2KNCA

Platelet integrin alfaiib-beta3 transmembrane-cytoplasmic heterocomplex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
54
structure length
54
Chain Sequence
b'GAMGSEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRPPLEEDDEEGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
publication title Structure of an integrin alphaIIb beta3 transmembrane-cytoplasmic heterocomplex provides insight into integrin activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 13
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00357 Integrin_alpha Integrin alpha cytoplasmic region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.930 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Bicelle-embedded integrin alpha(iib) transmembrane segment 2kncA00
2K1AA 2M3EA 2KNCA 2K9JA
chains in the Genus database with same CATH superfamily
4U3FE 1FE6A 3L72J 3L73G 2AEMA 3L74E 4BWNA 1MFZA 1VQ4P 1NKNA 3FXDA 1DX7A 1JEKA 2HYNA 3B4SA 3AE8C 5KLVE 1NH4A 1JO5A 2AXTH 3I56P 3VTPC 2RH0A 5BU5A 2QJPB 1N7LA 1KTMA 1K05A 1D7MA 2WQYC 1BDCA 1NTMK 1G2CA 4GOFA 1VQ7P 1LTGC 3L71J 1L0LJ 1OXZA 3USSA 3HD7C 4WBAA 2AXCA 2YKOA 3CCMP 2E74D 2WSSH 3CC7P 3A7OA 2ZYGA 3AE2C 2N9BA 3WUUA 1BGYG 1Q86Q 2GUVA 3M9QA 4QMAA 5K5GB 3L75E 3IR9A 5BU8B 1HJ0A 3H1LJ 2BCCD 2KOGA 2E75C 1R5SA 2QEXP 1VL2A 2I8DA 3H32B 1JM0A 1Q2NA 4XE5B 2K88A 1PPJE 1J2JB 2E76D 2ZXEB 4GOEA 3A0BE 4N6JA 4JF7A 2XZRA 2KZIA 3H32A 3L73E 1KQSO 3WMM0 2W27A 2JWAA 1QEXA 1KQGB 1IFMA 3MUDA 4Y28J 1LT9B 2Q3EA 2WZ7A 1LT9A 2O01N 1NTZK 3PTZA 3M9HA 3CC4P 2PP6A 3M0DC 3VP9A 3PP5A 3TK1A 3B8EB 3AEFC 1NO4A 2QJKB 3S4RA 2FYUG 2B9BA 1BSHA 1FS0E 2B89A 4GKGA 3M9BA 1S72P 4WWIA 1SFCD 4HB1A 1RF0C 1BGYE 1FJKA 4IFFA 3BATA 2AEFA 1MZ9A 1RE4A 1AVYA 2WWWA 3IF4A 1S9KE 1GK6A 1KQFB 2W83C 1FC2C 4IFMA 1EC5A 1AV1A 2JO1A 3B71A 1BE3D 3P7KA 4ZKUA 2QRXA 2Q5UA 1A02F 1PP9E 2E76C 1AQTA 2KLVA 2I1KA 5KJ7A 1N7SD 3KPEA 2N1TD 1SQXE 2H43A 1K9MQ 1NTMG 2JP3A 1HJBA 2KK7A 1JMMA 1LWUB 1E79H 3B5NC 2NPSC 4D6TG 2UWJE 5KKZB 3CCJP 1P84H 3SWFA 1LWUA 4JYCA 2BCCJ 3LW5H 3S1KA 2OARA 1VQLP 2GUSA 1JY3O 4Z1MH 1USDA 3P8CD 1X79B 2HR3A 4A7PA 4ZKPA 1YJNP 2BASA 1VQPP 1FDIA 2Y0EA 2ZYDA 4TLFA 4Y99C 1JCCA 1KB9I 3Q5PA 5CCGC 1KORA 3V2QA 4C7NB 1VQ6P 3BCCE 2C0XA 3CX5I 1YIJP 1GZLA 1NJIQ 1YQ3C 4C7NA 1VQNP 1BCCG 1TU3F 4RJTA 1EDLA 3H1KE 1K8AQ 1FZFA 2Y0CA 2H8PD 3CL3D 4OGQB 1SQBJ 2C9LY 3QH9A 1N7SC 3V2RA 1KYOH 2Q6QA 2N1TC 1NTME 2P10A 1NTZG 1KN7A 2B88A 2E5TA 2OQQA 3VMXA 1M1JC 5APUA 4D6TE 2CPBA 4EIJA 4U3FJ 1LGHB 1P84D 3L74J 1VQMP 1AQ5A 3RL0C 1S1CX 1SQVK 1RE3C 5GTHE 3W68A 1S5LE 2YKQA 3JCUE 2OTLP 2FFDC 3PLNA 3U59A 2FXPA 1S9KD 4DZOA 1OMIA 1PV3A 3M0DA 3CC2P 3O8ZA 1N8RQ 2XKMA 3D6ZA 1PP9D 1T2KD 3P32A 2W6BA 2WSCJ 2XU6A 3L4FA 2V4HA 1SQPK 1SQXD 