5AW9B

Kinetics by x-ray crystallography: native e2.mgf42-.2k+ crystal for rb+ bound crystals
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 51
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw9B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw9B02
3P32A 4LC1A 1CZQA 1HUCA 4C46A 2Q3IA 5AW6B 3VMYA 3A7OA 1NAFA 2Q7CA 2ZXEB 1GK6A 2Q5UA 2YNYA 5APVA 5AW9B 3OAKA 2Z5HA 4GKGA 2P67A 1T2KC 3NMDA 3M9BA 3LIEA 3TNUB 5CMZA 5AW1B 1S9KD 2WWWA 1J2JB 3WGUB 1GU5A 5AVWB 2Z5IA 5APYA 1OWAA 3VTPC 5AVQB 3KDPB 3M91A 5AVUB 5AW2B 3IR9A 2R5BA 5AW8B 2WT7A 1MV8A 3HE4A 1KQLA 5AW7B 1JUNA 3O8ZA 2C9NY 1A02J 3I5CA 1IO4A 3TK1A 4RETB 4AQRD 2P7JA 3MGNA 2YO3A 2R5DA 3HE5A 1FOSF 3M0AA 3NXSA 4B86A 3HTKA 2JJLA 2XU6A 4HYTB 4GT1A 5APQA 1GTWA 2E42A 2KP8A 3M0DA 5AVZB 2WPSA 4DZOA 3B8EB 2IPPA 2XZRA 1HWTC 3VMZA 1SP4A 1MUUA 2W6AA 2BASA 2WPRA 1GD2E 3VYIA 3VN0A 3M06A 3NTNA 1G2CB 1FAVA 2WTYA 4RESB 1NWQA 1H89A 2ZFCA 1HJBA 1OXZA 2QM8A 3P7KA 2H7HA 1GZLA 2WT7B 1JNMA 4EOTA 2P2UA 3L36A 2R32A 2E43A 3KQGA 1H88A 4C7NA 4JYCA 4AYCA 2QM7A 5APTA 1YYCA 2W27A 5AW3B 5APSA 1MFZA 3MD0A 1SLQA 5AW0B 4KHXA 1T2KD 3M9HA 5AVSB 4C7NB 3L35A 3T97A 2WPQA 2YO2A 3L37A 2N9BA 1S9KE 1GK4A 4M3LA 1FOSE 3V4WA 1X8YA 2C9LY 5APXA 5AVYB 3A5TA 1A02F 1HBWA 3NFQA 5AW5B 3TNUA 3TYYA 4I6MC 2R3CA 1CSBA 3LIDA 5AVRB 3HE5B 3A3YB 3V5BA 3SWFA 3P8MC 4AUWA 2VRSA 5AVXB 3VMXA 1H8AA 1CI6B 5APWA 5AVTB 4I2LC 4JYBA 3V4QA 2XV5A 3HE4B 5AW4B 3A2AA 5AVVB 1GU4A 3WGVB 1DH3A 1CI6A 3UIAA 5APUA 4XE5B
chains in the Genus database with same CATH superfamily
4AMXA 2COQA 3IFLH 4XBPB 1ZA3A 5IMLA 1G6RB 1J86A 4PP2A 4TQHA 5D4HA 4NS0A 2QJPB 1TDQA 2YRBA 4LOVA 1KFAH 1FF5A 4U6XA 4C56A 2P24A 4CSTA 2DN7A 9PCYA 1ED3B 1XF2A 5DA4A 3ARGB 4GKGA 4IU3A 1O6SA 3QDJA 4JN2B 3KPRB 1SVCP 1MH5B 2JQMA 5FO8B 2PWGA 1A6TA 4MMXC 1JZ8A 5CU9A 1O9ZA 1FI8C 5EU4A 2X53A 1NDGB 2ICWJ 4ODTL 2CMRL 3FTYA 3E80A 5GGSB 5EU7C 4YSCA 1P5VB 1XDTT 3QG7L 2IMNA 3V0AC 3BEVA 1ESOA 2NTFA 4N6JA 1X6NA 2E47A 4L4VE 2ZD0A 2ZX6A 3IWUA 3FCSB 3G5XA 2GABA 2HTLD 3OSKA 4Y4HA 5K59E 4N2KA 4NZUL 1YEHH 4U6YA 4ENED 3AE3C 5DD6B 4N8PA 3B7TA 3WO4C 1FYTE 4M93C 2N3JA 4JKPL 4WFHD 1JGUH 2PW2A 3JQOB 1MUUA 1EDKA 5J06A 1DLHA 4ELDA 4PB9H 3RK2C 5IBLD 3R2PA 4DF9A 2OL3L 3A4EA 3QQDA 4LSVL 2CMRH 1AVYA 1L0XA 4I7ZB 2WZPD 2FYUD 4YPCA 2ZKMX 1D9KC 3VRLF 1QGKB 1HSBB 5CGMA 4D6TD 2CDEA 1ZJAA 3OR7B 3WL9B 4E2OA 3PGCA 4UZGA 3MLTA 3BT2L 3H1HG 3HAEH 2K37A 4HJ0D 1CIUA 2W27A 1J5CA 1Q81Q 2BINA 1TF4A 2O5ZH 1NDMB 2R8SH 3LN5A 3GTNA 4NNXA 4ZTEA 5EFWB 3VI4E 4ZMVA 3Q3DA 1YEFL 3VI3B 5BZWB 2VXVL 1VCBC 4M1CC 4IL6H 1S3RA 2H89C 3VD0A 1A7RL 3E9TA 3RWIB 3C60B 4QT5A 1T20B 2G5BA 3NK4A 1ZA6A 3GM0A 4X7SH 4AE1A 3DUUB 1S7VB 4MB1A 3M8OH 3OKOA 4YZWA 1DBBH 1N5AA 3H9SD 4F37F 3L71E 4LARH 4C57C 1KLFA 1YEDA 1I1CA 1JD9A 3BUTA 4WU7A 2FD6L 2C3VA 2E9BA 2N1TB 3I85A 4XVTL 1THCA 4WHTA 5AZ2L 5LBSL 1DVQA 3L7FB 1KULA 3U2SA 2VSKB 3EH1A 4WGKA 3GMLB 1OTUC 3VDAA 2ZT9B 1NOHA 2JJUA 3HJEA 1ZTXL 3S5YA 5C6WH 4AL8L 4RRPA 4RSYA 3ZKXB 4L23A 1LO4L 2HTLC 2APBA 3BKCL 3WNJA 4Z7WA 1EBPA 1NAMH 3LY6A 2B9AA 4XI5D 1OARH 1EERB 4F8LA 3KVQA 4M7LH 2FYZA 4I3RL 5DDHA 1ZT1A 4L3ED 4PRNA 4W9HC 1DQJB 3OKDA 3O45A 4UUJA 1ZGLP 4OFPA 4A7GF 3AXIA 4U1KA 4OZ4A 4P46B 5DR5L 2FEDD 3AXLB 3CVHL 2KUBA 5KKZC 2FH8A 3TBYA 5LCVA 4BCZA 2P1JA 2BVQA 4W9JC 1AC6A 1B4LA 1D7BA 1PS3A 2SEBA 3FYEB 4JLRA 5FHBH 5A2KH 3CCVP 1NGQL 2WSCJ 2CKBB 2WWKT 1UOLA 1H3TA 1HHHA 3QUZC 5LBSH 3VXNB 4LLQA 3UYPB 2XPGA 4FI6A 4LDEB 3U9WA 2OP4L 1A9EA 1MAJA 2WLKA 1CQKA 1LTTC 2FB4L 3QJHA 4Z95H 3TTSA 1UTDA 4JO2L 3QQ4B 4KK9D 4O9HL 1G9EA 1KTDA 2D31A 1LLAA 2PPEA 2DEYX 1UXSB 3DBXB 5GJSH 5LNGA 5HI4D 4MJJA 2AEMA 1URZA 2ZXXA 2OL3B 1U41A 3LKQB 1PZDA 1BSHA 3T4AB 1JHKL 1G1CA 1OB0A 4X9FA 1J5OL 4NHCL 1NBYB 2HUHA 3KEHA 3FRPA 5E2WL 3H3PH 2VO8A 3T2OA 1Q90D 1Q9KA 2K3HA 4GUOA 1FG2B 1KCLA 1FO0A 2AABH 5I5MA 3ULVH 5CLWA 1LM8V 1L7IH 3LRSA 4X6BB 1LE9A 1HESA 3S5ZA 5J1SC 2E86A 4FABH 1B0GA 2YD5A 1QRNE 4HS3A 1IBHA 4GSUA 4E9XA 4YXKH 2WSPA 3UEQA 5FYKU 2WM0A 4GBXA 1IKFL 4QGTA 2JKTM 4NNPL 2WYHA 1OP5K 1JZ5A 2YBRA 3L95A 4S1SH 1MVFA 5HBBA 3ECUA 4HIJA 5LHDA 1OAYL 1PP9D 3I50L 2WSEH 1MJUL 4IKJA 1S3KH 4NN6C 1QVOB 4R0LA 5H2BA 3ZGIA 1T1XA 4WY4C 3IAOA 3GMRA 2VDRH 4XT1C 2XDHA 2V5SA 4NO0B 2PYEA 4GKOA 3T77B 1FLRL 4DT2A 2KK7A 3WN5A 5KVGH 1BOGA 4NYLA 5EIVA 4ZD3L 1XF5A 4G43B 2HFFA 3SYQA 2A73B 5I1KL 1OHQA 1MJJA 1QFPA 2DY2A 3JVGC 1NGZA 1O9VA 3PY9A 4EIZC 4GI9A 4A7UA 2AQRA 5IKCB 2OYMA 1CFVH 2OV0A 4C56B 1PP9J 3HHSB 3ILQD 1M57B 5FYJL 2XHNA 5C09B 1G1OA 3ULVC 3HS0A 3WAJA 1OSPL 1IVLA 4MD5B 2AEOA 3LV3A 3CHOA 2ZAEB 5JHBA 1I3GL 2D0HA 1NGYA 4HHAB 4WKZA 1VZHA 3FT3A 3FO1A 4MA7H 4ODVH 5CHXA 4G6AD 4Z8FL 1MLCA 3BEVB 4YE4L 2J72A 2J58A 2GTWA 2VSCA 4TLTA 3T71A 3RDTD 3DTXA 3D51A 5MENB 2XJLA 1YRKA 2R4SL 4PM1A 5DVMA 1KYAA 3ULUL 3FFCA 5KSVB 4NDMB 2VZ3A 3RY4A 2WWOA 1LTAC 3GKWL 4ZDHB 3F58L 5AB9A 3Q5RA 1IO4A 3ZW3A 4W80A 4X6DF 2GY7B 3VD3A 2X1QA 3S4SG 1GYVA 1NEZG 2H3KA 2E42A 4W6WB 3FSWA 3M0DC 4EO5A 2XTJE 2X6MA 1PJ9A 4IRJD 1MCLA 4JFYA 3VWJA 1HH6A 4OV5B 1H0TB 5DHYB 1R5WB 2R7EB 5JXED 3NA4A 2P5EA 1W72H 