5AW9B

Kinetics by x-ray crystallography: native e2.mgf42-.2k+ crystal for rb+ bound crystals
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
281
structure length
268
Chain Sequence
b'FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 51
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw9B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw9B02
4DZOA 1FAVA 2WPRA 3NMDA 3I5CA 3HE4B 5AW7B 1T2KD 3L35A 2R32A 4GKGA 4AYCA 5AVXB 5AVRB 3VMXA 1A02F 1S9KE 3B8EB 3TK1A 3O8ZA 4RESB 1GU5A 3P8MC 4XE5B 3UIAA 1OXZA 2Z5IA 3MGNA 3A7OA 5AVWB 3M0AA 5AVUB 1S9KD 1HJBA 2P7JA 2VRSA 1G2CB 1NWQA 4AUWA 4LC1A 1FOSF 1H89A 2WPQA 2YO2A 5APTA 5AW1B 1IO4A 2C9LY 1CZQA 3A5TA 1OWAA 3OAKA 2P67A 3V5BA 1JUNA 1CI6B 2WT7B 4GT1A 1H8AA 5AW8B 3MD0A 1DH3A 2Z5HA 5AW6B 1GD2E 2KP8A 3TNUA 3P7KA 4KHXA 4I6MC 3VN0A 3WGVB 3HE5A 2WWWA 5APSA 5APVA 1GK4A 2W6AA 2WTYA 4JYBA 1HUCA 1GU4A 5AVTB 2R5DA 1HWTC 5AW3B 2XU6A 5APQA 2WPSA 1MV8A 5AVZB 2YO3A 2BASA 3VMZA 3NXSA 4JYCA 3SWFA 1A02J 2Q7CA 2QM8A 5AW2B 1MUUA 3KDPB 2YNYA 1GZLA 3VMYA 2Q3IA 2ZXEB 2P2UA 5CMZA 4C7NA 2E42A 3T97A 3TNUB 2N9BA 5AVSB 1CSBA 5AW0B 1JNMA 5APUA 5APYA 2XZRA 3HE4A 3IR9A 5AVQB 3V4QA 1J2JB 2ZFCA 2IPPA 2R5BA 3L36A 3HE5B 4M3LA 4RETB 1KQLA 1MFZA 5AVVB 2W27A 3VTPC 1YYCA 2R3CA 3P32A 1SLQA 1H88A 3A2AA 1T2KC 5AVYB 2C9NY 1SP4A 4C46A 4AQRD 3M0DA 5APWA 5AW9B 3M9HA 5AW4B 4HYTB 2QM7A 4EOTA 1FOSE 4I2LC 2E43A 3LIEA 3LIDA 1HBWA 1GK6A 3KQGA 3M06A 3V4WA 3M9BA 2XV5A 1X8YA 3WGUB 2H7HA 1GTWA 3NFQA 3VYIA 4C7NB 3HTKA 3M91A 1CI6A 5AW5B 2Q5UA 3A3YB 2JJLA 3NTNA 3TYYA 2WT7A 1NAFA 3L37A 5APXA 4B86A
chains in the Genus database with same CATH superfamily
4I3GA 1NMAL 4W4NA 3O6FC 2X6MA 1RUPH 2DTMH 1HI6A 4GXUM 3F12A 1KCVL 1UG9A 3S3BB 3LCYA 2A6IA 5JMOC 3LW5J 1D5BA 5DURB 4YWGH 4R5TA 1TJIL 1EZVY 3IF1A 3QUMB 5IFHL 1NGZA 1VQNP 5E6YA 2QZ5A 1GU5A 5KYXA 1FAIL 2ZYGA 3JVFC 3OL2A 4LEEA 1R0AH 4WW2B 2ERJC 3UCQA 3K5BA 3FHQA 3MBWB 3IGKA 2QVAA 3VXRA 4X99B 2AEFA 1DE4A 3FQXB 2X9ZA 1MJJA 2XWTB 5SWQA 2O5YH 4ZS7L 3IRCA 4HJGB 4LVOC 4NBXB 2NR6D 1M56D 2WLMA 4LNRB 4UIMB 4JM2B 1S7SB 1G7PA 4NJAH 4RVBA 3BZEB 2VSKB 2UZXB 1IGIH 3H1JG 5GSRA 4R7XA 2NTSP 2W0LA 3LX9A 3FQTB 1YN6A 1WHOA 4I3SL 2XG4A 4N90E 1XMWA 1C8QA 3HUJF 3ECVA 1NCDH 1P84E 4ALAH 2VRKA 5GJTL 5CD5C 1E6JL 1CYXA 5I1JH 4JQVA 3VFTA 4F33A 2RR3A 3K6NA 3WTYA 4TSBH 2YXRB 2CLRA 5CN1A 3ASNB 1ZS2A 3L72D 1NGQL 2HVBA 3ZKMC 5IVXF 2VXVH 5JOPD 4AZ8B 2XU6A 4JPIB 4FQLL 5A2CA 3EDKA 2R39A 3C9NA 5I74B 1HXMB 3FH8A 3BAJA 2FB4L 3H0TA 2DQDL 2GSGA 1MUJA 3LKSB 1R24A 4R83A 2HPCB 1XD0A 3JT0A 1SXSA 3E0GA 3WNMA 1CE1L 4LCYB 4PRPD 4R90H 4XB3A 5DTFB 5HGDA 4E0RB 4NM8H 1HFUA 5I1CL 1HGZA 1DBML 1ZKAA 3CHPA 5K9OA 2O93L 4E9WA 3D85B 3DVNA 1JNHA 4H8HA 4A2HA 4AYDC 2WITA 4PIRF 1XTCC 2OMUB 1AQ5A 4DFHA 3RBGA 2HH0L 1T80A 4RZCB 3LEYL 4Z7UE 1QA9A 1S9VA 1BVNP 3BP4B 1KTLB 5JW3H 5HYSA 3NN8A 2AQNA 1IFDA 5E0FA 4X5WB 3ZE0B 4YHOL 1CFMA 3CWBJ 3C6SA 3ETBF 3NJFA 4DKEL 4OZ4B 2OL3B 3PAUA 1UH2A 5TDNB 5IOPA 1XF5B 1PD0A 3D12B 4DCQA 2A74B 3T8XA 1XMEB 2AJUH 3HI6H 4DAGL 5A6MA 2KZKA 4KNUA 1F4XL 1N5YL 1YQ3C 1JF5A 3T3MB 3O3EB 1CFBA 2H7HA 5J4MA 2NX5D 4OD2B 5KVEE 2V3FA 1MCWM 4QXUL 4L4VA 3OLEA 3O6KH 2CRIA 3NCCB 4WO4D 1QPPA 1XR8A 2VLRB 3ROOB 1CGWA 3OPZL 2IEPA 4N2IA 3HNVH 2FBRA 1BQUA 4L0ZA 1V3MA 3O2WH 5DLMH 5EDSA 2WM0A 3GNML 1NTKG 4C4UA 1KLUA 2F8XC 2C1PB 4XNUL 4PY8I 3CLQA 2BM3A 1FZJB 2GI7A 2W1NA 1R19A 4G5AA 4XE5B 1BVKB 1YMMD 4PJGA 2K6WA 3D3VE 3DYMA 5H8DA 4D6TJ 2NY0D 3HPLB 3QEHA 5LN4A 3S35H 4OFYA 1HHKA 2WVVA 2B4CH 1RUQL 3ZN6A 2A0LD 1JJUA 4A38A 2FZ3A 3N91A 1YEJH 3P2DA 2E4TA 5DZVA 4ZXBC 3O6QA 3II6A 3BH8B 3D9AL 5FR3A 4R4FH 2E7DA 3DYPA 4TRPH 4BFFA 1D7MA 1EGJA 2YWZA 5L7XL 2I60H 5EEWA 3QWOC 4X8CA 1JWSB 1QTPA 4K3JH 2GABA 3B37A 3PYCA 4JPVL 2EDYA 5D2NB 1JDAA 3GINA 3DBXA 4QHMB 5DZOA 5BV7B 2Z35B 1KXTB 1TQTA 2CK0H 3P3TA 3EOAB 4PRNB 4ZO7A 4CDHA 5J12B 3CFKB 1CVSC 1OAQL 4JM0A 3IDXH 1CLYH 1GGCH 2VT0A 2QLVB 2RIKA 3ZKNC 1R3IL 3UP6A 4E5XG 5TF1H 1S7TA 4XCFL 3KGSA 3VI3E 2IYOA 3APFA 1TQSA 4FMFA 4LEXH 4N2GA 3RVTC 2ZVOB 2BVTA 3MJ8B 5KLVG 1V3KA 1LTXA 4GH7B 4JYBA 4HAGA 2B2XH 3RWCB 1FO0H 3Q0HA 1XGTB 3ZIMA 1AXSB 2RQEA 3L3OB 4X4YA 3UO1H 5EHFA 5DZPA 4Y16A 1EGJL 1T22A 5C3IA 1EK3A 5EO0B 2P10A 2FNBA 2QM8A 3CXHJ 4HKJA 5EUOE 4HOZA 4G43B 4UB8H 5BUPA 2YD6A 5F1IB 5CP3H 3CN0A 3UOAB 4WFFE 2HG5A 1UXLA 4DH2A 3RTQC 3TNUB 2BY3A 4I2XB 3KXFB 1SY6H 4J4PA 3S34L 1DLFH 3PP4H 4L9DA 4GAYB 2QQKH 3RE0A 1ZSDB 2QJKB 5FYJD 4ZFZA 2YEVB 4S1SH 3GEFA 4N4YB 3AS2A 4IMKA 4LU5H 3VFWA 1TO4A 3U7WL 5HDLA 2OSLB 4OBSA 4KHTH 1V8HA 5ADPL 1IGJB 5JDJA 4GRWE 2B1HH 2UX6A 5L2KA 1WBXA 1BJ1J 4X9YA 2IAMA 2O3JA 4K94H 2ZUSA 2FL5A 4U3FG 5FOBB 1H0DB 1MCOH 2OJEA 4G80B 1JD7A 5GTHH 1X5IA 4OD1H 5FM5O 4ELKA 2GVYA 5AOIA 3H42L 1AXTH 2PWFA 4PJDB 1IGCL 5D1ZA 3V0WH 3PABB 5HJ3B 1U36A 3TBWA 4PGZA 1C7SA 4BK5A 4CW1A 1LE5A 4OCRH 4HUWA 3U4EB 3LDBC 1UA6H 1A14H 1ZTXL 4H26B 4GSRA 5CJ8A 4DVBB 2WW8A 3WSQL 2QADB 2BOCA 2ZYSA 1MFEL 5HYQA 1QFOA 3RL2A 5DJXA 5GZNA 1N9PA 4G7YH 1R5WB 2XC8A 4G8GD 1DJHA 5I30H 4G42B 5AVRB 3MRBB 3QS3A 3WI9A 2ICEB 1U0QA 5IWLC 3GXDA 3RX9A 1KCRH 