1DEEG 1FOSF 4K3AA 2A06D 1KMIZ 3K5BA 1URQA 1UIXA 2OYHB 3BASA 1OFCX 1LTSC 3PH0A 5EFWB 2YXQB 1ZMEC 1NVOA 1FZCC 3L72D 2OYHA 3L75J 3H1HE 1KB9E 1KYOD 2IBZG 1NTZE 1S5LH 3B5NB 5L8RJ 5KLIB 4L74A 3CX5E 3L35A 1LNQA 4EOTA 3H1IG 3L73J 3RK2D 3B5NA 1HH0A 1ZXGA 3TGUG 1SQQK 3H1JG 2YKPA 1M7LA 3AECC 5BVZA 4H44B 1DD3A 2PAJA 3L71D 2E5YA 5KJ7D 1L0LD 3IAOA 4I2LC 1KFNA 3OA7A 5DJUB 5AW1B 3GHGC 4DT0A 1GU4A 5AW5B 4Y99B 3UIAA 1KQLA 1OX3A 2P7JA 5CCHC 3GG2A 1T2KC 4LLHA 2BEZF 3AE4C 1IK7A 1GD2E 1EDIA 2W90A 5AW7B 3M06A 1KB9H 1JOCA 2WPSA 3H1LD 4IL6H 5CCGA 2Q9IA 2KSEA 2XNXA 3MHVA 1EXJA 1EZVI 3EWKA 1BE3G 1BGYJ 5CJ4A 3Q2YA 1OVUA 4I7ZC 3QWOC 1G1IA 3MIWA 1SQVG 2IBZE 1PGQA 3A3YB 3M0AA 4HJGH 1IC2A 2G8YA 3LIDA 3U1AA 1PP9J 1JCDA 1SVFA 4NPDA 3W67A 3H1IE 4EDFA 2YNYA 5E79E 1EZVG 1ZV8A 2Y9ZA 1SQXJ 2M8RA 2KLUA 3JSVC 1LTIC 1NTKE 1NU1E 2E75D 3TYYA 1EQ7A 3WU2E 2IDBA 3E1IA 1LT1A 2IYPA 2FFDB 3KZIE 1JY2O 1JY3P 2YO3A 3FX0A 5H2FE 1SQPG 4OGQD 2FFDA 3WUTA 5AVTB 3RBZA 3VP8A 2LKMA 1GW3A 2OGUA 5AVZB 3O6QB 1CI6B 1YHQP 1UIIA 1LWUC 3FWLA 1M8OB 3O6QA 5KKZC 1KB9D 1CI6A 1G2CB 1RY3A 5GTIE 2WSEH 1FZCB 2KYVA 3AEGC 2POHA 3CWBG 1LP1A 2M5AB 5E79H 3VN0A 3BCCJ 1SQQG 1FZCA 2M5AA 1OZHA 1NYHA 2FXOA 3JC22 3WU2H 1YTZT 4MN4C 3H1KJ 3RBXA 2FKWB 5H2FH 4N78D 3G6EP 3HUSB 2M3BA 2VRSA 2IYOA 1EZVE 2WPQA 1PGPA 1NTMJ 3A2AA 3HUSA 1VQ5P 3PJSK 1MFTA 4GT1A 1SQPE 1KFMA 4OGQC 1HTLC 3GHGB 1L0ND 3G4SP 2R32A 5AW4B 4W80A 4PV1C 3GHGA 1YJ9P 3B5ND 1Y9BA 2WSCH 1H0TB 1FZEA 2NPSD 2JDIH 5CCHA 3CCQP 3C9IA 3MD0A 2RN0A 1H0TA 5TISE 2A06G 2ZVOB 4H44D 1KZUB 1ZR4A 1Q82Q 3GW6A 4GDOA 3CWBE 2JJLA 4I7ZB 1SQBD 1HGZA 4IFDK 2LXCB 5AW9B 1NTKD 1NU1D 2MKVA 4R4MA 2Q1KA 2AEJA 4H13C 1OW6A 1AVOA 1KV4A 3PHLA 4U3FD 3A0BH 4NPEA 5CCGD 2R5BA 1DD4A 4W7YA 3L74D 3TDKA 3H1HJ 1URQC 3CXHI 3ABVC 1NTZJ 1KILB 3L36A 5KLVD 2OYHC 1VF5B 4OWFA 2D2CC 1KILA 3L71G 1GL2B 3GF3A 1U7MA 2CPSA 1GL2A 2XV5A 1J1EC 3EQ2A 5C39A 1QVGO 4UB6E 5KLIC 1RHZB 3FWNA 1YQ4C 1YJWP 3V4WA 5CMZA 3VOPA 1MV8A 3RL0D 1X9VA 2J59M 1JMBA 2I1JA 2QE7H 4H44C 3V5BA 2YMYA 2KP8A 2K1AA 3L75D 2J5UA 4HKZH 1AFOA 1Q7YQ 2FYUE 2KZJA 1FBMA 1L0NJ 3RK3E 4DCKA 3L70G 1LTAC 1PPJD 1KILE 1PFIA 1M56D 1OVVA 2A45I 5TJHA 3L73D 4YTPC 2WPVB 1HGVA 2KUBA 2ZAEB 5AVWB 1Y47A 1ZRTE 2YIUB 3OAKA 3EFGA 2WSEJ 1NOHA 4UB6H 5KAIE 1E5WA 1RQUA 3H1IJ 1QLED 1JY2P 4KT0J 1DH3A 1LJ2A 4PJ0E 1NTKJ 1NU1J 2A45G 4PV1B 2ZXXA 3CXHE 1M57D 2WITA 2H88C 3FGAD 1CSBA 2J58A 2IX7C 3WUVA 3AEEC 3N4XA 2KI7B 1M1KQ 1QGKB 1T3UA 1GU5A 1BGYD 5KLVJ 2Y9YA 2ZT9C 4U7JA 3EFFK 1YTZI 4OVNF 1VDFA 3CMEP 1FOSE 1ZW0A 1YITP 1PGOA 4L75A 4H13B 4O9BA 2N9YB 3MP7B 1IFIA 1S2EA 5KAIH 3L70E 5CCHD 2IBZI 2W6AA 2WTYA 1BDDA 3E1RA 3TSIA 1S3JA 1FDOA 1URQB 5KAFE 2R44A 4PJ0H 2ZFCA 3I55P 3Q5RA 3NTNA 2E43A 2BCCG 1GK4A 2RKLA 1BCCE 3NMDA 3BVHA 