2A4ZA 3DVGB 1U3HC 1NVOA 1U8PB 1UUSA 4BXLA 3Q8FA 5KN5B 5GGUB 4HIQA 4OZFH 4YUEL 3CBKB 3JWDL 4HS8H 3H1ZA 3TJHC 5TGBA 3OKNA 2NW3A 3HE7B 2NYYD 4XTRD 2OTUB 4P07A 3WE6B 5FF6A 4TUJA 1KZQA 1NTZJ 3QJOA 3TH2T 5KTEH 5EF3A 3L3DA 2R0WH 1IBZA 4KVCH 4P2YA 1ODUA 4QEGA 4YDJA 2FJSA 3KBPA 1K8IB 4NM4H 5CM1A 2P46B 4Y4HC 3ZY7A 1T2KD 3LKNA 3IKCB 3ZQ9A 4DIXA 2P24B 4JQXC 4NZUH 4MRCA 3BKJL 1DJGA 1J0JA 3HG1B 2DQTL 5FX3A 1XGYH 1U8LA 3FBKA 2CK3H 4JY6B 3L74E 2GUVA 1JZJA 1P5UC 2VDRL 1A6VL 2FECL 4GY4A 4OGAD 4U3FG 1WAPA 4YHOL 3UG3A 1P6AB 5MHSE 1GSKA 2GITB 3IDXL 3GI9H 1UZ6F 3VFPB 1FORH 3EBHA 3FL7A 5IVXE 3HNVH 4NAQA 2VLKD 2C1PA 5D7SH 5D1QC 5AKRA 4Z23A 4KKNA 1PZ5B 5DK0A 1HGZA 1RZKL 4W9EC 4K7FB 3NRPA 2XBZA 2OJ1A 4MMZA 5C08D 5CN3A 3BUIA 2KL6A 2YUXA 3VYPA 5D8JH 2W9DH 5FA4A 2KQNA 1IIIA 4MBOA 5G55A 4E36A 1A2YB 3N06B 3TN0D 2OARA 2Q5UA 4ABQA 4AG4L 5HD8C 2UYLA 3T0WA 3FYIB 1VF5B 3MN8A 3SBWC 3X1NA 1SQXD 2WXFA 5E8OB 1UZGA 3FTGB 3EYUH 5E79E 1XGYL 2RFXB 3VWJC 1MVYA 3IFOB 4UV7L 5AYTA 4DQOL 4WFED 2J1KA 3NJIA 1DVFA 2DLFL 2YKLL 2ZUSA 1BCCE 5EOCJ 2BVQB 4ZW8A 2F68X 1SXZA 1FE8H 1SBSH 5SWZD 3VRLE 5A2JH 4HC1A 1VQ9P 5GZND 4QHNB 1QSED 1GKEA 4JKNA 3KYKH 1GL2A 3OC8A 1RHFA 3PJSK 2VIRA 3JV4B 4G8IA 4JHAH 3N2JA 1A8ZA 1BYPA 4H0IA 4A39A 5HGHA 2IWGA 1XH2A 4GAYA 1WQVT 5ISZA 4D2NA 1UT9A 2AQ2A 3DBXA 2G9HA 3MTUE 2XN0A 3EGDB 4Q52A 4UAHA 2KPWA 3V52H 4RDBA 2Q7AA 1NAMB 4OZIF 1AOZA 4A2EA 5JHMA 5GSRB 4YDMA 4IS6B 2ZNXA 3ETBJ 1SP4A 2BOLA 2F54B 4MJ6B 1KB9E 5JQ6L 3SFEC 4GBXD 4IMKA 4YTPC 3VFOB 5JO5A 3NZHL 1MI5A 2OQJA 1NZRA 2HPOA 3FTSA 4KDTC 4I89A 4UOQA 4X6BA 3P7KA 1TENA 3BASA 3GLEA 4HWBL 4XP5H 1N59B 5KS9B 1KYOJ 3G5ZB 4K3EH 2PF6A 3PWPD 5F0JB 5E23A 2DYSB 2M2DA 4AGNA 3UOAB 3F04A 2K1AA 2YFNA 2VLKA 3RE0A 3WDHA 4L8BB 5CLXA 3CFKB 2VLRE 3WOVA 3BVNA 1WAAE 4IGBD 3F7LA 3QXVA 4JRYD 4AENB 1KB9K 1QW9A 1Y07A 2JB6B 2W0LA 1LTIC 1IAOB 2WYTA 2XQ0A 3MIWA 1TQTA 1U8HA 3CXHK 5DXWA 5H2BB 4BCXA 1EFXD 4JFDE 4K15A 1NKGA 3ZT7A 1SJXA 2BK8A 4BH8A 4NO0A 5BRZD 2HLEB 1CZ8H 4NYLB 3A0OA 2OULB 1JGLH 4D0BB 2WQ8A 5IB3A 3AQZA 3REWA 4GS7C 4X8JB 1VFAA 2HT2D 4FHKA 4AT6B 2GEEA 4KKAD 2FT7A 2GT9A 3H1KE 5HI3D 3WY3A 4OFIA 5H37H 3CL3D 3HAEB 4ZYKB 2W6BA 3KHQA 5HJ3B 2V0AA 2N56A 1OP4A 5IW6A 5DHVB 2QKIB 2IQAA 2V5TA 3GZPA 5TQ2L 4K7PY 2R3SA 1PGRB 2VDOL 3T0EE 2WSCH 2LLNA 3VXNA 2WZ5A 3RIAK 4WEMB 2VDOB 3EO9L 4Y4KD 3QNXA 3IDJB 4FHJA 1J1PL 5TK4A 4FN0A 4HHAA 2VKXA 2MHAB 4PJ0H 3BH8B 5E6ZA 4GW5A 3TL5A 3H54A 5C6PB 2WXIA 5FLUA 4Q0XL 5K69A 4Q56A 4NERA 2E4FA 5G5DA 4L0YA 4RKUJ 4CMHB 2JKLA 3MRPA 4M8UA 3V0JA 3VQMA 1GW4A 1L0QA 3KMDA 2YLKA 4YHYC 4OZHA 2AQNA 3JV6B 3TV3H 2VXUL 3AY4A 4FJ6A 4OKDA 3DXAB 1BEXA 2W5PA 4P2RD 5EZJB 1FL3B 4X5WA 1W2BO 2CJTA 4JO1H 4RISH 3V10A 1ZE3C 1MNNA 4WJ5B 3E8UL 1N10A 1SFCD 1FOSF 1I75A 3RTQC 4LKCA 1CGTA 1MPAH 4NNYB 3PL6C 4U0RC 3UO1H 1M56B 3IRCA 2AC0A 1H0TA 2PP6A 4XE0A 2XZQL 1FL6A 1ICTA 3H1JJ 1XGPB 2IV9A 3S5LB 4YWGL 5JPNC 5JDSB 3FRUB 4JAMB 1U8PA 3KHOA 1GTFA 1XGTA 3ECWA 4I8DA 1WS8A 3INUL 5IJDC 1TQWA 3NJVA 5L0QC 3MJ6A 3CZLA 1ZRTE 4RFEB 4UZSA 3NGBB 2N1TC 2FB4H 4Z95L 4Z7QB 3HUSB 1QTYT 3HE7A 3IT8D 2JXMB 1ZEAH 3WN5B 4MA7L 4ODVL 4G43A 1NAML 1MIMH 5IV2A 2LVEA 1GSMA 4XMZA 3TLRA 1E9OA 3WEBA 2I9TB 1NGZB 4KX7A 2CM6A 3SJVE 3V4UH 3ABGA 2XNAA 3FCUB 3V4LA 2YAPA 5DZPA 3BOVA 2I24N 3IJSA 1QR1B 1DQLL 3EOAA 1OLZA 3HG5A 4PUBH 2CCVA 2YQ2A 4MJIE 1MN4A 3MZTA 3VG9C 4JKWA 5TDNA 5C0BD 2CLZB 3QCUL 4Z7VF 1ILSA 2WWKO 3GHPA 4NSKA 2XXCB 3N55A 4PWFA 4NIYE 3B5NC 4WKZB 5B21A 1J1DB 5I74B 1KBGH 4CC4C 4I9XA 3K80A 4FMVA 5I1HL 5IVXF 2BHFA 1U7MA 2PN5A 3LS4L 4PGDB 3QJRB 3ESPA 3A6BH 3Q1SH 2ZXGA 3WNKA 3I50H 1HHKB 2ZWZA 4I1LA 2ITCA 3HBQA 4JB9L 5KSVA 4UNTA 1ZIBA 2WJ7A 2X1PA 3HZ3A 2ZCKL 3P9WB 4EN3B 5ADPH 4J1UA 1Z32X 3U1SH 5F3FA 3MUY1 4LL9A 3AWEA 4ONGH 1AJ7L 1NLBH 1A2YA 2ZAHA 3P3RA 3IJHA 3HMXL 2HFTA 2VR5A 1HEJC 3OJAB 1FFOA 2VXVH 3WU1A 1W8EA 1NC2B 2XG5B 5IVOA 3QXDA 2QA4P 2Z0UA 4Z7NB 2LVCA 1IAKB 1CYXA 4MMYB 2Y7SA 4YC2B 3SGDH 1ITBB 1JHLH 2DTSA 2NPSC 1A7OH 4L4TD 5F44A 2BWDA 2VJXA 5E2UH 5B38A 3RTQD 4JHAL 3UP6A 3DK0A 4MXQD 4P2CG 1IFRA 3DVGA 1AZVA 3REVA 5DHDA 3UFIA 3CMOL 4QHNA 4Y4FA 4F7CA 4AG4H 1D9KA 5IM7A 1VGEH 1S2EA 5F7KC 3BWUF 2ESVB 1QLFA 4OLYL 4G8IB 4AM0A 5J11C 1T22B 3B1UA 2EO7A 4GAJH 5AAWA 4UQEA 2WSDA 5IOPB 4A6YB 3EYVB 1GZQB 1X7SA 2CAKA 4HJGA 1ADQA 3SOBL 5IBUB 5ICUA 1RQVA 4MNQD 3VD4A 2E4TA 5GSRA 1KCRL 1XBDA 2LABA 2A74A 1YEIL 4L1LA 5EWIH 3ISWA 3OBAA 2R83A 1ADQL 1Z2KA 3IRZA 1K4DB 1CBJA 2GSIB 2B89A 2P28B 1JGEB 4H4NA 2C7UB 5IQ9A 1GH7A 4FZEL 1EGJL 5C0JA 5SWSB 2VXQA 1JGVL 1QYGL 4JL2A 4ZKUA 3ASWA 1L9MA 4IJTA 1E6OL 4W9IC 4J28A 2WT7B 4JANB 5DRWB 5DC0A 1HCZA 3ZTJH 4PJFA 5K9QG 1W5CE 3CFKA 1PZ5A 5DK0B 5C6TH 2KB7P 4JM2D 1DJWA 4XC1L 1G1KA 4EDFA 1DQIA 4ALAC 2DQEL 4PG2A 1X4XA 3UDWA 4HPYH 4HWBH 4G3YL 4MDRA 3U4EB 5ERWB 3MSPA 4J5VA 4W81A 5I0YA 5ADOH 4KO9A 4Y16B 4ENEC 5EF2A 2KI6A 2PXYC 3G08B 4EI2A 3L17A 3PV6B 3UGUA 5IVXB 2Q86B 1WFIA 2WTOA 4E9RA 2FLRT 3K71B 4WI5A 2ZKYA 4AUJA 1FNAA 1EV2E 3N9GL 3FQ4A 4LSRH 3NCMA 3MRJA 4P23A 4EZLA 4YSSA 1BXAA 4PJDF 3SIKA 3GMMB 1KEGH 4P4RB 1HN1A 3FK3A 4Y2DB 1NGPL 