4D9RE 5CILL 4RIRA 3FS9A 4I1PA 4N68A 1WZLA 3OAYH 4EUPG 4NUJB 3VFMB 4PJIE 3B2VH 3ERXA 4JM2C 3U9UB 3UTPE 4NCC1 4QLRA 5G4MA 1TG8A 3RWGA 1DCLA 1FZFA 3QO0A 5A6IA 1HZHL 4L8SA 1NU1G 4B0MM 5J06A 3OAKA 1KNOA 5GJSH 5ICXA 1KFAL 1JSYA 5L2JB 1FRGL 1ZW0A 3SQOH 1I3RB 4JRXE 2NY1C 2XU9A 4ODXB 2F53D 4G9FB 2YD0A 1UT2A 3QPXL 2JR8A 5IVZA 4OJFL 5EBLB 3MLSL 2WXGA 2IANE 5J6SA 2FYUK 2DLFL 4LDEB 1JN6A 1MLBB 5D1QD 4YFLF 3V7AG 3QXAB 4PD4J 3MC0A 4NOBA 2VL5A 2ZT9B 1YPZE 3F89A 4NQVA 1QLEL 2Z7UA 3D6YA 1EEUA 5EZPA 3T3PB 1CC3A 3WGVB 1KQFB 3F65A 1QRKA 3U1PA 5APSA 1Q9LB 2JO1A 4L1BA 5I6XC 1NGYA 1UM6H 3U4AA 4R7NB 3PCYA 5EFWB 3PQYD 4IEFB 4Q7DA 3QZBA 1IJNA 2J12B 4RX4A 3UBFA 1H8OA 4IGBB 4BIKA 5KANG 3NIFE 3BLPX 4YOKA 1EBAA 4K2UL 4BXSV 3KWTA 1AJ7H 1A02J 3NP4A 3QHFL 5F1OB 3W37A 1BQHB 3S96B 3SJVB 1KILE 3NEEA 4XH2A 2HVKB 3EW3B 5KBMA 3L71D 1MCHA 4ELMA 4OY9A 3TIDA 4CVXA 4HFUL 2VLJA 5GSVA 1NDTA 3L9RA 1VHPA 2XJKA 4TNWK 5DD1L 5K5GB 2YPLB 5DC0A 1EO8H 5GRWA 5E08L 1YC7A 3RX5A 4KT0J 3VXSD 4Z0XB 5MERB 1PGJA 1U8KB 2GTZB 4EI2A 2A74C 1E30A 1RE4A 4Z7IA 2NNRA 3G5WA 1G1IA 1DQJA 2DLEA 4YDZA 3EGDB 3ZTCC 1VACB 3WUWA 4NN6B 3FAXA 5CIPB 4OZFA 2D9CA 3DTDA 4X7DC 3MRNB 3D39E 5CCHD 2NY6D 3A0HH 2OMTB 2C7UB 2MRYA 4XCEB 4GY4A 4X83A 2PW2A 3IBEA 2WKOF 2ADIB 2IMNA 2VDKH 3K80A 4FL4B 4ZO9A 3BOVA 1YEIH 2XZAL 1KIPA 3JV6B 4Z78B 3OHXA 3RWFB 2DI7A 1ZLUH 4FTVB 3LD8B 5ERWA 1YECL 4KC3B 4YDIL 5I66B 4DW2H 4GW5A 3LNEA 1O9ZA 1DDHB 3A6CL 5H37G 5A7BA 2DQFB 2RMZA 4QY8B 4JRYE 4EVNA 1F41A 1JUFA 3A7OA 1BZ7B 1D5MB 4G9DA 2WWMD 1XDTT 4ZG1A 3RL1A 2P5EA 2R1XA 3BP7A 3WIIH 3MO1B 2DEXX 3ROLB 5E4OA 3JUYA 2O1JA 4Y19B 5D2NC 1JUNA 2R9HC 2HMID 1L9TA 4WUUB 5BV7C 1VKXB 1SDDA 4NAMA 4UAOC 4U2YA 5J12C 4NYLA 5IF0A 4Y9BA 1UD4A 3B9EA 1TMCB 4L74A 4UCFA 1IC7H 1FFQA 5CHNA 1EPFA 2AJ3A 1S7XA 3WHE0 4PRHE 4CVUA 4R7DB 3ZL4H 1P7KA 1OOAA 4RA0C 3TWCH 2KUBA 4OGXL 5EIVA 3PXHA 4H13D 1K5NA 4Y99C 4JQIH 3PHQA 1ACXA 1DVYA 1VQPP 3QWRA 4FI6A 4YDMA 1IAMA 3VMOA 3ULUF 3LNFA 4OZHE 5BS0E 4GKNA 1BX2A 1RPKA 5F44A 1MI5A 4IRJB 1C08B 4I77L 5KLVD 2X4SB 3TYFA 2FYZA 5IFJA 1A02N 1I8AA 4L3FA 4N6RB 1OCOB 3O6LL 2BASA 1DJXA 4AQEA 3AEFC 4DP0X 3SKUD 4YLCA 4ASWA 1IKOP 2FEDC 3GGWB 1C5CL 5C08B 1S8DB 4I5BA 4KJWC 2HZHA 1YO4A 4HZLA 1M7DB 1J9SA 1LO0H 2FUQA 2JJTA 3DURA 5KYUA 2QJKC 4AV4A 1MNNA 1NBYB 4GKZA 1XB3A 5IOKA 4NKOA 5D1XB 3V0AC 1OP3H 3ZO0A 4L05A 1TDQA 1LP9E 3NZUA 3TA3B 1OCWH 4HF5H 4L37A 3IR9A 2MHAA 5J6GB 4X7TB 2WVSA 4J3WA 5AALA 1FDLH 2G75A 3F6LA 3A67L 4DESA 3VTPC 3ARFB 3KPQB 2XI9A 5FPIA 5JLZB 1SLQA 2XTJE 4NNYB 1ULVA 2CO6B 3W3BA 4PG2C 5J5EA 4DETA 2E74D 4LVNB 2ESVB 3GLEA 3C5ZB 4I0PC 4R5VA 2H41A 3V4PB 3SYQA 5C9KA 2YXFA 1X5YA 1GW6A 2DQTL 4U3FD 3ZE1B 1ZA3B 4JFDD 4GP8B 3FW6A 1CD1A 2JCCE 1HDMB 3CDFA 1B4TA 1E6OL 1EEYB 3TJEL 2Y4SA 3L70J 4G59C 2NXZB 2W94A 3NFPB 3NIGF 1A1MA 3HUSB 3E6FB 3O3BA 1L9RA 5HJDA 1RK7A 4NC0B 4GLRI 5K59F 3L7EA 5GHWL 1PFOA 1FC2D 3L5IA 3OB8A 1TUPA 4EI5B 4JVWA 5DJZB 4KO6A 4WY4A 3BJ91 3H54A 3EYFA 4WI9A 1JY2O 2IZ0A 3KLQA 4H0HB 4NOFA 2CUAA 3EO9H 4XBGA 5I28A 4JFUA 3KBEA 1EXHA 1QO3B 1JPST 1YQ2A 2FYUE 3PFQA 1BIIB 3BT0A 3US0A 1INQB 2X1OA 3QCTH 4U1KA 5FYKL 4F7TA 2JV6A 4KZEH 3RWDA 4HKZH 1W6WA 4OF8A 5C0CD 5CMAB 1XZWA 1I4FB 3EJRA 5E03A 3FTGA 1RIUL 2ZYHA 4MJIB 2GT9B 3CE1A 2VJXA 4BFNA 2VJ0A 1QZNA 2FK9A 4BA0A 4PWGA 2B14A 3IDMB 5HHME 4PHXA 5T3ZL 3MLZL 2P5PA 4MXVE 4K7PY 5D7JD 3NA9H 4ELMF 2GEEA 1MJUL 1U8JA 1ND0B 2CA4A 2WB1A 3VD5A 2J8UB 1AP2B 1B0WA 1KV4A 3HE6D 4IGBC 4WV1B 5DT1L 1DL7H 4HWEH 1I1YB 5DMGC 3MROB 1ZWIA 3DX8A 3CH1A 1BJMA 3DKHA 2E6PA 3DRTB 4N9GB 2N1TA 4K9EL 3WLWD 4MMZA 1S3KH 3SYPA 3E6HB 1RUML 5CZKA 1LNQA 4PRPE 2IH3A 5DRNB 1G9ML 3LKQB 3O3AB 2ZE0A 1MW3A 1TQBC 4NDMB 2CPSA 4N2HA 4ZBJA 3U0WL 1TLKA 3GB7B 1ES0A 4NIYE 1MELA 5EIQA 5D55A 3BIBX 4P9HC 1QLEB 4U1GB 4Y8DC 5AFAA 3VXRD 1NIDA 3N1PC 4M3HA 2P3YA 1OHQA 2HT2C 5I82A 4H40A 4MS8D 4G6ML 1INDH 2XX1A 3MLWL 3VMPA 1JYXA 5H2FE 2ZUXA 3WEXA 4WO0A 4NN6C 4GMTL 3VO0A 3VXUE 2HT4D 1ITBB 4JQXC 5I18H 4C46A 2F2HA 4XRCB 43C9A 1J7VR 1N2RB 1ZAGA 2VLKA 3QQ4B 3FCSA 1WCBA 4EF3A 5BO0D 2FX7H 4YR6A 2Z1PA 1L9SA 1R5LA 3CQPA 5A16A 3VX0A 5LO7A 2O61B 4JM4L 5D5ME 1E4WL 4FL4C 3QARA 4MB1A 4AJYV 2C7FA 3QUXD 2IBZY 3DV6A 4NGHL 3NJGA 3MYZA 1LGHB 5TDPA 4JBZA 1HX0A 2FFDB 2JJLA 3UGXA 1YYMH 4IIQB 2W9LA 1C5DA 5IB3A 2CR6A 35C8L 3TEUA 3PGDA 1QLRB 3VQMA 3CWBG 3KWXA 2HUHA 4YE0A 1LEIB 1IRAY 3U1CA 4ZODA 3UYPB 3P9LA 2CIIA 4LCUB 3RVVC 2YMTA 3H32B 4HKXB 2VYRE 3KCPB 4I1RA 1A6UH 5JHBA 3WTSA 2C1OA 2BWQA 1NTKK 4MD4A 1BAWA 1WWBX 3CX5D 2RHEA 3BWUC 1R46A 2WQSA 3AXHA 4NZ8A 5TD4A 1PAMA 5JNYA 5T5FH 3U2SB 3BVNB 4EQ2A 3DX1A 4KJQC 3B3BA 5L0QC 4GIAA 5IB1A 1MHHB 3V6ZB 1EBPA 3MCKA 3NCYS 1UASA 1XSKA 4OFKA 4XVSH 1NGPH 2M2DA 1T6WA 1OE2A 3EF4A 1ZJBA 1KJ2A 3WUWG 3KPRB 1EEZA 4NHUA 3UEZA 2IOIA 4Y89A 5TTRA 5J1SC 4UQ2B 4F7MB 1WMKA 1AQKL 3IFNH 4XVOA 4B95C 3P11H 1ORSA 3WOVA 4F1ZA 2XUWA 5B3JF 1JGLL 3K6IA 4M4RA 1VGKA 2WP3T 2BSSB 4GQ9L 3WFDL 1TPXB 3U9PL 1KDJA 3NDYE 5I8EA 1J8SA 1NDMA 5I75B 1TZ8A 2KNCA 2OARA 4NPJA 3S98A 2PCYA 1KD1Q 5KLVK 2HFGL 3NCWA 1BF5A 4M5YH 4PVMA 4K3DL 3UAAA 3N2JA 2B8OT 4XOCA 5D1XC 2CAKA 