 4WEEA 1JP5A 1FBIL 2XPGB 2AEOA 5FA3B 1DQJA 3MXWL 5G4NA 1JMBA 5KBKA 2ISDA 1OP3K 4PJ5D 3TA4D 2ORBH 3C5ZA 3CLWA 4LASH 3LKSA 1CF1A 1INDH 1N8ZB 3WNPA 2XZCL 3GF7A 4HH9A 2MKVA 3Q44A 3VMOA 1JTHA 2JO1A 1MUUA 3V9EA 3WIFA 3CFCH 3QQ4A 2ZXCA 3SKJH 2P3YA 3CV5A 4BSVA 2PFXA 1JOCA 4EDWL 1LEIA 4WI9A 2NUTB 2ZSVA 1PEZA 4YC2C 3BXNA 1XXFC 2B89A 2OSYA 3FTUA 1J10A 1PL5A 4IS6A 2E7CA 4KQ4L 4NQCD 1WBZA 1YQ3C 5APTA 3IPBA 3OJVC 3STZA 1G94A 5GRUH 3WNNA 5LN8A 1EDKA 5HI3D 3CIAA 4OFPA 3L4CA 2H2SD 4EQ2A 2YAMA 1NA8A 1ROCA 4PQXA 5BO1H 2XQ0A 3FQRB 1CYGA 4DEPC 1OL0A 2JKTM 1N7MH 1PSKH 3O4LB 3VDCA 3BQUD 5HHNA 1QLEL 3SE6A 3GI9H 3EYVA 4P46D 1JHLL 1NU1K 5B5EE 1FHNA 3LS5L 3WGUB 4C57C 5T3ZD 2D7OA 3SWYA 1EDYA 3BP7B 1U0QA 1J8HE 2X1OA 2IQAA 2M83A 2OYMA 3OMZA 3GZQA 4DOHE 4AZ8A 3QZNA 1MCRA 3ELQA 2Q7CA 4YAQA 4U3FE 4BCYA 3DO7B 2ORBL 1P84J 4LASL 1PFCA 4YHPB 1L0LE 2KOGA 3HE6B 3RAJH 1INDL 1DJSA 1JZ7A 5BV7B 2BC4A 5FYJU 2AS5M 1DN0B 1GOHA 1N73A 1F6AB 3RIAK 5DD1H 2YUVA 3CFCL 3A0BE 1D5IH 2BNQB 4APQB 2NY1B 4MX7A 1HKLH 3HPLA 3SKJL 1AQHA 4OV5A 3MBEB 4TNVK 1CK0H 2GJZB 3KYAA 4X8CA 3N55A 5CGTA 1MH5A 5B3NA 2CJ3A 2CCVA 1VFOA 2Z1PA 5K1NA 3M07A 2IFMA 4LB8A 1N19A 5GRUL 3CCUP 1OE1A 1RH8A 2P5EE 3WXVH 5KAIE 4BQ9A 2FEJA 5DI8A 1DANU 2RB8A 4KDTA 1G7PB 1U30A 5BO1L 5IJDC 3JBG7 3ARDA 5HI3C 4WW1B 5C07D 5I6NA 4BHUI 4QRQB 1N18A 1FWXA 4X0KA 1N7ML 3LN4A 2H2SC 1PSKL 3OXSA 2R1XA 1QSFD 3NP3A 5D1ZI 1TQTA 1FNEA 2WZ7A 4H13B 1U95A 3GI9L 4PJCA 4HIEA 4PJ7E 7CGTA 5EEXA 3NFNB 4XN5A 3BQUC 1NIFA 1N0XH 4NC1C 2QELA 4Z7OE 4HLJA 4NZJA 3E6HA 4P46C 4ZW3A 2O26U 3MV8E 2X4OB 4Z7UB 5JIPA 1SQQE 2H26B 1CXLA 1LO3H 5KUKA 1MCWW 4RCAA 3UIYA 2VTFA 3QFJA 4LBEA 1LK2A 5FYJH 2YBRA 3I6GA 4M7LH 1SQXG 3DOSB 1HTLC 1NTZD 4XZUB 4X9HA 4YE4H 3IVKA 3IRZA 3R2PA 3RAJL 2G75A 4HXAH 3SDAB 5I9QC 5FO7B 3ZDYF 4E42B 3QQDA 1M8OB 5DD1L 3SPJA 2A74B 1D5IL 3GRWH 1HKLL 3CJJA 5TDPB 1FU1A 3CH1A 1J0HA 3D2UD 3BGMB 1CK0L 4AEEA 1CUOA 2P2UA 3IGKA 5I8OH 5D55A 5DS8B 3VMNA 2YJLA 2E9BA 1QBAA 2HFEB 3ARBD 3WXVL 1FH2A 3ZE2F 4N85A 3I6SA 2FDBP 4JFQA 5EO1A 3ZDZB 1W72A 4NUPA 5C2UB 1FG2B 3HC2A 3SZKC 4DKDC 1UURA 1KN7A 1XL4A 1A25A 2AQRA 1LTBC 4P05A 4ZO7A 1R3LB 4HCGA 1JDDA 2E59A 1XR9A 2RMNA 2ITDB 1VA9A 5EU7C 4BFJA 3GB7A 1N0XL 5A2KH 1ORQA 1JERA 4QAWA 1DO6A 3NQIA 2XWJA 4NQVA 4X6FA 2BNUB 3C5JA 5IROD 1JZGA 4J6IA 5BZWB 3VGAB 1LO3L 3DRTA 1KJ2A 4UV7L 4KJYA 2UWEE 2XQYG 2ZG3A 1BE3E 1MW3A 2BLFA 4Q58C 4XWOD 4M61A 3FT3B 5FYJL 1DFBH 1IQDA 1DUZB 4M7LL 4BE6A 4LMQI 1B0GA 4WJKB 4YE4L 4YHLH 4PRPB 4IDLA 1L0LJ 2WZ5A 4HXAL 3U7YH 1IBFA 4M6OH 3TGUG 3T77B 3A47A 3GRWL 3BUIA 2V4HA 1T0NB 1ZLDA 4IRJD 3HCVB 5J6SA 3UO1H 4FKEA 2R0LH 1CGVA 3QJZA 2Y23A 2GTWA 4QTFA 1JBJA 2HX8A 5I8OL 2MFNA 1XR8B 4ALAH 1PY9A 1QQDA 2XWCA 5FM4A 2ENSA 3W0WB 5I1AA 4NQCE 1TEFA 3LH9A 4E2OA 5IMKA 1M1SA 4E9VA 5CBNA 4N0RA 2Q86B 1JZFA 2BNRB 2I26N 2EH8H 3Q5PA 5DC2A 2X4RB 2YQBA 3ARBC 3P4NB 3NJGA 1YECH 2JQZA 4I18A 4PJFB 5ETUB 1HH0A 1IAOA 4ANKA 3EFFK 3DJRA 1MFUA 3CQQA 4JJ5B 2AK4B 2Y07H 3ZKSD 3IRCA 4JFZH 4LPTA 2BEZF 2Y22A 4YDNA 2FY8A 1KGCE 1ASOA 5HTSA 5AOKA 4DK5A 1YNTB 3HZ3A 3DHPA 1DVSA 4OD1H 3AWGA 1GYVA 2L0DA 4XHJD 4AT6B 5L2KB 1SQQJ 3TJEH 1J9TA 2X70B 4ODBD 1SHSA 4U6XB 1P1ZA 4PD4D 2YOAA 5AG8A 1DFBL 2DL9A 2CKBB 4L1HA 4IYKA 4HOZA 2IWEA 3HD7B 3NIGE 2RQEA 4MHHI 4U3XA 1U92A 1NWPA 3UTTA 5I0YA 2QVFB 3U7YL 3BIAX 3P2DA 4L8SC 3EO1B 4M6OL 2WHVA 3QWRD 1B4LA 2QPEB 3L4ZA 3WJMA 2N9YB 1EBPA 3KWVA 2X3CA 1SMAA 1YQ2A 2WPVB 4PV8A 5IFHH 5JHDB 3UO1L 3V4LA 5DFWH 2R0LL 2GK0A 2XKMA 4EYYQ 4HJEA 5I2IB 4ZUVA 3WFHA 4V33A 4IRJC 4DK3A 2RR3A 4G2AA 4HJGB 3OR7A 2ADYA 3ECBA 4ESKA 5D6DA 3RWFA 4N90D 5DRWA 5FXCH 2V8MA 1E5CA 2EH8L 4YE0A 5B7FA 3FK3A 1YECL 2NYZA 4CJ0A 4JFEB 1CI5A 2YD9A 3CU1A 5E08H 4RGND 5J7CC 5GTHH 4PUBH 1JK9B 4F20A 2EYTB 3DX9B 4XVSH 1E9PB 2Y07L 1NIAA 3GZKA 2CUHA 3L5JA 4PSPA 4JFZL 4K3EH 1OWWA 3HG3A 1ZHKA 4YSEA 2FL5A 4NIYE 2W91A 1MUJA 4R4FH 3CX5D 4L37A 5AVQB 1VFAB 1B6UA 1YZZA 