5K5GB 4XP1H 3MLRL 4JRXE 1M7IB 1OVVA 4FG4A 4JPSA 4MXQC 2EUVA 1A7RH 3A2AA 1D9KD 3TO4A 3QH3A 1D6EB 3JV4A 4ZZKA 2YPLE 1WGOA 3CDCA 4EXPX 1USDA 4GKNB 5IJKA 1X5IA 3EYOB 4DZ8A 3LIZA 1AD0A 1ZLDA 3LH2L 3FNKA 4JUTA 2PCXA 4OQTL 3RHWF 5BVPH 3LNFA 2BOBA 4JREC 3EH5B 1AACA 4JRYA 1BGXH 1XR8B 3DJ9A 4U6TA 2HLAB 1L6XA 5GGRB 4U3FJ 1G43A 2FHFA 2GKIA 3O2DL 3PJLA 1KT2B 1T4KA 4WTQA 3DRTB 4FFYL 1HSAA 2CHWA 3HC3L 4WFEE 1I31A 3QUXA 4AQEB 5KBKA 2E27L 1N7MH 1JWUB 5D7HA 2PGDA 4F8OA 3L75G 3AE6C 3CSFA 1N6QH 4APQC 4JCWA 2GUOA 3D4CA 3MGTB 4LSUL 3BP5A 3ZDYF 3SYOA 2YSSA 4L4JA 4NQDE 2BLFA 1OGSA 3S9DB 3D2UB 1A02J 2IADB 2QV2A 3HTKB 4OD1H 3MRQA 3PAUA 3QB7C 1RUAL 1URLA 1GGIH 1I8MA 3LXBA 2H0EA 3UMNA 3DUSB 3MRIB 4UB8E 3MODH 2OTLP 1KYOE 5APQA 3HZVB 1RVFL 2QZ5A 3GM8A 4QO1A 3RB5A 5EOCL 2AEPL 2X2YA 5B7MA 4NI3A 4YSEA 3APCA 4U7KA 1EGJH 2FIKB 2VDQL 3EJZD 4BRJA 3LRHA 1RK7A 4CU7A 2B0SH 2IZ0A 1BPLB 3IF1B 1Z5HA 2OCFD 4CC1A 4NQEA 1GGCL 4ZNCD 1HILB 3A24A 2Q2EB 1U8QA 2Y3AA 3C6LC 4XCCH 4XN7A 5D1QB 3N3EA 4H26A 1IBGL 3P9MB 2IGFH 2PPFA 4D9LL 4TYUA 1KG0A 2P44B 1AXSB 2YAQA 1JRHH 2EYTB 1VZGA 43CAB 1M90Q 2Q3EA 2JH2A 4IIQC 5ESAA 3PHSA 2FEDC 2P5WA 3BVDB 4UQ2B 4JQXA 3TBSB 1R3JB 1BPVA 2IBZY 3HE6A 5JW4Q 4OLEA 2H26A 1UOVA 1M2OA 1GJIA 3VGAB 3KXFA 3MA9L 4PB0H 5GGVL 3OW2O 3UC0L 1WG3A 4L4TE 3MJ8B 4A2GA 4F9LC 4JO1L 4RISL 3GZQA 1JNHB 4D7BA 1T6WA 3CBRA 5EPMA 1DBKH 1SHXA 5B8CA 1VKXA 1CXEA 2H32B 4LOUC 1HBWA 4ZFZB 4PGDA 1VFMA 4WY7H 3BH9A 1OZHA 2VISB 2FJHA 1EVUA 3RX8A 3WXWL 4I0PA 5F7MC 4P8QA 4OGZA 1ITCA 1DL7H 4XWGL 3DX9A 1RF0A 3JWDH 5F1IB 2Z64C 1YQ3C 1UWXH 2ZSVA 1N5YH 2ZUYA 3S35X 3QHZL 2FWSA 1D5BA 2W80C 3BQUD 4ETQB 1Q82Q 2J88H 3LNHA 4AKOA 1U6AH 4V1DB 4O2CB 1S9YB 5E1HB 4LRNH 1LO0L 2CU9A 3EDEA 5AUMB 4HULB 1AXTL 4GRLB 3IDYC 1CE1L 1QA9A 2YQGA 2HMIC 5E9DE 4ONFH 5M1BA 2YUZA 1BFTA 3P4OB 4G5ZL 1GY2A 2YPLB 2BFVL 4PJ5A 5I1CH 1AA0A 4LSDA 4OT1H 5KLVJ 4U1LB 5G2NA 1MEXH 1CS6A 2CALA 2JWDA 3QUML 4EI5C 4Y2LA 2CR6A 3M1BB 4MCZA 4JKLA 1OVZA 3ZL4H 3CXDH 1H3WM 4YFEA 4PWIA 4AZ8B 1UZ8A 2V2XA 2WBXA 4WUUB 2JJTA 1EJ8A 4ZTOH 4WW2F 4QAWA 4R4FL 4HIPA 2K9JB 3MXWL 4KRMB 2P8PB 3EFOA 4A6YA 1JUFA 1RMFL 3NJKA 3LQZB 3NESA 1YIJP 3TM6A 1GS6X 3BGFB 35C8L 1A9BA 3PWUA 4R26L 3WMQA 1EFQA 3D0VB 4G6KL 1N18A 4NJ9H 3D70A 4KZEH 1E4XH 2MJZA 3ARDD 1ZN5A 3N1MC 4OFYD 4WI2A 5F7YC 1RLBA 3ZKMD 5D72L 1MRFH 2ESVD 4YHIA 4X7TA 5D96B 4XOEA 1M1KQ 4U1SB 5MEPB 4PJXB 2WPSA 1DN2A 2VDRB 2WNWA 4N24A 3ZDWA 3QPQC 3NJNA 1KMGA 4KKBC 4AJYV 4KAQL 5B22A 4DPBX 3MAWA 4PP1C 3DPDA 4KK5D 4R7NB 5C6TL 3BKML 2MNUA 4P5KB 5I66A 1CDHA 1KILE 1M1JB 5E1IA 3RY6A 1T89C 4GG6E 5CP7B 5FK9B 4ZPVA 5AALA 7CGTA 4LEOB 4KHXH 3RY6C 3Q5OA 1I82A 3H1IG 5T1JA 3LZOA 3RPIA 2YGOA 2L04A 1B88A 3LKOA 5I1AB 3PF2A 4J3UA 4G8FB 4EVNB 2VDQB 3SKUD 4E9SA 3DYPA 1HCYA 3PL6A 4U1MB 4UNUA 5HXMA 4IBTA 6FABL 4L8DB 5DJCA 1LNQA 5KLVK 3L8QA 1IGMH 3PU7A 5E00B 2QMKA 2CDFB 3F7KA 3X13A 1QUNB 3ARFB 4PLKC 3BIKA 1Z9MA 5FKAB 1DZ0A 3ALWA 1M9WA 1LMKA 1QL1A 2A9BA 3SOBH 5KVFL 3K71A 4HS8L 3RWEB 3THML 3L72G 3NRFA 3DO3A 3M6DA 2IGLA 3CHXA 3JWNH 1XIWC 2J8UF 2IAMB 3VFVA 4HH8A 3GMMA 3VM7A 2AK4E 3VMOA 2QFRA 4L4VB 5DWPA 2ZWYA 1AQKH 4FKKA 3ZIYA 4E0RA 3J8F7 4P2QD 2AJUL 3FT2B 3E9UA 4I2XB 4F33A 2R29H 3ROOB 3D8MA 4YDIL 1YPZA 4AQAA 1X5AA 2WNGA 2ZP9A 4XCEB 4NKMB 5IJVA 3L4ZA 4MS8D 1EEZA 4JFHD 1C1EH 3O6LL 4X4MA 3NA9H 5TE6H 1PLGH 2K8QA 4A2HA 3L5WA 4O4YL 5E4EC 1O6SB 2Y24A 3KNBA 3EYVA 4F58H 4HJGB 1NAKL 3ECBA 2XBDA 4NCC2 4WTZA 5E1GA 3L72D 1NC4D 1JFQH 5DR5H 4EZJA 2FGWL 3BE1L 1T4KB 3CDFA 2WBWB 4MZ3A 4MN4C 4NQEE 4QRUA 4ZO9A 3N0AA 4Y19B 3HBGA 4Y4HD 3VXRB 2UZYA 1U21A 2NZ9D 4N0YH 3CUPA 4YL9A 5T1KB 3CIQA 1GGIL 1JNJA 1ETZB 4PW4A 3U7AA 3GJFH 2H3XC 4LGRB 5H2FE 2YSSB 1EDIA 4JFVA 4LPCA 1U3JA 4PWEA 2ERJC 4NC0B 4URTB 3RVWC 1FDIA 3SQOL 2ZWLT 1YA5A 2WT7A 4JANA 2V3DA 5JZ7D 3U4BH 4Z78B 3Q01A 5BRPA 3GW6A 3KPQB 1CMOA 4OZIB 2FYUG 1CD1B 1WBXA 3IB4A 1ZMYA 2D9CA 2YD0A 2PW2B 2FD6H 3AGWA 1L3WA 4MB3A 1JZIA 5FV1L 1SQBK 4M5YL 1ZS2A 1UXMA 1OTSD 1E2VA 1J1DC 4IU2A 1A3LH 4G8GE 2LV4A 3IRPX 4XX1E 3AEEC 3GXNA 5D2LB 1LWUB 5HD8D 3RZWA 4X6CE 3TN0C 2VDPH 4BFNA 2XQYG 3S1KA 3QUHA 1ZLVK 3MUDC 4PLKD 1OGTB 2FAUA 1BQ5A 1JFHA 3EDDA 1SQBG 2XN9B 3OVUB 3KGUA 3PQYD 3QC5X 1DO5A 4RWYH 1AR1D 4PCTA 4MXWH 3RA7L 1P84K 1DN0B 5D7KE 2YK1L 3VG0H 3U79A 5LXGH 1MEXL 2AP2A 3EJYC 1H6TA 2AJ3B 4QT5B 3KG5A 4JN1L 1U8IA 4CADB 4F7EA 2VLRA 4HGKC 5E6RB 2JDIH 3MRLB 3HNSH 3L3GB 5BJTA 3OZ9L 3QJFB 4Z6AT 2BOBB 3U7YH 2YA2A 4MFHA 2XKMA 2H1XA 1FZEA 1KLFB 3KLSA 5DFAA 2X4RB 3RKDC 3ZE0B 4ZMLA 4XP9H 5F8RC 2DI9A 4U33A 5FA3B 2CPSA 3OMAB 5FO7A 4S0HA 2V6HA 3DRTA 1DQTA 2ZYDA 4MD0B 1XH3A 4HIIB 4OCMC 1ND0A 4WUKL 3EKCA 3ZHFA 5DZNA 3A0HH 1P1VA 4K8RC 3IMSA 1PBYA 2JWYA 4HXAH 1MCDA 4QCIA 4X7FC 3IJEA 3TA3C 3FU8A 1N73C 4A7GA 6PAZA 1PQZA 1R34A 4JZNA 3T3ME 2BS8A 2C4FU 1JI1A 3L3JA 4GRLA 4GAGH 3KE0A 1T66D 1N0XH 3QEGL 4PIBA 4Y9CA 3OKKA 5KAFE 5ACZB 2OTPA 4OLWL 2IADA 4PY7A 5IQNA 4IIQA 5SX4H 1YNKL 3SZ6A 3OD3A 1JFQL 3V0GA 1E79H 1R3HB 1KB5H 2H5UA 3D71A 3BIBX 3CZKA 2AXJA 5DJ0A 3ZTNL 2P42B 1T1WB 5KSUB 5T3ZH 3M1BA 4MCZB 4TUOB 4XAWL 2E7LA 1T6AA 