5AW9B

Kinetics by x-ray crystallography: native e2.mgf42-.2k+ crystal for rb+ bound crystals
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 51
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw9B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw9B02
5CMZA 1FOSE 2P67A 3TYYA 5AW8B 5APUA 1FAVA 2XV5A 1NWQA 2W27A 3OAKA 4LC1A 3VN0A 5APYA 1MUUA 1JUNA 2Z5HA 4AQRD 2R3CA 2W6AA 4C7NB 4EOTA 4RETB 2QM8A 5AVVB 2XZRA 2R32A 3O8ZA 4I6MC 3LIDA 3M9BA 2BASA 3P7KA 2JJLA 3HE5B 5AW9B 4AYCA 3HE4A 4XE5B 3LIEA 1S9KD 3M0DA 2YO3A 4B86A 3TK1A 4JYBA 3KQGA 3TNUB 1A02F 2Q5UA 3KDPB 5AW6B 2Q3IA 2YO2A 2XU6A 1GZLA 2WPRA 3A7OA 1T2KC 2R5DA 3L37A 1IO4A 1NAFA 2Z5IA 3HE5A 3MGNA 2WTYA 4HYTB 1SP4A 2P2UA 5APWA 5AVSB 5AVRB 1SLQA 4JYCA 3NTNA 2E43A 2WPQA 3I5CA 1A02J 2P7JA 4GT1A 3VYIA 1T2KD 3NFQA 3VMYA 1HUCA 5APVA 1HBWA 3L35A 1MV8A 1DH3A 1H88A 3V4QA 5AW4B 4DZOA 1H89A 3MD0A 4C7NA 3UIAA 1CSBA 3B8EB 5AW7B 2IPPA 5AVTB 2C9NY 3P32A 2Q7CA 1CI6B 2WT7B 3HE4B 3M06A 2VRSA 5AW0B 5APQA 5AVYB 5AW3B 3SWFA 2H7HA 3A2AA 2C9LY 3P8MC 5AW2B 3VTPC 3IR9A 1GU4A 4C46A 1GK4A 3NMDA 1HWTC 3A5TA 2WPSA 1HJBA 2N9BA 3M9HA 1GTWA 3VMXA 5AVWB 1MFZA 1GD2E 3V5BA 1G2CB 5AVUB 1GK6A 3L36A 4I2LC 3HTKA 5AVZB 1S9KE 3M0AA 5APSA 3T97A 1OWAA 1JNMA 1H8AA 4M3LA 5APXA 1KQLA 3A3YB 3V4WA 3M91A 1OXZA 4GKGA 3TNUA 3WGUB 5APTA 2QM7A 5AW1B 2ZXEB 3NXSA 4AUWA 1CZQA 1YYCA 2ZFCA 4RESB 1GU5A 1CI6A 2WT7A 2E42A 5AVQB 5AW5B 4KHXA 2WWWA 5AVXB 2R5BA 3WGVB 2KP8A 1J2JB 1FOSF 3VMZA 1X8YA 2YNYA
chains in the Genus database with same CATH superfamily
1MJ7L 4RQQA 5AW8B 1T2QH 3EDDA 3SYAA 2F7OA 1G1IA 1AXTH 1UD2A 4TLKA 5DHVB 5EU4B 5B39B 5E8PA 3Q6FA 4IL6E 1E30A 1KLUB 1IM9B 1T5KA 1TETL 1Q81Q 4JDEB 1INQB 1MFTA 2BP5M 2G5BA 2GEQA 3B43A 1PGRB 4EDXB 12E8L 4ZOAA 1FC2C 5J12C 2Z92B 1M42A 4WO0A 3FCSA 3RGVA 1GGCH 1MKFA 1JY2O 3O6KH 2F1BA 4YXKL 1NIDA 4EI6B 2Y7NA 4HUUA 3BPCA 3CNKA 2B8OT 2PXYC 3MXWL 1AKJB 4LF3A 3O3AA 4GMTL 3F7KA 4PRHA 2XTLA 5AW6B 3EO0A 2C4FT 2DLTA 4J3OG 5H4ZA 1V7ML 3V9EA 3KLDA 3GMRA 2WTYA 4XP6H 2J1ZA 3CSYB 3BZEB 1QSFB 1E7VA 1S7WA 1KZUB 1K2DA 1BAFH 3ENEA 3FMGL 5DJ0B 4XVJL 3TXAA 2QHRH 2WLYA 4IOFD 3PQYB 3DK0A 5I76B 4XXWC 3O0RL 2NNFA 3L4FA 4LPXA 3VYIA 4YJZL 5EC1B 1WAPA 5ILTH 4X5XB 2OX5A 4HIEB 4NZJA 2OMVA 3DX8A 1NCCL 1WEJL 4MX7A 5K9KA 1CFNA 2E9JA 1IAII 1MCDA 4U1MB 5BRQA 3VA6A 2V4HA 3BSZA 3QDGE 4JRXB 5D2LB 3BAEH 4HULB 3ZYJA 4WJKB 4HHWA 1CD1A 1NWOA 1C9SA 3GGWA 2HMID 1MCBA 1YN7B 5J13C 1JZ7A 4NUQA 2QVMA 3EJZD 4JDVB 4CVZA 1Q0YL 2EIBA 1LT9A 1JV2B 5IWLC 5IF0A 5JHLA 5JW5A 2C1OA 4P2QD 3T1WA 1NCWL 5I5RA 4Z6AT 2X4UA 4XVSH 2ZVNB 4UT6H 2YPVA 1NAMB 4L5FL 5KVFH 3IXTA 4ODWA 2F7PA 4Y4HA 2M1KA 1E7UA 2GJ6D 4MA7L 1MCKA 5EUKA 1GH7A 3LH8A 5BOJA 4OTXL 2N0MA 4WW2C 4FQLL 4ZFOB 1BHGA 1J12A 4S1SH 2Z31C 3CXHJ 1YYLL 1OW7A 3RI5F 3T0BA 5B3JF 2AXGA 2CGRL 1SQ2N 1JTOA 2LLLA 4PP1D 4UQ9A 5SV3A 3VGHA 5SWZA 1ZOXA 5IHZA 4X6BA 1JZ8A 2BSSB 4ZUUA 3K0WA 5DMKB 1YEJH 1HHKA 1LTAC 1A4KB 2DQJL 3I56P 5E03A 1E4WH 3MNVA 3RGVC 3WKNA 3QEQD 1Y47A 2GA1A 4JFXB 1ZJBA 2IWEA 4RFEA 5C0FB 3I9GH 3VFOA 1UXMA 2RHEA 3PAYA 4WFFE 1H15A 4YUEH 5IB4A 3UZQA 4EZMA 4ZAKB 5AZ2L 3ZE1F 4UQIM 3OJMB 4J3XA 4ZMAT 2WNKA 3QXAA 3TIEA 1HINL 4EMZA 2OSYA 4JF7A 2QQLH 1KTLA 5D6CA 5EOQH 3RWEB 4JN1H 2HLAB 5MEPA 5LWYL 5KSBB 2FO4A 1QR1B 5FM5O 5SWQA 1ASOA 1F4XH 1SQQJ 4MJID 2WP3T 2F5AL 5B1JA 3B8YA 4Q97A 2F19H 3AXLB 2VIRB 2CXGA 1M3JA 4DT0A 3EJJX 1GJIA 3EYVB 4N85A 3STBA 4RAVA 4PJIF 5CINH 2WBJD 4EOWH 1LO4L 2ATKB 2NLJB 2KKQA 3AEDC 1YJDH 4JHBA 3EYSH 1KLFB 4MA3B 4XI5C 3IU4L 3L9RB 3WXVL 3EH2A 4MJ2A 4WZ9A 2G60H 3UAJD 4B9YA 3WUWG 4PJXB 2WBJB 3U2IA 1JZ3A 5JXEC 2A3TA 1OM9A 1T5WB 4R97B 3ARXA 4DGIH 3SQBB 2W9EL 1Z3GL 3GNMH 5DCCA 5DGQA 5CBAA 3CZJA 1HXKA 3C60C 1PZ5B 1BQKA 2E46A 1CTOA 1FC2D 3NJGA 3NA9H 3U4KA 3QO0A 3W11D 3INUH 3QFJB 5F7UA 1HH0A 2R1YB 4PWKA 4XH2A 4NERA 1CDJA 4L3CB 4UQ3A 2WZPA 3IRCA 5DZAA 5D1XB 1LEIB 2QKSA 4BSVB 2K88A 4OIIH 3C60D 4K73A 2WKLA 5C3LD 1FRGL 1IEAA 3VXMA 1F5WA 4MD5B 3FN9A 5E5MB 5IOPB 3G5ZB 3OC5A 2OBGA 1NOAA 2DLFL 1H8OA 5DLML 5HHMB 4XMUA 5BRPA 4EBQH 3BO8A 2K9UA 5ESQA 5IREA 5LUMA 3SGDI 4ZQKA 3BGMB 4G3YH 1MOEA 2OYHB 3EOAB 3NACL 5FK9B 4PJXF 3TZVA 4M4PA 4J39A 2IPTL 2PAJA 1IVLA 2J4WL 4FFYH 1N3NB 3FAXA 3H3BC 5KVDH 2C9VA 2HFFA 3FQUB 1U2CA 4XXCC 3PF2A 3SKMB 3J27A 1R24B 4NRZB 4WEEA 3T4YB 4N8UA 3H32A 3QJVB 1I8LC 5KW9L 3BUYB 3CTTA 2DI7A 1A6VL 1BF2A 4ZUTB 1KXQE 2VDOB 1WWAX 1X5YA 2PRRA 2DIBA 2Z1PA 2ZD0A 3S36H 3HC3L 3B7SA 1HYRC 3BVHA 3IKCB 2P8PA 1A66A 5E6ZA 1CMOA 3MV11 4M48H 3HI1B 1MVYA 3D9AH 3GJFA 4EKJA 5KBNC 2PPDA 5FUCC 5DRNA 5CAYB 2Z31A 3LSOB 4R7DB 4OI8A 2A99A 2O5ZL 1N64H 5GISH 3TEYA 2W6BA 5GS2D 4Q9RL 1BE3G 5DJDA 1HL8A 5CCHE 1NCDL 1XTMA 2OTPA 2VXQL 3VJ6A 3HC0A 5BZWA 3FWLA 1U3HC 3WHXB 2DYRB 3SEPA 3S48A 3L9EA 3ELQA 5MI0B 3WBDA 2ZXXA 2F8VA 5TE4L 2VM3A 3EF4A 4IRJB 2M5AB 1FIGL 1JO5A 3AU1B 4N9GA 3ROOA 5EZIH 1J5OL 5EU4A 2K3HA 1SLVA 4F7MA 4X83A 2GUSA 3VWKA 4P4KC 5HYFA 4G8GE 4NQUA 1BM3H 1U92A 3KGRA 1N8ZB 2X4SA 4HK3N 1FBIL 3HC4H 4WHYG 1HHKB 2HA1A 5IBLD 1EJ6A 4BM7A 5GJTL 4Z7UB 3HUJA 3BRVB 1Y0LA 2QSTA 4ALAH 2GEEA 