3ABGA 3TA3C 4CDGC 4OFYD 5HDQH 1LTBC 1KCLA 1UWYA 3DRQB 5C1MB 5CEXB 5I6MA 5GGTL 1XF4A 5CLTA 4X6DA 5E8DL 4J5VA 4CMHB 3ARFC 5JHMA 2WMMA 1HWGB 3WTWA 3B2PA 4ZX5A 2POHA 1ZVHA 2DN7A 2E7MA 3CN1A 1E50A 4FI8A 3VNYA 1LK3H 2BRQA 1UWEH 5KVDE 3BW9A 3RWHA 1CK0L 4NS0A 4GBXB 5CR1A 4KKQA 1NCBL 4MCYB 1TENA 1U3NA 2GW5A 4PS4L 5HYIA 1N10A 2N7AA 1L6PA 2EIJB 4TUJB 1BAGA 5F7HA 2PO6B 2WQAA 4DP1X 1M1JA 5SWSD 1AMXA 2NXZC 4M00A 3PP5A 4XX1G 3ZIYA 1MRFH 3T8MA 3HUSC 1JVKA 4NRXA 2A9NL 3F7RA 3L4WA 4L9LA 5BRQA 3HRZB 1QSED 3O4LE 3U0PB 1A7OL 2BFVH 1HIMH 2PP8A 3MFFA 3CLFL 4JVPA 4EI5C 3HZKA 4PJ5B 5K9JL 2C8NA 2J5UA 2KZWA 5CAYB 4Y16D 3RFZB 5AKTA 3L74E 4MJ6A 1F5WA 3H56A 1A02F 4JJHA 2JB5L 1T1WB 4M8UA 3P1VA 1HYSD 2ADJB 5MENB 3LN9A 4FG0A 4HH9A 4NQDA 4AM0B 1J88A 3ULUD 4N2EA 1WZ1L 4QMEA 1DVFD 2HG5D 2Q86A 2Q10A 1WYJA 4L3EA 4J4PD 2A1WH 2YUWA 4PJBE 1A6WH 2OTWB 5BOJA 3E7KA 1E5BA 5JIDA 4MCNA 3A5TA 1I1AD 1WAAA 4IMKC 3H1JE 2ZJSE 1BQRA 2PTVA 2J71A 2FO4A 3GHGA 3V2QA 2IAMD 4JDTH 4OQ1A 4N2FA 4BUHA 2E6JA 3WUUA 4RMBA 3ZKSD 4J2QA 3TX4A 1NU1K 1NIEA 1AG6A 2C9UA 3EDEA 2AGJH 1UM5H 4N28A 5CP7A 1WRGA 1FBIL 3MJWA 1F3JA 4WV1C 5GZOC 5EU3B 5D1ZD 2CO7A 2P58A 3PQYE 2HKHH 4PWHA 1WRFA 1L9OA 2G4EA 5ICYA 4PJHB 4KK9D 4ABWA 1DD3A 1W6LA 1NMCB 3VI4B 4U0RB 1L2PA 1ZV9A 2GSMB 3FB7B 3K2UH 3ZR6A 4A55A 2QL1A 1J8HE 2E4FA 2X4UA 3OG4B 3MUGB 1K72A 2DICA 2BP3A 1N19A 2WBXA 2X0VA 3AE6C 3C8DA 3NACH 4ODTL 3A47A 5GZND 4YAQB 4MJHA 2BHUA 3OJ2C 1MAMH 2D0GA 3BEWA 1FJ1B 4NNPL 3MV8B 3N1FC 4X9HA 3CFDA 1GYAA 3LPGA 1T2XA 2H2PC 5E6IA 3RVWD 3HG0A 4WEMB 3HVDA 2AXCA 3ORJA 4XGZA 1LDPH 2BVYA 3NZSA 5IQLA 2JI2A 3WKMH 1CT8B 1YAIA 2Y0SA 2FQFA 2WXOA 3FO0L 3K81A 2BVOA 3BHBB 2FGWL 1EHAA 3G9AB 5KANI 4M7LT 1CXIA 3VFSB 1F1DA 2PUQT 1YYCA 4IFFA 1X4YA 2BSRB 5K1VA 4FYSA 4QRPB 1CGVA 3MOAL 4YBQD 2ATKA 3QGVA 1RJZA 3OAUL 4XBEH 4RFNB 4PJ0H 2OSXA 4M6OL 1Q9OA 3CZFA 1C9SA 3ATBA 1U30A 1U8IB 2AP2A 3EUDA 4JHUA 4AXWB 4ES9A 3FFDB 3G6JB 4PTUB 5ENWA 3CXFA 4LAQH 1Q9KA 3L5WA 4XO8A 2FFDC 3WL9B 2AXGB 1A1NA 2D31A 4QF1A 5DQDL 4IIQC 3FRUA 3MMEB 1F56A 5EO1B 2WLKA 4BRVA 4ZMAT 5MEOB 1OSPL 1OY3B 5ESQA 4JFWA 1IVLA 1UQSA 4ZTEA 4RX4D 3IGFA 1H0TB 1QNZH 4AQ1B 4M62L 1NTKE 1NOLA 3HUJE 4W9EC 4XMPL 2VR8A 2UWEB 2Z91A 4IBVA 2LXCB 1J12A 4PJ7F 1I1FA 2EXYD 1KBWA 1DTUA 3Q5RA 1UJTA 3CUPB 5I6XB 4KK6D 5GS1A 3WJLA 4XOEA 4ZAKA 1JMBA 2J1XA 4KVCL 2VLJD 3STZA 1ILUA 2FQEA 3EGSB 5IVXE 5I1EH 5J3HC 2VDQH 5IM7B 3UEQA 3PHLA 1MVUA 2AJYH 2XWJB 3Q8AA 3EFDH 3QORB 2YD2A 3NZ8A 4WWKD 3TT3L 5KYYB 4X2UA 5KJRL 1OCZB 4W9LC 3DIDA 2A9CA 4NENA 4YFLI 3UABA 1WC7B 3KPNB 3O11A 1CLZL 2V2XA 3WN6A 1OD9A 3LNDA 4NIKB 4WNQB 2NNAA 1RE4C 3FF8A 3O9WA 2G60L 1QFUH 1KN4H 1U3ZA 4U6VL 2YKOA 1JERA 1I7TB 3TGXA 3U46B 2FJGB 4AENB 5LCVL 3CCLP 4D6TD 3CX5I 2W60B 4AGQA 1TPXC 4PCSA 3RG1C 3VFRB 3FQ4A 4Y88A 1E42A 1A7PH 5HBBA 4C56A 1TTCA 2F8OA 2K8MA 1DQTA 3DNKA 4QXTA 2CLVB 1ZRTE 2ARJQ 1GJIA 4P2QA 2HAZA 3LEXA 3MRQA 4FULA 4Z7VA 1CFNB 1NC4A 3OHXC 3KWVA 4TL4A 5FUZH 1NCWL 3ZTNL 2CUHA 1AACA 1EV2E 1T5WA 3BKMH 1OW8A 4M61A 3BEVA 5CZVL 3KDPB 1E0OB 5A2KH 1W80A 3UGEA 1YUHB 4B9ZA 5I6KA 1DEEG 3QEUA 1FAKT 4GKSB 4BQ6A 3ZKXB 1NBZB 2WSCJ 2DJMA 3SYAA 5L4JA 2P5ED 5B39G 1KIUA 3RURA 2ZAEB 4HUUA 4J3VA 3STBA 3FUJA 4QT5A 3CDZB 3L3IA 2F58L 1WD8A 3BE1H 2QR0A 2ZUYA 4GBXC 4UM9B 4P4KB 1IFJA 4ZPTA 4D0DB 3SDCB 3UTZB 1PKQB 4RGNE 3VH8G 1RUPL 2DTML 1L4AB 1U8LB 2EDKA 2F18A 5FGCE 2VN4A 3UAFA 1ZS8A 1X9UA 3CXHD 4YWGL 1E5WA 3ILQC 3QI9A 3D4CA 1VQ6P 2GY5A 2NT0A 5A6LA 3DJTA 1R0AL 3QUYA 4RAVB 1NCTA 1XH3A 4X5XB 4JKKA 1YY9C 1RPQA 3CGTA 2X09A 3QWRD 1TKWA 2L7EA 3HRZC 5EUKB 3RY5A 2IQAA 3X13B 3TO2B 2NY4B 3ZLQC 1U8OA 4LSDA 2AQ1A 3GKZA 3LRGA 1T7YA 1MI5D 2DLHA 5CGYC 5DJDA 5ABZA 3SPHA 5B8CB 5E00A 1M71B 3DPBA 2X2HA 3LSOB 3OKKB 4OGAC 3RFZC 4URTB 2ZKHH 1B90A 1WAAF 4HIXH 5DS8B 3U83A 3JWNG 4L73A 4XN7A 1IGIL 2CR0A 4FN0A 2AJZB 1MWAH 1XF3B 2MKWA 3QUMA 4RMVA 3WLBA 4WW2A 2BSBA 4JGUA 2EO9A 2QHRH 1NCDL 4ALAL 1IM3A 4PJ8B 1EDYA 4ZUUA 4RGMB 5FA3B 1T1YA 3EJZC 2JJTC 3L70G 1RJYB 2V7NB 5I1JL 1D6VH 2W5PA 2VXQH 2W91A 3L4UA 3WE6A 2Z9TA 4S11A 4TSBL 4X7CC 1NU1E 3F01A 1JXJA 2OMYA 4ESKA 5DJ2A 1EDKA 5CCGD 2VXVL 5C07E 1ZGLA 4TOYH 3CHSA 1J86A 4X98B 3RNQA 1KTDA 2WSFJ 1KXQE 1BSIA 3L4TA 1Y1DA 4RISH 5C86A 2CUIA 3R8QA 1RZGB 1M1SA 5HD8D 2RN0A 2Y25A 3AS3A 4MNGA 2KP8A 4R90L 4NM8L 1MJ8H 2G5RA 6PAZA 3GXNA 5AZ2L 1NMCC 3KYNA 2XICA 4U0RC 5C0GB 1CXEA 5EWIH 1V7MH 2H1LM 4YDJB 5JW3L 3CHRA 3TXAA 4I18A 2YUZA 3ZHKA 3DO4A 1AS6A 2HWZH 3QH3A 3Q1SH 4JNXA 4IQHA 3FZUD 2GHZA 1KGXA 1GS7A 4WY4D 2JIXB 2MQCA 5MHSE 4PD4D 5ESVA 2AJUL 3HI6L 5D1ZI 1BXVA 1NAKH 2Y5TA 1JY2N 1RK0A 3IAQA 3UBXB 3L73J 3ARED 4Z3HA 1J18A 1EAOA 1AVYA 1RZIA 4PLKD 1S4XA 3SDDB 1YEEH 4BE6A 3K71B 3FXDA 2A6DB 3KZ8A 2UZPA 4Y5XA 3O6KL 4BDVA 4J8RA 4LSVH 3HG1A 4K9EC 4ZUTA 3UTSA 7PCYA 3HNVL 1L9QA 5DLML 3O2WL 4CU6A 3P0VH 3EKCA 1EVUA 4H8UA 5TFSH 4C47A 4DNLA 5DJTB 2OCJA 5F0MB 2B87B 4YN3A 3O3DB 3MA7B 2DMHA 43CAB 1GKOA 2EXSA 2WV3A 2EIMB 1DFXA 3L95B 3EQ2A 1K6QH 1B0GB 3S35L 1IC5H 2B4CL 2K88A 1XCTA 4Y2LA 4BH7A 1LJMA 2E9GA 2WUBH 1FO0A 1YEJL 3UJJH 1N70A 3GS4A 3MPCA 4HH8A 5L4MA 5DJCB 4LLAA 