3VMYA 2XWEA 4OD1L 4HXBH 3TJEL 2ZP0T 4M7JH 4ECNA 4JKNA 1E30A 2TRYA 4WB4A 1BE3J 4J3WA 3FAXA 4XHJC 1YNLH 1U2CA 3UTQB 2P5WB 3C6LD 5CJXA 2YPVH 5I18L 3VFTA 1H3PH 4LLUA 1A6PA 4XBGB 1JNJA 2YFNA 3ARUA 4EAEA 1AACA 1MFMA 1NBCA 4PJAF 2Q3EA 5DHMC 5I8EA 1RL1A 2PYED 3F7QA 1KTRL 5J9PA 5IFHL 2ZKWA 2F54B 2YWZA 5TJHA 2NY7H 2ICEC 2YD7A 3T8MA 3UAJD 1BQ5A 1WWBX 3MLUH 4FMKA 1V27A 3ZRCC 4N0UB 3D30A 5HVGB 3MP7B 1C8QA 2R2BA 2O01H 3CZJA 4JMNA 4U3HA 1MHEA 4YO0B 1IU1A 1KB5H 2YD0A 1QKZH 2X4TB 1KBWA 1ZA6A 4D9RD 3GBMH 3FOLA 4LKCB 1LTJB 4FFZH 1NDMA 5E08L 3DI3B 3ARYA 2VAJA 3C6EA 3FO1B 5AOIA 4PUBL 3GSRA 4XVSL 5JDSA 4Q6IA 3WO4C 1TPXC 4NQSA 1WAEA 4K3EL 4A6YA 2VRQA 1NANH 2C5DC 3L95A 4RGNC 1FZMB 3TGXA 3EG9B 4R4FL 4IRSA 3KPLA 5I15H 1EXHA 2IPTH 2WXKA 4UYPA 1XEDA 1JNHA 4HXBL 1WAPA 2PWFA 2ZSWB 5FYKD 4M7JL 1KD1Q 3MHVA 1S72P 3L73G 1UYWH 2AEQH 3EFOB 3CPLA 4RMUA 4HMEA 2W0PA 1YNLL 3HUJB 3ZJAA 2D73A 4G9FA 1G6RB 3MRCB 4QCIA 2ZYHA 4M7KH 2YPVL 4HG4K 5DEJA 1H3PL 1XV8A 2OK0H 1LXMA 2B2XH 4LDEB 4JPKH 4MJ2A 5HDRA 3C6LC 3CPUA 4G1EA 5H4YA 1JXFA 1KCBA 4OCLC 1OGTB 1M9WA 2NY7L 3QZWG 4AKPA 2E9JA 5K39A 1D5XA 2WZAA 1JZDC 4FG4A 2PWGA 3ULUF 1PU0A 3MLUL 4BFFA 3HW7A 3CHQA 3ET9F 5DRZA 3UAJC 4PWIA 3VI3E 5KSVB 3CG8A 4IIQA 3AE6C 1KPRB 1WTGT 1KB5L 1VACB 1QKZL 2AXFB 4L4VB 4PSRA 2WXRA 3C08L 3T6WA 3ZKXB 4Y4HA 5AFAA 4KQ0A 3GBML 3RX9A 1IM9D 3VH8B 5MEPB 5CHNA 1S9VB 4MHHG 1H8AA 4FFZL 4PGCA 1S9YA 3RK2B 1IGJA 4HW6A 4KV5E 1G1YA 1YDPA 2XC8A 5E1QA 5TF1H 1DQQB 3UH8A 3TBSB 3GSWA 3ILPB 4JHVA 3OM3B 5DJZB 4I0KA 2H4EA 1BFVH 4FKHA 1K8IB 4MRCA 5E6UB 5BNXD 5I15L 3TWYA 2IPTL 4JM2D 4YPGB 1SQPK 4PLNC 1PBYA 4OZHA 3MJWA 1AHWA 3L13A 4R7DB 3TT1H 5B39A 2WQSA 2UUDH 3QDAA 1IJ9A 1ZMYA 1UYWL 2AEQL 3VAEA 4HUWB 1UXMA 4ZMTA 1DCLA 4HD5A 4JPWH 5MHSD 4M7KL 1ASQA 1WIOA 3KMDA 3X14A 3GSQB 3MUDA 3UROR 1PX3A 2OK0L 2WVTA 3ARDD 2B2XL 1DEDA 2FYVA 4JPKL 4RAVB 4HOWA 2WCPA 2PPCA 4LLWB 3AVEA 4ZNEE 1GOFA 2VDRH 4DWHA 3LN5A 4LVHB 2Q8AH 4ZMZA 1O7DC 2YXQB 2F61A 4BXSV 1FL3B 2IOIA 3GSXB 4F2FA 2BVTA 4PRDA 2DJUA 1P7HL 5AW5B 5EC2A 1ETA1 3ZSSA 5EU5B 2Y9ZA 4I13B 5ESAA 4QHUA 1AFOA 2VDKB 1I8MB 3PGCB 4N90E 4MD4A 1U21A 5FDYA 2NMSA 3FT4A 5J4MA 1CSBA 5ECJE 5DEFB 3KHOA 4JEGB 5TF1L 4B9FA 3AU0A 5AAMC 4WFED 1BFVL 1M1JC 2QADD 4X4ZA 5F7UA 1PIXA 1N73C 1HN1A 4XRCB 3GEWB 2QGDA 4Z0XB 3CX5E 1PLCA 2Y6SD 3IXTB 3TT1L 4JM2C 1J88A 5GGRA 4K9EH 5C92A 4MA1C 5FECA 2A4ZA 2OL3B 1QEXA 3SBRA 2Y7QA 3QFDB 4W9EC 2QGEA 1OF2A 1VQLP 3FPXA 4JPWL 2J44A 5JXEA 3MGAA 2ENYA 2X6CA 4RFNC 5KG9B 1YN6A 2DLHA 1AXSB 1EGJH 5D4IA 1GA2A 2ZXXA 1C08B 2QMKA 3GIVB 4LGPB 4KDTC 4QNPE 5DZNA 4F92B 2MH4A 5IM7B 4KNUA 2CIKA 2K3RA 3CC7P 3ARDC 2VDRL 2XLLA 4DAGH 5DQJA 3KDMB 2Q8AL 1ZE3C 1N2DC 2LLLA 1H0TA 1F4XH 2LTQB 3E38A 3TIEA 4PJBF 3MRBB 3WYRA 4X7EC 4ODUB 1HL9A 4G8FA 5E70A 4YH6A 3SGJA 1AXIB 4V1DB 1DCEA 5AW8B 3QGVA 4LHUG 2NYKA 3SDYH 4G43A 3H1HD 3PS6A 5KSBB 2J8UF 3OWRA 4S0SD 1PD0A 3IDYB 3GW6A 3BWSA 3W11D 3MO1B 3K1KC 5CLYA 3RFZA 3TCLB 3KEDA 4GKNB 4ZG1A 3P8CE 4X4KA 5ICXA 4LSVH 1MN4A 4Y2DA 1NWQA 3B5NB 3BVVA 3OW2O 4HAGA 1QA9A 2YKLH 4K3HA 1WTLA 4Q97A 1NUDA 5J1SC 5C0AA 3OGOE 3QUXB 1KIPA 2QADC 4FN0A 3U30C 1XCWA 5JHLA 2X4UA 4K9EL 4O02H 4TUJB 4ZX4A 5FYKE 2ZQKA 4HKZB 1KXTB 3VD1A 2Y6SC 3PWNB 1ODUA 1U8MB 3G5VB 4GB9A 1I8KB 4PLJD 3HG1B 2HZHA 3DYOA 5I1DA 3UAEA 4I85A 2QM8A 1ZJBA 4NJAH 4MDIA 4W9IC 1S7XB 1KILB 4DAGL 2JKRM 4Z23A 3FRPB 4JDEA 1DEEA 4LIQE 1T22A 2EIJB 1MWOA 2XG5A 2VIRA 1NCOA 1F4XL 5EPMA 3C60B 3FBKA 3IKCA 4I87A 1T66C 2FXMA 1U57A 2OMXA 2W9LA 2QGCA 1BVNT 3O4LD 1A64A 4Y2NA 4DNLA 4MDJB 1PGQA 1R5VB 3JC22 4BGDA 3DGDA 3SDYL 1B3JA 2NXYB 4YQXH 1CGWA 4WK4B 2PCYA 1TQCB 3ECUA 3MSPA 1I8AA 5C08A 4KXCA 5T3XD 2X1QA 3W11C 4LSVL 3REVA 2J2ZA 1WAAF 2GC4C 3P3YA 5FDWB 2YKLL 3BAEH 2EIDA 3CX5J 3HE6D 4LBAA 4ZUUB 5B1CA 4YFDB 4XAKD 3LZRA 4WI2A 2PP6A 4O02L 3U0TB 1J1XH 1HQRB 1PGRB 1G7MB 5DZJA 4AYMC 2BNQD 5APWA 2KB7P 2NY1D 4PY8J 4APQD 4B9YA 4YHNB 4WHCA 5DJ2B 5AB1A 