2KNCA

Platelet integrin alfaiib-beta3 transmembrane-cytoplasmic heterocomplex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
54
structure length
54
Chain Sequence
GAMGSEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRPPLEEDDEEGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
publication title Structure of an integrin alphaIIb beta3 transmembrane-cytoplasmic heterocomplex provides insight into integrin activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 13
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00357 Integrin_alpha Integrin alpha cytoplasmic region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.930 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Bicelle-embedded integrin alpha(iib) transmembrane segment 2kncA00
2K9JA 2M3EA 2K1AA 2KNCA
chains in the Genus database with same CATH superfamily
1QEXA 1SS1A 3L72D 1VQKP 3WUVA 4BWNA 1K8AQ 1SQVJ 2LXBA 1GK6A 2JEEA 1KILE 1LTGC 4U3FE 1NVOA 2WPQA 3P32A 2W90A 1SQQJ 3SWKA 5AVXB 5KAFE 4QMAA 2P2UA 2JJLA 4YTPC 3L71G 5AW8B 1NTKK 1QLED 1RF0C 3BRTB 1QL1A 3FX0A 2W83C 1YYCA 3OAKA 1QGKB 2ZXEB 4TLFA 4UB8E 1LWUC 4OGQC 1Y47A 3SFEC 3MIWA 1J2JB 3RL0g 1D7MA 5M1BA 3B5NC 4DJGA 4WB4A 2Q9IA 2HPCB 1N7SB 4JYCA 4Y99C 1K73Q 3EQ2A 2IFNA 3K5BA 1MV8A 3IAOA 1KB9H 2WSCH 3M0AA 1FOSF 1ZMEC 1BDCA 3VP8A 3D6YA 1BGYG 4L74A 2A06G 3PHLA 4K3AA 3BRVB 1M1JC 3G9RA 2YMKA 3H1JG 1JY2P 4GOFA 3GMAA 1EQ7A 2B87A 1L0LJ 3HUSC 2JO1A 2FFDC 1YJ9P 1H0TB 3H1JD 3H6PA 2B9BA 4JF7A 3CXHE 1KTMA 3LIEA 1VQPP 2YXRB 3NTNA 4AUWA 1URQB 1KILA 2R5BA 2W6BA 3VOPA 1LT9B 2Q5UA 2R44A 1KV4A 1NTME 3RK3C 1IO4A 3P8MC 2FXPA 3BASA 3HE5A 1NOHA 4IFFA 1VQNP 1J1DC 3L73E 3H1IE 3CCUP 3N7NA 3USSA 3I5CA 1U57A 1NU1D 3L71J 3BVHA 3VMXA 3RL0D 3TNUA 1IFMA 1VDFA 4RESB 3AEAC 4D6TG 3H32A 1P84I 3A0BH 1N73C 4Y28J 2M8RA 2JP3A 1HVVA 2AXCA 1KYOD 2YNYA 3AE3C 1NTZG 4NPDA 2KSEA 4D6TD 1FC2C 1AVOA 3CCVP 1E5WA 3MZWB 3D70A 1EDLA 4JQ0D 4O9BA 3L70D 3M0DC 1KYOH 1KQSO 2JDIH 1CZQA 1NHLA 2NPSA 3AE4C 3E7KA 4BRYB 1JY3O 4LC1A 1BGYJ 4N78D 1FZEA 1PPJE 2WPRA 5H2FH 3MUDC 