3CXHH 3HE5B 1JUNA 4LGDE 2D2CB 4LC1A 2QIWA 2H7HA 5APQA 3IFMA 3HE5A 3HRNA 4EI2A 5GTHH 2JR8A 3MTUE 1J1EB 5AW3B 2XNDH 3JCUH 1NHLA 2IFMA 5APYA 2HLOA 1JY3N 2QSIA 1SQPJ 2KSJA 3A0HE 3HUSC 1U57A 2FYUD 1T3JA 1N2DC 3I5CA 1L4AC 3GF7A 2E42A 2NZ2A 4JYBA 3GLMA 5B5EE 1QVFO 2PGDA 2P58A 1BSNA 5KAFH 3BCCD 1SLQA 2KS1B 3IN6A 2QA4P 3V4QA 1HF9A 4AYCA 3H1KD 2KS1A 5B66E 4KJMA 1FAVA 3CWBJ 3Q1MA 5AVQB 1N73B 2OYIB 1NTMD 2YXRB 2L5GB 1OIPA 2BCCE 1ZR2A 1MKMA 2BEQD 1SFCB 1Z56A 4WB4A 4YXDC 3CXHD 4XA4A 4D6TD 1N73A 2OYIA 2K37A 3CX5H 4I1LA 3CMAP 3ZDMA 4JBZA 1RH5B 2PRRA 2R5DA 3Q5SA 1SFCA 2HODB 2P2UA 1ZP0C 4WY4B 4RKUJ 1OW7A 2YMKA 1SQXK 3BRTB 2HODA 2QM7A 1GTWA 4H0LB 5B5EH 1G1JA 1WT6A 4WY4A 4PD4I 1W5CE 1YBKA 1W2BO 2AXTE 3KQGA 1LTJB 3OW2O 3V2PA 3TGUE 1AA0A 3H1JE 1LTJA 1KILC 1W2EA 2MJZA 1KD1Q 2C0WA 2ZT9B 1VF5C 3G71P 3CPWO 3HTKB 3GMAA 1H8AA 2GM4A 1GL2C 5AVYB 3M91A 3FXEA 4R4LA 3OJAB 3SSUA 4GIFA 1BCCD 3HTKA 4PV1D 2R3CA 3V6IA 1PIXA 2XDJA 2CK3H 1PPJG 3H1HD 4C7RA 1L0LK 2QVAA 3CCRP 2FYUJ 1NTZD 2OTKE 1P84I 1RQVA 1LP1B 1QX8A 1OWAA 2DW3A 1BE3E 3CX5D 3LIEA 3H25A 1PGJA 1X0TA 3AE7C 2P1JA 1ZLLA 3SFDC 2QM8A 4TT3H 1EDJA 3VMAA 4CPGA 3NXSA 1SQVE 3R2PA 1FU1A 3G9RA 2G3AA 3VMYA 4H13D 1OW8A 4W7ZA 3KZIH 2Q7CA 3T97B 1GMJA 4L76A 1X22A 3ITKA 2M0BA 1URQD 2GA1A 1DEBA 1Q90D 1L4AB 3T97A 1J1DB 2O3JA 4RESB 3MGNA 2YIUC 4D6TJ 5AVUB 1L4AA 2D2CD 3P8CE 1H89A 2FY8A 2ZVNB 4DOJA 4PD4E 5GTIH 1NAYA 4K35A 1IZNB 1NKZB 1HVVA 1KYOI 1PP9G 1L2PA 2IBZD 1R5LA 1SQXG 2FYNB 5APWA 3L70J 3RL0g 1N86A 2O01H 3BRVB 5AVVB 4DJGA 3VMZA 3H1ID 1NWQA 3AEBC 1HUCA 3L72G 1U7JA 4ASVA 3TGUD 3H1JD 4HYTB 1SQQE 1BCCJ 1T6AA 4YPCA 1AJYA 1KC8Q 3H6PA 1NGMB 2JWDA 1P84E 3PRJA 3S9OA 2P67A 1JY2N 3RK3B 1YI2P 4PD4H 5AVXB 2JKVA 2K3RA 2E74C 1T8ZA 2WSFJ 2ZYAA 2QJYB 1HBWA 1USEA 3RK2B 2WMMA 5AW2B 1L0LG 2B87B 2K9JB 1MUUA 3BCCG 5TISH 3TNUB 1K04A 4WY4D 2B87A 1RF1B 4L73A 2K9JA 2OYOA 3H1KG 1XTGB 3TNUA 1H88A 4H0LD 5CBNA 1S4XA 1IFDA 2W8ZA 1RF1A 1SQVD 2Z5IA 3AE1C 1IFJA 4BXLA 1R8EA 3CCLP 2HPCB 1FZBA 3H1LG 1QL2A 2NRGA 2A06E 3AE3C 2WVRA 1FZAA 1L0NK 2HPCA 3AEAC 3D6YA 2ZT9D 1EZVD 1OVRA 3L72E 3HE4B 3AE9C 3C1LA 1SS1A 4B86A 5AW0B 1KYOE 1XTCC 3HE4A 3SFEC 4ZNCA 2LXBA 3HD7B 1SQPD 3CD6P 1X8YA 1IFPA 2KIKA 1IFNA 2FYZA 3CCVP 4PD4D 1VQ9P 1SQBK 3CLQA 3HD7A 1N73C 2OYIC 4I6MC 1S5LX 1ZOYC 1NTKK 1NU1K 3CI9A 3CCEP 3MZWB 1HWTC 1JB0J 1SFCC 3D70A 3L71E 1L0LE 2V7QH 4EYYQ 2ITAA 2JEEA 1JTHB 3TGUJ 1IO4A 2E75B 3H1JJ 1SP4A 3NFQA 1DIPA 3AE5C 3KHUA 4WY4C 1EXIA 2RMZA 1JTHA 3II6A 4AQRD 3CWBD 2HG5D 5DJTB 4H0LC 5KLVK 1IK9A 2H89C 3TF5A 1VQ8P 1SQQD 1LTJC 3H1HG 2IFNA 3H1LE 1NAFA 1VQKP 1L4AD 5AVSB 1FJPA 2Y0DA 5APSA 1PZQA 3VYIA 5KTBA 2KNCB 4IL6X 3KDPB 3R4YA 1YYCA 2Z4EA 1BE3J 2KNCA 3L37A 3C8VA 2OTJP 3Q3DA 4NPFX 1WMKA 1SQVJ 2E74B 4WVZA 4JQ0D 5AVRB 