3QBTB 4TRPL 1MSPA 3NCFB 1NFKA 2I60L 2N1TD 5DHYB 4W4OC 2M8RA 5BVZA 2EYSA 4K3JL 3UG3A 5C9JA 4HIJB 2E7HA 2Z4QA 4MMZC 1AH1A 2AQQA 3TVMB 1O5PA 5F2FA 1CXLA 5IW6A 2B9BA 2CK0L 2NPSB 1K85A 3H7BA 1R9FA 3ILEA 3O8ZA 2BVPA 1JI2A 4MNQD 1SY6A 1L7TH 2Z5IA 2R0WH 3IDXL 1CLYL 1GGCL 1BG1A 1FFPB 1MZYA 2H3NB 3QDMA 4YGVB 2VQ4A 1G0YR 5TF1L 4Z23A 4G82A 3QORC 3GSQA 5JQIB 2P7TA 2V9QA 3K2MC 4LEXL 1K9MQ 3EO0B 4S1RH 2YSSB 3O2DA 3AEDC 1ZLLA 2M0BA 3PL6B 2FX9H 2B2XL 1GYUA 3BKJH 1FO0L 3UACA 3ZHLA 1SXNA 3S37X 1H15B 4KRLB 1YA5A 4P2RB 4Z7VF 4ZT1A 3UO1L 5E8PB 3WKNA 3G5XB 5D4IA 3V6OC 3TL5A 2MJWA 4MSWB 1HTLC 2NY2D 2VLKD 5HY9B 1IM9B 5KSUA 4KU1A 5SX4I 4ICXA 3L3HA 1GTNA 5T3XD 1VFAB 3CSTA 3D4ZA 1FZGA 4GAJH 1ZV8A 4HEPG 4W9CC 4X7FC 3RHWF 4E9RA 1F4HA 3UTTA 2UV3A 3W56A 1BSNA 2H89C 4OGQD 1FNGB 1SY6L 1HHHB 5JO5A 1DLFL 1GR7A 3PP4L 2QQKL 3SO3B 3BQUA 2WWKO 4S1SL 2HRPH 1DVTA 2WTYA 1DEDA 3IXTA 4LU5L 4XN1A 1NTDA 2JEEA 3KW7A 3FO2B 4KHTL 2E5TA 2IVFC 4OF7A 4EYYQ 1BFOA 1VLXA 2B1HL 4U1LA 5DZAA 2V5SA 1M4KA 1IQDB 4K94L 4B27A 4KGJA 3HLAA 1MCOL 5F1IA 3MRJA 5MEPB 4OD1L 3C60A 1EDJA 3ZKXC 4FABH 1JK8B 2YZ8A 2DKSA 1P5VB 3HN3A 4FNSA 2VAAB 4Z7WB 4I2XA 3SGEI 3V0WL 2BJMH 2R2HB 1G6RA 4RGOH 2CG9X 5D7IB 2EVGA 5KS9B 5BJTA 1T7WA 1NANI 3CU7A 5SV4A 2DQUH 2WXNA 3OXSA 5APUA 4WTQA 4OCRL 5E1QA 3SDCC 3ZL1A 1UA6L 1A14L 4YZWA 1FZMB 3MLPA 3G5ZA 5KAIH 2D3NA 3HC0A 4GIOA 4LLMA 1N8OE 4M7ZB 4LSPH 2F08A 1CG9A 4G7YL 3GXTA 2OR7A 4M8QA 1GZPB 3FFCE 4D0BB 1FYTE 4Z95H 5HGGS 5I30L 3ZT5A 2EVIA 5SWZB 4PV1B 1NCNA 4CMMB 3S5LB 5DA0B 4WW2F 5CJXC 5FHBH 4JMXA 4HLZG 2OTUA 4C55A 1A47A 1TQWA 1P1ZA 1IZNB 1XVSA 1T6BX 3B2VL 2HN7B 4MVBD 2QGBA 5T1LD 1Q1PA 1IE5A 3OF6A 4JJOA 2ZYRA 5GJSL 3N1GC 3DGGA 1MCSA 4JM2F 3SQOL 1MHCB 3CXHI 5AW7B 3ASWA 3U36B 2APXA 4PJ8C 3V5HB 4YHLL 4E41B 3CCQP 3IFLH 3MTXA 1NCCH 3IDJB 3QP3A 1KUMA 2DY2A 1NC2B 4G8AC 4ELDA 1HJBA 1CD8A 3LJ3A 1IJ9A 4GG6B 4P2OB 5KN5A 3L6FA 3L70D 3ILDA 3FB6B 2UXGA 3GSRB 3N50A 2BNQE 3MV9E 4GQRA 3VUAA 1UM6L 1ZDSA 4FXTA 5I2IA 4IYKA 1KYOH 3WEBA 1FWXA 4BD4A 1JPFA 1M7IB 3IAGC 3GPEA 4MN4C 2VDRH 5JPMB 2QVMA 3GZOA 5AUMA 2DQEH 1AJ7L 1TTFA 1KPRA 5HJGA 4W7YA 1G9NL 5E9DB 4ZFOL 1ILSA 2YRBA 4DKDC 3VD0A 1T1ZB 4X9FA 1MCCA 4YHPB 4I6MC 1CXKA 1MCWW 1VF5B 3H6AA 5F6IB 3MX0B 1EO8L 3DC0A 2FWOA 3QZPA 4YK4B 1HEZB 4U3SA 3UTOA 3BIAX 3CZKA 4P99A 4NO0B 5EN2B 2YA1A 3L1GA 4WFGD 5I16B 4E68A 4NRZB 3ZE0F 2WYTA 2FAUA 2HT3C 2Z64C 3FK3A 5CD3A 5I5RA 1CL7I 1SXZA 4IU2B 2BDNH 1I53A 1V05A 3QJHA 2MCG1 4AIOA 4IM8A 5T1MB 2P24B 1D7DA 4KBPA 5IB5B 4ANVA 5IQ9B 5BUAA 4DGWC 2XKMA 1PZ5A 3IJHB 1YJDH 4F5CE 3T3MF 4F7EA 4AJ0A 3ZSSA 5CBAB 2YPLA 3NIGE 4L3ED 4OM0H 3IDYB 1CSBA 4ZD3H 1HWHB 3Q9PA 5F9OH 3WNKA 2VDKL 4FKKA 2G4GA 2NSXA 5K59E 1IEAB 2AEQH 5IK3B 4UU9A 1IAIH 3HE5B 1YEIL 1IGFH 1A25A 1U8KA 2DWEB 1OWWA 2WVUA 2BIPA 4PSPA 4C59B 4PGBA 4QUOA 2Q76A 5H94A 5LGJA 4EDXA 3T08A 3ZDXB 4PD4I 4Q6IA 4P3DA 3GHGC 4DW2L 4NKIH 4YFDB 1S9YB 1IBDA 4L8DA 1FZKA 1JVLA 2P45B 4R2GB 4D8PA 2B3IA 3C6LD 3W5NA 1CGUA 2OMTA 4ZOBA 2J6EA 2OPCA 3G04B 4MDIA 2D7NA 3TBTB 3VGHA 3NVQA 4DO6A 2B7DT 2FECI 5DRXB 1B0IA 3D4YA 3FT0A 1S9XA 2ZOTA 3WIIL 5G55A 3JV6A 4YXKH 1OKEA 4IOFD 1VZGA 5JHLA 3CWBE 3TVMC 4U1SA 2GBTA 1V7NH 4L3AA 4AIXA 4D0CB 3I5CA 2R44A 4JZNB 2NPSC 5I66A 4LXFA 4AGLA 4NUQA 5DVKA 1UADC 3HJ0A 4XAWH 5JA8B 1J1OH 4U1MA 1Z56A 1IC7L 3WY4A 2WJ7A 3NRQA 4ONHA 1A5FH 2G9HA 2VDMH 3TWCL 2E9IA 1CO1A 5AAMC 2VKXA 4JQIL 2WUCH 3DOIA 2OYLA 2X88A 3AXLA 3PL6C 5E6IC 4MMYA 5EU6A 3LIUA 3CFMA 1BVLB 2CCLA 2BVQB 4W9GC 3F84A 5FW8A 2V7QJ 3OMIB 2ICCA 3BCFA 4NQUA 1G1YA 2DMKA 3ABLB 1TVBA 3A23A 4ZW5A 1W15A 1AC6A 2LLNA 3GMMA 3AT8A 4OZIA 2Y3NA 2F54E 4PJXB 32C2A 5DS2A 2BHFA 1VGEH 2K9UA 1E5UI 1ITCA 1IGYA 3K74B 5DLLA 3T0AA 2GUOA 3UC2A 2JKWA 1JPGB 1AGBB 2J8HA 3KAAA 1WA1X 1D9KB 1Q0YH 1DVSA 1LO0L 2YC1A 1WUNT 4K71B 1QHQA 3REWB 4AYMC 5BZWB 4OBRA 4MZRA 2Z0UA 3MRCB 4HF5L 3D3VB 2QSVA 4WTXA 1FDLL 1O9VA 3BASA 4LKCB 3T0EB 3L3JB 1FL3B 5D6CA 4NC1C 2P8MA 5F9AC 1ZY9A 4D3CH 3OSKA 1ORQB 3BPLC 4AUYA 1TCRB 5DJ0A 5C08A 5D72H 2Y9ZA 2N01B 5DQJB 5DYOB 3SE4C 5GS1C 4XCYB 1E27B 4PJDF 4NSKB 3BPOB 2EE9A 4RLDA 5LWYH 3IE4A 4F1SA 4O2CB 1ZSHA 4JFFB 4W9HC 3SO5A 1X4XA 2KXPB 3L5HA 3MRFA 1FG2A 4M7ZC 3ZMNA 3H85A 4KJYA 3T2QA 1JZJA 2VLME 5T1KA 4XN5A 2O6DA 2I26N 3QEQE 2X12A 4WFEE 3OB0H 5E1GA 3A2AA 4GT7A 4YSRA 3V4PA 2OXHA 2J59M 2XQ0A 2JMRA 1B88A 2WSPA 3CDCA 3QS2A 1SJHA 1PPJG 1AKJB 3QQNA 1T6VN 3O9WD 5D9SB 5KUKA 2IDBA 5AB1A 4TVPH 5F7YC 5FW6A 3EO9L 4BWTA 1XGZA 5DK2A 4APQB 1JXKA 2XYCA 2HJFB 4NPYA 2XDJA 3TEWA 1XCQB 4ODVH 3O8XD 3SPCA 1UKQA 4H44B 2XVBA 4WTWA 4Y4KB 2HTLD 4KZEL 3QCTL 2J8OA 2ZUWA 2XSKA 5FEBA 3ZL2A 5DHMC 2E56A 4P2QD 3LHAA 3V0VB 3ET9F 1AHKA 5FO9A 5C0AE 4TTDC 4WEUD 1XIWD 4PY7B 3RWIB 1RZ8B 1ZA6B 1CLOH 4ADJA 5B3JE 2HCZX 4JO2H 3FO1A 4LLUA 4AQOA 5A2BA 4P2OC 3QDJA 4F80A 1L3WA 3OZKA 4FLOA 5IESH 2BW5A 3NA9L 3T3PF 3BGMA 1XR9B 2QQNH 3V6FB 4J3OH 2R7EA 2YUVA 4LL1A 5CCGE 4XBPB 3NDZE 1DL7L 3BZ5A 4HWEL 3TCLA 5JPMC 1E4JA 4GPVA 3IYLW 1QRNB 1WWWX 3OQ3B 4X80H 2PNDA 4LL9A 2JKRM 2OZ4H 3S37H 3HKZA 3ULVF 2FYYA 4K7FA 2WXMA 1QX1A 1VA9A 3WAKA 4LCWB 3QI9D 1AO7B 3A4AA 