4KZDH 2M0BA 1T20B 3VYOA 3UP6A 2JIXB 5AVSB 3MRIA 2NY5C 4L37B 4NX0A 4P46A 2RCSH 4E41D 5CUSL 3HB3C 2FGWH 3T6XA 5KLIC 2W8ZA 2VLRA 4G42A 3KLAB 3KJ4B 5E6YA 1B6UA 2O01J 1A4JB 2QSCH 3C6LA 3KPNB 2QHRL 4U1GC 4WAFA 3W56A 3WHE1 3WXWL 1RURL 2HVKA 3IDGA 4AE0A 5I18H 1MCIA 1Q94B 4CW1A 1F1GA 2DICA 1I1YB 1GHFH 3B8EB 1N6VA 2XNAB 3MCKB 2HN7B 4AL8C 3LDBB 3OG4B 1G9HA 3EZJB 3MDJA 4RZCA 4WHDA 4DW2L 4U1LB 4XXCA 1ZT4B 3MOAH 1WFNA 2AK4E 1K4DA 3RY6C 3MAWA 1G7IB 1XH1A 3O6QB 4LB8A 1MAJA 1JZEA 1QYGH 3WU2E 4XHJC 4EUPA 3WNMA 2LR2A 2PP9A 3GKZA 2QJYB 3DUHA 4O4YH 2F08A 3BMVA 3NJMA 4PS3A 4WI3A 4J1UA 1QO3A 2OR8A 1GTWA 1Q9LA 2DM3A 1UUSA 2IWKA 4JG0H 4K9JA 3W5NA 1PCXA 4NKQB 2P7TA 3V0IA 5A6MA 2R4SL 1MHCB 2R9HD 1GJWA 1EXIA 3MLTB 5C07B 1GC1L 3RL0g 3TEZA 4N2NA 5CSBA 1E2WA 3QO0B 4KO5A 2EEBA 2FSDA 4JPIB 3CZNA 4NP9A 4WI7A 4S1QH 4IU2A 3BSZH 1J0HA 1GAFH 3EOBA 1H6EA 1T03L 3FFOA 5CD3B 2AI0L 3LPPA 4PPTA 3ZQXA 3EJCA 1WAAF 1KB9K 2HUEA 3F6IA 1KTDB 1VEMA 1HILA 3B2UD 5MEOA 1E4WL 4NAQA 4N3YB 1BM7A 1INEH 1LNUB 1R5WB 3QAZB 1LO2L 3ZE0F 2IDFA 4ZAKD 4RFEB 2WPVB 1M1KQ 2JV6A 4C54A 1CK0H 3OB0K 1NMCC 5LJYH 3L73J 4PJ9D 3QUYD 4PRNA 3LKRA 3PWPE 4NDMA 2IBZI 4GLRI 5F93C 5IM7A 1W72H 1M1JB 5C0BE 1SQBK 2PCPA 3AG2B 2OYIA 3DIFB 4P23C 3W81A 1EEYB 4FHKA 4RSYA 3VD1A 3DGGB 4RGNC 2D9QB 5CIPB 3WO3B 5I8EB 2K8QA 4NLHA 1IE4A 1O5DT 2A9ML 4C55A 3U7WH 2ARWA 4WU7B 1K05A 1JVOA 1WAAA 4PJ5E 3CMAP 2WVVB 5FO2A 4F9PC 4WWKC 3KMDA 3H42H 4JW3A 5T3ZL 5DQDL 4G7QB 3FQTB 2ZYAA 1FNHA 3N9GH 4U1SB 5HDRA 2NR6A 2WPQA 3CCHB 3FHQA 2HFGH 3NCYS 4MVBC 3A24A 4RA0C 1OKEA 2CJSA 4A68A 1S9YA 3WXVH 2QADB 1PGJA 3PL6B 3VWKC 2CRZA 1XXDC 5CR1A 1UACL 5ICZA 2FX9H 3F01A 4Y4KC 1RPUA 3K71B 1G43A 1OVUA 1QPPA 1FN4B 3F6LA 1NEUA 2P45B 1J10A 2QADD 5J12B 5MENA 5JW3L 3C2AL 1OV8A 1G7PB 3N06B 2HX8A 1WISA 3DVNA 5EOTA 2HH0L 3KPSB 1BP3B 3CHXA 3MLZH 2ZWLT 3I55P 4ZFZA 4W93A 2PXYB 3K6FA 1LTJB 4MXQC 4P06A 5F9AC 3TM6A 1RE4C 3KBEA 4ZX4A 2DM4A 1N12A 4HKXA 4XR8C 4AYEC 5J7CC 3F58L 1UWYA 3OKKA 2KUTA 3RUGB 1USEA 5FUCE 1ZHKA 3L5XH 1MCFA 1QHPA 2XA8H 1WZ1L 2CGYA 1NBYB 4Z7NE 4QOKB 1N8RQ 1HZHH 4ZPVB 5E5MA 1SM3H 2XG4B 2VDLH 4GQRA 5E8DH 2FYZA 3QXTA 2EDKA 2H6PB 3EYUL 4Q6YA 1ZLSL 5K59F 2KZWA 5D5ME 1C16B 2NUTA 4TPRH 1TJGH 2YHGA 2L91A 5F7YC 1MF2H 1PIFA 2EABA 3IJEB 2BOCA 3VXRD 1WT5C 3CU1A 3SDAC 3B3IA 3MGAA 1T3FB 1F3JB 1EO8H 2JE8A 4G9FA 2YRBA 4TNVK 2VAAA 3PL6D 5DS2A 5GS2H 1NM4A 3CX2A 1IAMA 3WV0A 1CU4H 3CN2A 3WNOA 3VP9A 2Y5EA 4U1IA 5AVXB 4CSSA 4ZYKA 3IJSA 2XXCB 4LOUD 1BJ8A 3K3QA 4K3EH 3SCMC 1C5CH 4NRXB 5DJXB 2KPNA 1S9YB 4NT6A 3V6BR 1UD6A 4BQ9A 5CSZA 3WUZA 1FH2A 5APYA 1NGQH 4WK2B 3L1FA 4J28A 3D50A 1RSFA 4B0MB 1MWAB 1BBDH 3MRQA 4H26B 1H5BC 4K71B 1IBGH 4WNQB 3QUKB 4Z7OB 4M7KL 2W6JH 4KQ4H 3HZKA 3K81A 1NKOA 1NU1E 1H3TA 2CHNA 4XMKL 3V2AR 4QJ4B 1UJTA 4F3FA 1NGPL 4J2QA 4PD4K 1I7TA 2A73A 1LO5A 2WXRA 3QZMA 5EZIL 1J5OH 4H44B 1G7HB 1TNNA 2X2HA 2M8RA 3QRGL 2IAND 1DDTA 1CDHA 4G11A 1QLED 4GODA 4KKBD 3BE1L 1B6DA 4POZC 2WQAA 5DMJB 1QFPA 3PWVA 1NTMD 1IAKB 2FWLB 2OTUB 3CV5A 2I7OA 1A7OL 1SJMA 3DURB 2Z7UA 4GRLA 2IANB 3OKDA 5TDOB 4ANWA 1RJCA 2DQIH 1AGCA 3GI8L 3HNSH 5E9DD 4HUVB 1NEZB 1CF8H 1PPJE 3F7PC 3LHAA 3RL2A 3UACA 5EF1A 2EYSA 4NQXB 3DX3A 3MV8A 4BRVA 1MHEB 1TVHB 2OR7A 3OAZK 4L4VE 3ULUD 1I7ZB 2N1TD 4I1LA 1KCUL 4PTTB 3BEWA 1OM3L 4UQ2B 1FYTE 1JMBA 2VRAA 2XX0A 2IWGA 4YEEA 3H9ZA 2HRLA 5DXWA 5HD8D 2VQTA 4A7PA 1K8AQ 2HRPL 5L8KB 2XC8A 1FE6A 1OB0A 2XTJD 3VXSB 1IZKA 1TETH 1DLFL 3FUFA 2IAMB 4HSCX 4U2YA 1VCAA 2X12A 4HKZH 2KQNA 4KK9D 3MRQB 3SE9L 3KS0J 3QEHA 1R0AL 5INDA 1S8DA 2FIRT 5DMIH 4LSDA 5LDSA 5JHLH 4X6EB 3J07A 3VXTB 2PYEA 2R1WA 4GKGA 3WIIH 1ND0B 3ABGA 5EBLA 2ZOLA 1KB9I 1UWXH 5F8RC 4YFLI 3QXAB 4MWFA 3TIEB 2R4SH 3MRHA 3DARA 4AUWA 5KN5B 1LE9A 2IAAC 2V3EA 4DZ8A 2RA1A 3FMGH 2OCJA 4F7PB 1DJGA 3K1KC 5I17B 4WUKH 4GW1A 3QCTH 4R9HA 1KTRL 4HPOH 1IQWH 1M9WA 2Y36H 3LZOA 4RJTA 5F88A 5T3ZD 1T03H 1HWWA 1QWNA 3OHXC 1SQXG 4E41B 1KQGB 1SQVJ 3ZRSA 1SFCB 3I6SA 3QORB 4TUOB 5AOIA 1E4XH 3FOLA 1N59B 2X2YA 3QPXH 1TKWB 4N2FA 2AXWA 1PSKL 4YFLF 1S7QB 3LIDA 1BSIA 4ABQA 1CBVH 4TVPE 3HUSC 1HDMA 4PJEE 4X2UA 4H1LG 5C09A 3CDFA 2NY3D 4JO1L 3MQIA 1EFQA 5EDSA 5KLVE 5E2WH 1BVNP 4FQHA 5DR5L 1AGEB 5CJBA 5F9OH 1J9QA 4MNQE 2YO2A 4PJGE 4NNXA 1KYOK 3HZYA 1HXYA 5E0QA 3ZRCC 3LKOB 3STZA 2CKBA 9CGTA 1WUZA 3EGXB 4UM9A 4A2EA 4R0LC 3Q3GA 4JFPA 1FDMA 5D1QE 1FZAA 1S72P 3RLSA 1JY3O 2LFEA 4U1HA 3L35A 2NPSA 4OUOA 1SQVG 1D7FA 3MV9B 5C07E 4Q2ZA 3CN0A 2ZZUT 2WYTA 3BP4A 2WXKA 3CWGA 4X9IA 5BZXA 4C56B 3B1TA 1ZLWK 7PAZA 2UX6A 3QJXA 4O02L 1A8JH 3OXRB 1RUKH 4JS7A 3QRLA 1XQ4A 5CHNA 4XCNB 4KZEL 1ET8A 2PFXA 2VLJE 2EILB 5IB4B 2L7UA 4BFOA 3SWFA 2EADA 3GYRA 1FG2B 1IKOP 3OPZL 4L9DA 1T7ZA 3N0PB 4NQVA 5I8CA 3II1A 1HJBC 3AEGC 3EFOA 1KB5L 1H3PL 2ZNXA 4PI0A 1DQKA 5EDXA 1CYXA 4LLDA 5EOCH 3LEXA 4DP1X 3CXDL 2EO1A 4PBVC 4A7GA 4DQOH 4QO1A 2X6CA 1I7RB 5E94A 1GOFA 1QI4A 2Y5QA 4OZHB 2YARA 5GJSH 5I19L 1W2BO 1VQ9P 2A4ZA 1W0WA 3PWVB 1KJ2L 2BRRH 3W0WD 2QG4A 1J05A 3TS8A 3F83A 3P73A 1LO4H 5D7LA 3CFDA 3BEVB 1M2VA 1XCTA 3VQMA 2UZPA 3ZDMA 4KKLC 1OP5K 4MA7H 2J20A 3VG9B 3ARPA 