4IBSA 2HPCB 2RMZA 2F5AL 3FF8A 1HOCA 3HZKA 4FQXA 4ZQKA 1F4YH 3BPNB 3II2A 1S7XA 1EXJA 4GQQA 1HAWA 3O11B 4KXZI 5CMZA 5EZLA 5HHMD 3RVTD 1A1NA 2P80A 5I1LA 1RE4A 4FXGC 4EKJA 5JA9A 1C7SA 5EOTA 3LQZA 3MDJA 3RWJA 1JVOA 3ENEA 4HUUA 5IHUH 2GJJA 3ORJA 4K9EC 1AXSA 3JC22 3SPJA 4PJIA 1NCCH 1RF0C 3NCXA 2Z34A 1FJPA 3BP7B 1FZJB 2NQDA 3PFUA 3RILA 4RFOH 1WRGA 2AK4A 3IN6A 2DKUA 4ZTOL 1RZPA 2R2EA 3VXSA 5LXGL 1HHJB 1O6TA 4YXKL 4Y16D 1AR1C 1RJLA 4LCIH 3MUHL 4F2ME 5KVMC 1OO2A 2VABB 3EYSL 2X4OA 4BZ1A 1NBCA 2XICA 1PLCA 1UB5B 3VFSB 2CXGA 4K23H 1LGVA 2EE6A 2YAFA 2KOGA 4ZPVB 2BEQD 3GB7B 2MCG1 1CC3A 1BD2B 5I17B 3AS0A 3NIGB 3UPRB 1J9CT 1FZAA 4XX1G 1G7HA 3SSUA 5DUPH 1YPZE 3TO2A 2Y0CA 5LDUA 5CCKH 3PNRB 3L9RA 1XGUB 1FO0H 1MELA 1MVUA 3PPEA 1VERA 1T3FA 4LSSL 1ZVSA 2GUYA 4N0UB 5ESVB 3L3KB 3II3A 2YBRB 1JXJA 3B7SA 2WNKA 2DQHL 4HIXL 5EZIL 1QUNA 2A6IA 3ARFA 1LTJB 4BELD 3WIFA 1DR9A 4JVPA 3HRZA 1Q9WB 3CDGA 3UDWC 3L73J 1A6PA 1KYOI 4H1LA 5HYJD 2V7NA 4PJHF 2ZUQC 3GMQB 2XQYA 3BCCE 5E0FA 3V5DA 4LCWB 1A14H 2IWKA 2IAMA 3DK2A 5J57B 4HG4J 4N6QA 1XF5B 3F00A 2A73A 3T4AC 3EQ2A 1Q9LA 2BZCA 1REIA 4GW1B 3QUKB 3KBFA 4F15C 5LBSA 3CIAA 4DP0X 3FT2A 3ZMNA 4F33B 1WD8A 5B4MD 5KJRL 2OMUA 4D94A 2W9DL 1BCCJ 1JF5A 2B77A 1QKZL 1S9XB 3QW9A 2LU3A 5CJ5A 1X6LA 2BIMA 2YXVA 4G72B 4BIKA 2ROXA 2Z4QB 2AITA 4Z1PA 2XV5A 2WXNA 3EYUL 3UZEC 4YDNA 2Y23A 2I69A 4Y5XA 4MD5A 3UAJC 5HYQA 1XSKA 1Q0EA 1JRHI 4UIMA 2I32A 4L48A 3ZE1B 2IYOA 4LGDE 1I4FB 5E9DD 1MFCL 5K1NA 3SQOH 3JUYA 1EMTH 4X7TB 4H44B 1U9KA 4R4BB 3V0VA 4WY4B 2CO6B 4RGND 1MHEA 3CE1A 1QFWH 4ZK8A 3CWBE 2GM4A 2WO3B 3K5RA 2HR3A 3NT0A 4HK3J 2ICEA 3K72A 3OQRA 3HD7B 1BEYH 4K4KA 1YEEL 5CP7A 5FK9A 3V7AE 1Z5LB 2EUZA 1BQSA 2V7QJ 1EPFA 5CCGD 3PREA 4OF7A 3ZHDA 2GCYA 1K2DA 2ZOOA 4YHNB 1M05B 2XVGA 4P46C 4OZIA 1JV2B 3ZHLA 4IOSA 2FT6A 5EB9A 5K33A 1L9OA 1E8WA 4JPVL 5F3HB 3SJVD 5I5RA 5IHZB 2ED6A 2PTTB 4PJXE 5IB5B 1X7QB 2C9NY 2N0KA 5IWLC 3QXWA 4L8CA 4DP6X 3MRKB 1LTSC 1YEIH 5DZ9A 5FM5O 1LNUA 4AQRD 5B7FA 1HINH 3U82B 5TE6L 3NFNA 1EHAA 4ODTH 5FFGA 2CDFA 3CCSP 3X13B 1P84J 1H15A 1L0PA 4ODXB 3L4XA 1AZCA 3DI2B 2K4AA 4FNLH 4JMNA 2ZJSL 5TJWK 4GSDL 3OKYA 1T83C 2J12B 1I1AB 2Q8AL 3WNNA 4RGOH 2NPSD 2J8UA 4W4OC 3NUKA 4OI9A 2KERA 1FFPB 1QVGO 3Q1MA 1IFIA 2C9RA 5KYXA 2BNRD 3NJGA 5HHNA 2P7TB 1N7LA 3ELAT 4KJWD 1JZ3A 4ONHB 2O1JA 2YPKB 1EEZB 3P2DA 3MV8A 1U8IB 4CADA 4F7EB 2VLRB 1KCUL 3RL0C 2FX8L 3GSNA 3TT1H 1N0LA 3DX1A 5F1NA 3L3IA 3VSTA 1AG6A 1T2JA 3OL2A 2X12A 3QBTB 4WQOA 3HG2A 1YVLA 3BMVA 4LLMA 5ENWB 1FYHB 3O0RL 2VL5B 2Z31D 4RMTA 2FVNA 5I8KL 1FNSL 2LLGA 3N42F 2W6JH 1YQ2A 4GKLA 3OV6A 4IEFB 5TE4H 5T1MB 5HHME 4CNIA 5IB4B 1P53A 5JPNA 2WGNB 2OCCB 4KZDH 1G9ML 3O4LD 5T1KA 1LP9F 4Z7UF 3I6LD 4MQSB 3WUTA 3E7KA 1X44A 2BW5A 2HRHA 2P43B 5CEYA 3CSTA 4H8VA 5J1AB 4DUWA 1S5LX 3L3JB 4P5TB 3GRWA 3B6SB 1OE3A 4DNLA 1NU1G 4WHCA 3RK3B 2VLME 1T0NB 2QQLL 2X38A 4OU3A 2VL4A 4OM0L 5ICZA 2WZ0A 5FPIA 4AUUA 4Y19D 1F2XK 1SF5A 2WCSA 2ARJQ 4XXDB 1R4XA 3N42B 3PAYA 3ZR5A 4CSPA 4Z7OE 1GW3A 1HUCA 2YD3A 2X2HA 4KKCD 2Q7CA 1IUZA 3MCLH 1RUMH 1DVFB 1UWEH 5MEOA 4HISA 1GK6A 1S7XB 5EA0L 3RL1B 5ITBL 3O11A 5JORB 1I1YA 4P3WA 2OTKE 2BSCA 1ZHLB 2NDGA 5B1CA 1EEQA 5DQ9B 3CVIH 2H45A 4G1EA 3UC2A 2J6EH 4IQHA 3B5NA 2J1YA 1GGTA 1H0DB 4QRPD 4DK6A 2VTFA 3B9DA 4PJIB 3FN9A 2X9WA 4P5SA 1NYHA 1F3DJ 5LGYA 3GO1H 4WU5B 4NP4H 5J6SA 2FLBT 1CUOA 3ABLB 4TSAH 1LT1A 1LEIB 2CKNA 4W4NA 2JO1A 1Q94B 1KN4H 1RQ5A 2CO4A 4X80L 3MI6A 4ZOCA 3VSUA 4JF7A 1FGVH 1X5KA 1VPCA 2CQVA 4W6XB 3VFTA 3W11D 4LPYA 4NCC1 2HRGA 4MJ6A 4C55A 4N87A 1UB5A 1ODAA 3T0VA 4ACTA 1HEZA 1TYRA 3VFOA 1BCCD 3P30H 4MZ2A 3H8NA 2JF1A 1JCDA 2IX7C 3PHLA 1BG9A 3B8EB 3CCJP 1MSPA 2IPPA 1I3UA 3LEXA 4LDCA 4N22A 3N1PC 4WF7A 3N43B 1T7YA 5A6MA 3QVAA 3IMBA 1GIGH 1MCWM 3SGEI 5I9QB 2G2RA 4JM2F 2L7UA 2D8KA 2ZWNA 3R18A 4IMLB 5I74C 3BMWA 1JZFA 1SYSB 3ZMRA 4KPHL 1V8HA 4XHJD 2H2PC 1WIPA 2WQSA 3FSZA 2IANB 4QRSB 5E4EB 1ZR4A 2EIEA 3ZHKA 3ISYA 4FZEH 5DJ2B 4BK5C 4IRSD 2OL3H 2FX9H 5C07A 3BVNB 3W38A 1TQBB 3Q9PA 3US0A 1OAKL 2ZOTA 3T0XA 1Q9WA 3UBXG 4YFLI 3TASA 5GJSL 2CHNA 4HALA 1WUZA 1AE6H 1B4JL 3MNZA 5BS0B 5TQ2H 5APSA 5FUCC 3QIUB 4XMPL 3GTTA 5C0FB 2E8YA 3HPLA 4P4KB 5DS8B 4D0BA 3HG4A 4P5MB 2HLFC 5KSUA 1YY8B 2IGFL 4BA0A 1NIDA 5BV7H 2Y5QA 3MO1A 3I84A 3OKLA 5DO2C 5AD0B 5FEBA 3JWOL 3H7BB 4YC2C 1QL2A 2WXJA 2Q9OA 3KLAB 5DSCA 1Z9PA 5KLVG 3EJUA 2EDYA 2Z8RA 4CGUB 3B2DC 3IJ7A 3CFCL 3S8FB 1L0LD 1WPCA 2WW8A 1OZTG 3QFDB 3SDAB 2B16A 3WCYA 3SCMB 4JG1H 4HUNB 5DVNA 2OSLB 2Z4QA 3V6ZA 1H3UA 3V4PA 3QZWA 4LMQE 5AVTB 2QPSA 2DIAA 2QPDB 3GI8L 1BFVL 3L4UA 4M5SA 4PV8B 1WHPA 3WKML 3BH8A 3IGUA 3UTSB 1SDDA 3NIDB 1ZEAL 3WGVB 1N12A 3VB9A 2C3HA 3V9CA 2LLLA 4HLEA 2BJML 4MX7A 1D5ZB 4HIXH 3DXAD 5G5DB 3VCLB 1OMIA 4JO4H 2ZCHL 1TEGA 4MXWL 3RA7H 3RUGF 3U1SL 3IS0X 1JHTB 3MX0A 1XB3A 2TRYA 2ZF8A 3B9KB 4JDVB 4V1DD 1L7TL 1W6LA 1TKWA 5EOQH 2Y7NA 1HQ4A 2PR9A 1JPST 4EUPB 2VDKB 5EZJA 4YE0A 4U1NA 1O6VA 1PYWB 3D2TA 5GIRA 1X0TA 1K2DB 2A45G 2X4QA 4DP8X 2G4GA 2RN0A 2V2WB 1AANA 2RH0A 4OW6A 1CI5A 1K73Q 1CPUA 4JPQA 4LKCB 3IR9A 4PD4D 3DI3B 5MENE 4QY8A 5L2KE 3MLUL 2H9GA 