5KLVJ 3PTZA 4H13C 3Q1MA 3P8CD 4DOJA 1RH5B 3AE5C 1LTTC 1BCCG 1PP9D 3GF3A 2KNCA 3H1HG 2HODA 2BEZF 2W6AA 1HBWA 3I55P 1NH4A 5AVYB 1S4XA 2J5UA 4AQRD 1PFIA 1BE3J 5B5EE 3L75G 2KLVA 1GL2C 1AV1A 3CCSP 2WSFH 1OVRA 2QJKB 4W80A 4M3LA 4JBZA 3L75D 1IK7A 2XV5A 3QWOC 2ZT9D 2Y0CA 1FJPA 4WY4A 1R5SA 2V4HA 1H8AA 2H88C 5CCGA 5AW2B 5APVA 1PZQA 3RL0B 4XE5B 1VQ8P 5AW0B 2K88A 2LKMA 4XA4A 2N1TC 1QVGO 3VMAA 2KS1A 1L4AD 1NTKG 2P1JA 2FYUG 5APXA 3MTUE 1NTZJ 5CJ4A 3A0BE 2Q6QA 2YKQA 1S9KE 2FYUD 2O1KA 1DD3A 5AW3B 2YMYA 3R4YA 3KZIH 2BCCD 1IFNA 1KYOE 5TJHA 3VYIA 2O01H 2WITA 2OYHB 5TISE 1LP1B 2WMMA 2HYNA 1GD2E 2M3EA 3L70E 3CCLP 2IYPA 1BCCJ 2YKOA 1HJ0A 4U3FG 3H1HJ 1YQ3C 4PD4I 1R5LA 1S5LH 1VQMP 1OZHA 2ZYDA 3NXSA 1X9VA 1SP4A 4N78E 4NPFX 3O8ZA 1KILD 4U3FD 1RHZB 1EZVE 3D6ZA 3CCEP 2IBZE 2QVAA 3SWYA 2IZ0A 1RF0A 4LLHA 1NU1K 2OTKE 2E5YA 1PP9E 2K9JB 2ZT9B 5KLIB 1GMJA 1N7SC 1CSBA 4PV1C 3H1KE 3CWBJ 1P84H 5KJ7C 3CC7P 2WSSH 1OXZA 1FAVA 2L91A 3G6EP 2YKPA 2Q3IA 1NTKJ 2AEMA 1SQVD 2Y9ZA 1HF9A 2E74C 4KHXA 5CHXA 2WT7A 1ZW0A 3TGUJ 3CI9A 1JY3N 4RKUJ 1URQC 3TF5A 4GDOA 3KQGA 1LT9C 3WUUA 2NPSD 3HD7A 1JY2O 3M06A 1FOSE 1VQ4P 5E79H 3L74G 2IPPA 1PGPA 3CXHD 1OX3A 2PRRA 1SQPD 1NTMG 3I56P 3AEDC 2OGUA 3OW2O 4A7PA 1SQBE 3L73G 3NMDA 3B4SA 3H1IG 2BCCE 1PV3A 1N86A 1RE4C 1GTWA 2NRGA 1KQGB 3L36A 4I6MC 4DZOA 3V2QA 1KILB 2H43A 4EIJA 3L72G 2JWAA 2O1JA 2HR3A 1S5LE 2KUBA 1AQ5A 1RE3C 2XU6A 1X8YA 3HE5B 2ZJSE 2ZVOB 4AYCA 3RK2B 2OARA 4I1LA 4WY4D 2KOGA 4L76A 5CCGD 3U59A 4ZKPA 1H89A 1JTHB 4Z1MH 1VF5B 1FZCA 3GG2A 3W67A 2K9JA 3TNUB 5GTHH 1GU4A 4DCKA 2HLOA 3M0DA 3PP5A 3H32B 2FYUK 3V6IA 2FY8A 1P84E 3LW5J 2YIUB 2M3BA 3KHUA 1PPJG 1XTGB 1L4AA 2K3RA 1USEA 2M5AA 5AVWB 4L73A 3H25A 1PPJD 1KB9D 2B88A 4BXLA 2JKVA 1KORA 1ZXGA 1NAYA 4KT0J 2NPSB 4H44D 1SQVE 4CPGA 3L74J 2Y0DA 2QJKC 1SFCC 3CX5I 2FXOA 3CMEP 5E79E 1T3UA 1SLQA 1SQQE 4WWIA 1NKNA 2W27A 2KNCB 4WVZA 4PD4H 2HODB 3AECC 3BCCD 3R2PA 3RL0C 2XNXA 2IFMA 3H1IJ 5DJUB 4ZKUA 2A45I 1S1CX 1IFIA 2P7JA 3CC2P 3L72J 1N2DC 2BEQD 2QRXA 1SQPE 2OTJP 2QM7A 1T6AA 5BU5A 2HG5D 2QG4A 1DIPA 1GDTA 4WY4B 3A7OA 