2QPEB 3BVNB 3T3PB 3BCCE 2WYIA 3FK3A 3MRMA 4GP8B 1F8TH 4HEPG 3BLPX 5HVWA 5FYJU 4ANKA 3VQ2C 2OYLA 3WLWC 2NT0A 1JPFB 4IRJA 4MMZC 5ETUB 4GIFA 2FLRT 3ETBJ 3LRHA 1SHSA 4U1HB 1X5GA 3NIDF 2QEJA 4FLRA 1L9NA 4KTDH 4Y1AE 5DMGD 3SKJH 1XCXA 3D51A 1MHHA 3NCCB 3RWFA 1ETZA 3UOAB 4K7FB 3Q1SH 4DN4H 4OIIL 2AAVA 2QV2A 5T5FL 1RV6X 1N73B 1M57D 5KSAA 1U8MA 4XCNA 2B4CH 5L2KB 2VQUA 3CD4A 5F3BB 1UM6H 4FTVA 1HINH 3OX8A 4MBRA 1DQDL 2CLVA 1QBML 1QW8A 2CPCA 1BVZA 3BKYH 3IFLL 3QT2A 4P46B 1A4KA 5EZPA 1QBLH 4IBUA 4OUUA 4PWIA 4DQAA 1GC1C 4ES8A 4OD2B 3B7UX 1ZXGA 4I2XB 3GT6A 3RX9A 5BV7B 4A63A 3DI3B 4NC1E 3LN5A 1G6RH 2O4EA 4L8SC 1M7LA 5EHFA 3DX7A 3AU0A 3J8F7 4YSUA 2ICWJ 4LAQL 4YHYB 3RVXD 2W0FB 1YG9A 2GJZA 3FH5A 4H25B 4TNWK 4YR6A 2N01B 4NFCA 1BGYG 3NIFE 1IC1A 3ARGA 3LXAA 5L6YH 4RBPH 4EEEA 1PPJG 4EOWL 1N7LA 1OLLA 3FXIC 1P7QB 4I9WE 4JHZA 3BVDB 5FHBH 4J2XA 2ZJSL 4ORGB 4JREC 2HG0A 3L7EB 4A04A 3VFSA 1KEGL 3IDXH 3SB3A 5HHNB 3DJ9A 1RJLA 3N40P 4LCCB 1YNTF 4FZ8L 3QUGA 4Y1SA 4TSBL 2YGPA 3IXAB 1O9ZA 3PPSA 4DP0X 4NJ9H 1J0YA 3EO1A 1ID2A 2J1WA 8CGTA 2Z31B 3LSOA 3CX5J 3TYGL 4XMTA 1HJCA 2IDCA 1VCBC 4RRPG 5AKTA 2EYSB 3GRWA 4NQXA 1N86A 5CJ4A 1JUFA 3T77A 3QXWA 5L2KD 1A21A 2JMRA 4HKBB 4OV5B 3LKQB 3I3EA 4Y99C 1OM3H 2JELH 3VMXA 2O5XL 4JG5A 2XDJA 3TOPA 5DZOA 4MQXD 4HIHB 4IQHA 5DK2B 3PGCA 4K9EL 3OTTA 3VFGL 5EPMA 2VMJA 3II3A 4NNYA 4ZS6D 3I02B 4L4VA 1P84D 2VH5H 4ZMLA 5I75B 4Q6IC 1G5AA 4J4PD 1Q9KA 3FT9A 1KBWA 1E9QA 3OMIB 2DWDA 3CZEA 1U3HA 1PG7L 3QXUA 4F37K 4P2OC 1B9ZA 2JVUA 1QFWL 4KTEH 2HLFD 3OQ3B 1RMFH 1D2OA 1HGZA 2W38A 3HPLB 5AW5B 3AWFA 4HA1A 4M7LH 5C2UB 1ROWA 5EORL 2C5DC 1OCWH 2NXYB 3AABA 1X8YA 1X3DA 1EJOH 1UENA 1RVFH 1EO5A 3BWZA 4G6ML 1N7SD 2NPSD 4WV1B 4HK3J 5AB2A 2Z1KA 3LOWA 1BA9A 4NQCB 5FXCH 2OYHA 1BZ9A 3EOAA 1TO4A 4F93B 1DEEA 1CGSH 1SOXA 3L3JA 4URKA 3MLSL 4UM9D 1E4HA 1PBYA 1RK7A 4JZOA 1GW4A 1RZFH 2X89A 5FOJA 1EZVE 4WUUD 4WTZA 5DO8A 3X1FA 4DW2H 1L7TL 3OR7B 1G84A 4YHIA 3ZE2B 4NUGL 5LCVH 5TK4A 3H56A 3V4UL 1A3LL 3BKML 2MKWA 5IJKC 2JJVA 3QK0A 3VWJA 1JHTA 1BJ1J 2ARJB 4GQPH 4LKCA 2P5WD 4QJ3B 2X87A 3R0NA 2JKJA 1WEJH 1U95B 4PRDB 3C5XA 2Q7YB 1XB3A 2MTAA 1MRFH 1I9EA 4FQIL 5IQLA 5JHDE 3AMKA 1NAYA 4PVNA 1KYOE 4WWPA 1XF5A 3OGOE 3BIKA 4L9LC 1YQ4C 3ULVF 4W7YA 1GMIA 4JHWH 4XPGL 2FEDC 4BE5A 4QRTB 3EYFA 1H3VA 4YLQT 1F3DH 5DYFA 4HBCH 1VPOH 4PJCA 5TQ0H 3VXRE 1HUCA 1T2QL 5IMOB 4YSOA 3LHPL 5E1AB 1OP3H 3H9HB 1ACCA 5KVFL 3VH8B 4KJQD 2ZUYA 4BE6A 1N18A 3G9VA 4AYFA 5GSRB 4WGKA 1MCEA 4BSWA 1HVVA 1MZZA 3CAFA 4HUUB 4PJIB 5CD3A 1AQTA 5AD0A 3ALXA 4N0FB 2AANA 1FORH 1CR9H 4XCEA 1CICA 3O2VL 4X80L 3LJ3A 4WNJA 4BA8A 4L1TA 1ZHBB 3MREB 3IDNB 5IQ7H 2OQJA 3VTPC 2QRXA 1V7MH 4XWOC 4DN3H 4PUBL 1SVFA 3S96A 4XC1L 4N2KA 1DDHA 5AVWB 1EDHA 1GHFL 3H7BB 4PJ6A 4U3CA 2ZTBA 2Q8AL 1XCQA 3IGFA 1SQPE 2YPLE 2D03L 3JYBA 1UASA 2WKOF 4LL4A 5GGSA 1D7MA 4TYUA 4ZS7L 1H8AA 3UTQB 4XPTL 3CXDH 1NGWA 2XWCA 1E9PB 5INCA 2V2WA 2IBZD 3H9SD 5F3HA 4ANXA 3CBKB 1JWMB 3V6FB 3NEOA 3K4AA 4MBOA 3MRNB 3LVEA 4FF9A 4JDZA 4L4TA 3TGUG 3NSFA 4G6FD 3DBSA 4LDEB 4CSPA 3TF4A 2FD6L 5F7BA 1UH2A 2ATPA 4D9QD 1KSRA 2CO6A 4HIJB 4PJ7A 5MI0C 4M8RA 4O2EB 1JV2A 1PF3A 2EXWD 1GZPA 5F96L 4YDJB 5J0BA 4PGEA 3PL6A 4UCFA 1UACH 3H85A 2VSKB 4IDJL 5H94B 3UTTE 5LGYA 4MAYB 1MJJB 1UHVA 3K2UH 1XF3B 1EAOA 2XCMC 5B66H 3GHGB 2DM2A 4WI0A 5GS3A 5J9PB 2CCVA 3DLQR 4L1DA 3L95A 5LB1A 3ZZLA 6FABH 5JNYB 4KVCH 4JZJC 3RKPA 2ZYHA 1H3GA 3RTQC 3T6VA 4W6WB 3TA3C 3H9SA 4UUJB 1ZN5A 4YGAB 3VD7A 5DVNA 3BH4A 3W9DA 3OQRA 2EDFA 4M6AA 2NNAB 1SMDA 4P48A 2VMDA 1IGFL 3GFUA 4PIBA 3V4LA 3X3GH 1MW3A 4WF7A 5JPMB 4L8DB 4GXUN 4R4FL 1UT9A 3TJEH 1OVVA 1AFVH 3LPOA 4PRHE 2VDNL 4XP1L 4EDWL 2EIEA 2JR8A 3F7YB 2DTMH 3UZEC 1Q0YH 3GHEL 1CFQB 4NYLA 1H9VA 3DURA 1JNJA 4A66A 1T1YA 1IFIA 1DVZA 1JXGA 3D0VB 1HCVA 2WSPA 4IS6B 4CPGA 4KRMB 4PLOB 3GKWH 2YKKA 5GTIH 1AMYA 1P2CA 3GBNL 4NAMA 4X5LA 5EU5B 3QXVA 5F9WC 2NY1C 5C0JB 4D9LL 2YKLH 4A2DA 3T97B 3OHXB 2GJRA 5DZVA 1PGOA 3BZEA 2P49B 1MY5A 1SN5A 4UIMB 3UPRB 5KZCB 4Q9QL 3B2VL 2I8DA 3NT0A 1A3RL 4Z9KB 1DJIA 3SDCD 1UWEL 3TGUD 1P53A 5DQDH 4ELKB 1YEFL 1UWFA 2IGTA 5JPNA 4ZMTA 3PG2A 3ZHDA 5E6SB 3GO1H 2JXMA 5IGXL 3V6ZB 5TH2B 2H7HA 3OLGA 2CUHA 1A6TA 5GS0L 4LP8A 3DYOA 3MACL 4N2HA 1GZPB 2MJZA 3QI9D 1E6OH 2W88A 1RZJH 3CMEP 3T1FB 1FZGA 5KBKA 1XF2A 1L0NK 2E4TA 2ESVD 1I1AD 3PHOA 4HKJB 5FHAL 3VD0A 4KJYA 3V7AG 4AYBA 1UUNA 1ACYL 4M48L 4GMSL 3LMJL 3VGBA 5D7IA 2CO2A 5LWYH 2WN3A 4H26A 5FO9B 2FHBA 3QARA 5ESAA 2VLKE 3VXME 2Z8VC 3FU7B 4Y1TA 2YXMA 4U7JA 4JVUA 4B9KC 2Q1EA 2AEWA 2K6YA 1KGJA 4AYFB 2A6IB 1XV8A 3MLYH 3QAZC 1I31A 1ZLUH 4DWHA 1UQSA 3RURA 4EE2A 4PRIE 4X8JA 4M6NL 3BT2L 1BFOB 1NMCB 4G6AC 3NCMA 3RVUC 5EEYA 2XV0A 1IEAB 1MFUA 1BZ7B 1FRGH 4KDTA 3DX9B 1P5VB 2BVPA 3C5JB 3FRUB 3SDCB 1S7XB 3GRGA 5EBWA 2OQJB 2RACA 3CC4P 3I6LD 1IM3D 2QVTA 2FQFA 3MNVB 4D6TE 1MCLA 3PDDA 3MFGB 3ETTA 2OMYA 4HIXL 4X6DA 1PAMA 3KPQA 5C09B 4OT1H 1WC7A 3EUDA 3GSUB 4JFFB 4B53A 3L3KB 4U1NB 4P5TA 4Q74A 5EBMB 3WLBA 3VRJB 1TZAA 2EIJB 2R9HC 5IK3A 3B7RL 5TGBB 2P4AB 4HVBA 3BPLC 1W2KT 1RZKC 3HNTL 4PJFF 1YEHL 3K1DA 2HLAA 4ZD3H 3C08H 