2LQRA 3ARBA 3CZNA 4AQ8C 3O8ZA 4YBLC 3HZYB 3N85L 1PZQA 3O6KL 4F9LA 3EFDL 1OSZA 1BZ7B 2CCLA 4DOJA 1OAZH 2ZX8A 4XVSL 3IGAB 2BHYA 4PRHE 4XNMA 4ZMOA 3HBPA 2KP8A 1YN7A 2C1OB 1J8HB 2DF3A 2OGUA 3NVQA 2CPCA 2XXMB 1KBKA 4JFPB 3HEIB 4ZOBA 3NN8A 4C83B 2QTEA 2XIBA 4ZUWA 3HBZA 1HL8A 4KH9A 2DL9A 1NIBA 4GG6A 1DD3A 1T2QL 2VW6A 4NFBA 4FQCH 4HPOH 5DEJA 3VN0A 1XL6A 2YPVL 5F7AA 4ZO6A 5SV3A 1JMXA 2NY0C 1J10A 3MV8B 2NY7H 4OCRH 4OLXH 4WFFD 1X4YA 3NZUA 2ZX9A 2XG4B 3OSVA 4P9ML 5JXAH 4D9RE 5CEZE 5C70A 4XMLL 4G7QB 1BXXA 4H0HB 1AQTA 1IC7H 2WWNA 5ENWA 3CX5J 4BHUA 4YK4B 1T5KA 5EU4B 5FDWA 4GRWE 4HUKB 4W9DC 5AOMA 1KN7A 4WB4A 3N44F 1U8JB 2CWRA 1A22B 2X3AA 5IHUL 1LE5A 2DICA 3QIWA 1QHQA 5DMKB 3KGRA 5IY5B 4QXWA 1MCQA 5TISH 1RZKC 1TVBB 2UX6A 5D7JC 5IREA 1HS6A 2W07B 4FC3E 4KGJA 4LP5A 4NQCE 4XNUL 3BGMA 5BZZA 1QSFD 4I77H 4PJ9A 5I71B 3NGBC 4TNVK 2AJUH 3AE2C 2QHRH 5J1AA 2WZ6A 4GQRA 2B5IC 3AREA 2QR0A 5C8JA 4KK5C 1A9VA 4XBEH 1WK0A 1AVOA 4Y2OB 3R7QA 4M7ZC 4WEUD 3NBNA 5F7NC 1SMAA 4WENB 3VRJA 4M56A 1JTTA 1ROWA 1EWHA 1OW0C 4BKLA 3UZVB 4U3SA 4B9FA 4F7TA 2WKOA 2UZXB 4TRPH 4PPTA 4ZFGL 4JN1H 5E56A 5C2BL 4L5FH 3C5XA 3ETTA 3HNSL 4MA1C 3RI5K 3GRGA 2EXTA 1OCWL 1WT5A 5EZOH 4LSUH 3REVB 3DDFA 3IJ9A 3CZEA 4O9HH 4Z7WF 5BS0E 3DDGA 3I6KB 4NIKB 4ZTPL 3WFBH 2WVTA 4XPTL 1U3HA 4TLFA 3PDDA 3MYZA 5IP4A 1CGXA 1RU9L 2GHZA 3VFRA 1DANU 4ZMNA 3MOQA 4PJFF 3H1IE 4TLUA 5DFTA 4FXGA 5C07E 4WU5A 3ZL2A 4X7EC 1W2EA 4L0ZA 5ITBH 4DVBA 2ORBL 3WNOA 4GRLC 1H5BB 3FKUS 2HVJA 1MV8A 3RWIA 3GSXA 1T20A 4P9HC 3VMAA 3QS2A 3WENA 2ZUVA 3FW6A 3HUJE 2EDRA 4I3GA 4AYFA 3O3AB 3E0GA 1AD9A 3E6FA 1AS8A 3DVNB 2GSIA 3RIFF 8FABB 3QDME 3DOHA 3VH8B 3ATDA 4GSRA 4GT1A 3UMTA 4HPYL 4M6NH 2MMXA 2VQ4A 4L8SC 4U7MA 4ZFQA 5EEXA 3QRBA 3SBRA 2IH9A 3LPGA 1ZGLM 4LLVB 1E42A 4PD4K 1PKOA 2NRDA 5T1MA 3EYFA 5IMKB 1PD1A 4PH8A 4F7MA 4NQXB 3GS4A 5E8PA 1H9DA 1HNFA 1ZTMA 5T3XD 1Q38A 1MCOH 1RHHA 4LBAA 1WZMA 1TTCA 3QFJA 1S4XA 4G83A 2GTQA 3KR3H 3FFCD 5JPMB 4E0RB 4Y1AB 3Q44A 3PP3H 5IR1B 2EINB 4J3OG 4WHYG 4XFJA 1QNZL 3K6OA 4YPJA 4NBXB 3MROA 4L05A 4XHQA 5ICZB 5C0FA 4P59H 3H3BC 4FFZH 4OZIE 4OGQB 5D5MB 3TVMA 5DDHB 3TIDA 2X28A 3O3DB 2YD9A 3IDMA 3OKLB 2N9YB 4QHPA 4EIBA 5BOZG 2CR0A 4S1DD 2Q0ZX 1GMEA 4YH6A 1FV1B 2D3VA 2ZCLL 3QHZH 1ROCA 3RL1A 1TPXC 4P5TD 3AT9A 1I1YB 3FO9A 5IFJB 1FU1A 4M5ZL 2IDBA 2PR4L 3D33A 2P5WD 3BC9A 5D4JA 4HWUA 3BJLA 5BO1L 5EMYA 1MXGA 4OD2B 3WEOA 1DBBL 4W9KC 4KKZA 1IX2A 1ZXGA 1CK0H 3N50A 2Q1KA 4YJZL 1CE1H 4HCIA 4YHPA 3QH3B 5FECA 3R1GL 2A9NH 1MCPL 2B0SL 3TNMB 4IBLT 3BCCJ 3H9YA 2KZJA 5E2WH 3KJ6L 2D73A 4UYPA 5DVPA 4AITA 1MQ8A 4PCSA 1WBYA 3U7WH 4XWGH 1NA8A 1JN6A 1XV8A 1OCWH 1JGUL 5K5YA 1JHTA 1KBPA 2UY6B 5SWSD 2OXGA 4K55A 3EJYD 4MGXA 4GRWB 1GRWA 5HDBB 3JV5A 1RH8A 3H2QA 1FG2A 4M5TA 2NY3B 5T5FH 3M9QA 3QCTH 1KACB 4RGMC 1LE9B 4BFRA 2JKSA 1BVNT 2NPSB 1NGXB 1UEMA 4WEBH 1V10A 1J2JB 4XVSH 5DS2A 1DUZA 1QI3A 1HT6A 3ES6A 4MWFA 2Y07H 4Q7DA 1KLUB 2H1LM 1I8MB 5EA0H 2BNQD 1XF4A 3UJJH 3DUSA 2YAMA 4RZCA 1SMDA 4GFTB 3QPXL 2PWFA 3SOTA 1EQ7A 5I6NA 4X0NA 5AQ0A 4ANVA 1DSYA 4R0LB 3ZTDC 4ELME 3MRCA 4N8CL 2YPVH 1KIUA 3B2UD 1FGNL 3OF6A 4HX1B 2PYEB 3T77A 4LHJB 4N90E 3WLBB 3ARDB 3A0HE 4I1RA 4KXBA 5GXBB 1CXLA 1E5YA 1NSNH 2WBJC 3H0TA 1EAPA 4ANXA 3H4FA 4GG6B 3G04B 3LN4B 3Q6FA 1OSPH 2OMWA 3L54A 1GXEA 5BPPA 3T6XA 5DMYA 3V0FA 3AZUA 1ETA1 2VN4A 4B9YA 4APQB 4U1JA 4EKXA 3W68A 2BASA 1W0WB 3LZNA 3RYMA 2G75B 4M8QB 5AZ2H 4KKAC 1MHHA 5JLZA 2OJEB 4A2MA 5KZCD 4QHKJ 5J12C 3AG1B 3MBXL 3QZWB 4XVOA 1XAKA 5DJXB 4AIZB 2SPZA 1J9RA 3MJ8A 2B4CC 1ZTXH 1UG9A 1IMHC 1OP3H 2ALAA 5IMMB 3JZYA 5C0AB 5CJBA 5GRVK 5PCYA 3UTSA 3SJVB 2H3NA 1LO0H 2VMJA 4Y99B 1PY4A 2OMVB 3HLKA 3IMUA 5CXPA 3TT3H 1KEML 1EEUA 2WMMA 4I0PB 2AXWA 3EFDH 3ZE1F 4LSSH 1OAKH 4TPRH 2V9TA 4NGHH 3MLSL 2FE0A 4Z3JA 4Y16C 4XGZB 1XH0A 2HODB 1TKWB 1LTBC 2EEFA 1HQ4B 3GMOB 4P5RA 4EUPA 4KQ4L 4QTIL 4Y2OA 4N2DA 3D69A 2F5BH 3TZVC 3ARWA 5CKAA 4YE4H 5GTIE 1A7NH 2F74B 1OEZW 3UZVA 3PNWA 3LIZL 1J1XH 1JTPA 3MJ7A 3ZYIA 3HE6C 4QY8B 2Q3XA 4JYBA 5C08E 4UOJA 3EYQD 1XFPA 3QWNA 4K9EL 4ZKPA 1RIUH 3MZWB 3AGVA 2BHUA 4YDIH 1INQB 3FOLB 4ZPTA 2E3VA 5I75C 4TSBL 1KENH 5AWNL 5AOZA 4PS7A 2OYPA 2GHWB 4XNMB 4Y1SA 3EO9H 5JIDA 5EUOA 1MG3C 3QYNA 1P7KB 1YEEH 5T1LB 4C8XA 1WFNA 2R56H 1ZW0A 2XA8L 4JFPA 4ZFGH 4ZXBB 3WIIL 2W60A 3GSUA 5DC9B 5HDOA 3WMSA 2ZQKA 4W93A 1G94A 2V7HB 3I02A 3L70J 1A9BB 3H1HE 1NGMB 4MKTA 2I9LA 3VTPC 3DKHA 3HN5A 3APFA 3LQAL 3MJ9H 2QL1A 3NIFB 4F5CE 1IIKA 3IMVA 3O3AA 2OKMA 2VLJE 5E8NA 3DVNA 4A7PA 1YEWA 2Z93A 4JY6A 1PZUB 1VPOL 1FSKB 5IQMA 2H47C 1UQSA 2CNYA 2E46A 3MFFA 5SX5H 3D12B 1I7ZB 2R5DA 1U8JA 5KVDL 1LE5B 1NTZG 1BZ8A 3EYFB 3MLVL 5IMKA 1R5LA 5DMKA 5B8CC 3RK3E 3CPWO 1WISA 3MCG1 1KZYA 1QQDB 2E8ZA 2ADJB 3UTTA 4PJ9B 1E27A 3DV6B 3RZCC 3G6JE 4K2UL 3GC3A 2VWEC 2R44A 4UTBA 3IMRA 3FXIC 4BSVB 5BZDB 4NQTA 3AMKA 2JI3A 1ZTXE 4GW4B 4KI5F 2XACC 2A77H 3LYRA 1URQA 4OIBA 4B95C 3KPRD 3O3BA 1J1OL 1PZ3A 1YPZF 2GI0A 4BKLB 5FFLA 4U3SB 4KVCL 2XTSA 3O3DA 5JIHA 1UKTA 2X0VA 3ZVVA 2XYCA 5C97A 3ULVE 4M6MH 1BM7A 1QLEL 3RUGB 5B1JA 4PSPA 1KBVA 5IVZB 1UD6A 1VADB 1XTMA 4DW2L 