2ITAA 4ONHA 1SQXK 1KTDA 3MBED 1X7TA 2JQAA 4OZFH 4Y19B 3QC5X 2DI8A 5MHSE 5EN3A 2UXTA 4Y5VB 1A6AB 1UB5A 2HJFA 3RL2B 4RO0A 1A9EA 5CNHA 2XIBA 4ZMPA 4I18C 1IAKB 3OGCB 2EVIA 3K74B 2GHWB 4OLZH 4S2SB 4JPSA 4KY2A 1JY3P 2ZCLH 1A7NH 3INOA 4PJCE 4P5TA 4AQRD 2OX5A 2YS4A 1TZHB 5DSCB 4EXPX 4XN2A 4X6CB 1N6QL 2FR4A 1A3ZA 2GW5A 3PFQA 1YCSA 2YUZA 2WKGA 4JGNA 2VT0A 4AUYA 4IOSD 2BSTB 4H13D 4GKSB 2VL5B 3I3DA 4XB8A 2VE6A 2E6PA 2NQCA 3QWOB 4MKTA 1FZKB 3AFLA 3H85A 5AKTA 4YQXL 3QIUA 3HZVB 1H3VA 3QFJE 2FWUA 2B1HH 2APSA 1T7VA 4PS3A 2ZP9A 4FQCH 2H0PA 4OBSA 5EIIG 4PS8A 1NMAH 2YC1B 3UTSB 3L3DB 2P1JA 4HHGA 3GHGA 3VGHA 3TPUA 5EZPA 2Z92B 3ZO9A 4WFEE 4P4KB 2O6FA 3BAEL 4RFEB 4R7LA 1CD1B 3SDAD 2F15A 1F86A 3MRLB 3QDJB 1J1XL 4JW3A 3FTSA 1J9RA 1EZUA 4BRJA 1GOGA 2IALB 3HE6C 2XQYK 5BV7C 3EADA 1QASA 3CVHB 4XO3A 3S8GB 2HODB 4XNUH 4HJTA 4CSPA 2NY1C 1UACH 1JO5A 3MBEC 3RI5K 3GSUA 2HFED 1CPUA 3GWJA 2WO3B 1P7BA 1PP9D 2AZUA 2ZCLL 3ZR5A 4GUPB 1A7NL 2YEQA 4JY6A 3QDGA 1YEWA 3M1BB 1R34A 2VMDA 2GT9A 3FB7B 1KGWA 3DBXB 5F3FA 5HHOB 1ZV5A 5C0GA 3MROB 3QP3A 2O6PA 3SDXF 4LLQA 3NJHA 1X5KA 2QMJA 4BH7B 3HMXH 5JORA 1LVEA 3QUZA 4J4PD 2ZAGA 5KS9B 4JYBA 3H56A 3TONA 4H13C 3ROOB 4EPSA 1HOEA 4YFLI 1L4AA 5C8JA 3GM0A 1ITBB 5K59E 1U93B 4KBPA 1E9OA 4FQCL 4ONGH 3KEHA 1EJFA 1HEZB 1NMAL 3MRIA 3LKNA 3K2MC 4KI5F 5CJXC 1LE9A 4K5PA 1PZ2A 1T5KA 2F1BA 2UZIH 3MNVB 4LVOC 3KXFA 3PP3H 4G8EB 3S5LG 3VXTB 2VR6A 4QR7A 2BW5A 3TEXA 3CI9A 3CUPA 2ATAA 3G7TA 1RU9H 3SDAC 3QZLA 4KO7A 1QBBA 1WWWX 1A7PL 2NZ9D 3FO2B 3WELA 4AV0A 4BQ8A 1VADB 5F7HA 4KNQA 4XNUL 1WUNT 1UACL 2JKSA 1IGFH 4OD3L 1ZK9A 1XSJA 1JY2N 2X4PB 3T8XA 4HT1H 4L1LA 3W0WD 3M0DA 1SJVA 3VM5A 5DUBA 2YMYA 3FCUB 5EU6B 4ZPVA 3EJSA 4LLDB 3BEWA 2FX9H 3L6FA 5MENA 5B7MA 1XD1A 4TV3A 2Y3AA 4L8BB 3N44F 5B5EH 1S4IA 4PRNB 1OT1A 3H1KD 5DDHA 2NQDA 2X2IA 1UOVA 3P7KA 1OCCB 1UD8A 2Y7NA 2K9FB 1KXVC 4XX1G 3FW6A 5DJ0B 5KANG 3HMXL 2IGLA 1KT2A 2IPPA 4IW4C 5FAAA 3Q6FB 3IJEA 4I8DA 1KIUA 4XCCH 1YA5A 3OKMA 1TQBB 4Q2ZA 4LPCA 3O3DA 2VRAA 3E6FA 1VQ7P 5ESQB 5L2KD 4J4PC 1NUNB 3G6JB 3S6CA 2BVQB 3WS6C 3SYAA 4AUJA 5DVLA 4ONGL 3E80A 3C09B 2FT8A 3BWAA 4K07A 4XZ4A 4RZKA 3UTTE 5CGMA 2KT6A 1R6VA 3AQZA 1QFPA 5JLZB 5T3XE 3Q1MA 2IPKB 4GW4A 4WWKB 2JI1A 5LO7A 3U1PA 3BZ4B 2ZVOB 3A0BH 3WO3B 4JFVA 5I73C 3L4VA 3VVWA 1J12A 1I4FA 1E0OB 2UZIL 4A7SA 3V6ZB 2OCCB 1N5YH 3O6LH 3LHAA 5E5MA 4J3OD 1G2CB 1G43A 1RERA 3AXIA 3KHQA 4XAKE 5JHDD 4DT0A 1K04A 5E6RB 1FRGH 5EV7A 5KAIH 3JWDL 4IIQC 4WGVB 5I24A 4N5UA 3L81A 5IWLA 1IGFL 3ARPA 2WLNA 4Y4HC 2NZ9C 3I55P 2VQTA 3LHPH 2DLFH 5CJ4A 2CDFB 2P44B 5K1JA 1OIPA 3SZ6A 3BASA 1WHPA 2XBZA 4IU3B 2FX9L 1PV3A 3NA9H 4YNYA 2OYIA 3SDCB 1FSKC 3T97A 1KY6A 5DZLA 3RZCB 2J21A 4QXWA 3U9UB 3TXAA 4PW3A 3CCJP 1HTYA 1QHPA 1ZHBB 1NGWB 3HAEG 3B9KB 1AHWC 2YGOA 3JWNC 4EE2A 4OZIB 4XCCL 1SLXA 5F7DA 2FD6H 5T5NF 3L5HA 2OZNA 4Z78A 1ZP0C 4MA3B 1H9DA 1EXUA 3L3GB 1MXDA 1XEUA 1SBBA 3OAYH 4K5OA 4QY8A 3SEPA 1FNFA 2DMHA 2VQ1A 3CIQA 5KYYA 4ZFGL 3RA7H 1TOXA 4YBHA 4GW1B 2P5WD 5JIMA 4PWFA 2UY7A 2FHBA 1TJIH 3PWVA 3KLDA 3TCXA 4OLUH 3O6LL 1N5YL 2ZKYA 3BP5A 4FFTA 1I9RH 1ZOYC 3PFUA 4HUXB 4L3AA 1T3FB 2J5UA 4G8IB 1FRGL 1T1ZA 2E43A 1Y7VA 2F54D 3D33A 3N7NA 4XMWA 2GM4A 4J3OC 4TSCH 2W81C 5HY9A 2X10A 5HPMA 3ZYOA 1UQSA 1KORA 5CMAB 4Q14A 2E42A 1V3MA 3LHPL 3QG7H 4WW2F 3TO2A 1FV1B 1NANI 3HRZA 4LSSH 1HHGA 4Z7UF 1A02J 5JW4R 1OW0C 1FJ1A 3NA9L 3FO9B 1JGIA 5DVOA 1SOKA 1DJHA 5C0AD 4HWBA 1PZBA 4NQXA 1IEAB 1LO0H 2JCCF 4ZBJA 2YMKA 2CLVA 2MQGA 4Q74A 3WKMH 2RA1A 2P24B 2B87A 1FZFA 5LVEA 2FD6L 2LFEA 5DVKA 3TNNA 3QJOA 1E42A 3EH3B 3MNDA 2B4CC 7TAAA 1JG9A 5FUZH 2R4SH 2Y6TE 4P0DA 1OGAB 2P80A 3CDGA 3M46A 1P2CB 1PJWA 3MNMA 4NJ9H 4OUOA 4M29A 3T1WA 3MFFA 3RA7L 1NGZB 1E2WA 4NKDB 4X6DF 4Z3TA 4Z8FH 2W92A 4C7NA 3IAOA 1TJIL 3P0VH 4FGMA 3SE8L 4OLUL 3QEGH 2HJKA 5E2WH 2VRKA 4PTTB 5CD5D 1I9RL 3VB8A 2IX7C 3DV4A 3ZU8A 5CIPH 4FA6A 1RIVH 2R9HC 4X5XA 4JZJA 4B95C 3NIFE 1EAPB 