4IFDK 3UIAA 5AVRB 3B5ND 1NU1G 2I1KA 2KK7A 2PFXA 3GHGA 2OYIA 1OWAA 1YTZI 4OH8B 4HYTB 2HFED 3S9OA 1VQOP 1S9KD 1JTHA 1LTJA 3CC4P 2KS1B 2OYHC 4HB1A 2I8DA 5GTHE 1RF1B 2WSCJ 2KSJA 2E76D 1JY2N 1J1EB 1Q7YQ 3CPWO 3L70G 3MGNA 1A02J 1W5CE 3AE1C 1FE6A 1IFJA 1SQPK 3HD7D 4H44B 2FXMA 1ZRTD 1S2EA 2ZYGA 1XTCC 4OVNF 1NTMK 2IBZG 4NPEA 3MP7B 3RK3D 2H89C 2YO3A 2Y9YA 5KLIC 2WTYA 4YPCA 3JCUH 1KB9E 1S3JA 1PP9G 3F5HA 1EZVD 3H1JJ 4C7RA 2IBZD 2PAJA 1JNMA 1GK4A 1RQUA 4PD4E 3II6A 1GU5A 5APUA 3H1KG 4R4LA 4KJMA 1E79H 3TDKA 2C0WA 3H1KD 1Q81Q 3BCCE 1BDDA 1SQXD 4W7ZA 2E42A 2FYNB 2O3JA 1NYHA 3VMZA 3PJSK 3B5NB 1T2KD 1DD4A 3D71A 1R8EA 1NU1J 2WSEH 4R4MA 1Q2NA 1CI6A 1UIIA 5CBOA 3FWLA 1LTIC 4C7NA 2IX7C 1KQFB 5KLVE 1M57D 1JCDA 2LR2A 5BU8B 1ZP0C 5CCHA 3GLMA 4D6TJ 3HRNA 1KD1Q 3A3YB 2WT7B 2E76B 3AE9C 2H7HA 3CX5D 4H13D 1RF1A 4GIFA 5KKZB 1KILC 2C9LY 1HGZA 1BE3E 2ZYAA 1NAFA 4ASWA 1WT6A 1SQBG 1HGVA 3HD7B 1DEBA 2BCCG 1PIXA 3CX5H 2RMZA 1JMBA 1GW4A 3Q5RA 1K9MQ 1QX8A 3O6QA 3PH0A 1SQBD 3M9BA 3RK2C 1IFDA 3RK3B 2IZ1A 2KYVA 2N9BA 1PP9J 1VF5C 2A45H 2E75D 2WZ7A 1LTBC 1LJ2A 3M9QA 1L2PA 1YTZT 3JCUE 5CJ0A 3B71A 1ZRTE 4JPZB 5H2FE 4ZMDA 2J58A 5K5GB 2YO2A 2W6JH 4I2LC 3RK3E 2YIUC 1NTZE 4WBAA 2E43A 3L75J 4K35A 1JY3P 1L0ND 3EFFK 3V5BA 2RN0A 2Y0EA 1OIPA 1EXJA 1LWUA 1FZCB 1P84D 1YI2P 2NPSC 2GM4A 2GUSA 3B5NA 3C1LA 4N3YB 1DEEG 5AVZB 1JMMA 1SQXE 5APQA 2NZ2A 3H1LD 4EOTA 1QL2A 1SQVG 1ZR2A 2C0XA 1N7LA 2CPBA 3MD0A 4ASVA 5KAFH 2E5TA 3TK1A 4H0LD 1L4AB 2FYUJ 2M5AB 3HTKB 1W2BO 1EDJA 1SQQG 2CPSA 1M1JA 1OW6A 2O01J 1ZR4A 3EWKA 3CCMP 2WVRA 3KYQA 3G4SP 3HUSA 2QSIA 2QEXP 1SQQD 2BCCJ 2FFDA 3M91A 3KPEA 1X0TA 1LNQA 1NO4A 4L75A 2PP6A 1Z56A 3BATA 4XFJA 3CX5E 2XKMA 4WY4C 1SQPG 1LTSC 3U1CA 1Q86Q 3RBXA 3OJAB 4RJTA 1VQLP 5CCGC 3KZIE 3SFDC 3VN0A 4GOEA 2R3SA 3L4FA 2E75B 3CWBE 3Q5SA 1T8ZA 5L8RJ 3A5TA 3C9IA 1PGQA 3LW5H 3E1RA 1YQ4C 1KQLA 3AE2C 3T97A 4PV1D 4U3FJ 1SQXK 1M7LA 5AW1B 1NTKE 3FXEA 5AVSB 1Y8AA 5KJ7D 4HH2A 2D2CD 2P10A 5APSA 5DJTB 1YHQP 1BSNA 3TGUE 2XZRA 1Q90D 1J1EC 1G2CA 1IC2A 3QH9A 2ZAEB 2R3CA 2E74D 3GHGB 4MN4C 1JOCA 1N73A 2OYIB 