4JFDD 3AE8C 2GB2A 4AXWB 1FZOB 4KNUA 2WKLA 3I6KA 5FW6A 4OQTA 4AQAB 1PY0A 2DOCA 4X4KA 4NKMA 3S3BB 3TNMA 4KV5E 3VXSE 2UZPA 1IK7A 4B0MM 4UB6E 1GOHA 3G9VA 4U1HB 5A16B 4N3YB 2X40A 3AQDA 2P8MB 2ADYA 4TL5A 4AUWA 4PG2C 4S11A 3V5HA 5BV7C 4P9HL 1NCAL 1RIHH 3GBDA 1OAQL 1MAMH 1UZ6E 2VUKA 5CBEB 1NJ9A 5EORL 1WVZA 4M43L 5I26A 1EEYA 3NJXA 4N0CC 1NCIA 3FQ1A 3GI8H 3NOIA 4R9HA 5D1ZA 1AD9B 2O4EA 1QSVA 3BJ91 4LSVH 2MCMA 3QUXC 8FABA 2XTJC 5JW5A 2XY2A 4IJ3B 3TH3T 5BS0D 4HT1H 2PP8A 1F97A 1NEZA 1NUDA 1DQMH 2ZG1A 1H3PH 3LHPL 2PP7A 1DFXA 2WN2A 1ET5A 1AKJB 3TBVB 1H19A 4FQXC 1DQLH 4PUBL 2QQLH 2NMSA 2J25A 2OR8A 3V6OC 3UTSE 5EEUA 2LAGB 4KUCF 3P0YH 1KTLB 5AW1B 1Y7VA 4PEEA 3UH8A 5E08H 5HHQA 2YXMA 5GJTH 4XN9A 4ETYA 4HCRH 5L4IA 4RZCB 2JELL 1RHHB 2OYOA 1A7PH 1F8TL 3A22A 3ULSB 1EHLL 2WUBL 3FF7A 4MYWB 1FH5H 1KIQB 1KXTA 3Q43A 3LNGA 1LDPH 1CLVA 1JPSH 1KDIA 1MCFA 4YDVB 5KVEL 4U0QB 3IDNA 3UO8B 5C0IA 3GHGA 3REWB 1LWUA 3QDMD 3NP3A 5CBNA 5SX5K 1FC2D 3IDMB 3G04A 3N40F 5KBMA 4ODSH 2EYSB 2R0KH 3MJ9A 2YSTA 1MCSA 2AEJA 2BSEA 2FDBP 2XN9A 3F65A 4PREA 4YBQD 3TCXA 4HOZA 3FO9B 5IESL 3NYKA 1XZWA 5IFJA 2P48B 5HJ3A 1MHHB 2MQ3A 1I8IB 4BWWA 4PGEA 5EH1A 2VDMH 1ZCRA 4NKDB 4TNWK 3PFQA 4NQUA 1P84I 2KS1B 4K9EH 2LXBA 5C0EA 4G8EA 5INDB 4NQDD 4XN1A 3T8MA 4QAMB 1N86A 3MODL 3BZFB 4IOIH 3ZBMA 5IMMA 3L71J 1T0OA 2HKHH 4AI7A 2H7HA 4GSDH 1GZLA 4XXCC 1PW3A 1XQ4A 3LAFA 3W9EB 1A5FH 2OMVA 4GQZA 4DO5A 1LJ2A 4M61B 4K5PA 4QTIH 5IW1A 4YHKL 4HGMA 1NC2D 3ZT5A 3D85A 1E4JA 3OMNB 1OM9A 3F7PC 3U36B 4MAZA 3K6FA 2IOIA 3R0MA 3L4FA 3MRDB 1PF3A 3GMOA 3ZE2E 1JS4A 5HHOD 3V8CA 4DZBA 5IIEA 4TT3H 1ECYA 1Z66A 1WDAA 1NTMK 3DO4A 3M86A 3MOAH 3QIBA 1NGXA 4JZNB 4L4VD 1OAXH 4Y7MA 1BMZA 4I6MC 1B90A 3SHSA 4MJ4A 1U4FA 4N5UA 2XXFA 3EO1B 2YS4A 4DO4A 2F7IA 4Z77A 4ZNEE 1NBZB 4J2XA 2OYIA 1FL6B 1QFUH 5DJ6B 5DD6A 3CMAP 3O8XD 4P49A 5I28A 3QNZB 2VDLL 2HPCA 1QKZH 2H2SC 4PR5B 4DGUA 4ZQKB 4DGYH 3FDWA 2KNCA 3QUYD 3KD4A 4G70B 3V4UL 2FATH 5EUOB 4KDWA 5KOMC 3HUSA 2FYUJ 2ZF9A 5JHDA 2Q10A 1A1NB 4KAQH 3O6MH 4K9JA 4KFMA 5I1LB 3WJMA 3LZQA 4NM8H 1ZWIB 3NIGE 1HTLC 4LRIA 4ZXBA 2W60B 4OQ1A 3ME0B 5ANHA 5IV2B 1ZV9A 3AQYA 3OJDB 3WUWB 3IMTA 5JHAA 1E9OB 2CDEB 1K4CB 4ELKA 5KYUB 2EJ1A 3WTXA 3Q6FB 2YAOA 1R3LA 1VJSA 5CZKA 4N78E 1WS7A 1YN6A 5DMGD 3WKMH 5JPMC 4Z3GA 1T7VA 4FZ8L 3S37X 4EN2A 5K9OB 4GOSA 5JW3L 5SWZA 4K7PL 3E6HA 5JLZB 1FVCB 2POHA 3VXSB 1MLBA 4ZUTB 5GS0D 4AIZA 5L2KA 4ZO7A 2HN7B 3US9A 4AWJC 1M7UA 3CWBJ 2BX5A 4K3JL 5L4MA 3APNA 2G5BB 4LIQE 5FXCH 5HVHB 1TPXB 4D8OA 3AROA 4HJIA 5DD0H 3VGFA 4J39A 1ORSA 4GDOA 3OKOB 5DQJB 1WFOA 3MACL 2GJRA 2F53B 3KPNA 1G7JB 3FH8A 1SEBA 1SY6A 1TOXA 1VQ5P 4PW9A 1BWWA 1S9WA 3QQNA 4XZ4A 1L0LE 2GPZA 4GPVA 5MI0B 4WHTB 4NO5B 3SDYL 1HTYA 4KTGA 3T6ZA 1PIFA 2RQEA 2XG5A 3Q5PA 2EZ0C 4PJHA 1X9UA 3QXDB 5T5FL 1A1MB 2O30A 1FBIL 3K1KC 4LL1A 1WSST 2E9WA 3A5VA 2A7BA 1P4UA 3CDZB 4LCWA 2XZAH 1MJ7L 2HG5A 5E5RB 5IVZA 1FE8L 1SBSL 1H8NA 1QBMH 2A4CA 2XV2A 3MBEC 1K6QL 2ZYAA 1JSYA 1E9QA 4Y1TA 4ZMPA 5BO0D 3ZQXA 3ITKA 1EXGA 3MA7A 4QRBA 4XC3H 2DYPD 3SDXF 5J13C 5GGVY 5EBWB 3SGDI 1PNCA 1OOWA 4OZ4B 4P46A 4KO6A 2LTQB 3SBQA 4AMWA 1LP9A 4Z7UA 4XN4A 1FNFA 2AJYL 1KIPA 1AAJA 1CT8A 1MFDH 5AVYB 1MKFA 3HNTL 4KV5F 1QFWL 4NQDB 2MCPL 4N0RA 1OTUD 4QJ3B 6FABH 1LT9C 4PGCB 1KEMH 4XTRC 1HHHB 3HIZA 1DFBH 4L9LC 4LOEA 4UV4L 4YVUA 3K0WA 5GRXG 3L3HB 4ZUSA 5EIIA 1X5MA 1VQKP 2BMKA 3F7VA 1G7MB 3PGFH 3MRMA 3UTOA 3GT6A 3MV7E 1I4FA 3WIHA 3VMXA 2I07B 4D9LH 1RJZA 3QQ4A 5BUPA 4I18B 5E99L 4MTMA 3ARDC 3ZKMC 2OMYB 1KIRA 1RUAH 3B3IA 4WY4A 2CO6A 4NFCA 3CC7P 2ZKHH 5E94B 3UAEA 4LK4A 2DQJL 1LO4H 1VAHA 2VZSA 1G4RA 4AGOA 4M3KB 4ZAKB 5I1JL 4G8GA 2D7NA 3ML8A 5D2NC 2ICEB 4HIHA 5HHXH 2E9JA 4D7PA 3BLPX 4PSRA 1BYNA 1ZHNA 4M29A 2B9BA 2P67A 4J7RA 3QUZD 4UQ3A 4FZ8H 2W91A 4QLWA 3NSXA 3DX2A 2DWTA 1AO7B 2AJSH 5IHZA 1VQLP 3QUMH 4NT6B 2RALA 4L8CB 1CTMA 1KIQA 1JY2N 1KXTB 5HDLA 3FTVA 1KJVB 3LS5H 3HMWH 2G8YA 3UAJA 2QGCA 5EDXA 1OKEA 1FAIH 1GYWA 3MCKB 1P1ZB 2OZ4A 3IDNB 5C0IB 3EG9B 1KQLA 4XMTA 4GLRI 3OKEA 1HKFA 1BG1A 4AM0Q 1KYOD 3WTSA 3TVMC 1Y47A 1A65A 3BKYL 5FFOA 3WIHH 4F37K 2K88A 2I26N 3GMRB 1VADA 5F6IC 2H8PA 4OM1H 5D1ZC 2NUPB 4OVVA 1YNTF 5LVEA 3NA9L 2NW2B 4GO6B 2IWFA 4PRPD 3ETBF 5EU3A 4B9KC 4JL1A 1WZ1L 1G7LA 5INDA 5C0EB 1N64H 1BAFL 1D6EA 2P5EE 3SYCA 5LGHL 4ZS6D 3VA6A 2DQHH 5EZIH 3LKSB 3CCHA 2EO9A 4MS8C 4DZ8B 5B38G 5IB2B 2WTYA 1UA6H 3O9WD 1LO5A 4J27A 2BVPA 1OGPA 3WXVL 5MP6L 4OJDH 3O6QA 5E2TL 1EDJA 4PB9L 1B6DA 3FHAA 5F89A 3OAYK 5EBMA 2KLVA 3BCCG 3ATFA 2V3EA 4NNPH 4S1RH 3CFBB 5D7IF 3D2UD 4N9GB 5BRQA 4AIXA 1NEPA 3ZZLA 5I6XB 3RDJA 5EUKA 5SWZE 1U8OB 2GTWB 3D39B 3PRZA 1PGOA 4R7DA 4IGBB 4C47A 3OMIB 1UWYA 4LP8A 1R8EA 4HSAC 4PV9A 4XNYL 5F97E 4JQVA 3ZQWA 2VERA 3P0VL 4M1DH 1F1AA 4XP4L 4FGMA 4X5XB 3OGOE 2KXPB 4JQVC 1KTLA 4ELMB 1ERNA 5SX4I 1HVVA 2D0FA 1FZMB 1OT2A 4FFWC 1YUHB 3FQYA 1WE5A 4QXTB 2BZDA 3DPBB 3VYNA 3DX7A 4FJYA 5CINH 5MERB 3RL0B 5M7QA 5CGYD 3V5KB 4IBZA 3FMGH 2KNCB 1A0QH 1CVSC 3IAQA 5KYWB 4DPCX 5I8CB 5AW4B 2F54D 4KJPC 1IC5L 2QVFB 1OTSC 4G9FE 3UIAA 4Q4EA 3RDTC 1D3CA 3GHGB 4LC1A 5C39A 3ASNB 4S1RL 