3BWUF 1A4BA 3PU7A 3U7AA 3JWOC 1N2DC 4P04A 1C5CL 2BSCA 4UOW0 1M57B 5JDJA 2CUAA 3S5YA 2P5EB 2IBGA 1LTTC 3LXUX 3U36A 2EACA 3K8LA 1VFUA 1AIFA 4M61A 4GBXC 3OKYA 2P3YA 5K9OB 3HC3H 3DRTB 1TMQA 2R39A 4ZTPH 3CK0L 2PO6B 3TFBA 3NCJH 5I16B 4PJEB 1ULVA 4V11A 1F90L 2OL3L 2HX9A 2VERN 3NJVA 4G8GB 1A1MA 1MHPH 2GITB 4I7ZB 3LNEA 4GH7B 5D2LE 4ZW6A 3GPSA 4M1DH 1M7UA 4H13D 2VN4A 5EEUA 3FQRA 5CN3A 2IPTH 3CFIC 4DFIA 2H2SD 4Q9RH 2FO8A 2A38A 2BNQA 4ZUSA 1XF3A 4HWBL 4I18A 1JPTH 2IJ0C 3C8HA 2WMPA 3EXJA 4WW2A 6TAAA 3VRLF 2FSEB 4N6QA 4KXZH 3ZDXB 5AVTB 2VQ4A 4PY7A 1L9SA 2AEIT 5T3XE 2N4IA 2ZT9D 1CLYH 2BHZA 3IDYB 1J9RA 2Z64C 4N8PA 1O6VA 5APQA 5IJDC 5DMGC 3HMWH 4JFOB 4XO8A 2W60B 1QSZA 1C5DA 3BD3A 3E38A 2DMHA 5ANMB 3NIGB 4NQEB 2DQIL 1N19A 1XIWA 1Q90A 1Z9OA 4GRLC 4PJEF 4M6ML 3SYCA 1U7JA 4JL1A 2FYNB 2BC4B 2W59A 4AJ0A 1NTKG 5IK3B 5JIDA 2R0LH 3D6GA 5TFSL 2OYKA 2DI9A 3IGAB 2BH0A 2VXQH 1IU1A 4M62L 4NQED 4CC4A 4HAGA 4XI5D 4HK0A 2QJKB 1XAKA 4FXTA 1N5AA 5M95B 4I48B 5AOKA 1MNUL 2QGDA 3KBHE 2QSCL 4L29A 4ZX5A 2MFNA 3U0WL 1WAEA 3CX5K 3GEFA 3H1JD 4TUKL 4EPSA 3BFOA 4BDVA 4AYID 5GRUH 2JI1A 4QAMB 1I7ZA 4XN7A 3MOAL 5B1AB 4OLUH 2GTQA 5I1EL 4PG9A 1ID5I 1EZSA 4HIPA 1FOSE 1KY6A 3CSFA 2X9XA 3UZEA 2NYZA 3K6IA 1HWHB 2J6EL 1I9IH 2NPSB 2ZX8A 3LV3A 4HOWA 3VI3E 2SPZA 5C0EB 2BVYA 1LTBC 1ZR2A 3P69A 1P4LB 1SXZA 2XYBA 5EU6D 2Q20A 1OANA 5E79H 3IMBA 1IJDB 4JRYE 4B5EA 1PFCA 5I23A 2QFPA 4RGNE 3O45A 1SBSL 2AV7B 3KNBA 3MUY1 4WHTB 3CLEL 1LMIA 1HL4A 1NUNB 2W65A 5AW9B 1UB6A 2XUWA 3BKJL 3MBEC 3QHFH 3SGEH 1S9KD 1MJJA 4F8LA 5CP7A 2O5YL 5BRZB 1FZJB 4PJIE 3W0WA 3TNUB 2LTQC 3RX8A 4DK3A 4ZSOE 2GJZB 1K6QH 4S1QL 3MJGX 1TQBC 3P4NB 3L74D 5MENE 2NY6B 3WKML 4J3SA 1VACA 3C2AH 3ESOA 3D25B 2K45A 3UPCA 2G9KA 4ELMB 4PB9H 3JZ7A 2AV1B 3PHQB 4S2SB 4JY6A 4X6DB 3A47A 3JWNC 4F7CB 4XNZB 4MJIB 5B3SB 4JRXD 2DQFB 5GRJH 1QQDA 2Z35A 2H7WA 4OM1L 3B6SB 4LLWB 5AW4B 4U6HB 1R6VA 3P11L 5JUEL 2R0WH 5C97A 2WWMC 2ERJB 5C08D 4B9JA 4FABL 2OYIB 3DIFA 4PJHF 5ICYA 5GHWH 4LHUB 2LLGA 4KV5E 43CAB 5G4MA 3G71P 4P99A 4WO4A 3L72E 3AT0A 4QYOA 1YNLL 4GKNB 4Y5XB 4Z7OF 1SQQK 4MCYB 4W9IC 3FX0A 2A7BA 2CBPA 3QEQB 2WTRB 3MBWA 4MAZA 4NBZB 4Q6KA 2XN9D 1SQBJ 5EPMB 4KX8A 4BRJA 4U0QB 2AJSH 1P69B 5E9NA 3BD5A 2AXGB 3DV6B 1AHWC 2CGRH 1FJKA 4XN9A 5HHXL 4LPCA 2A06E 1H8NA 1QAWA 1SYSB 2AVFA 1E3FA 1U42A 3W5MA 1PGPA 2XXFA 4BKTC 5C2BL 4YHOH 2DQCL 3QHZH 1BZQK 3QWRD 3R06A 4QXGL 1ZHLA 4F58L 4G7YL 3CC5A 1FFRA 2W65B 2MKVA 3GZPA 2J72A 1F00I 2OMNA 4PJ9B 4YGVA 2DJ4A 2WAQA 3FBQA 1IC2A 3IFLH 3L16A 5DFTA 1A6AB 3TEWA 2V5TA 5FLVA 3U9WA 4GSXA 2B1HL 1PKQA 1HZLA 3VXNA 4KK6C 2XG5A 2OKMA 3MRKB 3V10A 4PJGB 4KXAA 1O9VA 4UQBA 4HBQA 4ZFZB 4NOFA 2R5BA 1BIIA 1KCRH 3EFDL 3U0PA 3L5IA 4FS0A 3BT2H 3ILQD 1XTLA 3ARWA 5ANMA 3IKKA 4PJBE 1L3NA 4BIKA 2EVIA 1D2PA 2YN5A 2V7HA 5DS8A 1C1EL 3PIQA 3HEIB 1JK8B 3KPPA 2OZ4L 1ZTXH 5D9SB 1OL0A 1KNOB 3QG7L 5HHPB 1KTCA 3M6DA 4ZNCA 2QGBA 2HB0A 5CINL 2W6AA 1NOLA 3FZUC 1LWUC 2NNXA 3FH8A 3GLMA 1P5UA 3IRZA 4C56E 3GXDA 2ZYIA 4LCCA 3EYUH 4LVOB 3IAGC 2CHWA 1V27A 4HPYH 5BMFH 4M03A 4MQ7A 3JBG7 5ABAA 2BEZF 1KPRB 4OU3A 2YUZA 5M1BA 1W5CE 2Y1VA 2V9TA 2WTRA 3MBWB 5EZLA 2PETA 2QV4A 5FWRA 5TTRA 3CCVP 2KT6A 1C12B 3BUQA 2WVRA 1SHMA 4PGCA 2QE7H 1F58L 1OF2B 2JSFA 2W9EH 4YPGB 4HKBA 2BP3A 2HR3A 3AWGA 5B3JE 4IRZH 5AVRB 3JV4B 2HKHL 3INUL 4QRQB 4XNYH 3ETBF 1PEWA 4QCIB 2K9YA 1AGFB 2FRGP 1U7MA 2W80C 3ZGIA 4DK6A 5D93B 5A2JH 4HLZG 4RVBA 3SN6N 4LFHD 4I1NB 2GCYA 2ZAHA 3DV4A 1PLAA 5CCJA 1PZBA 1WIUA 4D94A 4ZFGH 1I9RH 1QTSA 1T7WA 4ZUUB 3HS8A 4YSTA 3JTSA 4PWGA 1S9KC 1FVCA 1UXWB 4MLSA 3FUKA 2LAGB 4FYSA 3NQKA 4GO9A 4GUCA 3BP5B 2EKJA 3DIDA 5E5UB 1TG8A 3SDAA 3VXRB 3NAAL 5JDSB 3GUTA 4BCXA 4ZDHB 3TNMA 5JZ7C 3QGVA 3U59A 1EAJA 5C0RL 2R4RH 3QISA 1MY7A 4Z8FL 5TE6H 4TLTA 2YAHA 1MDTA 5DVLA 3V0VB 2GI0A 1DBBL 1HJBA 1FLTX 1B90A 5E4AA 4QY8A 4RGND 2OL3A 3JSVC 5KJ7D 5L4JA 1J5HA 2PCFB 1L9OA 5E00B 1ZLEA 4FQ1H 4NZ8A 3QRGH 1B0GB 2Z34A 4FZ8H 3O9WA 1SBBA 3VGGA 3HPJB 2ZP9A 1R5LA 4PJDB 2I32A 2GHZA 3L7FB 2WIMA 3T8VA 1E42A 4FXKB 32C2B 2Q3ZA 4U1MA 1KXVC 5KAQF 3AAZA 4JZJA 4P4KD 3D18B 1U95A 3E1ZA 4WI9A 2FL5B 3IE4A 5AAMA 1VZGA 2F61A 5LGJA 2FXMA 1VLXA 3CX5E 1NBZB 1PSKH 3BRFA 2APSA 1JJUA 1HXMB 1VHPA 4ZXBD 1LJ2A 1JGUH 1COBA 1JZGA 2AQ3A 3A0BH 2PWEA 5JW5B 3TBTB 2FBWC 3QDAA 2BSED 4U1JB 3M46A 4IGBD 1DLHA 3HG5A 4PJCB 3SCMA 2KNCB 1MFDH 3D33A 4JFVA 4CVXA 2EVGA 2HVJA 1GL2D 1BOGA 1DVXA 1H0DA 1RHHB 2WZ7A 2DIJA 5A16B 3US1A 1B0WA 4MXQD 1TJIH 1OOAA 2MOQA 3SDXE 4X8XA 4YDZA 3CFEA 4L3CA 4HMEA 1EJFA 1FO0A 4OKDA 2MRYA 4ALAL 4DGWC 1AIZA 4RMUA 1DQVA 4GKSA 3LIEA 4MDJA 5CBEA 3VXRA 3LKSB 2JIXA 3L4WA 1Z5LB 3ASWA 3L08A 1KPVA 1E8ZA 1MWAA 2Q5UA 1R75A 3RX5A 1Q9OB 1M90Q 2EDLA 2IALB 2YC1B 2K70A 3MRLB 4DN3L 4HJSA 1BOYA 3CLEH 3O45B 3VI3A 3ZL1A 3T3PF 2EYRB 2N59A 4TVUA 4DTGL 4O02H 5L8LB 2ZXWB 2NDFA 2C34A 4WJ5A 4KZEH 1HEZA 1HEJC 4LCCC 3A67L 4KX7A 3NCXA 4KXZI 4P3CL 2ZCLL 4IFFA 5E56A 1P6WA 1N67A 1F11A 5JQ6H 2VDOH 2AXTE 1ZS8A 4MJJA 4PREA 1P6AB 1YA5A 5C8JB 1NC2A 3GBML 1SXAA 3GSQB 5FO7A 3TA3A 2VJ8A 5DD1L 2PR4H 2C9QA 5GGQL 3TJPA 4ABUA 4JDZB 3C8KB 2VIRA 