3IDMA 4NNXB 4ALAC 1O6TA 1JNJA 5D93B 3ULAB 5I9QC 5EIIA 1VF5C 5CHXA 5F6IC 2UZYA 2YXWA 1Z66A 3H1LJ 3QUYC 4I89A 1B4LA 4LLDB 4LHUB 4YK4C 4AV0A 2V9TA 5AKSA 4ZX3A 3TEXA 1HILB 3CN2A 4CU7A 2QJYB 4JF7A 2IBZD 2WWWA 1K8IA 4JY5H 3SE8H 3H9ZA 5I26A 3AEEC 3W68A 1F2XK 4AYID 3IMWA 1JZ8A 1CGTA 2R23B 3STLA 1INDL 3MCG1 4YTPC 4TQIA 2QDWA 2HJKA 3NJNA 3QEGH 3QFJB 4TUUA 3TFBA 5HHOE 4ECNA 1FFTB 1CI3M 1ODUA 5I18L 5HYJA 1OF0A 1J05B 3P0YH 1NM9A 4FEIA 3ETSA 3VX1A 2FX7L 5K33A 4ZFOB 1SBBA 1T3FA 4UOJA 4C7NA 2DBLH 4UQ3B 2VSCA 2IJ0C 4PRBB 2Y6TE 4P3CH 4YDKH 1EEQA 5A2FA 5F9JB 1BIHA 1YYML 1YPZB 4MBOA 3S8FB 1NMBH 5A2JH 4M5ZH 3ABKB 2MFNA 2BSED 1PYWB 5DFVC 1M1XA 4R2GC 5G2NA 3SFEC 2UUDK 1N68A 3W0WE 4UB6H 1CDUA 3B5TA 1SQPE 3CC5B 5DK0A 4Z3JA 3GSOA 2XHNA 2ZAGA 1PZAA 3SBWA 3Q1EA 1A6UL 3L73G 3MU3A 1IC0A 4Y5YB 5DXWA 1NL0H 3EYVA 2F74B 4G5ZH 2E0PA 3A5VA 2OYHA 1HQ4A 3PJNA 2BHZA 3TZVA 1KILB 1E4XH 1QSFE 3TS8A 2VDKB 1JZ5A 3VSVA 3G6AA 2D2OA 3GRBA 1UIIA 4XMLH 5T5FL 4A7GA 1WGOA 3IM1A 5LXGL 1KGCD 3KH3A 4QRRB 2AXFB 2J1KA 4JCLA 3W5MA 3FC8A 4PWFA 3RK3E 1BQHG 1CQKA 4XVSL 1NGPL 5IB2A 4OZIF 3P2TA 2YXMA 2KPNA 3MTUE 3FH7A 2VLLA 1EA9C 2IO5A 3AXIA 1SEBB 3FTYA 4ODHH 2FIKB 3QE5A 3VYOA 1F6FB 2B4CC 3HB3B 1KGUA 3IFNL 2NW2A 4LP5A 3P11L 2ZKMX 3FQNA 3DX3A 1DQKA 3IU4H 3INUH 5EEUA 2WXJA 1H9DA 4GRLB 4GKOA 4B50A 2BPBA 3CL3D 4PJAA 2QPSA 3DX7A 4Y5XC 2DWDB 3HG1D 4NKDA 1HH9B 3UTSD 3DK2A 1SUJA 4HG4J 4XN9A 3PAZA 4X4KA 3CCUP 1FDIA 2X4OB 2LXBA 3OR7A 4KVNH 5CJ4A 4F93B 2VABA 4GINA 2V3EA 2WOYA 1W0WB 1SQQJ 4W9ZA 1A6AA 5T3XE 3V95A 1D9KC 4M5YL 3WUVA 4K71C 4I1NB 4LCCB 3HBGA 1ET5A 4PM1A 2XN2A 1B9ZA 3H9SB 7TAAA 3NFNA 1EAPA 5JDSB 1S5HB 5HDQL 1FZAA 2KT6A 2KBGA 4KXDA 5EPMA 1XB6A 1FA4A 1JGUH 3S3CB 4BSWA 3KLHC 3T0EC 5B1KA 4XP4H 1NYHA 3DX9B 4PH8A 1BVOA 1W72H 2BRRH 4EZMA 3LKOB 1LK3L 4GT0A 1JIBA 1UWEL 3B6SA 1KWKA 3H1HJ 2PXYA 3OKDB 2GUVA 2WYZA 4CILA 5HHPB 4WJ5B 5GIRA 2QPFA 1FVDB 2OCCB 2NZ9C 4J27A 2DW5A 1OEZW 3ZE1F 2X9YA 3BPOC 3B7TA 3OAZH 3HN8A 3KS0J 4JLRA 4MRBA 4IHOB 5FM5M 3P9MB 3NPSB 1ZHLA 4E9XA 1EMTL 3QDMD 2CLZB 2P80A 4HFWA 5IHHA 1MRFL 5AOLA 1OB1B 1RZJH 3IAPA 4U05A 3VXOA 2Z7WA 3ULSB 3PFUA 3VRIA 2R69H 2VQTA 1ADQA 2BFVL 1HIML 1RMFH 3EFFA 1DUYA 4K94C 4OZHB 4NKQB 3MZWB 4PVBA 5BS0B 1R3HB 2DLTA 3B8YA 5C0JA 2J2ZB 1H3GA 4P57A 1QBBA 5EFIB 4APQC 1URZA 2WCGA 4EZKA 1PPJD 1YC8A 1AHWB 3AU1B 4QRUB 3LPFA 4H44C 4X6FA 2K3HA 4M48H 1IAKA 3UTTD 3KWWB 4TKWA 1NEZB 2A1WL 5JZ7C 1TU2B 1A6WL 4FGMA 4MD0B 4H0LB 2OMNA 3BQUC 1NWPA 3MV11 4AVJA 3JWNE 4LPVA 4DKAA 4F2MB 5IP4A 3GJFA 3HJEA 4MQ7A 3BKCH 2AV1B 4JDTL 4NZJA 3ZT6A 3BPNC 4AYCA 4U6YB 3WNIA 5E5LA 5LB1A 1LGVA 2Y1YA 2QMJA 2AGJL 1M05B 1UM5L 1KLGA 3C60C 4M93B 5LGKA 1KMIZ 3UIAA 2AQSA 3L70E 3DO7A 2CMRH 3N0AA 2HKHL 5F88A 2J8UF 4FXKA 4AUWA 1KEGL 3AQZA 3CQFA 5AG9A 1G0DA 4WHYH 2LFEA 3RHWK 1RH5B 3SY6A 4ZW3A 2WXKA 4HKZB 1RKRA 1U4EA 1OP5K 1OWAA 3K2UL 3KZIE 2EC8A 3O41A 3QXDB 4WI5A 5J1AA 3V2AR 3NACL 5D93C 2NY3B 3ZZLA 3LZRA 5HPOA 2L7QA 2XVLA 1M7UA 1MLCB 4LVEA 1OPGH 2XQBH 4P04A 5HYFA 1ASQA 1MAML 4V1DB 4AW7A 4CVZA 5FYLE 4DP7X 3CH8A 5KVFH 1QBAA 5L8JB 3S9OA 4LMQE 5TISE 1TIUA 2QJYC 4I48B 4AUJA 3D4GA 4N20A 4BZ1A 3LQZB 4ONGH 1S7WA 1ZLEA 5D4QA 1EJ8A 5GGVH 4XCCH 3WKML 3FT4A 3KBPA 2IZ1A 1KBKA 2QADD 1SQVJ 3N7NA 4ZTPH 3CVHA 2JKJA 3FT1A 2XYBA 3G9VA 4NP9A 4B9PA 1MHEA 4OU3A 5AVTB 4XXCA 4Q97A 5AW3B 1RHFA 4YBHA 3CHQA 3QDGA 4YAQA 1R5IB 2EXTA 4XBEL 3E3QC 3WNLA 3BZ4B 3MNMA 4XAKD 1DQVA 1KJMB 3QDHA 1H3TA 3MLVH 5FO8B 5EC1A 3PHSA 1ZLVH 3MJ7B 4LAQL 2IBZI 3KPSE 4ZS6D 1WBYB 1P1VA 4JDEB 3I9PA 3FT2A 1ET8A 1ZGLM 2J3SA 2N9BA 2VSDA 1F4WH 1MVYA 4J3XA 5DZLA 3RUGB 3M9QA 1I1RA 3SZKC 1PZUB 2I9LA 2MJZA 2FLMA 1QNZL 4NQCB 3UADA 4G9FD 4A7GF 3VCLB 2I9TA 2ODHA 2CRZA 4ZO8A 4XN8A 1ACYH 4YX2H 2ADGB 1E9PB 4RBPK 4F7CB 2C9QA 1OK8A 3HZYA 5EIIG 1JM0A 4NO3B 4Y5YC 2VR5A 2ZT9D 4WHTB 2CDGA 2I69A 2YPKB 3FCTB 2WIIA 4I2LC 3BN9D 2MQ0A 2CPBA 2XIDA 3L73D 5KSVB 4JFQA 3LIDA 1MDTA 4P46A 5K9QG 5I1EL 3EYOA 4GJTB 1XGYL 4ENED 2VDQL 3Q43A 1VPOH 2AJYL 3RPIA 2DIEA 1KQSO 3EFDL 4PJAF 3ZUNC 3F7VB 4UQ9A 5DRWA 4YDVA 1VQ7P 4AKQA 3HZVB 2BP8A 3ULVD 4I13B 1MW0A 5EOTB 5IIEA 3TBVA 2R2BA 1GMEA 3MUJA 3SY0A 3SJVD 3HB3C 5BW7C 3AEAC 2COVD 4HCGA 4OD3H 4OVUA 5ISZE 4JHZA 3BQVA 1QFUL 1KN4L 4IRSB 4OTXH 3HCVB 3MGOB 3FX0A 2GIXA 3VXUB 1OQOA 3FU9A 2YPLD 1NCIA 2E76C 1MCJA 1A7PL 2H4EA 3UJIH 2ZXDA 3D71A 3K46A 3TWYA 2CDFA 2IGTA 1NLDH 2WO3B 1C16A 1JPSH 4XCNA 3TPUA 2Q9IA 1NZRA 1N73A 2DMCA 2YFNA 4IDJH 2D0HA 3MRRA 5EOCJ 5FUZL 2B89A 3BATA 1CFSB 3UZEC 4Z7OB 4NO2A 3P77B 1EO7A 3ABMB 4LCCC 4C83B 2IXQB 4PW3A 1P4UA 5CJQH 2FJGA 3LVEA 3V9EA 3VE0B 3WS6C 4ES8A 4ETQA 4P9MH 1PTZA 3QT2A 2C0WA 5BZDA 1CBJA 1AR1C 4QHPA 3U4BH 5BZXA 4EIGB 5LQBH 2KLVA 2KK7A 1OGAE 3A0BH 2ZG1A 4LGSB 1NEUA 4AT6A 2W8CA 4HH2A 3FRPA 1HSBA 1WLHA 2LVEA 2Y7QA 3R4RA 4JREB 5HVWA 2IDUA 3BE1L 3PWPB 5I1DA 5L88H 1T7XA 5BRPA 3B2DC 1NFDB 4WCYH 4OZGA 2P49B 2IADA 4KI1A 2YIUB 4HB1A 3NPSC 4A7VA 5IVNA 3H2QA 5EOQL 3VXNB 5E24E 2VITA 1AQ8A 2KQMA 4GUQA 1N8ZB 1Q94B 4J23A 1ZT7B 1S1CX 2WXHA 1XAUA 2FJFB 4AGOA 5EU5A 3MRMB 3BT2H 1BYNA 1NBVH 4Y5VA 4DWHA 2X9WA 2DOCA 4UM9A 1NBQA 