5JW4Q 3SGJC 5C09A 5I1HH 2UXVA 2HJLB 3FULA 4JN1H 4P5MB 2W95A 1YMHB 4M5TA 4YXHH 4KK8D 2LLNA 3SJVB 2O3JA 3QG7L 3FQTA 1EQ7A 5CJ8A 5C08D 5I66A 4LSSL 3LKOA 4G5ZH 2HG0A 3W0WE 2KQNA 1YMMB 4XCEB 4UB6E 1X4YA 4OI7A 1CE1H 2GEQA 4CMHB 3PAYA 3RK2D 3K5SA 2ZYSA 3AG3B 3MUGA 1NDGA 3I3EA 3OKDB 3SB3A 1OHQA 2DKSA 1LO0L 1CXHA 1LTJC 3L17A 3MI6A 4G8AC 4OZHE 3MIWA 3I6KA 5E79H 4HK0B 2NUPB 2AXGA 3WKML 3SFEC 4W9GC 5FUZL 2R4SL 3QIWB 3CMEP 1P4BH 3VI4B 5CBAA 3JV4B 4WSKA 4NJ9L 3WHXB 1YEKH 1FO0H 2OMTB 3G5YB 3RIFK 5L2KE 2ZCHH 2C3XA 1A1NB 1EEZB 3JXAA 5JQ6H 1XZ0A 3TDKA 5DK3A 3ZQ9A 3RBXA 5GGVH 3MLVL 4AYCA 3CZEA 3MTXA 1T89A 4PU2A 4Z8FL 2VLKA 3P0VL 4C4UA 3QEGL 5E2WL 3F00A 5CLWA 4U1SB 4PS7A 4YDLB 1YRKA 3DDFA 3Q13A 5FGCB 2P7JA 1RIVL 1WDAA 5E1GA 2NW3A 2ZCZA 1ANUA 3MRKA 3EFFA 5CD5C 1Q4NX 5I1HL 3WEXB 1QNZH 1VHPA 4PIBA 3QIUD 4GP8B 4JN1L 3LXUX 5ERWA 4YXHL 5CEXA 5K9OA 3EKCA 1JYNA 4AITA 2WQUA 4XNBA 3FSAA 3P77B 5DMKA 1E4KC 3FFCA 4GP4B 3KPPB 4EOWH 5HHPB 4G5ZL 3T2NH 4U7JA 5CD3B 1E65A 1CE1L 4N26A 5JIKA 1A2YA 2XICA 1GW3A 4BZ1A 1J1EB 3NZ8B 4ZMWA 5C0CA 3RK2C 1DIPA 3PNRB 5HJBA 1RY7B 1UASA 4HJIA 5IFJA 5AVZB 1XIWB 2KLRA 2EDNA 3C75A 3MRFA 2WXMA 4GLRH 5E4AA 3AUWB 4ZFOB 1UFUA 2FLBT 3DX1A 3BVNB 3BP6A 1KBPA 3H1LD 1FO0L 1YEKL 4GINA 4AQ1A 2ZCHL 1XGQA 2AERT 2DMCA 3N0AA 5JQ6L 3KM1A 2OTJP 2FK9A 3CFUA 5GGVL 4XB7A 3DOHA 4P2OA 1NCHA 3MXVH 5GJSL 4HCRH 1CE6B 5C0IA 2P5WE 3TFBA 1D5MB 1U8HA 4B9IA 4B41A 3D4CA 2R15A 3F5WB 2WWWA 4YBLC 1G1OA 2FX7H 3K6OA 1K73Q 1K85A 3MRMB 4JREB 4KTGA 1D5BB 5LAXB 3SE3A 1QNZL 4NO5A 1RPKA 2AZAA 3C2AH 3ORJA 3ML8A 3WEAA 4JFYA 1NCTA 1L4AD 2FE0A 1RF0C 4LVHC 1LWUA 1OAQH 3HG2A 3OAUH 5D7IF 5G5DB 2ILLA 2N1TA 4V1DD 2OW7A 3QIUC 3WNOA 4EOWL 1ZHNA 4F27A 1K3ZA 1ODAA 1XF3A 4JJOA 4ZOCA 3F58H 5JHMA 4XWGH 4K15A 3RWDA 3T2NL 3K72B 4Y99B 2JKIS 3U36B 1QSVA 1CBJA 3RRQA 4JRYB 4N2BA 4QMAA 4YLQT 2VLMD 2YGNA 3GS4A 3QUGA 3GHGC 4QOKB 3TT3H 3CAFA 5C0AE 1KWGA 1BA9A 2I85A 1OX3A 3JT0A 3UAFA 3KAAA 5IK3B 1BDDA 5A2CA 5AWNH 1TF4A 3B5ND 1WIUA 2EDHA 2EEFA 4G42B 3QUXD 2ZOTA 2OZ4H 1RMFH 1YHQP 1VZHA 1LP9A 3BUYA 3CSYB 1EPFA 2YLHA 4XPBH 4MDRA 2VZUA 1EVTC 2AKRA 1GIGH 4F2MB 4RDQF 3D69A 3HUJE 3FOMB 3MXVL 1CTNA 3S3PA 4CVZA 4HCRL 5EULV 3DPDA 4JZOA 5AUMB 4NYLA 2Y9YA 3LNHA 2YGVA 2FX7L 2GITB 3CCRP 1CD9B 4RNRA 1TVHB 4U1JA 5IGXH 3BUBA 4L48A 1IFNA 2MHAB 4MASA 1SYSA 1ZDSA 2CDEB 3C60D 3C2AL 4ZMNA 3VFOB 1NKNA 4H2CA 5D8JL 2D7MA 2OFQA 1OAQL 3CHXA 3OAUL 5DEZA 3QUZC 5D8JH 2IH1B 2R83A 2LTQC 4R7NB 3F58L 1L4AC 5C08E 2NXYD 1ET5A 2AXWA 5KYWA 3OKNB 1U91B 2EIZA 3UYPA 4TKWA 3CFDB 3EBIA 4LDOB 3WIHA 5EO0B 4G72B 1VENA 2YBGA 3R06A 3TT3L 1SYVA 3IDNA 1ETZB 1F97A 3QULB 3W2DH 2KI6A 1CDJA 1FCCA 3OKOA 1RZGA 4XH2B 3BH8A 5AWNL 2FRGP 3RNQA 3TWCL 2B39A 1BMGA 2Q7NA 4R5VA 5GS3A 2KIKA 2OZ4L 1Q9WA 1RMFL 2Y1AA 4L9LA 2YN5A 3Q6GH 1NU1D 2Z3FA 4XPBL 4H7VA 3QUXC 5LHDA 1GIGL 1IM3B 4H25A 4GUQA 1N68A 4Y19D 4KRNA 3M0DC 2P10A 1N2RA 1HAWA 1JPGB 1BG1A 4GKZB 3CC4P 1EZVI 2XPZA 2G2RB 1NKRA 3R7RA 1G7LA 2NT0A 5FEBA 3ETSA 3C6SB 4M4RB 2HUEA 2XN9A 3O2WH 1ZGLA 2GJJA 5IGXL 2OMVA 4JBSA 2BP0B 1T8ZA 1LE5A 1PD6A 2OTWB 2QSQA 1IBHA 4WY7H 5KLVG 5AW0B 2KDGA 4NWTH 4NO2B 1P84I 2O5ZH 3C60C 4AVHA 2DDQH 4JRXB 4HSQA 4Z7VF 2IDQA 1VERA 5D2NA 4DZBA 4YHIA 5FR3A 2R0ZH 3NTCL 3RWJB 3HN3A 4HWZA 5B8CA 2Q1KA 8FABB 2VN7A 1HGZA 2Z31B 5EA0H 1UA3A 2NXYC 5LGKA 2UX7A 3SSGA 2PCPB 5IQMA 1A4KB 4NKMA 3UG5A 3CX5H 3W2DL 5LDSA 1NFIA 1TQCC 2W83C 4OZGB 3UTSD 4R2GB 2FQFA 2DWXA 5ALCH 1XH3B 1EAQA 2Y36H 4WTQA 3LXCA 4GRWB 5IVXF 5FYKU 1V3LA 3Q6GL 4MJ5A 5KTEH 4HKXA 1GGBH 1I1RA 4DVBA 5IWLC 3IWUA 4JO1H 1ZVSB 3H53A 4H8PA 5KEZA 5B21A 4K5NA 5FK9A 5AYUH 1ZR4A 3QDGE 4L8DB 4ZFFA 1CXEA 1PAZA 2Z91A 3SQBA 2WVRA 2OJEA 4I1NB 3FU0A 3IFLH 3KW7A 5C6TH 1SJEB 3O2WL 5ESVB 3JVFC 4D2NA 3JTSB 4AV5A 3PPSA 2G9HA 3N06B 3HNTH 4HEPG 4WY7L 2NY5C 3RWCB 3T3PF 4DGIH 1QR4A 2Q2LA 5EBWA 4NWTL 1YQ4C 3BDYH 4PJ0E 4E9XA 3L71G 2O5ZL 4NNYA 2P80D 4Z7NE 1EZVX 3KR3H 