5IEHB 2W83C 3IFPB 2E9WA 2WT7B 2YJQA 1I8IB 4QOKE 4OCYH 5FUZH 3PGDA 4UMSA 3P11H 3U2JA 3RAJL 3BN9C 3L3OC 1ASPA 2IV8A 2P26A 1QNZH 3D39E 4YDJA 1E5UI 2AGJH 2F7IA 1F1AA 4WY7H 4OLVL 4LQ1A 4EI2A 5TDNB 1T21A 4W9HC 4POUB 3OKLA 4JRWA 3AXIA 2DWEA 4UOJA 3FPXA 3MYJB 5LNGA 1WD8A 4L3ED 2J5UA 1NL0L 3TBBA 3QPXL 1IAOA 5IP4A 1QLFB 1S3RA 2VQ1A 1P1ZA 1I82A 2G9HA 5LG6A 2CPBA 4NM4L 1S9VB 5E2TL 1BCCJ 3L6FA 4RAHA 3BDXA 4AJVA 1BVKA 1J1OH 1CXFA 3JUZA 1YNTB 4AEIH 1RUKL 2EKSA 5IW6B 4BZYA 5AVQB 4NBYB 2GM4A 4PJ9A 2KZIA 4LVHC 1BSHA 1Q1JH 4PRID 4XN5A 3VXMB 2W9DH 3WFHA 1J2JB 4G80A 1T1XB 4PRPB 1L6ZA 3E7KA 2YNYA 4ASVA 5TGBA 3QRBA 5T1KA 4BXVA 1W6LA 1RSYA 4H0HB 3CXHK 1T22B 3I9AA 5G5DB 3A0OA 5B1CA 3NIDE 1LE9B 2FECL 4PRIB 4XVOA 4E9YA 1EDIA 1MIMH 4X0KB 5KBPA 2GW5A 1LT9C 1DBML 3RL1A 5IWLA 4JBSA 5DD5L 3RPIA 4KK5D 4ONOA 3QCUH 4I8DA 4DP4X 1KELL 2C9UA 5JPNB 4PJXE 4G59C 1RFDH 3CWBE 1UB5B 3IEAA 4KQ3H 8FABA 1BYOA 4MXVE 1P7KB 1X5XA 4O2CB 2C7UB 8PAZA 5JMRA 3GM8A 1AXIB 1FZCB 1A6TB 4AEHL 5HI5C 1L2PA 5IKCB 2Q3IA 2CDEA 1Z56A 3A7OA 1OIOA 1BFTA 1L9PA 2A6DB 2B5IB 4AIZA 4HOMA 3PXHA 4IYKA 5FB8A 1L9TA 5AOJA 5FHAH 4EO5A 5C9KA 2R8SL 3QUZC 3RI5K 2Y2TA 2VLJA 4PP2A 5C92A 3SOTA 5E1IA 1KXVA 4CN6A 2GK0A 1TENA 1KGYE 1IC4L 5D7IB 1F4WH 4AVIA 5I74B 1CQKA 2P5EE 1JYVA 4X5WB 1MVFA 1A8ZA 1CTMA 1MV8A 1XAUA 2QZQA 4I3GA 4LBEB 5E8PB 5G2NA 3UCQA 3VFPB 3X3GL 1MFBL 1QRND 2ADJA 3I85A 1CXKA 4KRPC 2ZUWA 4LOEA 4JEGB 3SKJL 1NIEA 1KJ2H 1G5GA 2Z92A 3RGVB 3F58H 1AXSA 4H88L 3PP4L 4HF5L 4UDTA 3GBDA 4TRPL 2MQ3A 1EZVI 3PL6C 3VWKB 2WLMA 1MJUL 3M1OA 4PJHA 4K3HA 5KYWA 4Y4KB 3M7OA 1M1XB 1Q9OA 3MA9L 4MNHB 1NAMH 2GBVA 4NQSB 1CF1A 4XP5L 5C71A 5PCYA 4JDTL 1QTPA 1VQNP 4WSJA 5HGBA 1CFQA 1R47A 1RP9A 5JDSA 3WFCH 1WD9A 5FDWA 1KT2A 4U3SA 3CZSA 4PGDA 3MGTA 4Q4EA 5F89A 2CO4A 1QSEB 1S9KE 1YY8A 2YJLA 2YMKA 1XMWA 2DS4A 2I9TA 1DBAH 1L4AD 4XTRC 4BWWA 4G2AA 1X7TA 1B2WH 2F0CA 3GSQA 3JVGA 5TK2A 5E00A 1IT9H 4IK6A 3NXSA 2B4CL 1NC4B 4IBWA 1N2RB 2CAKA 4NQDD 1KYOH 2A6DA 3UC0H 3DUUA 1XGYL 3EDEA 4H0LB 3SJVE 1Y1DA 3WY1A 2YPLD 4Q89A 1F0LA 1YN7A 2CIKB 3B7TA 4LIQH 2OYPA 3WGVB 1FAIH 4HJGB 4GXUM 3QIWD 2XKNA 4MD0A 3AAZB 4JZJB 3KLHD 1MQKH 2LVEA 4MZ3A 4EUPB 4K5LA 5FCUH 3ZT5A 5T1JA 2YLKA 3BAIA 3GW6A 4LLQA 4WWKA 4XPBH 4Z7NB 2ZOKB 5JO5B 3ZOAA 3VFPA 1FVDA 4HWBH 5CD5C 3HG1A 3UP1A 5DVOA 1KENL 3FQYA 5JPMC 2Z8RA 4PJFA 3BPOB 3HG1E 1HHGA 2G4EA 4R4BA 4Z7UE 4G9DB 4BZ2L 4XGZB 2UZXB 2DWEB 2YOAA 4XO4A 2JB6A 1BD2E 1RK0B 2I27N 1KC8Q 3FH7A 4EI5A 5CZKA 1OSPL 3PCYA 3TFKC 2QMJA 1AP2B 4DEUA 1KBKA 1HHIB 2RGSA 3M1CA 4ZTOH 1QSED 1UADC 1SY6L 5IY5B 1URQD 2XU6A 1MCJA 1UQSB 3NEEA 2VL5A 5JA8B 3MROB 4IJTA 1LGHB 5B1JC 3ULVE 4L1BA 3TV3H 2Y6SC 4Z76B 4HLEA 3CN3A 1IKFH 5CJOH 3WENA 3TFKD 1YEHH 5K39B 5C0AB 4XB3A 3BQVA 3EGSB 1S9WA 3TN0C 1DHKA 1AD0B 5HYSG 3P9MB 1JMZA 4AGNA 5EC2B 4XFJA 2D3VA 4Y5XA 2MMXA 2XY1A 2DQTL 2FB4H 3K2IA 1J5DA 2CKBH 4JJHA 3VFRA 2Y07H 2QSVA 3W2DL 3T4AA 5BS0A 1OP5H 4JHAL 1L7TH 1LL1A 2DQHL 2EDJA 4E9LA 2J59M 4KROB 1IJNA 4O2CA 2OMWB 1Y9BA 1NC2B 3IJSB 3QZOA 4GW4A 1EAPA 1JZ2A 1G1CA 4DOJA 4HXBL 1T0PB 3TJHD 1BYPA 1IILE 3C60A 3IN6A 1TJMA 4D9QE 1KN2H 4AQEA 2KI7B 2J6EH 1OGPA 5FUZL 3H1IG 2OMUA 4F8OA 5IUSA 5EIIA 3AE6C 3VYPA 1YQVL 2A4CA 3EOTH 4YZFF 2JWDA 1A6AA 3A5VA 2AZAA 4FKEA 4JHWL 1A3QA 5L4IA 5B3NA 5JORB 2VLKA 3II2A 1EEQA 2UY6B 4K3DH 2VE6B 1EDLA 4ODWB 4U6TA 4YTPC 5IHUH 1FGNH 4QTFA 3SDCC 1VQMP 2Q7NA 5E0FA 4Z7QF 5C6WH 4J12A 3QDMD 3VXOA 4X9BA 1JV5A 1U93B 1IAIL 3Q8BA 2F54D 3ECBB 3TO2A 3LAFA 5IHLB 4L4VB 1R4XA 1RK1B 1T7VA 3QWOA 2E74B 3Q2LA 3KYMB 3PWJB 4P9HC 1QWUA 5SWZB 3VFMB 1JGVH 3TTSA 4LPUA 2X2IA 4PRBA 1WT6A 4NM4H 3N43B 3L3HA 1BXUA 3WG7B 1WS7A 2OTLP 2F54B 4XXDB 3BO8B 3RA7L 2BCCG 4GQ9L 3ZTNL 1OIPA 3BUPA 3PJSB 3H1IJ 3ARQA 3FQNA 4RISH 1O7VA 1T1ZA 3BHBB 4ESKA 1CT8A 1WRFA 1XGZA 5H2FE 3FONB 4TUUA 4OVUA 1VGKA 1XTCC 4ILDA 1SQXE 4QHKJ 2N7BA 1QFWI 1P4UA 3B3BA 3LHPH 3GKWL 2VZOA 2ICES 1OT2A 3EG9A 4CDGC 1NCTA 1W80A 1HAWA 1OLZA 2GBTA 3EHBC 2NRDA 1JNLH 4P23A 3DUSB 1N0XH 1F2QA 3GF3A 1GS7A 2F15A 3HCVB 3L3JB 3M88A 2IBZG 4FCAA 4ODTL 5E2UL 3UTTB 4FXKC 1LDPH 4QCIA 4FERA 5AOZA 2F6AA 1F02I 3RPIB 4XN8A 2FY8A 1S7VA 4N4YB 1AFOA 2Z7WA 4ZS6C 3B4SA 1RFDL 5DLLA 1V7NH 5EIQA 1YPZF 2QFRA 3O2VH 4X80H 1JY3P 1JZFA 1XD1A 3QNZB 1MFCL 1S5LH 3CCQP 3DMMC 4JYCA 4E5XA 3L74E 1A7QH 5MEND 1TQTA 5IQ9B 1Q2NA 5B22A 2CDEB 5L9DH 3CC5B 3IDMB 2CH8A 3WFBL 5D1XA 2VE6A 1LEIA 5G55A 2A45I 4BH7B 2CLRA 4HJ0D 1NANI 5BZWB 1ET7A 5CHXA 2D03H 2YKOA 2W81C 1CL7I 3GHPA 2F1AA 1Y1UA 1U3ZA 1ZLDA 2YRZA 3CZKA 3GLZA 4R4BB 5GGVY 4AXWA 1MLBB 1EFXB 2HFEB 2LU5A 1Z32X 3T0EE 3Q2YA 1OD7A 3AU1A 3TBWB 1E28B 4ZZKA 2ZXCA 2DQGL 5FDYA 1FZEA 1RHZB 2ZKWA 3P4MB 3M06A 1CUOA 3H9SB 4LLUA 4UUJA 5C0CD 1JRHL 3ARBC 1SQVK 2V33A 5EOCL 5IT2L 2B1AH 1XT5A 4TQEL 3MRJA 5D1ZI 4HAKA 1G0DA 5GRJL 4NN7B 1EGJL 1G4MA 4MKMA 3WUVA 2R23A 3IMWA 4GP5B 4MA8L 4OJCA 4HDIB 1FNSH 4C4KO 5F7FA 3UGEA 3H32B 2XZQH 5I1GH 4FABH 3IAPA 3KCPB 4JM2D 3P2BA 4F2FA 4M5ZL 1A0QL 5I1HL 2X38A 1VQ4P 3K2UL 4JDTH 3P9MA 3G6AB 2ZCZA 1RUPH 3S37H 5JW4N 4K55A 4Z0XB 3B5NB 2O93L 5DJTB 1JGDA 2FAUA 1MJ8L 4J3BA 