1L0LD 4GKGA 3W68A 1N8RQ 1KFMA 2XDJA 4H44C 1FZAA 2L5GB 2VRSA 3ABVC 1LTJB 1MZ9A 5C39A 3CCQP 5EFWB 2QM8A 3V4WA 1L0NE 4UB6H 1JM0A 2CK3H 5CCHD 3VP9A 5AW4B 3C8VA 1FDIA 4H0LB 2K37A 4TT3H 3JSVC 1M90Q 2IDBA 3EFGA 3FXDA 5GTIH 2KIKA 2R5DA 1JB0J 3GF7A 2V7QJ 3S4RA 1SQBK 1QVFO 1OVUA 2SPZA 3MUDA 1ZOYC 1FS0E 3H1LE 3HTKA 1K05A 2WWWA 1U7JA 1S72P 5AW5B 5KAIH 3V2PA 3FWNA 2OYOA 3L71D 5B66H 1KMIZ 1W2EA 2JR8A 3TSIA 2WPVB 2P58A 1SQPJ 4PD4D 2FYNC 1BSHA 3TYYA 3IFMA 3CD6P 2QIWA 1FDMA 1VPCA 3BCCG 1GL2A 3F89A 1FJKA 4GT1A 1NTMJ 3V2NA 1CW5A 2QJYB 1VQ7P 4IL6X 2N9YB 2WPSA 2AEJA 3WUTA 2H8PD 4PV1B 2KB7P 1VQ5P 1L0NK 1OW8A 3L73J 2G3AA 4YXDC 1Y9BA 2POHA 1RY3A 1X79B 2D2CB 4I7ZB 3M9HA 2W8ZA 4IL6H 2G8YA 3CMAP 5KLVG 4DT0A 1FZGA 2E76C 4B86A 2J59M 3IF4A 1BGYD 3Q5PA 2M0BA 2A06D 3Q2YA 5KKZC 2N1TA 3G71P 2R32A 4OGQD 2E74B 5KLVD 1Q82Q 1KFNA 5B5EH 1CI6B 3HD7C 1KC8Q 2FBWC 1YJWP 3L74E 3V2RA 4C7NB 2I1JA 1BE3G 3FGAD 1EDIA 5BVZA 2YXQB 1SQVK 1KZUB 3CCJP 3N4XA 1IFPA 4PJ0H 1UIXA 3V4QA 3Q3DA 1SFCD 1BE3D 2Z5HA 2ZXXA 4UB6E 1SQQK 4LGDE 1L0LE 1ZLLA 3IR9A 1HJBA 1NWQA 2AXTH 2QJPB 1GW3A 3L72E 1JCCA 2K9YA 5GTIE 2GUVA 3GW6A 3B8EB 3O6QB 2FYZA 4ZNCA 1M8OB 1LTAC 5KAIE 1IZNB 3CL3D 1T2KC 5B66E 1EZVG 2O01N 1FZCC 4OWFA 3CLQA 3BCCJ 2ZT9C 1HUCA 1HH0A 1MKMA 3L37A 1NTZD 1FBMA 5AW7B 1FZBA 5AVVB 3L71E 1LGHB 4HJGH 1AA0A 1FDOA 5AW6B 1AQTA 5APTA 2HPCA 1M56D 5TISH 1ZN5A 1N7SA 3AEBC 2UWJE 1L0LK 1EDKA 1U7MA 4JYBA 1L4AC 1SQXG 3E1IA 3HE4B 3RGUA 2ITAA 5KJ7A 4IL6E 1LWUB 4OGQB 2WQYC 1FZFA 1MFZA 5AVTB 2LXCB 3VTPC 2RKLA 1BCCD 1YIJP 1PL5A 3CXHI 1SVFA 1NJIQ 1H0TA 3H1HD 1RQVA 1ZV8A 5APWA 2IYOA 1YBKA 1JUNA 1TU3F 2KXPB 4Y99B 1BGYE 2A06E 1URQA 1SFCB 2FKWB 2GA1A 3KDPB 3H1JE 1LT9A 2DW3A 4EDFA 1IK9A 3WU2H 2E75C 1PGJA 4PJ0E 3AE8C 2BASA 1M1JB 1MUUA 4GODA 1G1IA 3JC22 1M1KQ 3IN6A 3HUSB 3CWBG 2FFDB 2MJZA 3L70J 3SSUA 2AXTE 1EXIA 2A45G 3CWBD 4IOIH 1RE4A 2KP8A 1NU1E 5CBNA 1OVVA 1USDA 3GHGC 3OA7A 1G1JA 1AJYA 2OYIC 1GL2D 1NTKD 3TGUG 1RE3A 1LT1A 1FU1A 2QE7H 3T97B 2P67A 3SWFA 2Z4EA 1J1DB 1LTJC 1DX7A 2Q7CA 3TGUD 5CMZA 2WSFJ 1OMIA 1T3JA 1VQ6P 5APYA 1YITP 