1Y8AA 3F89A 4IOIH 2K9YA 2HFED 4AUWA 4C46A 3N7NA 2O01J 3AE6C 1ZN5A 5CJ0A 5AW6B 3AEDC 4N3YB 1RF0A 2QJPC 5M1BA 1WRGA 3E7KA 1L0NG 2WPRA 2KXPB 4RO0A 2E76B 4UB8E 5AW8B 3RK3D 4IL6E 1IJDB 1GW4A 1J1DC 1KILD 1VPCA 1CZQA 2L91A 1PL5A 2NPSB 1FDMA 2O1KA 1VF5D 3P8MC 2O1JA 4HH2A 2NPSA 1GL2D 1SQBG 2Q3IA 3KYQA 4BRYB 1ZRTD 4KHXA 5APXA 3CCSP 1NTKG 1NU1G 4OH8B 5CHXA 3SWKA 5APTA 2IPPA 4BRYA 2SPZA 4U3FG 1K73Q 4N78E 3SWYA 1Q81Q 1SQQJ 3MUDC 3L74G 2A45H 4ZMDA 3F5HA 3RGUA 2WSFH 2C9NY 2FYNC 2LR2A 2R3SA 5KLVG 4JPZB 1A02J 2KB7P 2YO2A 3A0HH 1LT9C 4UB8H 1LTBC 2PFXA 3G3ZA 2FBWC 1L0NE 4ASWA 1JNMA 4YXWH 3LW5J 5CBOA 3V2NA 3CCUP 3A5TA 3U1CA 2IZ0A 1FZGA 3D71A 3HD7D 1N7SB 2ZJSE 2N1TB 2QJKC 3RK3C 1GDTA 1QL1A 3L70D 1M1JB 1N7SA 2IZ1A 4GODA 5B66H 2Z5HA 1RE4C 2N1TA 4M3LA 2QJYC 1M1JA 1CW5A 3RK2C 1LTTC 1VQOP 5APVA 3L75G 2V7QJ 2QG4A 1SQBE 3RL0B 1EDKA 2M3EA 1M90Q 2WT7B 4XFJA 2FYUK 2FXMA 1RF1C 2W6JH 1RE3A 2WT7A 5KJ7C 3KXDA
chains in the Genus database with same CATH topology
2K1AA 2M3EA 2KNCA 2K9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K1A A;  2M3E A;  2KNC A;  2K9J A; 
#chains in the Genus database with same CATH topology
 4U3F E;  1FE6 A;  3L72 J;  3L73 G;  2AEM A;  3L74 E;  4BWN A;  1MFZ A;  1VQ4 P;  1NKN A;  3FXD A;  1DX7 A;  1JEK A;  2HYN A;  3B4S A;  3AE8 C;  5KLV E;  1NH4 A;  1JO5 A;  2AXT H;  3I56 P;  3VTP C;  2RH0 A;  5BU5 A;  2QJP B;  1N7L A;  1KTM A;  1K05 A;  1D7M A;  2WQY C;  1BDC A;  1NTM K;  1G2C A;  4GOF A;  1VQ7 P;  1LTG C;  3L71 J;  1L0L J;  1OXZ A;  3USS A;  3HD7 C;  4WBA A;  2AXC A;  2YKO A;  3CCM P;  2E74 D;  2WSS H;  3CC7 P;  3A7O A;  2ZYG A;  3AE2 C;  2N9B A;  3WUU A;  1BGY G;  1Q86 Q;  2GUV A;  3M9Q A;  4QMA A;  5K5G B;  3L75 E;  3IR9 A;  5BU8 B;  1HJ0 A;  3H1L J;  2BCC D;  2KOG A;  2E75 C;  1R5S A;  2QEX P;  1VL2 A;  2I8D A;  3H32 B;  1JM0 A;  1Q2N A;  4XE5 B;  2K88 A;  1PPJ E;  1J2J B;  2E76 D;  2ZXE B;  4GOE A;  3A0B E;  4N6J A;  4JF7 A;  2XZR A;  2KZI A;  3H32 A;  3L73 E;  1KQS O;  3WMM 0;  2W27 A;  2JWA A;  1QEX A;  1KQG B;  1IFM A;  3MUD A;  4Y28 J;  1LT9 B;  2Q3E A;  2WZ7 A;  1LT9 A;  2O01 N;  1NTZ K;  3PTZ A;  3M9H A;  3CC4 P;  2PP6 A;  3M0D C;  3VP9 A;  3PP5 A;  3TK1 A;  3B8E B;  3AEF C;  1NO4 A;  2QJK B;  3S4R A;  2FYU G;  2B9B A;  1BSH A;  1FS0 E;  2B89 A;  4GKG A;  3M9B A;  1S72 P;  4WWI A;  1SFC D;  4HB1 A;  1RF0 C;  1BGY E;  1FJK A;  4IFF A;  3BAT A;  2AEF A;  1MZ9 A;  1RE4 A;  1AVY A;  2WWW A;  3IF4 A;  1S9K E;  1GK6 A;  1KQF B;  2W83 C;  1FC2 C;  4IFM A;  1EC5 A;  1AV1 A;  2JO1 A;  3B71 A;  1BE3 D;  3P7K A;  4ZKU A;  2QRX A;  2Q5U A;  1A02 F;  1PP9 E;  2E76 C;  1AQT A;  2KLV A;  2I1K A;  5KJ7 A;  1N7S D;  3KPE A;  2N1T D;  1SQX E;  2H43 A;  1K9M Q;  1NTM G;  