2ARJQ 3G9RA 3RL2B 2NW2B 4TQHA 4HWUA 2ENYA 1G7QB 3PV6B 4LEEA 4NPDA 1HGVA 3S34L 3KPLA 5C2BH 2CKBB 2DQCH 5CFHA 2VGLM 1INQA 3AFLA 3AWEA 4KMTH 1PFIA 4U33A 5D1ZD 4F15B 3EFFK 5DEJA 4PGBA 4HLZH 4ELME 2HCZX 2BVQA 2VXTL 1P7HL 1JXDA 5LAXA 4OV6F 4RCAA 3EBIA 3H1JE 3HN5A 2NT1A 5ID1A 4TT3H 1S7RA 4OZHE 4CN4A 1F4YL 2E3VA 1S3KL 2E9BA 4NFBA 1ZEAH 5IG7B 5IBUB 3H0TA 4JKNA 4B97A 4OD2A 3MUDA 4LLQB 4IGBA 5D72L 4I5BA 3KDMB 2EVFA 3E9TA 1N9PA 2G3XA 3MR9A 4HW6A 4NBXB 4WY4D 1N68A 2NQCA 5LXGL 1W8NA 4N2LA 5CWSB 3QRFM 3VVWA 4NP4L 3GINA 3MRIB 2R1XA 4YHZH 3EFGA 4EIZC 3D85D 2V0AA 5MERB 4HS6A 3CFCL 2CMRL 3BCDA 3BH9B 1DQTA 1YC7A 2R5DA 3EBAA 3IU3B 4U1KB 5TQ2L 3MRKA 1O0VA 2IQAA 4NC0B 4FYQA 1CLOL 2WMMA 5D1QD 3EYQD 2BWIA 4HJGH 3WTSA 1EZVY 1U92B 2ERJC 2WAHA 5EZJA 4UT7L 1MCOH 4MQTB 1JDDA 3I5CA 5HHNA 4AK2A 3GMLA 2LQRA 1TCRA 3BP7B 2Z4QB 4P46C 3SDDA 1NBCA 1OO2A 1PCSA 2XN9E 5DS8B 2R3SA 2XVKA 3RK2B 1TIUA 4OZFG 1TQVA 4GG8A 4BCZA 2P5PA 2ZG3A 2WSSH 1AVYA 4YXWH 1I1AA 1LT9B 4C7NA 4Z7IA 3EHBD 5AENA 3TONA 4LCYB 4P2YA 2VL4A 4KK8D 4EXKA 4M6MH 2EDBA 1RE3C 3UTOA 1Z0NA 1AD0A 3CSBA 2XOTA 2WB7A 3ARDD 3OB8A 1HDMB 4OZIF 3U30C 4W6XB 3R19A 4Y4HB 1QUNA 1SJXA 1QABA 1N4XH 1TLMA 1U8NA 3LH9A 4P2OD 5EZOH 5GZND 5EF0A 3VDBA 1B4JH 1YMHB 1T21B 2D7PA 3ZDWA 4QXUH 2VW7A 1CGXA 5IFHH 5J5EA 3FFDA 2GSGB 4H0GA 4OAWA 3QYCA 1CGTA 1E6JH 4KMLB 2DBLH 4Q14A 1N7SC 3AE4C 1YJNP 4FLHA 4UNUA 5IHZB 3ZTCC 5HVHC 2EQDA 4N3TA 1UC6A 2WWKO 1HOCA 12E8H 1FZKB 1IAIM 2OL3H 4G6KH 5HI5D 3WMQA 5JA9A 3FHAA 1JTTA 4KZ0A 1XGPA 3O6KL 5E6RB 4YXKH 3M0AA 2J5LB 5H35B 1JNMA 3MR9B 4F5CE 4G8IA 2GTZA 2UZYB 3BZFA 4IBQA 5AOMA 3SYOA 4DUVA 3WNIA 5IBTH 4Q2ZB 3V6OC 3MUUA 3WGUB 3MO1B 5FA3B 3UGXA 1EFXA 4K3DL 4BHUI 2JO1A 3QIWA 3OXRA 3BVWA 3KPSE 2P46B 5I73B 1CC3A 4FQXC 5I2IB 2WSDA 1FFTB 4R5VA 4H0LD 1SFCD 1FG2A 1DFBH 3QORD 5HXMA 2O5YH 3H2WA 2E74D 5C70A 3L5HA 2ATAA 3K91A 1W9XA 1L6PA 4X50A 3ZL2A 3RZCA 3O0LA 4ADJA 4LCIL 4O00A 1SMOA 4AQ1B 4DT2A 3L3DA 4AT6B 1CTNA 1X44A 2V8MA 2I60L 4HZLB 3FB7A 5C0CA 5TISE 4L2LA 4JM4H 2VZ3A 3SGKC 4RWYL 1LTIC 15C8H 4XVUD 3D34A 3B9DA 1OP3K 2W07B 1VPCA 2BSRB 3MC0A 4P9ML 1MXGA 3D09A 2NCEA 3N2JA 1ODAA 2FWOB 4YXDC 5JUEH 4P59H 4RAUA 1XGQA 3U6XS 1T5XB 1EK3A 3ULVC 3Q8CA 4FFYA 4HUNB 5E9DB 2K7PA 4OTXH 3RWJA 3FCUB 4W4OC 3RILA 2YD0A 2E43A 4A6YA 2EAEA 2YS4A 2FX7H 4GINA 3MLRH 5ALCH 2OP4L 4O58H 2LOEA 2VLMD 3QWNA 3T2NH 1G7PA 4OZFH 3C5ZB 3VAEA 1QASA 2CUMA 2GIMA 3F04A 4PJIA 2NDGA 1DD4A 2ADGB 3M07A 3CHQA 3WHE0 1NDGA 1U4FA 4Z5RB 5FYKE 3SBWA 4LP5A 5L9DL 1ZLVK 1I8KB 1P84K 2IDUA 4GI8A 1OALA 2F53D 4QXGH 2EDOA 5I2IA 3KGUA 4ENEC 3HI6L 4TUKH 4ZAKA 3SE3A 3O3AB 1CJYA 1JWSA 2V9UA 1VQ5P 3MGTB 1CICC 5F0PB 1UM5H 2DEWX 2VDPB 1LJMA 3NRPA 1GK4A 4U1KA 4UQEA 3VB8A 2Q2LA 4FFZL 3P3RA 4RNRB 3SE8H 1MIML 5EUOB 2B1AL 5HY9A 2GSMB 4PLKD 2H1PH 1ZA6A 4JZNA 2AJVH 5KSVA 4FA8A 4JPSA 5J1SC 2EXYC 5APSA 4GBXD 4LSVH 4L23A 5D7JA 5GIRA 2RALA 4XCFH 1GZQB 1L7IL 1AQDA 3T2OA 4PV1D 3RAJH 3OKDB 4JCMA 5KAFH 4ZPVA 5LGKA 4HEME 4X4YB 1XH2A 2ZYRA 4A6YL 3MCYA 3NPZB 4ZFOL 1IBDA 5B8CC 2P24A 3F6JA 3SWYA 1C16A 5EEVA 4YDKL 4CMHC 4JFDE 4A37A 1XF5B 4ZUWB 5IQMA 1VKXB 4D7PA 3HG2A 4CSZA 1HHGB 3CZFA 3INOA 3C09B 1QHOA 4FXGA 4XCCL 4N5UA 4AG4H 1JS4A 2AJSL 4MNGE 2Y9ZA 3DPBB 25C8H 4UB6E 2D4DA 4WUUA 3PJNA 2WBKA 2ITCB 3PNWA 3QUXC 4MDIB 5IHHA 2NNAA 2BWQA 5BZDA 5L7XL 2R3CA 3C6LD 3OG6B 4YFEA 3P77A 4H88H 3EQ2A 3MYJA 4XNYL 5D1QA 4R3SB 1D5ZA 5CO1A 1JCKA 4QNPE 2R0WL 2F74B 1U8PB 2E7HA 3MBXL 2XWDA 1KB5B 4JJOA 2EIDA 2VR8A 2BEQD 4LSTL 4CC1A 5CZVL 4MAUL 1J0KA 1JWSB 4X9FA 4YHNB 4N90E 1Q82Q 3ET9F 3UTTD 4XP5H 2BY0A 3KR3L 1BJMA 1HSBA 1NZRA 2CUIA 5IFJA 5I1CL 2DYPA 2X6MA 2I85A 1I3GH 5LXVA 1SP4A 3CJJA 1LD9B 1YJ9P 3DXAD 1FZOB 4P07A 3VU2A 2ITEA 1ACZA 3QNXB 3WNLA 3FQ2A 5M7QA 4HGMA 2KUBA 3H1JJ 1V10A 5GGSB 1QFHA 2BK8A 5J1AA 4E41A 1HYSD 1L6XA 2EVHA 3HE6B 4AEHH 4X6CE 1HFUA 1C1EH 3MUGB 4X7TA 4AQ1A 3DVIA 3TCTA 3LIZH 5IGXH 4HCIA 4OZGB 1JDAA 3FU5A 1LLAA 3APFA 2P24B 2DYPD 2X4RB 1RE3A 1HWGB 1HESA 1WHOA 2H3NB 2NY1B 5H2BA 2P5ED 3EHBB 3OAZH 2B1HH 3MJWA 5F0JB 1WUNT 4FLSA 1JRHI 3A2AA 3QJFA 3P2DA 2FJHA 3CVHH 3EJUA 4Y16C 3T0AA 3N42F 1C12A 3DBXA 3KM2A 3H53A 4YHKH 2H3XC 1AQKH 3S2CA 3M9HA 2MCAA 2YGVA 3VXPA 4CN1A 5EEXA 4MB4A 3DMMB 1AA0A 1B3IA 2Y7QB 3NH7H 5EA0H 3JV0A 2F68X 4U3XA 4XHJD 5F1KC 3KWTA 2DBLL 2LHAA 5I1KL 4QHNA 1UGNA 4NQDA 1SQQD 3RGUA 1FBIH 3W9DB 1YRKA 1OCZB 1ZP0C 3M91A 5TF1L 4KKPA 2EC8A 4OZGF 5APTA 2UYLA 2JDIH 3RK3B 3OPUA 2Q6WA 3IVKA 3FXDA 5DRZB 3TURA 1MCPL 1KGIA 1XB6A 2PP8A 3AE7C 3F7YA 1UWGH 4QI3A 1KGCD 3BP5A 4KJPC 2VDKB 3BN9D 4IJ3C 4K94L 2NX5B 3CFBA 1TSHA 3D07A 2WWKT 1PTZA 3EDKA 3VRJA 2Q76A 4AJYV 6PAZA 5I1AB 5GS0C 3WE6B 2ORBH 2OXHA 1XH3A 4X9HA 1FDIA 4TL5A 3CMOL 3WU2H 2LXCB 5KW9H 3BMWA 3UADA 2ZWSA 2WQVA 5EFWB 1K9TA 3CMGA 3IDJB 1OCOB 2XHNA 4R7NA 3CX5H 3U36B 3KXDA 3BLKA 4NCC2 4CKVX 1U8OA 1UVQB 4DJMA 2NXZB 1HIML 4NZFA 2X4TA 2X70B 5GRVK 3B34A 3S2AA 2E59A 3ITKA 4JM2C 1X22A 4LSQH 4WI5A 3V4PB 4ZNEA 2JJSA 4LNRA 1PLBA 1SY6A 2E5YA 3GMMA 4N28A 3T3PE 4O02B 4QKTA 2H6UA 4JKLA 4JANA 1AO7D 3IFOA 3P3UA 1SDDA 4MQ7B 1DSWA 15C8L 1ZHNB 