4P4KA 4Q0XH 4Y19D 4QPEA 3IWVA 1PKQA 2LLLA 4WUUD 2N7BA 2RCSH 1ZK9A 3PDDA 5C0EA 1U8LA 3JTTA 2VL4A 2ZKHL 4HIXL 1UH3A 4EJ1C 3IMRA 3AECC 5BQ7B 3BFOA 1YSOA 3UBHA 1AHWC 4QCIB 4FG6D 2D03H 3DMMB 5TH2B 4F24A 1MWAL 1NINA 1YAZA 5JIHA 4DZBB 1MY7A 1BD2E 5H2BB 2X44D 4QJ5B 3B9KB 3ME0A 2K3RA 3FQRA 2QHRL 5AW4B 4ZSOB 3EXJA 5DVMA 1H5BA 3HI1A 4CBZA 2OM5A 1G1JA 4Y4FB 2Q20A 1CPUA 3MGAA 3MRGA 4H0LC 4FMVA 4Z7QB 1D6VL 5ANME 1JGVH 2XZQH 2VXQL 3BDXA 1P2CA 4IRJD 3QQ9D 1MCPH 1M71A 3KW8A 5AW5B 1GZQA 5DD6B 2G5BB 3T97B 4MQXD 3RWJA 4E5XB 1J1DB 5K93A 4TOYL 2JP3A 1AD0A 3CPUA 1J9RA 1G7HA 4B9YA 3GMRA 4KJPC 5DC4B 4RISL 5C39A 3IJ7A 3MRHA 4H1LA 5C08D 1N0LA 3L17A 3MYJB 3RVUC 5B5EE 1EZVG 3LQAH 1MJ8L 2O6PA 2YD8A 1S9KD 1EZSA 1TTUA 2ZD0A 3P3YA 1P4IH 1NGWB 2OZNA 3WENA 5EWIL 1BA9A 1GCYA 2K78A 4PJHF 1V7ML 3CZEA 5FYJU 5KJ7D 1KIRB 3FHEA 3GI8H 4PJ9A 1FZBA 1M2OA 3VI4F 5J9PA 5T1KD 4M1CC 2Y0CA 3Q1SL 3C5ZD 3PJLA 1UD3A 4XP9H 4JFEA 5IW1B 4J3TA 2FYVA 2ALAA 1UD8A 2V2WB 5DD3H 4O2FB 4F8TA 3HAEA 3T6ZA 1WBZA 1NAKL 1YRKA 3VXQB 2QVTA 4AGNA 3SFDC 3KVQA 4S2SA 3MJ9A 2YQ2A 5DUPH 2BK8A 1F90H 1E8WA 1YEEL 5D7KE 3WHXA 2R2CA 4LSVL 2WZPD 1DSYA 4HS6A 4PQXA 2YQ3A 4PS8A 3SE9H 3P0VL 3PHOB 3I6KB 5TFSL 4CGUB 5FYJH 4KROD 4BM7A 2BNRA 1T5XA 2RBLA 3H1LG 3QDJD 1JTHA 3UBXA 2Z3FA 3GJEB 1K6QL 3G6JF 4E9YA 1IC5L 3ARTA 2J73A 5DEJA 1U93B 2DYPB 1UD2A 2WUBL 2APVA 2MOQA 5C09A 3UJJL 3RK2B 4W80A 2XZRA 1WS8A 4KHXH 3QJTB 4IS6B 2YUXA 2KPWA 1AS7A 4M56A 4PMFA 2AJSH 3UZVA 3NZHH 2LU3A 2WKGA 3SPVA 5KYWA 3DIVA 2UWEF 4XE0A 1SVBA 5PAZA 2PYEE 4NQQA 2P44B 1VQ4P 2I24N 3QO1A 3CBRA 3EO1B 4N8VB 1GW4A 5MP6H 3PWJA 3RI5K 4GSDH 4W1TA 1L7TL 2R0WL 3BSHA 3WFHA 3K3QA 3GD1C 4IU3B 4KRPB 4ZJ9A 3BGFB 4HT1H 1L0PA 3QNYA 2WZ6A 4KKCD 2UVFA 4LVHC 1PZDA 3T4YA 1JZ3A 1KIQB 4KKRA 1P84J 4S1RL 1JV2B 1ZT1A 2M3BA 4B7LA 2FX9L 2VMFA 3FN9A 4MLIA 3BKJL 1QWUA 3M1BA 4B5EA 4OLYH 4XHJC 1LD9B 1CFQA 2GB2A 2D7QA 5E8NB 4FLRA 4IRSC 4I7ZB 1AFVH 5HGHA 5HYJD 1C5BH 2H6PB 1LLAA 1FV1A 1I9IH 3PIQA 4OUUA 4LPWA 4P23B 3MRLA 1P7QA 4PP1C 2HA1A 3KPLA 4HS3B 3JWOH 2CKNA 4GAJL 4N87A 2PRRA 3RRQA 4M8VA 5ECJE 3CFEB 3NJLA 4ZMZA 4P5TA 2VDQB 1S7VB 3QJZA 1U8PB 4OCNC 4HJEA 3HD7B 3T0WA 2ED9A 2HRPL 3TT1H 2TRHA 4OKDA 2EDBA 3KPEA 1UC6A 2EINB 1OX3A 2AQ3A 3Q6FA 1URQB 3RL0D 4AIZA 3PNWA 3CFBA 4X4ZA 1HL4A 5B7EA 3NK4A 1S7UB 1SFHA 5D2LA 2DM4A 3V4VA 1ZJAA 1JZ7A 4LLQB 4HGMA 2FGZA 3G5VB 4FABL 2CRYA 2DQIH 2OX5B 2Z5HA 1G1CA 3CK0H 3LAFA 4EOWH 2BJML 4JREC 5F3HB 2VLRE 4RGOL 4BE5A 2OYHC 1MWOA 2DQUL 2G3XA 4OCXH 1SMAA 3TZVD 5E9NA 4HU8A 2M83A 3EH2A 3PREA 5TDOA 4PGCA 5I6PA 1OPOA 4I0KA 1PX4A 1EQWA 3QIWA 3H1KE 1ERNA 4YPGB 1S3JA 4UQIM 1KT2A 2GJ6A 2ZUVA 1JTOA 4Z95L 3IU3B 1VADA 5JHDA 4ZNEE 4DEPB 4L4TA 2OMZA 3QJOA 3WIFA 5FDYA 3U7YH 1IAOB 5FHBL 4QOKA 4BZ2H 3K6SA 1NM4A 2W81C 2HFTA 4ZTOH 1TZIB 4YC2C 2XRAH 2VE6B 3B5GA 2N7SA 4YHIB 2P5WA 1R3JB 2LABA 2NLJB 3ZQ9A 1WTLA 3Q8CA 4WK2B 3PG2A 1W2BO 4FJYA 2BCCJ 4BELD 4GO6B 5D2NE 3DMMC 2R29A 5E79H 4L3CA 3H1HG 4JFXB 4K73A 3CSYA 5JIQA 2CWRA 4Y4HA 1TVHB 3B9KC 1S7QB 3D2TA 1J0YA 1N59A 2EAEA 3MNVB 4KY2A 4M7LH 4XPTH 5D8JH 2J1YA 3FCGA 1M2VB 2B77A 4Y4FC 1T4KA 3BWAB 2CKBL 3IFLL 1NCCL 3SCMA 3TONA 3Q01A 4RJTA 3FB5A 4RH4A 1DLHA 1O6SA 4HUNB 1ZR4A 3FRPG 1CVRA 2OXGA 2I07A 1J1DC 4AE0A 1LTGC 4G72B 1IC2A 2DDQH 4Z7AA 2LQRA 3HPJB 1BMGA 2QPUA 3P4OB 4P4RA 3M45A 3PGCB 2LVCA 4RNRA 2PXYD 4L8CB 2DQEL 1R8EA 1JTPA 4HHWA 1MWAB 1OF2A 2KDGA 4ZPVB 3RQ3A 1YEDB 3TTYA 5IZ7A 1K5WA 1DHKA 3KXFE 4JG0H 4U6HB 3FYIB 4JKMA 3B8EB 4WUKH 4XXWC 1I8LC 5FGCB 3DK0A 2EDNA 3Q7JA 4FOMA 4PCTA 1HXYB 4IBZA 3GDBA 5B38B 1AGCA 2GHWB 1N5AA 3Q3DA 1YITP 4HEMA 4O2EB 3LB6C 4X9BA 1AIFA 3HZMB 4MDJB 1G7LB 2BERA 2OW7A 2OFQA 4YIQA 2YPVH 4O02B 4GBXD 4WK0B 1Z5LA 2J7LA 4N8UA 3TH3T 4F7PB 1Y07A 2AK4E 4NN7B 3D2UA 1EERB 2K9FB 2BDNL 2F7IA 1OM3L 4PJDE 2PW1B 3C9IA 1LT1A 1ADWA 1UB6A 2PO6D 3S5YA 4YHKH 4GS7B 4R3SB 2JJVA 1YJDL 3QIBA 2OR9H 2Z31A 5HVFB 4ABVA 2X4RB 4OM0L 4MXQD 4KXCA 4ZD3L 3SDAA 5F9OL 1JGEA 2JXMB 3H2PA 4FQQB 4EIJA 2AEQL 1YQ4C 1IAIL 1QEXA 3EJJX 1IGFL 1JP5A 1D7FA 1KGJA 3X12A 2CDEB 3GMOB 5K39B 5C0BB 1CDGA 2NYYC 4H1LG 4KZ0A 4WGWB 3AS0A 2JKSA 4KO7A 1VJSA 4NKIL 3FU7B 4GQZA 3LH9A 4GXVH 1J10A 4L23A 3H1LD 2ZOKA 3RK2C 1A6TB 5E70A 4PRDB 1RULH 3X3GH 1IIIA 1CR9H 1L0XA 1X5AA 5TE7H 1SQVG 1VFBB 4YXKL 3DX6B 5F7UA 5EZOH 5A7EA 1GDTA 1N7MH 1A1OB 1V7NL 4XMZA 4RRPA 1RK1B 4KDTC 5JORB 4XP1H 3EXLA 4XAWL 2QZQA 1J1OL 1OL0A 5IV2B 1S7RB 4AKPA 3DV4A 1I82A 3HAEG 4KRPC 3BGFC 3GM8A 4MAYA 4ONFH 5GGVY 3VD4A 1A5FL 1LO5A 3QH9A 2VDML 2X2JA 3QIUB 4P5SA 3Q44A 4PJ6A 2WUCL 5HP5A 3FF7A 1JMZA 3LNGA 4UYPA 1OZTG 1MCLA 5IG7A 3RGVB 1HCZA 4HGWA 4ZNCA 1YJNP 1X7TA 1ZT4B 2NYKA 2L4OA 2XIBA 2W59A 2YD9A 4IIZA 4N0UB 4I7ZC 4ZI8A 4PLJD 3H55A 1AOZA 4V2BA 4ILDA 4IJ3C 3SJVE 4KK5D 5E94B 3GXFA 5F7DB 4PBVC 4EUPH 4P23C 3NAAH 3QDGD 3MNZB 4Z7UA 1X9VA 1BXUA 2MNJB 1VGEL 1Q90D 4PV8B 3QPQC 3MV8D 3UBXG 4HWBA 4G70B 5DQ9B 4MXWH 3KWUA 3M07A 4WSKA 5INDA 3KD4A 3T9WA 1EHLH 1MFVA 3ATDA 2DWTA 3CC7P 1TEFA 1Q0YL 3BH9A 3R4DA 4G8FB 2C3XA 1EUTA 3VYNA 3HD7C 2UXTA 3VTAA 4KK8C 5DEFA 1NA8A 5EB9A 5DWUH 1RQVA 1URQC 2WPQA 4O51B 3OC8A 