2JP3 A;  1HJB A;  2KK7 A;  1JMM A;  1LWU B;  1E79 H;  3B5N C;  2NPS C;  4D6T G;  2UWJ E;  5KKZ B;  3CCJ P;  1P84 H;  3SWF A;  1LWU A;  4JYC A;  2BCC J;  3LW5 H;  3S1K A;  2OAR A;  1VQL P;  2GUS A;  1JY3 O;  4Z1M H;  1USD A;  3P8C D;  1X79 B;  2HR3 A;  4A7P A;  4ZKP A;  1YJN P;  2BAS A;  1VQP P;  1FDI A;  2Y0E A;  2ZYD A;  4TLF A;  4Y99 C;  1JCC A;  1KB9 I;  3Q5P A;  5CCG C;  1KOR A;  3V2Q A;  4C7N B;  1VQ6 P;  3BCC E;  2C0X A;  3CX5 I;  1YIJ P;  1GZL A;  1NJI Q;  1YQ3 C;  4C7N A;  1VQN P;  1BCC G;  1TU3 F;  4RJT A;  1EDL A;  3H1K E;  1K8A Q;  1FZF A;  2Y0C A;  2H8P D;  3CL3 D;  4OGQ B;  1SQB J;  2C9L Y;  3QH9 A;  1N7S C;  3V2R A;  1KYO H;  2Q6Q A;  2N1T C;  1NTM E;  2P10 A;  1NTZ G;  1KN7 A;  2B88 A;  2E5T A;  2OQQ A;  3VMX A;  1M1J C;  5APU A;  4D6T E;  2CPB A;  4EIJ A;  4U3F J;  1LGH B;  1P84 D;  3L74 J;  1VQM P;  1AQ5 A;  3RL0 C;  1S1C X;  1SQV K;  1RE3 C;  5GTH E;  3W68 A;  1S5L E;  2YKQ A;  3JCU E;  2OTL P;  2FFD C;  3PLN A;  3U59 A;  2FXP A;  1S9K D;  4DZO A;  1OMI A;  1PV3 A;  3M0D A;  3CC2 P;  3O8Z A;  1N8R Q;  2XKM A;  3D6Z A;  1PP9 D;  1T2K D;  3P32 A;  2W6B A;  2WSC J;  2XU6 A;  3L4F A;  2V4H A;  1SQP K;  1SQX D;  1DEE G;  1FOS F;  4K3A A;  2A06 D;  1KMI Z;  3K5B A;  1URQ A;  1UIX A;  2OYH B;  3BAS A;  1OFC X;  1LTS C;  3PH0 A;  5EFW B;  2YXQ B;  1ZME C;  1NVO A;  1FZC C;  3L72 D;  2OYH A;  3L75 J;  3H1H E;  1KB9 E;  1KYO D;  2IBZ G;  1NTZ E;  1S5L H;  3B5N B;  5L8R J;  5KLI B;  4L74 A;  3CX5 E;  3L35 A;  1LNQ A;  4EOT A;  3H1I G;  3L73 J;  3RK2 D;  3B5N A;  1HH0 A;  1ZXG A;  3TGU G;  1SQQ K;  3H1J G;  2YKP A;  1M7L A;  3AEC C;  5BVZ A;  4H44 B;  1DD3 A;  2PAJ A;  3L71 D;  2E5Y A;  5KJ7 D;  1L0L D;  3IAO A;  4I2L C;  1KFN A;  3OA7 A;  5DJU B;  5AW1 B;  3GHG C;  4DT0 A;  1GU4 A;  5AW5 B;  4Y99 B;  3UIA A;  1KQL A;  1OX3 A;  2P7J A;  5CCH C;  3GG2 A;  1T2K C;  4LLH A;  2BEZ F;  3AE4 C;  1IK7 A;  1GD2 E;  1EDI A;  2W90 A;  5AW7 B;  3M06 A;  1KB9 H;  1JOC A;  2WPS A;  3H1L D;  4IL6 H;  5CCG A;  2Q9I A;  2KSE A;  2XNX A;  3MHV A;  1EXJ A;  1EZV I;  3EWK A;  1BE3 G;  1BGY J;  5CJ4 A;  3Q2Y A;  1OVU A;  4I7Z C;  3QWO C;  1G1I A;  3MIW A;  1SQV G;  2IBZ E;  1PGQ A;  3A3Y B;  3M0A A;  4HJG H;  1IC2 A;  2G8Y A;  3LID A;  3U1A A;  1PP9 J;  1JCD A;  1SVF A;  4NPD A;  3W67 A;  3H1I E;  4EDF A;  2YNY A;  5E79 E;  1EZV G;  1ZV8 A;  2Y9Z A;  1SQX J;  2M8R A;  2KLU A;  3JSV C;  1LTI C;  1NTK E;  1NU1 E;  2E75 D;  3TYY A;  1EQ7 A;  3WU2 E;  2IDB A;  3E1I A;  1LT1 A;  2IYP A;  2FFD B;  3KZI E;  1JY2 O;  1JY3 P;  2YO3 A;  3FX0 A;  5H2F E;  1SQP G;  4OGQ D;  2FFD A;  3WUT A;  5AVT B;  3RBZ A;  3VP8 A;  2LKM A;  1GW3 A;  2OGU A;  5AVZ B;  3O6Q B;  1CI6 B;  1YHQ P;  1UII A;  1LWU