4PJ9C 1IE5A 2YGPA 5EDSA 2VM4A 2X4SA 2ADFH 5TQ0L 5D7JA 4TSBH 1YN6B 2C0XA 3P30L 3T4YA 5ESAB 2GBUA 2KYIA 2F8XC 1CDGA 3KJ6H 2ZT9C 2VR3A 4TXVB 1HGVA 1LEIA 3MLYL 1MUJB 1FFNB 2XWBA 4NRZA 3F89A 2N01B 1A4BA 4UB0L 1LEKA 3RNKB 1JBJA 4PJ8A 5L2KB 1HL4A 4N0FB 3AEFC 3VFTB 3LHPH 1J1XL 4IRJC 4K8RH 1OCZB 2Y06L 3R19A 5KSAD 4QDGA 3BZ4B 1ZMEC 4ZS6C 1ZLSL 2FBOJ 1HCVA 4KX8A 1U8LB 3Q06A 4O58H 1F6AB 4MD4A 4ELMA 3ULUE 5DK2A 3BQUB 5IB1B 3HS0C 5B3NA 3O6FA 2PO6A 2Y3NA 3VFWA 4FFVC 1W2KT 5CJQL 3KHUA 3DBSA 2VDLH 5FHBL 4AGQA 4EYYQ 2Q7YA 4QRPE 2UXVA 5HYIA 3VMNA 2VR8A 3V2QA 1DVTA 3SYPA 3VX1A 4FQIL 4DZBB 3V6IA 3LZFH 3IKKA 5KBLA 2P3YA 2G30A 1SQQJ 2UX7A 1S8DB 5EU6A 2WXRA 5DD5L 4K7FA 5FYJD 4ZW3A 4JCMA 3W67A 2WXQA 5J3HD 1I3VA 4QHMA 4M7ZB 2OYIB 4NN7B 5GS2D 2CBQA 3S4SA 3HPLB 3FU7A 4F92B 1S7RB 2E7CA 1OW8A 3NDYE 3NP4A 4TNFA 4U49A 1UOWA 3H6JA 3I3BA 3EBIA 5L88L 4NZRH 2WINA 4Q4IA 1ZLSH 3L70D 3MA7B 4FFWD 3U4BL 2ZAIA 1MCJA 2KQMA 3IFOA 1NC4B 5HDBF 1W6WA 3EOTH 4PJCA 3AWGA 1TFPA 1AHWB 3BSZH 4KMTH 1VQ4P 3RP1A 3ZTCC 1A5FL 2WPQA 2E74B 3VW3L 3V4PB 1NFDA 5IROA 3T6VA 2QVMA 2WQYC 3DGDA 4PJ7A 2QGEA 4RBPK 2R2HB 3HNVL 3U1AA 1G7MA 3B3BA 3QISA 5FV2A 4L4TB 2IFGA 4GODA 1M1SA 1TO5A 2NXYB 4XB3A 4HIEA 4X4XB 3HG3A 4PJXA 1K3IA 3VCLA 3EOBB 4HKXA 4X4YB 3MV9A 5T33L 2HN7A 2MCPH 4IKKA 3JCUH 1QYGH 3RWDA 1BGYG 2DD8L 3UJTL 5I66B 2NYKA 4EN3D 1MKMA 5D2LE 4NXKA 3IF4A 2VITA 3ELQA 4UILH 1HYSD 3K2KA 2DJSA 4L1TA 5IHLB 5T5NF 3BT2H 1M9SA 2QQNL 3USSA 4G9DA 5GIRB 4WLCA 5JO5B 4B7IA 1RAMA 1KB5L 1H8OA 5HTSA 2W0FB 3CXHE 2WLNA 3RU8H 1EO5A 2Y2TA 4YHLH 3PL6B 4U1MA 4QOKE 5H4YA 4Z5RB 3OPZL 5KS9A 4XPHL 1HZHH 3E7JA 2ZIDA 1U93B 1CICB 1YMHA 3QEHA 3TYFB 4FFVD 1I9RL 2FR4B 4ANKA 2R51A 1WWBX 5H35A 1L0NJ 3B7UX 3HS8A 4X80H 3HZYA 3GRWL 1NTKK 4BFKA 1RIVH 3DSNB 2LU5A 4TS6A 3QZOA 4GMSL 5TD4A 4WWKB 3GDBA 4PRIE 4EPSA 1BXVA 3LSOB 2VLJA 4AW4A 5K59F 3BPLC 1WZ1H 3HE4A 4JPZB 1RFDH 2XFGB 2VKWA 1NLDL 3WN5C 4Y1AD 4HMEA 4JY5L 4X8GA 3WELA 4KNTA 5BMFL 1UFGA 3UJTH 4JVUA 4BUGA 4C83A 5IT2H 1CYWA 1JPSL 1UA6L 1HQRA 4S0SD 3LDBC 4P2OD 1G7LB 2R9HD 4JK0D 2OM5A 4DZOA 1AOHA 3LKSA 2DBLL 4K3JH 4YNYB 4LPVA 2HKFH 1RZFH 5B4MC 4TNVF 5AENA 2D7PA 2IBBA 4OQTH 1FN4B 3D1MC 4UOW1 4G7SB 4KXAA 4ORGB 5DHVA 1ES0B 1LO2H 5LCVH 3HW7A 1MFEH 3BX7C 3IBEA 1WT5C 1NWQA 2WYZA 3F7VB 4UTAH 5EBMB 3IDJA 5L8KB 1KJ2A 2AJSL 2BCKA 4YBLB 3MRMB 4N2BA 2J5WA 1L3NA 4AYCA 3L48A 1OOAA 2OMYA 1G4MA 3CFUA 2HX7A 4HLZG 5CEZH 2EIJB 2LOEA 5FCSH 4BRYB 5E9AA 1BLNB 4AIEA 3AREB 5CAYB 3T0DA 4X5XA 5MHSD 2NXZD 2NY3C 5FO9A 3CLFH 3MR9B 4RRPG 2BPBA 3EJRA 1HK6A 3KW8A 2AVFA 5DC2A 1ZHBB 3INUH 4JFEA 3TNNB 1HYSC 1A6ZA 2YD7A 3M45A 4Y4KC 1LQSR 2OR9L 4K35A 1XBRA 3B2MA 3RZCD 3HS9A 1V05A 1DUYA 3GMNB 5AVRB 5CJOL 3FN0H 4EOWL 4PG9A 4DOHB 4IU2B 1PG7H 4H8WL 3MV7A 5FC9A 1ZPLA 1MFDL 4O4YH 4YZFE 5I82A 3Q0HA 5LNEA 4D3CL 4XNZB 3P77A 4DTGL 4HGWA 2JJTC 1L9PA 4OIIL 5F7BA 3UG5A 1YDPB 4FEIA 1OCRB 1JERA 3EXLA 3UTZB 4J3OF 2PNDA 1ZY9A 4N2LA 3RWHA 4XRCB 3TT1L 3WE1A 4KVNL 1A6AB 3MOAL 4J4PD 3TSIA 4LRNL 2UZIL 3GSXB 2G2PA 5J9PA 3IETA 2VQ1A 1XEUA 2O61A 1BGYD 2Z7WA 2YXQB 3QJFA 1ECZA 4AH2B 4Y19E 1E4XI 3ARGA 1H3VA 1F4XH 1F6AA 2FSDA 2KLSA 3CSYB 1CGSH 4MD4B 4RDQF 2O5ZL 4YO0B 5F88A 3WNPA 3FUDA 3KPMB 3HI5L 2ICCA 4WEEA 5FA3A 5FO7B 2VN6A 3LQMA 3PUCA 3LZLA 4PJCE 3Q7JA 2XDJA 1NGWB 2XKSA 2YN5A 4UB0H 4GSXA 4HKBA 4HZLA 1R33A 1NMAL 3HMXH 4ZODA 5DJZB 2HTKC 3WEAA 4LCWD 4NPYA 4OIIH 4OJFL 4BFJA 1MXDA 1A6UL 5C07D 4JRXD 1J48A 1ZT4B 1C12A 2XWJA 3EUDA 1LT9B 1UFUA 5DZLA 3IYLW 1RZ7H 2X4UB 4PV9B 3VGDA 1G7IA 2BOCB 2JIXD 3LXAA 4AYEC 4TSAL 1UXWB 1YJWP 3F2LA 4Y9BA 4BK4A 5ACZA 1IGTA 1IFPA 2QFPA 4YLQT 2CBOA 3L73D 3FWLA 2R0LL 4UWQB 2AJVL 4NRXB 2DD8H 2L7EA 4JDEB 2Q8BH 1OT4A 3CSPA 1HJCA 4GXUN 4ES9A 3DX7B 2PLTA 2X2UA 1VFOA 4I0CC 1TJIL 3FXEA 4KQ3H 3SPHA 3HRNA 3CHQA 3D39D 2O01N 4UM9A 1FV1A 1D5XA 1C8QA 1G5AA 2IPUG 5D1XB 5C0CD 5HDBE 5I8CA 1CD0A 3K4AA 3DRQB 4QUOA 5B38B 4Z76B 1AS7A 5F7EH 3SFDC 1YNKH 2VH5H 1VCAA 5L8JB 5I15L 4O2EA 3FU0A 1E5WA 1YSOA 3LRGA 5KLIC 1SXAA 1UJ3B 2B59A 3C6LD 1CL7L 2X4SB 4I13B 3BN3B 4K7PX 4WSGA 1D9KB 4X9YA 1A7OL 5GTHE 4LEBA 2JLPA 2R2HA 5D7JB 5IM7B 3JSVC 4GOEA 1KNOA 4NC1C 4TSCH 5I30H 1HU8A 1ULVA 1FNSH 3NTCL 3CZJA 3PIQB 1HL9A 1JGDB 2F8VA 1QFUL 2GA1A 3QR2A 1CLYH 4HKZH 1GZQA 2E76B 3LIUA 5GGRY 4OH8B 4APXA 1PDKA 1V55B 2HZHA 4HFUH 7TAAA 1S3JA 3FUFA 2KDYA 1G6VK 1V54B 3D30A 4BQ6A 1GKOA 4NQSB 2F7QA 3HKZA 5JHDD 3NG5A 3PYCA 2JVUA 3MTXA 3KWWA 5H2FH 5JIIA 4Y9GA 3EBGA 3ZRFC 3UPRA 1Y6MR 4ZSOB 3EWKA 1M8OB 3ZJAA 1YQ4C 5DK2B 5IB1A 1RIHL 4LOUD 5E4AA 3O6FB 2RACA 5GGSY 3L9RB 2XRAL 4KO7A 3E1RA 3D3VD 4DKEL 2EVJA 4KKLD 5IJCC 3WFEH 1DE4A 5ESVA 4FNLL 5TK2A 2XZZA 4MCYB 3D4GA 5GHWL 4XHJC 1KORA 1L0ND 2HTKD 4Y5VC 4A1RA 4FDWA 1I53A 1EHKB 1AXIB 2Y6SD 4UTBH 5T5FA 4DUVA 3BVXA 4D0CA 3G71P 2NR6D 2VLJB 5JOPD 1OWAA 2OQQA 1FJ1A 4CDGC 1FZFA 4CVUA 4HX1A 5E2VH 4L9DA 2QDVA 1OB1A 3ZKXC 3S4SB 5I6XC 3D6GA 2KLTA 3BVHA 1MCNA 5TFSL 5HYSG 4K2UH 4PJCF 4KQ0A 1Q9LB 4GW1A 4I9WE 4UMSA 2Q86A 2WINB 5FM4A 1P0SE 3HRZC 4Q6IC 5JHLL 1C08A 2LFEA 4WWIA 4LNVA 4UIKH 5FW7A 5D7SL 5E1QA 4TQPA 3JT2A 1WAAF 4N68A 