2DDQL 4V1DE 2R0ZL 2YMOA 4K7PH 3CFBA 4GEIA 4RAUA 3T0WA 1CW5A 3PGDA 3OC8A 3ASNB 1RAMA 1BQSA 2DJ4A 5HHQB 1CXKA 2GABA 5EA0L 4RMWA 4F7TA 1I7UA 1YEHH 2JKVA 2HP4A 1MHCA 5KAQG 3QYCA 3KH3A 1LT1A 3QI9B 3QR0A 4NS0A 3MV9B 3OJDB 3EJJX 4NO0B 4B0MM 2HFFA 1HILA 1AS6A 5ALCL 1Y07A 1PFOA 1BF8A 5EU3A 3QXWA 4I48B 5C09D 2Y36L 4LKXA 3LRLA 3N41B 4PIRF 1NIEA 2PW1A 4PEEA 4AUUA 3GNMH 5KTEL 5DJAB 4E9LA 2DWDA 3BVXA 5L4MA 3B2VH 2XKNA 3CCMP 4HBCH 4PV9A 4R8WH 5DJCA 1HKFA 1ICTA 5DZOA 3HRZC 1AO7B 4LIQH 5AYUL 1O6TA 4ZQKB 4DP7X 5DUMH 1Z5YD 4KU1A 4D0BB 2QJKB 4OGZA 4ZW7A 4X9FA 4A2EA 1BFSA 3IFLL 5C6TL 4GRMA 2HN7B 3R4DA 5EU6D 4OZFG 4DGIL 3HNTL 1OAUH 1UJ3B 2W80C 5IT2H 3V4PB 5CUSH 3BDYL 3LZNA 3BSZA 3HG5A 3SYOA 5B1AB 4NHCH 3KR3L 5E95B 1UXSA 2HRLA 2IBZE 4K7PL 3V0VA 1HYSD 3X3GH 4EJ1C 1XFPA 2BK8A 4A1RA 2GAZB 4QHNB 1F4HA 2PR4L 3DJSA 2J8HA 1F1AA 1YEHL 1INEH 1J8KA 1PGJA 1MVUA 3GXTA 4NENB 3Q8FA 4U2YA 5DJYB 2A83A 3WJJA 4H5SA 2EE0A 3IS0X 1GMJA 4NN5C 4WWKD 5SWQA 3P32A 5FYKL 3WHE1 1IFIA 2VDNH 2CRIA 4HX1B 3V7AE 1E5ZA 1Y1UA 3QNXB 1ZLWH 4XNDA 4NIKB 4XCYA 4DESA 3VO0A 1AQKH 3FCTB 5JPNA 4GAYA 3CVIH 4FYSA 2I07B 3GNML 2DI9A 1H8NA 3O3AB 3TBTB 1UKTA 1S78D 4PJHA 1NU1E 1SLQA 1JWMA 4J2XA 3B2VL 1QVOA 3PJLA 4HBCL 2QV2A 4R8WL 1ZE3H 1CI6B 2FL5B 3Q1SH 4LIQL 1CG9B 3PPEA 4FJ6A 2NY3B 3C8HA 5C6PB 5DUML 1D7DA 1YQVH 2DICA 3FTZA 3FCBA 3X12A 4AV4A 1NBQA 5C0CD 3OMIB 4WFFD 3HE7B 3BVHA 3U79A 4HALA 1ZT7A 3VD4A 4H1LB 3O0LA 3KLAB 1DBMH 3FQUA 4AYBA 4FAAB 3UZQA 5IT2L 4EZMA 2Z7UA 5CUSL 3RZCD 1JV2B 2A99A 4UDUA 1IL1B 2DTMH 1UA6H 5EB9A 2XZAH 4QRRA 4F93B 4LLYA 4ODTH 4NHCL 1BQHB 3IXAB 3TBVA 3B1UA 1U3HA 2ZF8A 2WPRA 3B9KD 4DUVA 3X3GL 5LXVA 1IARB 4MVBD 4W9JC 3WFZA 3CFQA 1HFUA 1TZIA 4G1MB 3ESNA 4DVRH 4Z76A 1T20A 1HYSC 1INEL 4UI2A 2XFXA 3AXLA 5G4OA 5C0FB 3QJHB 1TQBC 5HGDB 6TAAA 4X4YB 4TXVB 2CSPA 1GY1A 1HSAA 2Z93A 4P3CH 3VD5A 2VDNL 4G8GB 2HPCA 3UTSE 3L74D 4PJ7F 4H0IA 1LTIC 4JQVA 4LPUA 4WWKC 3N50A 4LDCA 3EOYG 4MJJA 4YN3A 3X13B 3IFPA 4Z7OF 4CL7A 3TEYA 4XP9H 5C0ND 4H8UA 2DZEA 4Q56A 5GSRB 4X6CF 4J7RA 1W72H 4JUSA 1XH2A 3ZE1B 2F19L 5D7KE 2E9WA 3N85H 3Q1SL 1S78C 3G08A 2ZXQA 1DN2A 4XO9A 2LOEA 5CEZD 3CSBA 4NSKA 4OF8A 3ZYIA 4AMKH 3AEAC 2DQUH 4U1LA 3RURA 1I8UA 2NTFA 2OYHB 2X09A 1KENH 4I77H 1DBML 5EIQA 3CNKA 3GEFA 4PG9A 2WXGA 4UUJB 1OW8A 1KJ2H 4ENED 4YR6B 4LCUA 4IEFA 1UA6L 2XZAL 43C9A 1TSHA 4ODTL 1YJ9P 4Y4FA 3RZCC 2OTUA 2L7EA 4IMLA 2WLIA 3DX6B 4Y8AA 5EN2B 2AMGA 5DRXA 2A45H 4G3YH 3S4SB 4AQ1C 3B9KC 4DVRL 3GHEH 3L7EA 2XQYA 2AJZB 5I1LB 1OGAD 4H4NA 1S7RA 2BY1A 2FJFB 4MVBC 3T0EA 1K72A 1LQBC 4P3CL 1VQ6P 5FW7A 1G87A 1HWTC 1AGDB 1NC2A 2JH2A 4U3FG 1FVEA 2CGZA 5APQA 2IDBA 4DO5A 2NX5B 4EUPB 3KXDA 2C9RA 5A16A 4XO4A 5BW7A 1GMEA 2CLRB 3RG1C 2POHA 4XGZA 3GJEB 1L0LG 3FONB 5C09E 2IDUA 4WY4B 3AGVA 4YGVB 1NU1J 1W72L 4Z6AT 2CUAA 2AV7A 5C0NC 5C6WH 3B56A 5B66H 1YJWP 3DA0A 3N85L 1M1XB 3PJNA 3GMNA 3MRQB 3HRNA 4KTDH 4MZIA 2DWSA 3WUWG 1JTTA 4B50A 2OQJA 2AEFA 4HLEA 5LBVA 4AIZA 2H7HA 2VDOB 4AMKL 2DQUL 4FC3E 2EO7A 5HPOA 3FT1A 1YMMD 1KENL 1IFRA 4I77L 1RZPA 2FO4A 1KJ2L 1T21B 2D3LA 2R23A 2VDMH 1QUNA 1TTFA 2WVVA 3NGBB 1Q0YH 4L3CA 2EIBA 4AE0A 5MEQA 3UZVB 5E4IA 2R7EB 3FL7A 4ENEC 4EI2A 3DVGA 2Z8WC 4Y5YB 1SXAA 3ATAA 3MRNB 3HFML 3JTTB 4WV1A 4AMXA 4G3YL 3KG5A 1QZNA 2A9AA 2QKIB 3GHEL 3C8KB 4HETA 4WKXA 2J6EA 3Q48A 4NOFA 3Q8CA 1A4CA 4O2FB 3QO1A 3TYFB 1C9SA 4WWID 4LXFA 4Y28J 4CVWA 4C58B 1VDGA 2QQLH 1KGXA 2UZYA 1GH7A 2VLRB 1R24B 3CZNA 4I7ZB 4LSPL 3QC6X 1IGTB 3U2SA 4POYA 5DS1A 2Q9OA 2KH2B 3QEHA 3H4FA 3AS0A 1SQPD 3H8NA 1DDHA 5F1NB 3K71B 4C59B 1JF1A 1X3DA 2MKWA 2UWJE 1J9QA 2HWZH 3FFCE 3VXPA 1TSRA 3T2OA 5DJ6B 4HV8A 3EDFA 3QNZA 5CGBA 1MZ9A 3WL9A 4IDJH 5GRYA 2X2HA 2CLZB 1H5BB 5DHYB 4TLFA 3JSSA 2XYBA 3O8XB 2HT2D 3BUTA 4U1HB 2NPSA 4GLRI 5C0CE 3JWOC 4WFFE 3IGAA 5IW1A 2WTPA 1S3RA 3I75B 3FFDB 1OAYH 1TMCB 3BW9A 3LTVA 2O1AA 3EH1A 5BXFB 2VDML 2WKOA 2SEBA 1Q0YL 4XNYH 5C9JA 3V5KA 4CMHC 5BUAA 1L0NG 