C;  3FWL A;  1M8O B;  3O6Q A;  5KKZ C;  1KB9 D;  1CI6 A;  1G2C B;  1RY3 A;  5GTI E;  2WSE H;  1FZC B;  2KYV A;  3AEG C;  2POH A;  3CWB G;  1LP1 A;  2M5A B;  5E79 H;  3VN0 A;  3BCC J;  1SQQ G;  1FZC A;  2M5A A;  1OZH A;  1NYH A;  2FXO A;  3JC2 2;  3WU2 H;  1YTZ T;  4MN4 C;  3H1K J;  3RBX A;  2FKW B;  5H2F H;  4N78 D;  3G6E P;  3HUS B;  2M3B A;  2VRS A;  2IYO A;  1EZV E;  2WPQ A;  1PGP A;  1NTM J;  3A2A A;  3HUS A;  1VQ5 P;  3PJS K;  1MFT A;  4GT1 A;  1SQP E;  1KFM A;  4OGQ C;  1HTL C;  3GHG B;  1L0N D;  3G4S P;  2R32 A;  5AW4 B;  4W80 A;  4PV1 C;  3GHG A;  1YJ9 P;  3B5N D;  1Y9B A;  2WSC H;  1H0T B;  1FZE A;  2NPS D;  2JDI H;  5CCH A;  3CCQ P;  3C9I A;  3MD0 A;  2RN0 A;  1H0T A;  5TIS E;  2A06 G;  2ZVO B;  4H44 D;  1KZU B;  1ZR4 A;  1Q82 Q;  3GW6 A;  4GDO A;  3CWB E;  2JJL A;  4I7Z B;  1SQB D;  1HGZ A;  4IFD K;  2LXC B;  5AW9 B;  1NTK D;  1NU1 D;  2MKV A;  4R4M A;  2Q1K A;  2AEJ A;  4H13 C;  1OW6 A;  1AVO A;  1KV4 A;  3PHL A;  4U3F D;  3A0B H;  4NPE A;  5CCG D;  2R5B A;  1DD4 A;  4W7Y A;  3L74 D;  3TDK A;  3H1H J;  1URQ C;  3CXH I;  3ABV C;  1NTZ J;  1KIL B;  3L36 A;  5KLV D;  2OYH C;  1VF5 B;  4OWF A;  2D2C C;  1KIL A;  3L71 G;  1GL2 B;  3GF3 A;  1U7M A;  2CPS A;  1GL2 A;  2XV5 A;  1J1E C;  3EQ2 A;  5C39 A;  1QVG O;  4UB6 E;  5KLI C;  1RHZ B;  3FWN A;  1YQ4 C;  1YJW P;  3V4W A;  5CMZ A;  3VOP A;  1MV8 A;  3RL0 D;  1X9V A;  2J59 M;  1JMB A;  2I1J A;  2QE7 H;  4H44 C;  3V5B A;  2YMY A;  2KP8 A;  2K1A A;  3L75 D;  2J5U A;  4HKZ H;  1AFO A;  1Q7Y Q;  2FYU E;  2KZJ A;  1FBM A;  1L0N J;  3RK3 E;  4DCK A;  3L70 G;  1LTA C;  1PPJ D;  1KIL E;  1PFI A;  1M56 D;  1OVV A;  2A45 I;  5TJH A;  3L73 D;  4YTP C;  2WPV B;  1HGV A;  2KUB A;  2ZAE B;  5AVW B;  1Y47 A;  1ZRT E;  2YIU B;  3OAK A;  3EFG A;  2WSE J;  1NOH A;  4UB6 H;  5KAI E;  1E5W A;  1RQU A;  3H1I J;  1QLE D;  1JY2 P;  4KT0 J;  1DH3 A;  1LJ2 A;  4PJ0 E;  1NTK J;  1NU1 J;  2A45 G;  4PV1 B;  2ZXX A;  3CXH E;  1M57 D;  2WIT A;  2H88 C;  3FGA D;  1CSB A;  2J58 A;  2IX7 C;  3WUV A;  3AEE C;  3N4X A;  2KI7 B;  1M1K Q;  1QGK B;  1T3U A;  1GU5 A;  1BGY D;  5KLV J;  2Y9Y A;  2ZT9 C;  4U7J A;  3EFF K;  1YTZ I;  4OVN F;  1VDF A;  3CME P;  1FOS E;  1ZW0 A;  1YIT P;  1PGO A;  4L75 A;  4H13 B;  4O9B A;  2N9Y B;  3MP7 B;  1IFI A;  1S2E A;  5KAI H;  3L70 E;  5CCH D;  2IBZ I;  2W6A A;  2WTY A;  1BDD A;  3E1R A;  3TSI A;  1S3J A;  1FDO A;  1URQ B;  5KAF E;  2R44 A;  4PJ0 H;  2ZFC A;  3I55 P;  3Q5R A;  3NTN A;  2E43 A;  2BCC G;  1GK4 A;  2RKL A;  1BCC E;  3NMD A;  3BVH A;  3CXH H;  3HE5 B;  1JUN A;  4LGD E;  2D2C B;  4LC1 A;  2QIW A;  2H7H A;  5APQ A;  3IFM A;  3HE5 A;  3HRN A;  4EI2 A;  5GTH H;  2JR8 A;  3MTU E;  1J1E B;  5AW3 B;  2XND H;  