2H2SD 1VPOH 2AERT 4JRFA 1YNLH 4PJCB 2H0JA 3LRMA 1DQQB 4HWZA 1HKLL 3M1OA 4XB8A 4YHZH 4BCYA 5KVEH 1G7QB 1L4AD 4JM2C 4ORGA 1I7UB 4Y5XB 2QELA 3C5SA 1RV6X 3UO1L 3UYPA 3DX0A 2J3SA 4E41A 2BNRE 5F7HA 3FO2A 4YSAA 1TJIH 3BSZA 3Q9QA 3X1EA 2XT1B 4GKNA 4XI5C 1ONQB 3EYOA 4R0LC 5BV7B 5T1LD 1URQC 1NL0H 1OGAD 5CJ8A 1E5CA 2ZCLH 4LAJH 4E9LA 2FTAA 1VEMA 1ZANH 5C3TA 4BRYA 2IH3B 4IYKA 4TQEL 2GSGB 5E6SB 1IEBB 1U8NB 4OGQC 4AZUA 3HD7A 3W0WD 1YO4A 3QUXB 4ENZA 3FSOA 5JNYB 4UQ9A 2APWA 5CBAB 3D69B 5BMFH 4YHNA 3RJQB 4DHLA 2GUOB 4XPBL 4PD4I 1RUQL 3N6YA 3VD9A 1V27A 4M43H 4ALAL 1CG9B 2Z3FA 1NMCB 2FR4A 3APMA 5KYYA 5FUCE 3EOTL 4XXWA 1TNNA 1L6ZA 2PO6D 2OMXB 4KKLC 1M53A 4UOZA 3RVXD 3FB6A 2XN1A 1QSFB 5GGTA 3PWJA 4WO4B 3L2LA 4FQIH 3HZVA 2ENYA 2QJYC 4QO1B 2EE9A 1P6FA 2Y6SC 2NCMA 2P8LA 2QPUA 1CB4A 4MVBC 2V37A 3II1A 4J3BA 3IF1A 3IDIA 1IGML 3ZDZB 1NCAH 1MFCH 1BGXL 2NY1D 3Q8EA 3BFQG 4N5EC 2A9ML 3RWHB 1RUKH 3VXPA 1JNLL 2YK1H 5D1QA 5I6PA 3DV4A 3MBED 4N85A 5D71H 3WFDL 1IK9A 1WITA 2YPKA 1URIA 5F6HJ 43CAA 5KS9E 2LFGA 4JQIL 4O5LL 3HRPA 1EO8L 1OALA 2XWEA 2NY0D 4FNQA 3T8VA 4U6HA 2WWWA 1KY6A 1KPRB 2Z1KA 3TBSA 2CBPA 4JPWL 3RGVC 1SQXE 1N6VA 2R39A 3O0LA 3CN2A 4YO0A 3T0ED 3C2SA 3D39E 3MJGX 4HUXA 3D87B 3SE8L 3WFHB 1L4AC 2CGRL 3N0PB 2VH5L 1CZ8L 3S48A 1NO4A 3SPCA 4JHBA 5D9SA 3RUGE 5HYJA 4QNPF 3CN3A 3M7FB 5JPNB 3GIVA 1J0YA 1J8HE 4H40A 2A6JA 4YVNA 1IT9L 4NN5C 3BEWB 4Z3IA 5HGAA 2YRPA 4NLAA 2XX0A 2ZAGA 4PJXF 5CEYB 3DTXB 3MLXH 4ZMQA 5MENA 1RQUA 1BLNA 2MSPA 1URQD 4IFFA 2F15A 4JFHE 1QEWB 1UXWA 3VWKD 1F3JB 1YMMB 3D50A 4YSRA 3X1FA 2IH8A 3HPJA 5B1KA 3ZDXB 2XX1A 1U8CB 3ILQC 2ZOLA 2NXYC 3ZZ1A 1SHSA 3A6CH 3IPFA 4X5RA 3L75D 4Z7VE 5IG7B 5T3ZL 5JZ7C 1JXDA 1MDTA 4RQQA 4PRHA 4WNSA 2X41A 3IXTB 2XBTA 3HLAA 5LGJA 3U0PA 1SQPJ 4YAQB 1JAEA 4BINA 4GLRH 4JFUA 5ANME 1D5XB 4BV1A 5D1XA 3VXRD 4YSDA 2FBJL 5DHYA 4YPGB 3WJJC 4AXWA 1L0NK 2K4WA 3X17A 3F7RA 2CO3A 3O4LE 5BXFA 3VXQB 2LHAA 4AE0A 3P77B 4G1EB 3FAXA 2P26A 3B5NB 1CGSL 5KN5A 5GGUA 3L75J 3NIFE 4LFHG 5CJQH 5E4OA 3BUDA 1FFTB 3DX3A 1OCOB 1RJYA 5AW0B 1Z9SB 2HX9A 4CJ0A 4B7LA 5FUZH 4DJGA 1IQDB 2FEJA 1OK8A 2D0GA 5F9DC 4TUJB 4IK7A 5E7BA 5HDRA 3BGFC 4FF9A 15C8L 3V5HB 1DL7L 2ZXCA 1PV3A 1SQVK 4WV1C 3ATBA 1P6WA 1JVLA 2IZ1A 5JIKA 5J9PB 1AIZA 2F19H 3T09A 4QXUH 2F1AA 1MHPH 4WO4D 4NHUB 5JXEC 3QRGL 3CFDA 1D5MB 4PJEB 5JW5B 5DJDB 5MEPA 4FL4B 1MWAB 2D03H 2K7QA 4J3OC 4LE8A 1WBZB 2NQ3A 1SOKA 1AKJA 4QRPA 4XMKH 1M1JC 2BDNH 5HVFB 2GITA 1CI6A 1OAZL 5HVHC 4HZLB 4GAFB 3NK3A 2IEPA 3G7TA 5DGQA 2QSCL 4FTVD 5FYLL 4FULA 2VXSL 1JY2O 3KPOA 3QUZA 4L9LB 5APVA 3UERA 4HD5A 4FFZL 1OPGL 4H20L 1MFAL 4G8FA 4EVNA 2H6OA 3FMGL 4E9YA 1SJHA 3STLA 2WSEJ 1F90L 2CBMA 1ML0A 5CZXD 4MMZB 2XWCA 3W9DA 3A0BH 3J2PA 3UCRA 4PWHA 4PD4E 4JDEA 4TVPD 1N4XL 3RNQA 1QEXA 4AKQA 2NY4B 1RP8A 1HOEA 4OGAC 2IYPA 3CK0L 5CJXA 3VX0A 3QORD 5KJRH 4HV8B 2H4EA 3KLAA 1XMEB 1MRFL 5JW3H 5KG9B 2BS71 5DZVA 3DIDA 3L4CA 4E41D 3D4ZA 3OHMB 3CFIC 2F2HA 1MW1A 4G9FB 2UY7B 1I8IA 3MXVH 3PWLA 1SZNA 2YGVA 3LB6C 4Z1MH 2GI7A 4BH7A 4JBZA 4DP1X 4O2EB 2FUQA 1B0IA 2BNUB 1UIIA 3NZHH 1EHXA 2JKWA 3ML9A 3QJZA 5TFSH 3V95A 1GL2B 1QTPA 3H1KG 4ERSL 1AFVL 3H25A 2Y7OA 2BC4B 4ZMXA 3BWSA 1SDDB 1NBVH 3BESR 1B2WH 5AG9A 2DBLH 2GFBA 3L73E 4TQIA 3QT2A 1HIMH 5C86A 3ZKSD 3N7NA 2IFNA 4MX7B 5IW1B 4X99B 2MQ0A 2X44D 4OAWA 2JTYA 4L73A 3QWOB 4KI5D 2HG5D 5CMAA 3GSOB 3SKNB 4WRLA 3L5HA 5PAZA 3H32A 2XSKA 3CFEA 3EHBD 4B6ZA 2F54A 2I7SA 4HG4K 2QSTA 2Y1VA 1P7HL 1KWKA 4U1NB 4NC2B 2YGQA 4L5FL 4LSRL 4ZFFB 2BXZA 1G7PB 2FJGB 1CE6B 3KL5A 4Z7IA 2OPCA 3O4LB 4G1MA 5CD3B 4GQ9H 1CBVL 3X3FH 3KDMB 2MJWA 3QXTA 2QJKB 3H1LE 2J1WA 1Z3GH 2WXMA 4OCSL 2FJFA 3PWVA 4L1HA 3DO7A 3V4WA 3P0GB 5DJ6A 3JTSB 3VWKA 3H55A 2VLKB 3BW9A 4DCQA 1WIOA 3RGVA 4H44D 1QSFA 5I0VA 4XPGL 1K5NB 1SOXA 2A45I 4Z7VB 4PR5A 3S34H 3LHAA 2QQKL 1FZCA 2OMZB 2VYRE 3AE7C 1E28A 1RZGB 2WSKA 3ZKQD 2G60H 2Y2WA 3B7RL 2NZ9C 1ZOXA 2YWYA 1M7XA 3SD5A 2IPTH 3LRKA 4EMZA 3FAWA 3ME0A 4NUPA 1BD2D 3SKOB 5KYUA 4Q0XH 3SEPA 3EJJX 5D5MF 2E0PA 3T0EA 3H42H 4LPUA 1WP6A 3EDJA 1G0XA 1GZHA 1U33A 3Q2VA 1JGIA 1I7RA 5ETUB 3SQBA 1VFAB 3R4RA 4FNPA 2P49B 5IFAL 4ZMAT 4NX0A 3GSNL 5K9OA 2GT9B 3GIZL 4M6AA 2OX5A 4M48L 2WUBH 2YXRB 4MA3A 4U3FD 1QAWA 2DYRB 4TLKA 1BLIA 4BZ2H 3K5BA 4HKJA 1P84D 1J5DA 3KL0A 1I7UA 5IFHL 2DH2A 5D6CB 3P73B 5ICYA 2QRXA 4G6FB 2VCOA 1FNGA 5D7KD 1P5UA 3TTYA 1GGBL 2AW2A 2G2NA 2YPLD 3O2VL 1J0KA 1USEA 2BVEA 3MRRA 1X9QA 1DHKA 3KDPB 1ORSB 3L3GA 1PNDA 5BJTB 1DVZA 2QQKH 3K91A 1UCTA 1L7IL 5DURB 5EF0A 1S7WA 2NZ1A 3K4ZA 4DP7X 2A6DA 4P59L 3ARYA 5CNHA 1IB5A 2X4RA 3EBAA 5D6DC 3STZB 1X5HA 4QTHA 2IH3A 7PAZA 2AV7B 1AJYA 1GHFL 4C7RA 3CH1A 4N78D 1ORQB 1JP5A 5EF1A 5JR1L 4N3TA 3G9AB 3RIAF 5BW7A 1S9KC 4KBPA 2ZOLB 5JIQA 4UB6H 3FCTB 3G5VB 4RIRB 5GRUL 3ZDYB 4EBQH 5IG7A 4PYGA 1DSFL 4GUCA 4X5WB 5HHOA 5CILH 2JKIS 2BVOB 4LSQH 2X4NB 3U0PB 4YLCA 2CRYA 1V7MH 5D93C 1U3NA 2Y69B 3I6SA 5D71L 3WFDH 3OKKB 4N2CA 5CCJA 3HN3A 5AAPA 1DDHB 4PY7B 4NHCH 5IWLA 4KZCA 3X14B 5B1JC 3VGAC 3KZIH 1EXUB 3D7PA 1HAUA 3FB6B 5BXFB 2X89A 1CF8H 1YCSA 1JZGA 3CWBD 1KJ2H 3HC3H 1DCLA 3U9PH 5K9JL