2JWDA 1LWJA 2IBBA 2R44A 1XIWD 1DQLH 2C8NA 3FAWA 3VA6A 4L9LC 4ABVA 4PGBA 3VSUA 5BO0D 1A6TA 3L70E 3MDJA 1KN4H 1FZCA 2J1ZA 5EUOB 5H94B 5HYJA 1JV5B 1A4AA 2CJUH 4DO6A 4AYEC 5I0DA 5TH2B 4GODA 5TDNA 1BE3G 4D7PA 1JFQH 1SPDA 2QQLL 1RULH 1PZ5A 1R5IA 25C8H 2B14A 4J8QA 2QT6A 4L0PB 1CYXA 1QWNA 4HPOH 4EVNB 3NCMA 5CWSB 1Z9NA 5F6HJ 2JNZA 4LLMB 5INCB 4M8QB 3H7LA 4PW9A 4YDLC 3MMEB 4FXKB 1RK0A 2HWZL 2QVAA 3L1EA 3H54A 5IFAH 2GTQA 4IDJL 4P4RA 1WA2X 2ZWKA 1I3VA 4A6YH 4D7BA 4DKTA 3LIEA 2GJ6A 2QR0A 4NM4H 2GUOA 5CEZE 2DQFB 5B8CC 5EF1A 2Z7ZA 3IJSB 4LLVA 4AC2A 1EUUA 5EUKB 3U25A 3BO8A 3U0PB 3MYJB 4JZNA 1RFDL 1Q82Q 2HT2C 1UWYA 1OAYL 1S4XA 2ESVA 4JRYD 1HK6A 2CDGA 3PJSB 5DJXA 4OW6A 4PHXA 4XNYL 3OF6A 3VNZA 3RWGA 4BKLB 1HXYA 1KGUA 4I2XB 4H40A 3WY3A 4Q52A 2L4OA 1DQLL 1LP9E 2FYUD 4O00A 3WLBB 4FRWA 4AXWB 5E1AB 2E7LA 4ODWA 5EWIH 1DSYA 1KN4L 3HC3H 4NZUH 3VRLE 1WA0X 1XIWC 4ELDA 5TGBB 5I6KA 3FH7A 4L73A 3NH7H 2CJUL 4PAZA 2P8LA 2VC2B 3H1JD 1QD0A 1XGUB 5F97E 1JYXA 1PYWB 2DLTA 1I8IA 1JFQL 2JF1A 1RULL 1I31A 2XRAH 4ANXA 4S1SH 1L7IH 4KC3B 2FJHA 2ZUSA 3UMTA 4HPOL 2HUHA 3KPNA 2FGZA 4MAYA 1JPTH 3QZWA 2A73B 1G5GA 2WYHA 5CEYB 2L7UA 4DN4H 4C47A 3ULAB 2KLTA 1U3NA 4G7RB 1G7QA 4LHJB 1M2VB 2GSIA 3D18B 4ZTEA 1R0AH 2B9AA 4X7TB 5G55A 4UB6H 4A6YL 4NM4L 3VMPA 1IQWH 1WC7B 2C9LY 2KZIA 2C3GA 3D87B 4M5YL 4X9YA 4EIBA 4LVNB 3REWB 1RCYA 4NAMA 4J6RH 1EZSA 3B5HA 3V6FA 3B2PA 2B20A 3F89A 3TVMA 1U8CB 5A40E 3IBOA 1YMME 3TU6A 3FMGL 5KBNC 4NN7B 5BQ7B 4KJPD 5KLVK 4P04A 4UTAA 4HLZH 2MTAA 1RZKH 1JZ4A 1A9BB 4H88H 4HIHB 4N2KA 4AGQA 5AVSB 1IZJA 2APFA 4JG5A 1K4DB 4IKKA 3VI3F 1J8SA 4S0TD 3L70J 2JI3A 3M8OH 5EWIL 3ESMA 3HC3L 4NZUL 4V11A 1Z9SB 5JZ7D 1QFWH 2GFBB 1T1XB 5A43C 4N2EA 4QTHB 3NH7L 4DGYH 3OC5A 2CO7A 2Q3XA 1F18A 4AQ8A 5IHBA 1E9QB 1Q94B 5EFIB 1DVZA 2RKLA 3NEOA 2EH7H 1IM3D 4U1GB 4YXLH 4MXWH 4GAFB 4Y16B 2XRAL 3LIUA 1FYTB 2IXQB 1L7IL 4S1SL 2CPCA 2XN9E 4GQZA 4ZPTA 5AD0B 4HIJA 4DO4A 1NTZG 1JPTL 3E0GA 4DP5X 1Y8AA 3VD2A 3LQAC 5HJDA 3NFPB 1HH9A 3WS3B 4IKNA 5EEUA 5DEGB 4DN4L 3V0EA 3BZ5A 1KQFB 5K93A 1SQPE 3DX7A 2IH3B 4U6HB 5D2NE 1UD2A 4R5XA 3ZYJA 1R0AL 3GSVA 4EIZC 1R3KA 1XWVA 1RIUH 3OA7A 4KX9A 1U8KB 1BX2A 2AJ3B 2GCYB 5DUJA 5AKRA 5DK2B 4GUCA 1BZ7B 5E8OA 3CX5I 3ZDMA 3VFWB 4EI0A 5BS0B 3UJTH 3VOPA 4JRXD 5FV1L 5ISZA 1BFOB 4J6RL 4EOTA 1KLFA 3K1DA 3I2CH 3LSOB 2FWSA 4U7KA 3WFDH 2WTOA 1AGEA 4Z7WA 4R4MA 4F33A 2PMZA 1F6LL 1OVVA 1BDYA 1MFBH 4PY8I 4QRUA 3LX9A 4W6YB 1RZKL 5ENWB 4H88L 4IJ3B 3S96A 4U1IB 4ETQB 1ZA3B 1J87A 3IDMB 2G8YA 2RN0A 3ARFB 2V5MA 3UZEA 4IM8A 5M94B 4KJPC 3PWJA 1W8EA 5LGJB 4R2GD 5CLZA 1RHZB 4LCCB 2W8ZA 3M8OL 2V9QA 1SGKA 4F8LA 3VTPC 2XTJB 1QFWL 4HKJA 1HZKA 3B8YA 4DGYL 5HGHB 5K9QI 2AV1A 3BSHA 2OTKE 4GO9A 4B3EA 5IB4B 5JZ7C 3L48A 1ZT1A 4PREA 3V5DB 5DJ8B 1F3DJ 4GSUA 5GZOD 3HKFA 2EH7L 4NNPH 1NFKA 3IK2A 4YXLL 4MXWL 3F05A 5T1KA 2YD2A 3NUKA 4XNQA 3WFBH 2PW2B 2XWBB 4ZXBA 3VXUA 5SWSA 1CD8A 4P3DB 5AW4B 2EADA 4KI1A 3PWPB 3CC5B 4NPYA 5DZAA 4EIUA 1X5HA 4WHTA 1HNGA 1HI6B 1PNDA 4JGJA 1NBYA 3DRQA 3ABMB 4FXGB 4O9BA 3OVUB 1YEEL 3DROB 1RIUL 4LHUA 4HK3N 1D9KB 4ZO8A 3T0ED 3MX0A 3UJTL 1XB8A 3V55A 3AREA 3LXAA 4OF6A 4B96A 3LVTA 4G6FD 1NKZB 3I2CL 4K0OA 4HG4J 1QRNB 3SKUD 3WFDL 2VDQH 1RF1A 3EO0A 1ZLUK 1L9TA 1T5XA 3LRGA 5BJTA 1MFBL 2N9BA 2GK2A 1EZVY 3L3KA 5JHLH 3GT6A 1Y6NR 2B4CL 2RACA 5CSGA 3L2NA 5CAYB 3NBNA 1OTSD 4B7LA 1MNUH 1NBZB 2JDIH 3QI9D 2VXSH 3U4BH 3MV9D 1LYQA 1P69B 1URQA 1TTBA 4NO0D 4JQVC 5AAPA 5CN3A 2Y1VA 4Q9CA 1FPTH 1P6AB 5J6HA 3EGXB 4BKTC 4R2GC 1JS4A 5BZDA 5MENB 2VDPB 1QLFA 2ENPA 2X2YA 4FLSA 4PGDB 3D39A 4KH2A 1Y18A 2R0KH 2YO2A 2VERA 3DECA 1SF5A 4ASVA 4NNPL 4ZODA 2A9DA 5T1DH 1RJCA 3WFBL 4F2ME 1HGVA 3DURB 2YPLB 4OVVA 2J58A 5GZOC 1AQTA 1MRDH 3MOBH 1P84K 1P7QA 3AWEA 4BFEA 6CGTA 5J06A 1DL7H 2CIIB 2KPWA 4U33A 1SQPJ 2HFTA 4EN3B 3ZX1A 5ICUA 3TNUB 1QSEA 4RDBA 4ORZC 4DGWC 1GTWA 5C97A 1IK7A 1ZLEA 2YN3A 3VJ6B 4MJIB 4NXSA 4KJMA 1NEZB 2OMWB 