1CZQA 2P1YA 4WI0A 3ZMEA 4B9FA 4WZ9A 4TLFA 5KBKA 3HTKB 3OLIA 4H5SA 4D3CL 4CPGA 4MX7A 4N85A 3MLRH 4IMLA 3PJSB 3REVB 3ZYIA 2EDTA 3NMEA 2R1WB 5D72L 1MH5B 2YBRB 1OVRA 3W9EB 4WU5B 1UZ6F 4ZQKA 4QHLB 1E4KC 4Z7WF 4UDUB 1KV3A 5KSBB 5LWYL 1UD6A 4P46D 5D7IF 5HGBB 1QFHA 2V7HB 3CZGA 4LDOB 4BFOA 2V17H 1N64H 4FTVE 1GPOH 4BFJA 4P9HH 2HODB 4PHZA 1KLFB 3BO8B 5IMLB 1X5MA 1L9MA 1FL3A 2VISA 2X4NB 1ACCA 4ZYKB 4DEPC 3QRLA 4BWWA 4Z77A 4QHUB 5C8JA 5AVZB 1SQQD 3HVNA 3O6MH 4OIBA 4RWYH 3TBSB 4TVPL 5E99H 2ZXWB 3HBZA 2B20A 4JY6B 1VSCA 3EG9A 2Q3IA 1WT5A 4JB9H 4Y1SA 1OK0A 1PFIA 3LN4A 4ODVL 3QNXA 4Y19E 1COBA 3EYSH 2DB8A 4XNMB 3G5YA 1ZHNA 4PV9A 1MCDA 2OYIB 3RZCA 4J28A 4X50A 2EVJA 2HYNA 2CU9A 3FU0A 1FNEB 2R5BA 3VI3A 3F62A 3WMPA 2XNAA 1QP1A 1ZTMA 5FXCH 1BCCD 3ESNA 1D5XA 1CLOL 4IBUA 4V11A 5SX5H 2X41A 2ZX9A 4RMQA 4LL4A 1QOKA 2PPDA 2IWGA 3RY6C 2ENYA 3VQ2C 2EE2A 4N0FB 1FGNH 3S97C 2GAZA 2RA1A 4DK5A 5EUOA 5IESL 4UDTB 4JN2A 4GG6F 2QQNL 1XGQA 5AOZA 3T71A 1DN0A 4WHCA 4UMSA 3QZWA 4GW1A 4L4VE 4HHAA 4JDZA 3I3BA 3OXRA 2XXCB 3CHOA 3DTXB 3H1IG 2ICWJ 5GGSA 3V0VA 3V55A 4X80L 1FFNB 3CX5H 3NH7H 3OKLA 5IQNA 2OZ4L 1RZ8A 2GJZB 3AT0A 3S37L 3NPZB 3JCUH 1WUZA 3X2QB 5IKCA 3GMNB 3DSNA 2QRXA 3GEWB 2SEBB 3CFTA 3BUPA 3OG6B 3QRGH 3RB7A 2CKBB 1HH0A 1N7SB 1S9KE 2IWKA 1G4RA 3ARGA 5D1XE 3WN5B 3X1NA 2EXWD 5GS0D 1ZVNA 3HG2A 3WIHA 5I17B 5KJ7E 2BEQD 2FSEA 5DHVB 4JY5L 4ZUWB 3SE8L 4Q6KA 4GRMB 4NAQA 3T0XA 4UM9D 3T04D 2VOTA 4P4KD 3V8OA 3GSWB 2ESVE 4QHNB 2DW3A 4D9QE 1SQXK 4AYBA 2W6JH 4F8QA 2NQDA 1L4AD 4AQZA 2KH2B 5BOPA 3ZE1E 3QEGL 3CLWA 2P28B 4L5FE 5I15H 4GS7C 3ES6A 5D71H 2OMBA 4RA3A 3WJJC 5FUOH 3P0YL 4Y1AB 1U8QB 3Q5PA 4QRAA 4UQAA 5DUBA 1QI3A 4PB0H 4POZD 2I8DA 2Y0DA 1IB5A 1FIEA 3VB9A 3F5WB 1TT6A 2DBLL 1KPVB 1M6OB 1ETB1 2NY4D 1Z2KA 4TL5A 1WZMA 1URIA 2QSTA 4PGDA 1I9JH 3MTRA 3EJTA 4KO9A 5GGRY 1GCFA 4C57C 3BAYA 2OK0H 4WI3A 1NMBL 4JG9A 4PJIA 4M5ZL 4LOUC 3EHBB 4XI5C 4XVTH 5AEAA 3KMDA 3UH8A 5KEZA 3ZDXF 1E28B 4TNFA 1E7VA 3EOBA 4OV6F 4NT6B 2Y7OA 1N6QH 4JRXA 3FHAA 4WFHD 4XNXH 1MN4A 5IB4A 2X0UA 4BFGA 4MA3B 4X0KA 1S5LH 2IANA 2FXOA 3QG7H 1NL0L 4N0YH 3P4MB 5FA4A 5I71B 1UWGH 4G5ZL 3AE2C 4HUKB 5F7KC 1E4XL 1YPZA 4KKLC 1K4DA 3FPXA 4MJIE 1CICB 5AVQB 4PJ9C 3D51A 4XMLL 1U8NA 3DXAB 1R17A 2A9AA 4N5UA 2FYUJ 1RF1B 2YJQA 2XWDA 4U1NA 3LIZA 2X7LA 3QUZB 4HIHA 4M7JH 1T2KC 3VFNB 5MEQB 1JK9B 2HKFH 2X70A 3QIUC 4JFED 1ZMYA 3UYRH 1SP4A 4XODA 3OC5A 4ZMWA 4JL1A 2DS4A 4H88H 4ODHL 2J8UE 4FD0A 1I3GH 2UY7B 4JFHD 3RGVC 4FQHA 5E2VH 2QM7A 1QFPA 3FN0H 3IU4L 3MRKA 3INUL 2PPAA 5F9WB 4YVUA 1Q9WA 2OLDA 2PR4H 2DM3A 1W5CE 4XO9A 3ULUH 5FDWA 4OAWA 3RFRA 4UINH 3ITKA 3SOBH 1CE6B 1ETZA 5CCKH 1CDYA 4HUXB 3Q3GA 1JWUB 3CN3A 3LMJH 4MNHB 2GUSA 1S3RA 3QQDB 3EJSA 3VQLA 3HBQA 4KVNL 4PJXF 2FDBP 2HPOA 4K5MA 2JIXD 1OB0A 5ACLA 2BNRD 5EBWA 4AEIL 2W07A 1YNKH 1XXDC 2CCWA 2HFEB 1K8DA 4BRYA 2RGSA 1VIWA 3KYMB 4TSAH 1KTBA 4L76A 2TSAA 3PWNB 2VDMB 1CYGA 3LW5H 3SDDD 2ZOLB 2E8ZA 5HPMA 1JGUL 3NJMA 5C09D 2YK1H 1NWQA 2VC2H 3GSVA 4CC1A 4ADIA 3D39A 3Q2YA 4XP4L 4HSQA 1W72L 2BRRL 1YEFH 3VFPB 4A2MA 4N0CD 2E5EA 1R3LB 3E1F1 1DBBH 1G87A 2ZSWA 4YPCA 3P3SA 4ZFGH 4U4IA 2EYRA 3MV7B 2ZKWA 3K8KA 1NCGA 4PWIA 2BC4B 1BW8A 1I8KA 2QKIA 1PY0A 4AYFA 5GRYA 3FSVA 5JTWA 1GJUA 3ATAA 3WNJA 3R19A 1O7DE 5FM8A 4JRYA 4RMWA 1RZJL 1Z3GH 3VM7A 3PWLA 2R69L 5EBMA 4PRIA 5AYQA 2EDJA 3Q6GH 3X14B 3FU6A 1Q86Q 3I84A 4BFEA 2NSMA 2Y1AA 3IFPA 3S3DB 2WPSA 1ONQA 3KLKA 4HWZB 2EICA 4FQXA 2ZOOA 3B5NA 4TNVF 3T1WA 4HG4K 1WIOA 1P7QD 3QQ3A 5F7MC 3T8VA 3THMH 1PKOA 1SS1A 2R27A 4M48L 2OYIC 1ASPA 3QAZB 4FCHA 5KAFE 4Z3FA 1GS8A 3ATFA 4PRHA 3GW6A 2H43A 2CRMA 4M5TA 4KX7A 4P5TD 3MLXH 4D9LH 3WDHA 5HI4C 3VXMB 1VQLP 2ICWA 3D25B 2QT6A 5E1AB 3MUUA 4OZHA 3KPRE 4P2RD 4U2ZA 1IUZA 1M57B 2L7UA 1MFZA 1JO5A 2D0FA 2QKSA 3C08H 2W27A 4HJSA 4HBQA 3BKCL 1OW0A 2HLAB 2RJMA 4H25A 4R4NC 5KSAA 1A0QH 2IPKB 3Q8FA 1RAMA 4H0GA 1KFMA 5E2TH 3ABZA 3BP6B 3PLNA 3GMLA 4MA1B 4UT6A 5TJWK 2KZ1B 2CMRL 3GZQA 3KWWA 3MSPA 3SPJA 4KMQA 3IDGB 1UCBL 5J7CC 2IFFH 4O9HH 4DUWA 2BCCG 2QJPC 2CJTA 1DYZA 4OGYH 5CGTA 3QIWD 1TTAA 4QRTB 4NO5A 1LP9A 2GJ6D 1TJMA 5B66E 3WN5C 1FL5B 2AKRA 1OPGL 2X5PA 2R1YB 4ABQA 5JHDD 2XQBL 1MFCH 2WAQA 4L4TD 4XWGH 1H6UA 4OIIH 1EZVE 5KVFL 1SQXE 3X3FH 4S0HA 3WTXA 1IL1B 4HUVA 3T65A 3QEQB 1SF3A 3AG1B 4LKXA 4QOKD 5IGXL 3JV0A 2BP0B 4HK0B 1L0QA 4M6MH 4E9TA 4ONGL 3GLAA 2IFGA 1A9EB 5GGVL 3TYGH 4LIQH 4XCCL 4B9CA 2P5WD 4OZFH 1BQSA 5ETUA 1JWMB 4BQ9A 1QQDA 2JCCA 4LSSH 1GGBH 4ZTPL 2YEZA 2IPTH 1RL1A 3K72A 2R3SA 2B0SH 3G71P 2JJSA 3SBRA 3SGEH 2J5LB 4Y4HD 1MIMH 4R9HA 2A6JA 1HL5A 4WI4A 2KUTA 4C4KO 1LILA 4GT1A 5SWZD 1NANH 1E9QB 4PV1D 3HLKA 5E8EB 2FJHA 5IJVB 4YHNA 2K1MA 3FQUA 1U6AH 3SCMD 4FAAB 3MLVL 2L3BA 4XOAA 2L91A 1NKNA 2PP7A 3QYCA 1K4CA 4YNYB 1WFMA 3P73A 2V2TA 4PJ5E 4EN3B 5IEKB 3OGCB 1RI8A 2BMKA 2BVUA 3EHBC 4P0DA 1UB5A 4RAUA 4DZ8A 1YPZF 2NUPB 1OOWA 1BE3D 3LRSA 2E6QA 1LHZA 1BZOA 1UUSA 4F15B 3LKPA 3QCUH 1ACYL 4YX2L 4XVUC 5MENE 1YI2P 3GRWA 1B0RA 3H1LE 4B41A 1YJDC 3TJHC 5I71C 5FUCC 5I1HH 1EFXB 1WP6A 2XNDH 1JTTA 4PPTA 4UANA 2JKVA 3L74J 1JV5B 3VMYA 1D6EB 2E75C 3CXHH 3JYBA 