3JCU H;  1NHL A;  2IFM A;  5APY A;  2HLO A;  1JY3 N;  2QSI A;  1SQP J;  2KSJ A;  3A0H E;  3HUS C;  1U57 A;  2FYU D;  1T3J A;  1N2D C;  3I5C A;  1L4A C;  3GF7 A;  2E42 A;  2NZ2 A;  4JYB A;  3GLM A;  5B5E E;  1QVF O;  2PGD A;  2P58 A;  1BSN A;  5KAF H;  3BCC D;  1SLQ A;  2KS1 B;  3IN6 A;  2QA4 P;  3V4Q A;  1HF9 A;  4AYC A;  3H1K D;  2KS1 A;  5B66 E;  4KJM A;  1FAV A;  3CWB J;  3Q1M A;  5AVQ B;  1N73 B;  2OYI B;  1NTM D;  2YXR B;  2L5G B;  1OIP A;  2BCC E;  1ZR2 A;  1MKM A;  2BEQ D;  1SFC B;  1Z56 A;  4WB4 A;  4YXD C;  3CXH D;  4XA4 A;  4D6T D;  1N73 A;  2OYI A;  2K37 A;  3CX5 H;  4I1L A;  3CMA P;  3ZDM A;  4JBZ A;  1RH5 B;  2PRR A;  2R5D A;  3Q5S A;  1SFC A;  2HOD B;  2P2U A;  1ZP0 C;  4WY4 B;  4RKU J;  1OW7 A;  2YMK A;  1SQX K;  3BRT B;  2HOD A;  2QM7 A;  1GTW A;  4H0L B;  5B5E H;  1G1J A;  1WT6 A;  4WY4 A;  4PD4 I;  1W5C E;  1YBK A;  1W2B O;  2AXT E;  3KQG A;  1LTJ B;  3OW2 O;  3V2P A;  3TGU E;  1AA0 A;  3H1J E;  1LTJ A;  1KIL C;  1W2E A;  2MJZ A;  1KD1 Q;  2C0W A;  2ZT9 B;  1VF5 C;  3G71 P;  3CPW O;  3HTK B;  3GMA A;  1H8A A;  2GM4 A;  1GL2 C;  5AVY B;  3M91 A;  3FXE A;  4R4L A;  3OJA B;  3SSU A;  4GIF A;  1BCC D;  3HTK A;  4PV1 D;  2R3C A;  3V6I A;  1PIX A;  2XDJ A;  2CK3 H;  1PPJ G;  3H1H D;  4C7R A;  1L0L K;  2QVA A;  3CCR P;  2FYU J;  1NTZ D;  2OTK E;  1P84 I;  1RQV A;  1LP1 B;  1QX8 A;  1OWA A;  2DW3 A;  1BE3 E;  3CX5 D;  3LIE A;  3H25 A;  1PGJ A;  1X0T A;  3AE7 C;  2P1J A;  1ZLL A;  3SFD C;  2QM8 A;  4TT3 H;  1EDJ A;  3VMA A;  4CPG A;  3NXS A;  1SQV E;  3R2P A;  1FU1 A;  3G9R A;  2G3A A;  3VMY A;  4H13 D;  1OW8 A;  4W7Z A;  3KZI H;  2Q7C A;  3T97 B;  1GMJ A;  4L76 A;  1X22 A;  3ITK A;  2M0B A;  1URQ D;  2GA1 A;  1DEB A;  1Q90 D;  1L4A B;  3T97 A;  1J1D B;  2O3J A;  4RES B;  3MGN A;  2YIU C;  4D6T J;  5AVU B;  1L4A A;  2D2C D;  3P8C E;  1H89 A;  2FY8 A;  2ZVN B;  4DOJ A;  4PD4 E;  5GTI H;  1NAY A;  4K35 A;  1IZN B;  1NKZ B;  1HVV A;  1KYO I;  1PP9 G;  1L2P A;  2IBZ D;  1R5L A;  1SQX G;  2FYN B;  5APW A;  3L70 J;  3RL0 g;  1N86 A;  2O01 H;  3BRV B;  5AVV B;  4DJG A;  3VMZ A;  3H1I D;  1NWQ A;  3AEB C;  1HUC A;  3L72 G;  1U7J A;  4ASV A;  3TGU D;  3H1J D;  4HYT B;  1SQQ E;  1BCC J;  1T6A A;  4YPC A;  1AJY A;  1KC8 Q;  3H6P A;  1NGM B;  2JWD A;  1P84 E;  3PRJ A;  3S9O A;  2P67 A;  1JY2 N;  3RK3 B;  1YI2 P;  4PD4 H;  5AVX B;  2JKV A;  2K3R A;  2E74 C;  1T8Z A;  2WSF J;  2ZYA A;  2QJY B;  1HBW A;  1USE A;  3RK2 B;  2WMM A;  5AW2 B;  1L0L G;  2B87 B;  2K9J B;  1MUU A;  3BCC G;  5TIS H;  3TNU B;  1K04 A;  4WY4 D;  2B87 A;  1RF1 B;  4L73 A;  2K9J A;  2OYO A;  3H1K G;  1XTG B;  3TNU A;  1H88 A;  4H0L D;  5CBN A;  1S4X A;  1IFD A;  2W8Z A;  1RF1 A;  1SQV D;  2Z5I A;  3AE1 