3DGCR 1Z9LA 4I2LC 1XB6A 2I7SA 4AQOA 2XI9A 3OJAB 1OQOA 2VDQL 4K7PX 3T0EC 2IAMA 2QPUA 5JHLL 1U7MA 2JI2A 2CO2A 3V6IA 3UACA 1MVFA 1VKXA 2OKMA 1IEHA 1QATA 3GMMA 4OJFL 4PB0H 4A7UA 1L9RA 1MNUL 5FIEA 2WXHA 3RNKB 2ZKMX 2VXSL 3U4BL 2YIUB 3IDJA 3BD4A 4EIGB 3QEQA 3SYQA 1QI3A 1DH3A 1OTSC 3BCCD 4EI6B 3LW5J 1MI5A 2WD0A 3D4YA 1FPTL 3QI9C 1PZ3A 3AW5A 4PJHE 4NM8H 1JUNA 1XSIA 5LCVA 1RZFH 3V6BR 2IANA 5ECGA 4R4LA 4I1RA 3W82A 3X1BA 1F2QA 2KLSA 3HS0B 1V10A 2HTLD 1GJUA 3RDTB 1T1YB 4MS6A 1OARH 2R0KL 3GLDA 3DI2B 2V2TB 2FFDA 1E6OH 2PO6B 5ACZB 2ZUXA 1TNNA 2KNCA 3AAZA 4BFRA 4E5XB 5J13B 1YLBB 1OCRB 4TULH 5EF2A 3ZXAC 2NY3D 1IBZA 5L8RJ 1MRDL 3MOBL 3V4VB 4NDMB 2HSIA 2EDQA 2C4XA 2H6UA 4GW5A 3MODH 1E4JA 4QRRE 2NNXA 1X22A 2QJKC 1WBYB 2R2HA 2O61B 3O6QB 3SIKA 2RHEA 5K9QG 1HL5A 1DZ0A 2X7LA 3PP3K 5DHDA 4Y8DC 4N5ED 3LD8B 2KHAA 3UBXA 4P3WA 3CFKA 4WV1C 1RZIB 1UJ3C 2HAZA 2WGXA 1TCRB 5FA4A 4N8VG 3SKMA 3ZR6A 2ZWNA 4ZDHB 2IFFH 1TCMA 4JKMA 3EF4A 5EIIA 3LY6A 4BRYB 1WEJH 4R0LB 4ICXA 5CCHA 1B88A 1G9MC 4PB0L 1CYWA 4PJCF 1WFJA 2IIJA 4RVBA 5HPMB 2WCGA 3VB9A 3ZIMA 5B3SB 2WLLB 3FRUA 5BU8B 1KPUB 1RZ7H 4PBXA 3WSQH 3ZY7A 5F7EH 4NO3B 4G8GD 3MUY1 4OZGE 2A6JA 1X6LA 4UDTA 5HDBB 1D7BA 4HUVB 4NM8L 4FMFA 1RZFL 1A9VA 1PD1A 3AB0B 1V3KA 2ATKB 3CFIC 3MNZB 4N9GA 3H1ID 2N56A 2A06D 1OARL 2GSGA 1ZRTD 3K6SA 2RH0A 1E6OL 3VWJA 1LJ2A 5DUPH 1L6PA 3VACA 4ZRGA 3F12B 2HTLC 1CZ8H 3SE9H 4LEEA 5CN1A 1UWXH 2CO4A 2ZX9A 4TULL 4U49A 2EKJA 3GSNA 4N8PA 4OH8B 3A21A 1J05B 1L0LK 2ZXDA 3TJHD 2CRMA 5DA0B 3QAZB 3MODL 2NY3C 4N1CA 4PJ0H 3VN0A 4AOFA 4YHMH 2A45I 2ZYRA 2X4QA 2XTSA 3ZTCC 4G11A 1KLUB 4LLAA 3TYYA 4ATTA 4A2DA 4KROB 4M4PA 1VEOA 1JCKA 4UQAA 3HB3B 5JNYA 2OQQA 1T7WA 3O45A 1M56B 2A6IA 4F37F 1FZCC 1VQKP 1Q0XH 3T0EE 3P54A 2IFFL 3KYOB 4WNSA 1FZJA 2Q7YA 1WEJL 2I7OA 3ZIYA 5MEOB 4E9RA 3DK0A 5DHVA 2VN4A 1J9SA 3TGUE 4MAYD 4BJLA 2NSXA 1VZIA 1UJTA 4KZCA 1RZ7L 5EZJB 3V4UH 2EDTA 1ERNA 2UY6B 3IGUA 4O5LH 5F7EL 4FQHA 3WSQL 1L2PA 2Y2TA 3HE4A 2JE8A 4A7GA 1QL1A 1TG8A 4ZUWA 2NX5D 2R5DA 1EBAA 1UENA 1JZ3A 1SMOA 5D7SL 2EVJA 2EZ0D 4P57B 5AW6B 2ZUTA 3B83A 3VX0A 5BOJA 2ZUWA 1TLMA 1DBKL 3VD7A 5DUPL 4MBRA 1JGUH 2VH5H 5BMFH 1CZ8L 4QHLB 3SE9L 1IT9H 2AXGB 2VMFA 1WFMA 1OP3H 1WICA 5F3BA 1QI5A 1PCXA 3IU3A 4DPBX 4HVBA 4O58L 3TURA 1GS7A 4O2EB 2EABA 1KFNA 1Z9MA 3L1FA 5TE4H 3PP4H 2W88A 4KO6A 2JXMA 4HIIA 2FKWB 4OFYA 3TJHC 3WUTA 3K46A 3ULVC 2HVJB 3NZSA 3OXRA 1YTZI 3RY5A 1F58H 3VG0H 5FC9A 5CMZA 4DJMA 3H6AA 1CB4A 1NIDA 3Q5OA 1Q0XL 3V95A 1AXTH 3N41F 2F5BH 4NT6A 2BHUA 3N1FC 2XNAB 3BN3B 3NIDB 4TUOB 2PPDA 1GXEA 5E4EC 1NFDA 1JN6A 3LRSB 1L9PA 1KB3A 3NZUA 2VM9A 1A02F 1YHPA 3UBGA 1YPZA 3NJNA 3SPVA 1L0NK 1DLHA 4N6JA 3V4UL 2K8QA 4LEXH 3RVUD 4OIIH 4WJ5A 1N8RQ 4MAYC 4R9HA 2DQHL 1JK8B 1HHHA 3QDMA 5HDWA 5FWQA 2DD8H 1MDTA 4NAQA 3UYRH 4P49A 4MBOA 1MKFA 2WKLA 2YSSB 5D5MA 4NRYA 3C9NB 4F7PA 1JGUL 1M7LA 1E79H 1I7TB 2EZ0C 2VSMB 1FLTX 5BMFL 5ISZD 5JW4N 1C8PA 2GEEA 1IT9L 1LP1B 2DN7A 3EYOB 1IZKA 1CIDA 2FB4H 2NY5H 3CDCA 1UG9A 3RTLA 4UQEA 1BVLB 1YY9D 4ABWA 1A7RH 1PGOA 1VLXA 2Y5QA 2O93L 1S8DA 2WLYA 5TE4L 3PP4L 1L7TL 3J07A 1ZV8A 2Y9RT 2CHNA 2CU9A 1F58L 2ZOKB 3VG0L 3IE9A 1SXNA 4PJ9B 3HAEA 4CGTA 2BMKB 5CCKH 3QYNA 1NINA 3UPRA 3DTUB 3FJTA 3U4AA 1KB9D 1AXTL 3NGBC 2F5BL 5HYJE 2E74B 1WA1X 3H2WA 4FA8A 4AH2B 1KGIA 4HIXH 3DBSA 5A7EA 4AQ8C 4HU2A 2XIIA 4Y1AB 2IWKA 32C2A 3H1HG 2VN6A 1GK6A 3TGUJ 4Y5YC 5TDOB 5SWSD 3VRJB 3EGSB 4TNWF 1OCZB 5IIEB 1ZPLA 4LEXL 5BUPA 5AVWB 5IUSA 4OIIL 4PBVC 1JZ5A 4FXLA 3G6EP 2W0LA 2C4FT 2R0WH 1VQ9P 3U7AA 3RVUC 3RTQA 2DD8L 1XMEB 4G7SB 3AE4C 4GKLA 4N0FA 4WO4A 1KIRB 2OJZH 5I6OA 3UYRL 3Q2LA 2H43A 2IV9A 3BMWA 3VA2C 4I7ZC 3WTUA 4NQDA 5IQ9B 3H1IE 3Q2WA 4LCWB 2ED8A 3ARED 3K81A 1NAYA 1ZRTE 1WT5A 3BSGA 1XF4B 4I0PB 3B34A 3ZE1E 3D05A 1FFQA 2WT7A 2FB4L 2X89A 2NY5L 5FUCC 1JSYA 5AW1B 2UZXA 4XMLH 43CAA 3V2QA 2WXPA 1A7RL 5F7BA 4WI4A 3ZHFA 1A3RH 5F1IB 1N9PA 4F9LC 4CU7A 2EVHA 4P48A 1H5BC 