4NZDA 4AQAB 1J1DB 5HGDB 2HT2D 4CNIA 4ERSH 4JG0L 1K5NA 5HDBF 2G75B 1OE1A 5HHQA 4OGQD 3LS5H 4NWUH 2P7TB 1UYWH 3O81A 4XOCA 4M8VA 5APVA 1UA6H 1HXYB 1ZSDA 3A21A 4PJ0E 3GTNA 4TMPA 5FEBA 3VM5A 3RDTD 3KBPA 4CVXB 3LIUA 2L7QA 5FYLD 1AKPA 3ILPB 5DEGA 3DHUA 1CGWA 1UWXK 2O6DA 3RWDB 1WWWX 2SEBB 4YO0B 1J5CA 2ED7A 2JKWA 5B4MD 1BZEA 4LVEA 1TPXC 1IBBA 2CE6A 3JXAA 3VXUA 1OF0A 1P4BL 1MDAA 4WLCA 2VDML 3U7YL 2NXYC 1FNFA 4ODXA 1AQHA 4ZXBC 2GJPA 2ZXAA 5I0VA 5DZNA 4Z77A 5CNHA 3KLKA 4AC2A 1TT6A 3A6CL 3EAKA 1TQSA 2UY7A 3GHBL 3AE2C 2V37A 3L1GA 4X98B 2NUTB 3F85A 4G6JH 4NFDA 1MIEL 2I7SA 2A6JB 4M1GL 2PPCA 1OAQL 3MLWL 3TT1H 3NOIA 3S88H 3QSKB 4G5ZH 4IS6A 3IDJA 4KUZH 2H45A 5FV2A 2ZWZA 1U8LB 4WW2F 2FKWB 1A6PA 4K8RH 5F2FA 3U4BH 4ODVH 3PYCA 2BWDA 5D7SH 3NCFB 3ZE1B 1D6EB 3C9NA 3IMTA 3TEXA 5EC2A 3RFRA 1ZGLP 2OTKE 1R3HB 3GDCA 5F1NA 5E2UH 1A4JA 1Z9MA 3RUGF 1YPZE 2FR4A 5I0WA 3CPUA 1I7RA 1ZA6B 4JZNB 1N5YL 2KLTA 3C8KA 2EZ0C 5HJGA 1RULH 3P8CD 5KLVJ 2DQ6A 3QI9A 3HZVA 3QJTB 3LVTA 4JFYB 1T6VN 1EZVD 3F62A 1OGAD 3BPOC 3KXFA 4ZO9A 5E8OB 2YBGA 4Z7WA 4XE0A 4YE4L 4F2MA 4QTIH 3O6QA 2VRQA 5I1JH 5ANME 3T65A 4PB0H 1FGNL 4W1TA 3HS9A 4K7FA 4Z18A 2X4UB 3ARDC 3AE1C 4G82A 2AV7A 4S1RL 4XNQA 4XVSL 1AS7A 4EYYQ 1LEKA 3MLUL 4UMGA 1GMEA 4FNLL 4YHLH 1IZJA 3JTTB 4WW2B 1RLBA 1CFVH 1MELA 4D7BA 1GGIH 3MLVL 4DPAX 1HTYA 2FIKA 2Z91A 3SDXA 1FZFA 3T2LA 2IVFC 1V55B 3A23A 4I2XA 1KJMB 2QKIA 2C26A 5D1XE 1PL5A 5GGTA 3CFUA 4RMSA 5E1GA 4P2RD 4UB8H 4F24A 5KYXA 3RFZB 3MRJB 2N1TA 4FCHA 4N0UE 3TASA 3TN0B 2Z7YA 5A2LH 3S97C 2Q6WB 3IVKB 2ILLA 2R29A 3CFEB 1WHPA 1OVRA 5HHME 3RBSA 3Q48A 2D73A 3UYOD 4M02A 2GHWB 3ASNB 3OAYH 4L4TD 4P4RA 1JK9B 4WO4D 4LSUL 1Q1JL 2BVPB 3C5JA 3MBEB 4JFSA 4NUJB 4ZAKC 5CP3H 1GYVA 2HKAA 3BCCD 4F7EB 4ZFOA 2LTQB 3AM8A 4XXDA 4G1EB 4XPHH 3VI3B 2DZEA 4C4KT 2JJWA 3LN5B 1S9XA 1JGDB 1MJ8H 1J1XL 3HS0A 3IWUA 2O3JA 2FR4B 3V7MA 4IRZA 5CZXD 1A6UL 4EN3C 3DROA 4LEXL 4CMMA 2K78A 35C8L 4H25A 1SEQH 2GUVA 4MXWL 4JFYA 4QR7A 2X3BA 2OX5B 4FP8L 3DYPA 3DGGA 3NP4A 1JHTB 1KDJA 4F5CA 1BIHA 1JVLA 1U9KA 3DDFA 3SDYH 3AGWA 3ETSA 6CGTA 3OKNA 4C46A 1YJDL 3Q05A 4N86A 4Z7VF 3T3ME 1FL3B 1FZBA 1GKEA 2H0PA 5EIVA 4FKKA 3SZ6A 1X6LA 3GEWB 4PV9A 3WN5C 3QEGH 3GGWB 3IRPX 4XVUC 3PGDB 3FXEA 3MZTA 2DBJA 2J88L 2V5SA 1P1VA 1EZUA 4HWEL 5D5MA 1WIPA 3WJJA 4MJIE 4OW6A 1OAZL 3ELAT 4XCYB 5IR1A 2XQYG 5DVKA 4AH2B 3L2MA 3ZDYF 4KO6A 4YWGH 5IVZA 4KQ4L 1JCCA 4YC2C 3VOPA 4E36A 3TNUA 3AM8C 1TEYA 1WWBX 3L5XL 4GFXA 5GSRA 5LN4A 3KYOB 1VADB 5E99L 2PTUA 4O5LH 1ZE3C 2OM5A 2G3ZA 2IFFH 3S37X 4Y16D 1D7CA 3G04A 4W9EC 2WKOA 2X1WL 2RQEA 4NUJA 3DDGA 3KAAA 3UTSD 2ICWI 2UYLB 4MNGA 1FL5A 2YGQA 4IL6X 3K6OA 1ZRUA 3V2RA 5KSUA 1IBHA 1Z9PA 5KVEE 4NC2B 2X89D 2OYHC 3N44B 4DGIL 2GABA 4FQHB 1NCGA 5HHOD 3UYPB 4C7NB 1M53A 2LW3A 5I15H 3GSNB 4HUVA 4GKLA 4GT7A 5KVDL 1WBXA 4JMXA 4F8NA 1GOHA 5DJ2B 5LBGA 4ZZFA 2BFVL 1JPSH 3G5XB 1MI5A 1BAGA 2J57A 2ZCHL 2XICA 3NTCL 2FNWA 5DQ9B 3DPDA 1WQVT 3ZDZE 4HC1H 4PJ5A 3IF1A 3U4EB 1MWAL 4UQCA 3F00A 5KOVC 3UJJH 4DVRL 1P7KA 4J3OC 2H9GA 4GKOA 2FZ3B 1PFOA 1PZSA 3VWJD 3JSSA 1GPOL 5IB3A 3V4PA 4M1CC 3NGBB 4XH2B 3PHAA 1X7QA 5BJTB 1FPTL 2J1KA 3P9LB 2Q7YA 4PRDA 1K8IA 1KIRB 2EC9T 2EDEA 2VKWA 3P02A 5EO1B 1SVZA 5DJDB 4UDUA 1SVBA 2K1AA 1E79H 1BX2B 3WIIL 1FUNA 4IMKA 3G3ZA 5JHAA 2R1WB 1FNAA 1L4IA 4XC3H 1CSBA 1DBAL 3SQBA 3VXNB 3CHRA 5C0RH 1E27A 1PLGL 4FQJH 2XWZA 1UOWA 2ZYSA 4L1SA 4CJ0A 4UT7H 5LGHH 2E6QA 2AKRB 4FRWA 2BZDA 2WYHA 4GW5A 4ZMVA 3ZO9A 3GI9H 4P4KB 1DJYA 2Q6QA 5FF6A 1AP2A 2VM4A 3HC4L 5CCHD 2COQA 3VSQA 3IGUA 1SY6H 1EDYA 2GUOB 2JP3A 3FT4A 2EUVA 4WFGD 4QYOB 4D0DA 2V7NB 4QHUB 4H8HA 1IQDA 4Y28J 3RTQA 1DEDA 2UXVA 4RGMC 1HE7A 2G0KA 3DSNA 4ZW3A 1RU9L 5HJDA 3ZO0A 3WDJA 3BPLB 4NAJA 1A2YB 4NQSA 3JC22 2WZ0A 2YQ2A 3C87A 1KQFB 1AANA 3IS1X 1FHNA 2NNRA 1NU1K 1OAQH 3S88L 4ICWA 5DR5H 1AGCB 5I1IL 1YYML 1QFOA 4OLYL 1JGUL 1E6JL 5EV7A 1JHKH 2UX7A 1MJ7H 1TU2B 1DLHB 4OB5H 1EDJA 1IKNA 5BUAA 3AG3B 4WRLA 4NZTH 4G6KL 2ITCA 3FO2A 7CGTA 4JFHD 3UGUA 1KTMA 3CH1B 1WZLA 3HHMA 4XOBA 5F7DB 1HK6A 2CCWA 1KC5L 3A0HH 1JTPA 2YGOA 1NTZE 3IPFA 4EXPX 3N7NA 3P77B 3BDYL 4NKIL 3PQYE 2VMCA 3QEUB 1G0XA 1FGVL 3AT8A 1E8WA 3C5SA 4UTCA 5FKPA 1QFUL 3GJFB 1BVLA 3EYOA 1NICA 1QLEH 2OSXA 4K3JH 5DJ8B 4PBXA 4PJFE 4PWJA 1NH6A 3VFUB 1SXNA 1KLGB 1U8CB 4PJDE 2NY3B 4AX3A 2XU9A 2CK3H 4XNQB 3ULAB 4WUKL 1OWWA 2YR3A 1SUJA 4JQIA 1DVUA 5HYIA 5FYLH 1N8OE 4HPOL 4QRRD 3VXTA 1KXHA 3S5LA 5DFVD 4JHAH 4QRPB 3FUEA 1QI5A 3MO1A 5JR1L 1C08A 2D7QA 2X2JA 3RK2C 2XRAH 4FFVD 3HD7C 2VLRB 4GAAA 2GBUA 2HT4C 3I50L 2GVYA 4AE1A 5FO7B 3LZRA 1U58A 4G5AA 5D4HA 3GBMH 3ARBA 3DGCR 3FB5A 4OCSH 2A5UA 4IKNA 4DGUA 5GGVL 7FABL 1H9DA 4LGPB 4ELKA 3EH1A 5AZEL 4XCFL 1N0LA 4M7ZC 4WTXA 4HGWB 3WS6A 4Z3HA 2XY2A 2A9NH 1XBDA 2JNZA 2A74B 2Y06H 4GB9A 3ZE1E 1OSZA 1PJ9A 3RL0C 1WLHA 2PTVA 1H3WM 5IM7B 3RDTB 3VRLE 5GS0D 5E51A 1A9VA 3ARDA 5IB5A 4EAEA 1M1JC 1DTUA 1OQOA 1GC1H 2CLZB 1Z6JT 1ZGLA 3AREC 2A6KA 3Q5YA 3O3DB 5DJAB 2RMNA 2BRQA 1R3JA 4L5FH 1EIBA 4L8CB 2YK1L 2XFGB 2DW5A 1Q9LB 2NXZC 4GUQA 4OLVH 4KZDL 4J4PA 5KAIE 2AK4A 3CFMA 5A7EA 1SEQL 3FT1A 2H6OA 5ETUA 