2H8PB 4OJEH 4A1RA 1QKZH 1K73Q 1CICC 2ZWLT 3SE6A 4NBZB 2YWYA 1VPCA 5DEGA 2WTRA 1VPOL 3UAJC 5EV7A 3W39A 4HIIB 1IFRA 3I02B 1KPUB 4YHZL 1GMJA 4FNPA 4R0LA 1YIJP 5I23A 3HE4A 1Q1JH 1F42A 2E7LA 4X9GA 3IB4A 2RB8A 3HC2A 1CFTA 1CN4A 3D2UD 2I7SA 3Q2CA 5CBEA 4XPFH 1SQVK 3VAEA 1GIGH 1TJGH 4OD3L 3T6XA 1KB5B 1KBBA 1WF5A 3QAQA 5J8OA 4LHUG 3DGCR 1CD9B 1BJ1H 3QA3B 5F9WC 3G3LA 4PRPA 2PCPB 1BBJB 5FYKE 3HS0A 1ZHBB 1ACZA 3QIBC 4X5RA 1BQ5A 2Z31C 2WBJA 3LY6A 4K5LA 3QJVB 3UJIL 1PD6A 3SDAD 1AGEA 1NLDL 1JPSL 2O6FA 5JXEC 2XNXA 4RFEB 1CMOA 1BGYE 5HVGB 1BF8A 4HPHA 1JAEA 4IDJL 3NSFA 4NN5B 3TN0B 4XVJL 4G8IA 5LBVA 5T3ZE 1MZ9A 2EACA 4FERA 1T0MB 3HR5B 2WWKT 5CJQL 4Q9RL 2C9VA 4PYHA 4P9ML 4YXWH 4A7TA 3AGVA 2ICES 2FHCA 2JSFA 3U4BL 5LQBL 4XB8A 2D73A 1FVCB 4YSSA 1MCRA 4PUBH 1UACH 4N90D 4ZOCA 1GAFH 5I1KH 3EFOB 2Y69B 1C12A 4HDIB 3LKNA 4GFXA 1CL7H 3J07A 3MRIB 4LSRH 1USDA 1G2CB 5IHWA 1P84D 2QDVA 2XY1A 4FXGA 1UOKA 4QRPE 2NX5A 3PWUA 4P5KA 1PY4A 2C9SA 5D5MA 5GPRA 5IJCC 5L88L 2XN9B 3WU2H 4N5EC 2MTAA 4OJYA 4CUCA 4WCYL 5ESAB 2A6KA 4YLBA 4A6YA 4UQEA 3ZX1A 3VM5A 3G6JE 4NQSA 1X5KA 2RFXA 4FFWC 4RMTA 3UBXI 1ZXQA 4MAYD 3U0TA 2ZIDA 1YN7B 3AW5A 4N24A 5HI5C 3GMPA 4TTGA 4PIBA 1T20B 1OM9A 4HX1A 3ZHNA 2YHGA 2DWYA 3PNRB 4NM4H 1BZ9B 5C70A 1JFQH 3BT2L 4UQDA 1YEGL 4PD4H 1NBVL 1XCXA 3P02A 2XKUA 4QD2E 4CSSA 5IUSA 1KXVC 1KV7A 3V0IA 4UOZA 2UWEE 1HH6B 3HHSA 1HHIA 4Q0XL 3RDTB 3MBEB 2A45G 2RCSL 1R3KB 1W72B 2XXFA 3SN6N 3B2UD 3E2HB 3VWKB 1W8NA 2NCMA 4OZHF 3ZSTA 1WFJA 1GGIH 3MI6A 3V79C 2D03L 2JWAA 3VNZA 2XPGA 4KI5C 4BSVA 5TQ0H 1NTKJ 3QAZC 2JJWA 1U8CB 4GG8A 3TCXA 1MCBA 1U3HB 1ZIBA 1QSZA 1AE6H 2JB6A 3QNFA 1GC1H 5KVMC 4AM0Q 2P2UA 3AEBC 3TO4B 5DMKB 1SGKA 1JGVL 2XZQL 4WU7B 4JMNA 4KKBC 5GRJH 3PPSA 1GOGA 3HEIB 4KKAD 1MCPL 2A83A 2IALA 3N43B 3H1HE 1JBJA 4K7PX 3IETA 4QWWD 2EDQA 4WLCA 1UOLA 1J11A 2GK0A 1RZ7H 4JZJB 3ALPA 4OWFA 4HIEB 4LE8A 1AGFA 3V6OE 4MB4A 1QMUA 4G1MA 5FV2A 3V5DB 4K8RD 5JYLA 3CN4A 3BAXA 4OLUH 2WQYC 4UV4H 3T77B 3FTWA 1F6LL 1SYSB 1XGUB 1T04A 3ASOB 3PWVA 3LQAL 3Q06A 1BZQK 4QRBA 4W6XB 2PYFA 3DGDA 2O26U 5BMFH 2VM9A 1P4IL 3D3VD 1YNTB 5IMOA 2G5BA 2R51A 2E59A 1XH2A 5C2UB 3EAKA 3GI8L 5HI3C 1JL8A 3MBXH 1CGXA 4CC0A 1UWXH 5CEZH 4DZOA 4IK6A 1TEYA 2DM2A 3ETBJ 3IF4A 4XP9L 1QUNB 3L7FB 3MYJA 5DD3L 1IX2A 5CZRA 5AVXB 1P0SE 3QJFA 1OP4A 3SDXB 1KQGB 3O45B 4J3OC 3F8UB 2VGLM 4N78D 4FFZA 3TIEA 4J2XA 3IKCA 5DUPL 1F90L 3EYUH 4G6AC 5HDWA 4YEFA 4YFEA 1UM4H 3RZCD 3CCEP 2J5LC 3KNBB 1XTLA 2NY5H 4NQEB 1UZ8B 2VQ1A 4FF9A 2IBZX 4Y7OC 5D7LB 9CGTA 3SE9L 1XF2B 3G6DH 3GHBH 1FQ9C 1CGYA 3CCHB 5FYJL 1OXYA 3O4LA 3OHMB 1HCVA 3S5ZA 3RKPA 3GSUA 1AOHA 1NSNH 3GRGA 4LLYB 3EYQD 1KC5H 1N6VA 4YSTA 1WCQA 4POYA 3IMUA 5FKPB 5E8OB 1BLNA 3I55P 3MRPB 2GCYA 1CW5A 1NEZG 4EN3C 3IVKB 3AS1A 1OTUC 5HDRA 1ZE3H 1IV8A 1Q72H 3BUQA 2Y9YA 4Y4KD 4PG9B 1ZOYC 3GXUB 3R7RA 3MAWA 3IJSB 1G7MB 3RIAF 4KHXL 3V5KA 1LP1B 1G7IA 2ZG3A 3RUGF 4WFFD 4F15C 1NEPA 1JEKA 4MFHA 1JZIA 4A37A 4MXVF 2AJSL 5BRZB 3NZHL 1R5VA 4IOIA 2X38A 4PJBA 5F7AA 2IV9A 1CDBA 4JHWL 3EJPA 4OLEA 4K35A 1RIHL 2V4HA 4WFHE 2E7CA 5AD0B 1CI5A 3SGJC 5MP6L 1L0LG 1FE8H 3RVXC 1LEGB 1H3XA 1YZZA 3ARGD 1L5GB 5C3LD 1I7UB 2JWYA 1SYVB 3BP5B 1IE4A 3LNHA 2W0FA 4HT1L 1KJ2H 3M86A 2DH3A 4PRAA 2YA0A 3T4AB 3ARBB 1SQVE 2WSKA 4KMLB 5LAXB 2Z8VC 2O01J 2WAHA 3ARDA 3FOLA 1P4LB 1QRND 5GXBB 3W38A 1LT9A 1X5GA 5K5YA 1XCWA 3PQYA 2XKNA 4OLYL 3I6GB 5JR1H 5TK2A 1KQLA 4P2AA 4NZTH 1XZ0A 2GA1A 2H88C 3P32A 1AFVL 3UZQB 4M7KH 4DERA 5LG1A 3FUIA 1C5BL 5E5MB 4DGYH 4UB0H 5GTIE 5F1NA 1J8HA 1I9IL 2Y6SC 2X6CA 5EO9A 2VW6A 2W65A 4RZKA 3SKJH 3JWOL 1U92B 3ZRSA 4AW4A 1UXWB 4DP2X 3S35X 4HA1A 3UDWA 5F3BB 4CVWA 5JW5A 5IR1B 1HSAA 1VEMA 4LRNH 1N0XH 2Z0BA 1KB9H 4Y2NA 2ERJB 4D9RD 4WW1B 4NN5C 3TT1L 1N86A 4UT9A 1A9BB 2WXIA 1FL6B 3AE7C 1UJ3A 3UTPD 5FGRA 3N41B 4Z7OF 1LXMA 3A22A 2XWXA 3AAZB 4LVOB 4HP5A 1S5IH 2CA3A 1YDPB 1H3WM 4Y9FA 2F68X 1GSKA 1XEDA 3BESR 5ACZA 2DQIL 2X1WL 3CK0L 3NESA 4NQDE 1NTMK 2ZSVB 5EU4B 3GUFA 4EOWL 3BVUA 4DP4X 2IAND 4B0MB 3IGUA 2Z7ZA 3QFDA 1RZFH 4OLVH 4U6XB 2IH1A 3HE7C 4PGEA 3ILPA 4OCXL 1JF1B 1SEQH 1WK0A 2VW7A 3ESOA 1DSFH 4RRPM 3DSFH 2LT9A 1FVEA 3D18B 1LO4H 1JCKA 2EIZB 4ATTA 3D33A 1NFDF 2PCFB 5ACMA 2MKVA 1WFTA 2WQUA 5KOMC 5F96L 3SGKA 2QFPA 5C0NC 1OALA 1J1XH 1W8EA 2OQJB 3BLKA 5G5DA 5I1AB 1C1EH 4RAHA 2OX5A 1H8AA 3HUJA 3FO9A 2G2PA 1AQDA 2FTAA 1W2KT 4WKZB 3U7YL 4BZ2L 4GUPA 4XNZC 2HFFA 1P84I 4ZTOL 5KBNC 4BINA 1KILD 3NSDA 2XRAL 3RDTC 5JOEA 1SJEA 1HINH 3GF3A 2ZWKA 4R96B 3ZYOA 3E2HC 3VWKC 2VDNH 5ADOH 5I1GH 5IVXA 2F8IA 3IAOA 3ZY7A 2OTLP 3FCUB 3MLTB 1SHSA 4M7LL 4FHBD 3KR3H 4UT7H 5D8JL 4XPTL 1U3HC 2X4QB 4FLQA 4DUVA 3FOMB 2OAAA 3TO4C 1KULA 1WSST 1EAQA 2B59A 3FUKA 4PREA 1KENH 2K70A 2BHYA 1RZJC 2ATPB 4HGKC 5C6PB 2OMXA 1Z9SA 2CM6A 2O01N 1D5ZB 4WDIA 4GRLD 3SD5A 4Z7QF 3U6RB 2P46B 4KTGA 3JYCA 4DO4A 4CNIA 1X6LA 2WLLA 4P2RE 2MTPA 3BXNB 3D39D 1HHGA 4JZJC 4MJ5A 2DDQL 1RXLA 2WIMA 2UZIH 1OGAB 1KCSH 2FR4A 4QRSA 5D7SH 2LU5A 5M1BA 5HHQB 3NTCH 2OI9C 1MFMA 2PN5A 1M2VA 4WO4B 3DROA 4JDVA 2HVJA 1TZHA 4J1UA 3SE3C 4JG0L 2OTKE 2QKIC 6FABH 4HV8A 3X11A 1T21B 1IFNA 4WUKL 1YY8A