4PJXB 2IADA 1YY9C 1U36A 1URQD 1WWAX 3ULVE 3N43F 4XOBA 4ZW6A 2H0FA 3HFFA 4I89A 4WVRA 1NWOA 3ZLQC 1BYPA 4FNTA 1CU4H 5CCKL 4HS6B 3STLB 1GGYA 2D31B 3L73E 1G4MA 4HA1A 1OAZH 4NBXB 3IF1A 3G71P 4F9PA 1DQTA 4HIXL 1KTMA 1A66A 2D8KA 4PMFA 3UEQA 3KPRA 4F7CA 5JMOC 1FG9C 5ANMA 1AANA 1JDCA 4UAOC 3V9FA 3GMOA 4ELMA 5A2AA 1P7QD 3D50A 1KZYA 4A39A 1FNAA 1M71A 3GHBH 2K9UA 3WNLA 1EJ8A 1O5DT 4UYQA 3L4YA 2R0WL 3TO4A 3TV3H 4PJ8B 1GY2A 1T04A 2OJZL 1SHXA 1KBGH 2EDBA 3KZIE 3I02B 4Y2OB 1U42A 2FBJH 2BHFA 3D4GA 1ML0A 5KJ7A 4UB8E 3BUDA 5HI4D 2V17H 5E9AA 3WXWH 2NW2B 1CZQA 4PRIB 2XWTA 2R1WB 1AGFB 2OI9C 3B4NA 2IAMD 4XMLL 3AREC 4NNXB 5KLIC 4BDVB 5FB8B 4ADJA 1NTZK 1QWHA 1RF1C 1A3RL 4L3EB 1Y9BA 1OPOA 4OFIA 2W0KA 4B9ZA 5IVZA 1EFQA 5GGSY 4AENA 2QEJA 1A4JB 4HC1A 1QFWI 3ZL4H 1Z9OA 1S7SA 5D6CA 3NIFF 1TTCA 1CU4L 1URQC 4HZLA 5L4IA 3L54A 3CPWO 1B0RB 2HMID 5FCUH 4AIOA 4FE9A 1OAZL 4ORGA 2BRRH 5IMLB 2WPGA 4KX8A 4WFGD 5EZLA 5DK0B 3V9CA 4O9HH 5CGYD 1SN0A 4FFYL 5DFTA 3MJ7A 1K4CA 3SY6A 4XXDB 2APBA 1Q9OB 3FUKA 5E8PB 5A6LA 5BVJB 1FZOA 1Z9PA 2ED6A 3G6DH 4QF1B 3FSZA 3U4EB 4R26H 1ND0A 3PQYA 4ICWA 3GHBL 4OZHF 1F4WH 3P69A 1ZGLP 4Y16D 4OZ4A 1FYTD 2RAMA 2VMJA 2A3TA 1ZVNA 2Z4QA 3BRDA 2OMZA 3QS2A 2JELH 5L8JB 3CWBD 1KBGL 4J8RA 1HL4A 3FCSB 5GRVK 1C16A 2GA1A 2CA3A 2DQ6A 1U3YA 5LXGH 2B1AH 5CILH 1AD0A 4KGLA 4RA3A 1S7UA 3WXWL 4UQIM 4BZ1H 1OK8A 2OSLA 4HJUA 5FUCE 3QQ9D 1S9KD 4GQQA 1EO5A 1M3IA 3D07A 4H0GA 2WBJB 3ZVVA 1Q81Q 3B2UD 3GGWB 4XPGH 1KYOK 1KC8Q 1N5AB 1JTOA 3KPSB 4Z7WE 5HI4C 1PKQB 2WCSA 3GMQA 5EBLA 1KJVB 4GQ9H 4YDVB 4XPTH 4D0CB 4JFFA 1I9EA 5BS0D 1AH1A 5DF0A 2IAMC 3ZT6A 5L6YH 3HPJB 1KTLA 2C9XA 5DYOB 2KKQA 1W0VB 4WTZG 3WKPA 4H8VA 3ZL4L 1GVIA 4GBXA 1JVLA 1PP9G 2ZAEB 4I6MC 4MQ7B 4UMSA 3QH3A 1PAMA 3L73J 2TRHA 3NOIA 4H44B 3Q5SA 1FL6A 5FCUL 5A6IA 4NN7C 1HQ4B 2BRRL 2DB8A 3H3BC 3NCXA 3CZFB 2E8YA 3QUHA 2AEWA 4O9HL 4RQQB 4OCXH 3VWJD 2HMIC 3W39A 3P73A 1SHWA 2XTJD 3BDXA 3GYRA 4DZOA 2FFDC 5CGYC 1SDYA 5ID1A 5HGAA 3P9MB 2ZWZA 3VE0A 3G6DL 5EUOE 2XG4A 3VFMA 1FZBA 3II6A 3VXUE 2A38A 4R26L 4ZAKB 5SWSE 2A9BA 3LH8A 3HZKA 4JK0D 3FN9A 5GS2D 3PAUA 1BYNA 3E9UA 1MRFH 4JQXA 5GSVB 4JFDB 1M53A 2AJVH 2KUBA 3BGFC 2XSKA 4U1GC 1MFAL 5F1KC 3ETBF 4NPKA 3FQ1A 3B43A 3QUMB 5E5RB 2BIQA 1IFPA 3QPXH 4D9QD 2C7UA 5LXGL 2MNUA 2B1AL 5CILL 4ZYKB 4AE1A 5CEZH 4HS8H 4BZ1L 1NC4B 2C1OB 4MB4A 4JDZA 1BZ9A 4PD4K 1G5AA 4YBQD 1MLCA 2WINA 4YHOH 1PVHA 4MTMA 4XPGL 5EDXA 2DM2A 5KVDE 1UZGA 1RLWA 4F58L 3MRGB 2YLKA 4GQ9L 4XPTL 3QQ9C 4N3TA 1S9KC 4JKKA 3B37A 1OZTG 3B2UC 1DBBH 2XACC 4N9OB 3BFQG 3FQNA 1QRND 2FQDA 2R27A 3CZKA 4HFWB 1I7ZA 1JDAA 1OM3H 1JWSB 5H2BA 3A22A 1M05A 2KUTA 2PCFA 1O6SA 3HI5H 3OKKA 5DJDB 5AB9A 1HCVA 3I84A 4L1TA 3EWKA 3NJVA 5GGUB 5ICYA 4HHAB 3H1KG 4GG8B 4HEMA 3JWNG 4I2XE 4IJ3C 4OCXL 4XN4A 3CCVP 1TVBB 3P9LB 4OAWB 3UDWC 3VXSA 1AIZA 1IC5L 3VFUA 1QLRB 1F3DH 4JCMA 1OP9A 4LCCC 3VWJC 2ARJA 5KOVC 4U1NA 4LGRB 2XTJC 4XBPA 5L7XH 4M62H 3MREB 4E68A 4PMEA 4PJDB 4MNHA 1MRFL 2F58H 1ZT4A 4AK2A 2LU4A 2AJVL 2YPLD 3MLTA 3IB4A 3AG2B 5E1IA 2BRQA 5KSAB 3FSOA 3CX5K 3W9DA 5HHMD 1QSEE 3T2LA 3WTYA 3QPXL 4X4XB 3RUGB 3U6RB 5CEZL 2YIHA 4J3OG 3QUYB 4HS8L 1FDMA 3QRGH 4NP4H 3WIHH 1HYRC 5AEAA 4EN3D 4LP4A 5KZCB 4YHOL 2I9LA 3SWFA 4AM0Q 4FXGC 1MJ7H 3BJLA 3JV5A 2TSAA 3WHE0 4PRAA 4C83A 4DP6X 4MJID 4WKZA 5D7EA 1S9WB 4TQEL 4YBQC 1PPJD 2BCCD 1IFGA 1DBBL 3HTLX 1KLGB 3IDUA 4JF7A 1I1FA 1T83A 3DV6A 3IFOB 3PWLB 4ISVB 1TETH 4H20L 4TLUA 5CLXA 1OM3L 4NQQA 2OSWA 4UQBA 1K05A 3QEQE 5EO9B 3HI5L 5E9DA 1MI5E 1CFSB 2HG5A 5FW6A 1DQKA 2H2PD 2X1WL 4W9CC 4K7PY 3L4FA 4KZ0A 4YZFF 2IANE 2ERJB 3KWWA 5APYA 4D94A 4CVXA 1Y0LB 5HJ3A 4GG6A 3H25A 1KQSO 2H1PH 2ZKHH 3MRRA 5KW9H 3VXMB 4J3XA 5IQOA 4L2YA 4FCAA 1JZEA 3O9WB 5F3HB 4M48H 1NGPL 1N0LA 3RDTD 1P6WA 5L7XL 4M62L 2BIIA 4RMBA 4GP5B 4OVUA 3VGGA 4AEIH 3OMNB 1EFXA 4A55A 1BOYA 2EYRA 1ES0A 3G3ZA 1U8PA 3ZDXE 3TIDB 5F9OH 2ZZUT 4E41B 1JZJA 4PBDA 1QABA 3CWBE 4L75A 1G1KA