1AHWA 1BZ8A 1PIXA 2GPZA 1T0NB 1PDKB 2YQGA 3BCFA 4IBTA 2V2TB 4GI9A 1OHQA 3E6HB 3MNZA 5JW4M 3TPKA 2YXRB 5ADOH 2YGNA 3BQUA 5K9QG 1DQLH 1UKSA 3DNKA 4RMQA 5CEXA 3PWUA 3N9GL 5DO2C 5IQNA 4JPWL 3STLA 3VFWA 1RZKL 2HFGL 3LZLA 5L88L 3SD2A 4POYA 3D85A 3NN8A 4HEPA 1M3IA 3NSXA 4NN6C 5JOEA 1XSKA 4Z0BL 4LHUD 5IV2A 1Q38A 3VFOB 1KB5A 4MAUH 3A3YB 4QF1B 2OW7A 1SZNA 4QOKD 2N56A 4G80B 3ZDXE 1FBMA 4F57L 3SFDC 1HN1A 3QQ4A 1OE2A 2VB5A 3CLWA 1WGVA 3F12A 3W67A 3P0YH 4PRPD 1MG2C 4LLAA 4IFDK 2NY6C 3CCUP 4OD1L 4JBZA 3X1GA 4Z3JA 4Y4KD 1D9KA 2DQUL 3MJ9A 2Q86B 1KN7A 1CL7H 1JE6A 2ZSWB 2PABA 4JUTA 4MQXC 5K9QI 1M7IB 4N0CC 4TQEH 1ZT1A 2F8OA 3H42L 4NP4H 1S46A 1ETB1 1HHJA 1W72B 2FO1A 5LO7A 4Z3GA 3D08A 4B60A 4GQZA 1A7QL 3G04B 4RDBA 5C8JA 2K1MA 3QIBD 4QHMB 3DX1A 2BY2A 3Q8AA 5SWSE 3LYRA 5HYJD 5E8DL 5KS9A 3WJMB 5KSVB 3MVSA 3EJTA 4M5ZH 3FFCB 3HE5B 3WMPA 1BWWA 2DQEL 2WBJC 1JB0J 3NZ8A 4HUWA 3O11B 4LARH 4CNIB 2BOCB 2J21A 4NDMB 3WCYA 4FXGC 1EMTH 1QEWB 3QZWB 3DBXB 2KYVA 1ZANH 4M3HA 3F05A 4HV8A 3HCVA 1IK7A 4D6TJ 5DQJA 3FOMB 4DPCX 1HL5A 2GJ6B 2CU9A 4OF7A 2Y0CA 3NQIA 2IFMA 1AZRA 1L4AA 1X9QA 4IOSD 1Z9SA 1EGJA 1W72L 2QT6A 4TSCL 1SM3L 5ISZA 4Y88A 1QBMH 4JPKL 1PZDA 5TF1H 1RHHA 2YMTA 1A0QH 2BVOB 2H32B 3GSXA 3MD0A 1HU8A 5FYJH 5I1HH 4G72B 1VZHA 1VAHA 1A6ZB 2X9ZA 4YLBA 3TSIA 4KVPA 1P4IH 3RNQA 1I3GL 4UZSA 5AOLA 5C0GB 5C3IA 1G6RL 4M7LL 3WE1A 3RJQB 4ZMQA 2DMCA 3OR6A 3GMPA 1EHLH 4JE4B 2X6BA 3TZVB 3GIZH 4KI5E 5I8OL 2WSCJ 2YXQB 4OI7A 1K3ZA 3TA4D 1PLGH 4LSRL 1R3LA 1XGTB 5IFJB 3TCLB 2XPGB 2JTYA 5HHOE 5H2FH 4Y9EA 5AZUA 4FMFA 4HPHA 9PCYA 3KLSA 4PRHD 5FX3A 3GSOB 1IL1A 2WGXA 2R29H 4QUOA 4TLSA 1RZFL 1UJ3B 1MCHA 1KXTA 5CD5D 1UEYA 4JY5L 4OWFA 2YXVA 3GRBA 4MYWB 3QJUB 4WTQA 4Y4FC 5J1AB 3J2PA 1U2HA 2WWMD 4XWGL 3TYGH 4Y19E 1JHLH 1A7OH 3RWHA 4AMWA 2C4FU 3QS3A 3OGCA 2PLTA 2J8OA 2O5ZH 1MQKL 2VDQB 4PS4L 5DEFB 2MIZA 3VD3A 3AQXA 2I60H 4HCRA 3UYRL 3APNA 4WVRA 1IE5A 2YD7A 2WBJA 2Z0UA 3B56A 1KENH 2YKQA 4FTDA 4GAGH 3VYNA 3U1SL 3N1PC 4WW1A 1AMXA 5DFWH 3NFPB 3T09A 3OZ9H 5JIKA 2JLPA 1ZSDB 1GGYA 3QQXA 2WZ5A 4JGNA 4TSAH 1NTZK 1DJXA 3S4SA 2IAMC 4AM0A 2X4SB 4FYTA 1BE3E 5CCKH 3BX7C 2L0DA 3GDBA 1KILE 1NGXA 2BVQB 4JFEB 4KXBA 2OXGA 5KBDA 5CBNA 4OFYD 4ZW8A 4MASA 1IAOB 5CR8A 2VABB 2JTDA 2XWBB 4ICXA 1CR9L 3AEFC 1PZCA 1FZMB 2WXIA 2AERT 2B14A 2FH8A 5I6XB 3GBLA 2QEXP 3FO1B 3O9WC 1N4XL 1DQQA 1ZV5A 2FGWL 3GRWH 1F86A 2NYKA 4IGBB 5C0BD 1JZ6A 4LDOB 3BZ4B 4OGYL 1S9XB 1Z66A 3HS0B 5HGHB 1N6QH 3WNNA 4ZMNA 3RVWC 2QQQA 4L73A 3P4OA 4GW1B 4XBMA 1RURH 4WV1A 4F1SA 4XMZA 1KPUA 2D3LA 3U0PB 2KHAA 2XNAA 2X2UA 1U6AL 1YUKB 1IEBB 1G9NC 5KAFE 4FFWC 5H37A 2FDBP 4Y2DA 1DEEB 3MTRA 4A7TA 2JH2A 1K4DB 3LQZB 4JRFA 3Q2CA 1U58B 2DTSA 3SE8L 3IGKA 4WFEE 1XF1A 2YZ8A 4GT0A 1P0SE 4XVTH 5IEKA 5AYUH 2FJFB 3VVVA 3DOSA 3H1KG 5F0MB 1FL3A 5CBOA 3QDMB 4XPGH 1UVQA 2OMVB 5ERWB 3UTSA 1OGSA 1PZ2A 5DJ6A 3U1QA 5BVPL 2NY5H 1QSFD 4MMYA 5J06A 5JOFA 4UU9B 4BRYA 1HQ4B 3KPOA 1GW6A 4P3DA 4N20A 2JIXD 2WM0A 4F27A 1I8UA 4G7SB 3Q9PA 1YTZI 1OZTG 1G9NH 2B77A 2FWOA 2UY6A 2XT1B 4KBPA 4FQ2H 1XR8B 4PGEB 3WS3A 4CL7A 3L4YA 2X9WA 4YGVB 2DM7A 1ACXA 3QUMH 1P84E 3FOMA 3BEWB 4KH9A 1K4CB 4DKFL 1KG0B 4WY4A 3EYFB 1YI2P 2XZCL 2AEMA 4GYBA 2J1XA 3ECVA 2FX7L 3ZZQA 2OXGB 2WO2B 1GAFL 1RK1A 5HI3D 1PQZA 4W9CC 5I1DA 1YMMA 4DPBX 4E0RB 4JO2L 4ZMZA 2XLLA 5D7HA 1MFNA 3HTLX 1BVOA 5EUOE 4XXWA 1IGJA 3CL3D 3E1F1 5LAPA 1AFVL 1T04B 5AW1B 1NC2D 1TZHA 3KPMA 4I85A 4WHCA 3NIDB 4Y1AA 3H1KJ 3GXNA 3KYNB 4KUZL 1CT8B 4KNSA 1WE5A 4N1EA 5DD3L 4B9CA 1BMWA 1OB1B 4GAYB 3WIHL 2E5EA 2DPKA 4NPYB 1JNHB 2YD1A 1YNKH 1KPUB 5CZVH 3IBEA 3HAEB 1UD5A 2DMKA 2CALA 3CIQA 3O4OC 4QT5B 4DKEL 2E0PA 1UEMA 2UUDK 1J1XH 1ZGLB 4XNMB 4XO3A 4NZRH 2HJLA 3IMVA 2TRYA 1L0LK 3U0TB 2YD9A 3MA7B 3GXFA 4IIQC 2ZYGA 1NTKD 4BXLA 3NRFA 2C4XA 4M00A 4QWWC 5B7EA 4ETQA 1ESOA 5KAIH 3ZMNA 4JM2A 4YBQC 4Y2LA 2KSJA 3UH8A 5AKSA 4BRYB 1HQ4A 1WVZA 4HJJH 5GGTH 3DO3A 5GS0H 1K8DB 4KJPD 1RZJL 2MHAA 5D5MF 3B71A 2ZKHL 4KO9A 5BXFB 4TM9A 4K7PY 4JKPL 1VA9A 2ATPB 1CFVL 4P2QE 3FGAD 1F8TL 1T4KA 2CZNA 1DVTA 2WMPB 3LCYA 3E8VA 2UZIH 4BINA 1P6FA 2ATKA 2NLJA 3OMAB 4IK7A 4PJCE 4WW1B 1MLBA 3L45A 5DUBB 5CLZA 3ZDZB 2BNUB 2VDNB 2RJMA 1XVSA 2BCCE 4KRNA 4M7LT 2BVEA 2X5PA 4MA1B 4YSDA 5DURB 3UMTA 4PCSA 2G5BB 1U8IA 2HJKB 4A6YB 3S8WA 2KPWA 1B0RA 2RR3A 3M86A 1ETZB 3BISA 1GMJA 1AZBA 4ODUA 3DV4B 4GO8A 3TBCA 1FDOA 1SF3A 4XMWA 2J71A 1CYWA 1A4CA 2KQMA 3OX8B 4GAYA 2KIKA 3L3HB 2XN0A 4UV7L 2NZ1A 1LYQA 3EO0B 3HMXL 2CHXA 3S35L 1CIDA 1QBLL 4BUGA 1YEWA 4LQFH 4DUWA 3HN8A 1RERA 5KG9B 2D0FA 3GQFA 4YDVB 3GZOA 3IYLW 5GZOD 5GGRY 4LEXH 4ZMYA 3DTDA 4CVUA 5TISH 5GPRA 2Y2YA 1F3JA 5BO0D 2EIKB 2AS5M 3UFIA 4WEBH 4U6YB 4YLCA 5GS1B 4KH2A 4K3AA 4EIBA 5JHMA 3W37A 1A14L 4KTDL 5EH1A 3FFCE 3N1FC 4LLDB 3FO2B 3GSOA 2AZUA 1V54B 4LAJH 2JJTC 3SWKA 2HYNA 1FZCC 1A7NH 5FYKL 3SDXB 1KFAH 2VXVL 2ZCKH 1RJLB 4OZHA 1UIXA 1HF9A 1IC5L 1RY7B 3GMNB 5ENWB 2JCCF 1L3WA 2Q87A 2O61B 2JKVA 4R84A 1IIIA 2H3NA 3QJZA 4K7PL 1AQDB 2CDGA 2XQBL 1QRNB 3QI9C 4MJ6B 5DJCA 3VGFA 5JHDB 2VXSH 1YC8A 1T2XA 1GPOH 4JR9L 3B5NC 3RWHB 3VXUD 1LP9A 3VMZA 2NUPB