C;  1IFJ A;  4BXL A;  1R8E A;  3CCL P;  2HPC B;  1FZB A;  3H1L G;  1QL2 A;  2NRG A;  2A06 E;  3AE3 C;  2WVR A;  1FZA A;  1L0N K;  2HPC A;  3AEA C;  3D6Y A;  2ZT9 D;  1EZV D;  1OVR A;  3L72 E;  3HE4 B;  3AE9 C;  3C1L A;  1SS1 A;  4B86 A;  5AW0 B;  1KYO E;  1XTC C;  3HE4 A;  3SFE C;  4ZNC A;  2LXB A;  3HD7 B;  1SQP D;  3CD6 P;  1X8Y A;  1IFP A;  2KIK A;  1IFN A;  2FYZ A;  3CCV P;  4PD4 D;  1VQ9 P;  1SQB K;  3CLQ A;  3HD7 A;  1N73 C;  2OYI C;  4I6M C;  1S5L X;  1ZOY C;  1NTK K;  1NU1 K;  3CI9 A;  3CCE P;  3MZW B;  1HWT C;  1JB0 J;  1SFC C;  3D70 A;  3L71 E;  1L0L E;  2V7Q H;  4EYY Q;  2ITA A;  2JEE A;  1JTH B;  3TGU J;  1IO4 A;  2E75 B;  3H1J J;  1SP4 A;  3NFQ A;  1DIP A;  3AE5 C;  3KHU A;  4WY4 C;  1EXI A;  2RMZ A;  1JTH A;  3II6 A;  4AQR D;  3CWB D;  2HG5 D;  5DJT B;  4H0L C;  5KLV K;  1IK9 A;  2H89 C;  3TF5 A;  1VQ8 P;  1SQQ D;  1LTJ C;  3H1H G;  2IFN A;  3H1L E;  1NAF A;  1VQK P;  1L4A D;  5AVS B;  1FJP A;  2Y0D A;  5APS A;  1PZQ A;  3VYI A;  5KTB A;  2KNC B;  4IL6 X;  3KDP B;  3R4Y A;  1YYC A;  2Z4E A;  1BE3 J;  2KNC A;  3L37 A;  3C8V A;  2OTJ P;  3Q3D A;  4NPF X;  1WMK A;  1SQV J;  2E74 B;  4WVZ A;  4JQ0 D;  5AVR B;  1Y8A A;  3F89 A;  4IOI H;  2K9Y A;  2HFE D;  4AUW A;  4C46 A;  3N7N A;  2O01 J;  3AE6 C;  1ZN5 A;  5CJ0 A;  5AW6 B;  3AED C;  4N3Y B;  1RF0 A;  2QJP C;  5M1B A;  1WRG A;  3E7K A;  1L0N G;  2WPR A;  2KXP B;  4RO0 A;  2E76 B;  4UB8 E;  5AW8 B;  3RK3 D;  4IL6 E;  1IJD B;  1GW4 A;  1J1D C;  1KIL D;  1VPC A;  1CZQ A;  2L91 A;  1PL5 A;  2NPS B;  1FDM A;  2O1K A;  1VF5 D;  3P8M C;  2O1J A;  4HH2 A;  2NPS A;  1GL2 D;  1SQB G;  2Q3I A;  3KYQ A;  4BRY B;  1ZRT D;  4KHX A;  5APX A;  3CCS P;  1NTK G;  1NU1 G;  4OH8 B;  5CHX A;  3SWK A;  5APT A;  2IPP A;  4BRY A;  2SPZ A;  4U3F G;  1K73 Q;  4N78 E;  3SWY A;  1Q81 Q;  1SQQ J;  3MUD C;  3L74 G;  2A45 H;  4ZMD A;  3F5H A;  3RGU A;  2WSF H;  2C9N Y;  2FYN C;  2LR2 A;  2R3S A;  5KLV G;  4JPZ B;  1A02 J;  2KB7 P;  2YO2 A;  3A0H H;  1LT9 C;  4UB8 H;  1LTB C;  2PFX A;  3G3Z A;  2FBW C;  1L0N E;  4ASW A;  1JNM A;  4YXW H;  3LW5 J;  5CBO A;  3V2N A;  3CCU P;  3A5T A;  3U1C A;  2IZ0 A;  1FZG A;  3D71 A;  3HD7 D;  1N7S B;  2ZJS E;  2N1T B;  2QJK C;  3RK3 C;  1GDT A;  1QL1 A;  3L70 D;  1M1J B;  1N7S A;  2IZ1 A;  4GOD A;  5B66 H;  2Z5H A;  1RE4 C;  2N1T A;  4M3L A;  2QJY C;  1M1J A;  1CW5 A;  3RK2 C;  1LTT C;  1VQO P;  5APV A;  3L75 G;  2V7Q J;  2QG4 A;  1SQB E;  3RL0 B;  1EDK A;  2M3E A;  1M90 Q;  2WT7 B;  4XFJ A;  2FYU K;  2FXM A;  1RF1 C;  2W6J H;  1RE3 A;  2WT7 A;  5KJ7 C;  3KXD A; 
#chains in the Genus database with same CATH homology
 2K1A A;  2M3E A;  2KNC A;  2K9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...