5KLVK 1VL2A 4D6TE 3ITKA 2WSEJ 3H1KJ 1S5LX 3PRJA 4H0LC 1PGOA 1L0NG 1SQXJ 2ZFCA 1KB9I 3A0HH 4BRYA 2N1TD 1G2CB 1JEKA 2KLUA 1K04A 3KXDA 3LIDA 2Q3EA 1N73B 4N6JA 3G3ZA 3AE7C 1OFCX 1HTLC 1A02F 3HE4A 3AEFC 2QA4P 2AEFA 2Q1KA 1VQ9P 1MFTA 3H1LG 3P8CE 3CCRP 2OQQA 1HWTC 3MHVA 3RK2D 1X22A 2XNDH 3NFQA 3U1AA 2KZIA 3L35A 4RO0A 2QJYC 1BCCE 1KN7A 1SFCA 2PGDA 3H1HE 4EI2A 3WU2E 3AEGC 1VF5D 4H13B 2K1AA 3S1KA 2D2CC 4I7ZC 4EYYQ 3L75E 1SQBJ 4UB8H 1NTZK 3P7KA 1GZLA 2OTLP 1GL2B 5KTBA 4C46A 1JO5A 2KZJA 1YJNP 2MKVA 4IFMA 1AFOA 4W7YA 5AW9B 4U7JA 1OW7A 1N7SD 2RH0A 3PLNA 5CCHC 1IJDB 2ZVNB 2JWDA 2B89A 3AE6C 2V7QH 3VMYA 1KYOI 1EC5A 3AEEC 2B87B 5AVUB 3RBZA 2FYUE 1L0NJ 3L74D 1RF1C 2N1TB 5AVQB 1H88A 1DH3A 1WMKA 1NGMB 2QJPC 2OYHA 3ZDMA 1L0LG 1LP1A 3A0HE 1AVYA 3CXHH 1NTMD 4HKZH 4YXWH 2KI7B 2Z5IA 2C9NY 3WMM0 3A2AA 1WRGA 1NKZB 3L73D 3H1ID 3H1LJ 1EZVI 1URQD 2IBZI
chains in the Genus database with same CATH topology
2K9JA 2M3EA 2K1AA 2KNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9J A;  2M3E A;  2K1A A;  2KNC A; 
#chains in the Genus database with same CATH topology
 1QEX A;  1SS1 A;  3L72 D;  1VQK P;  3WUV A;  4BWN A;  1K8A Q;  1SQV J;  2LXB A;  1GK6 A;  2JEE A;  1KIL E;  1LTG C;  4U3F E;  1NVO A;  2WPQ A;  3P32 A;  2W90 A;  1SQQ J;  3SWK A;  5AVX B;  5KAF E;  4QMA A;  2P2U A;  2JJL A;  4YTP C;  3L71 G;  5AW8 B;  1NTK K;  1QLE D;  1RF0 C;  3BRT B;  1QL1 A;  3FX0 A;  2W83 C;  1YYC A;  3OAK A;  1QGK B;  2ZXE B;  4TLF A;  4UB8 E;  1LWU C;  4OGQ C;  1Y47 A;  3SFE C;  3MIW A;  1J2J B;  3RL0 g;  1D7M A;  5M1B A;  3B5N C;  4DJG A;  4WB4 A;  2Q9I A;  2HPC B;  1N7S B;  4JYC A;  4Y99 C;  1K73 Q;  3EQ2 A;  2IFN A;  3K5B A;  1MV8 A;  3IAO A;  1KB9 H;  2WSC H;  3M0A A;  1FOS F;  1ZME C;  1BDC A;  3VP8 A;  3D6Y A;  1BGY G;  4L74 A;  2A06 G;  3PHL A;  4K3A A;  3BRV B;  1M1J C;  3G9R A;  2YMK A;  3H1J G;  1JY2 P;  4GOF A;  3GMA A;  1EQ7 A;  2B87 A;  1L0L J;  3HUS C;  2JO1 A;  2FFD C;  1YJ9 P;  1H0T B;  3H1J D;  3H6P A;  2B9B A;  4JF7 A;  3CXH E;  1KTM A;  3LIE A;  1VQP P;  2YXR B;  3NTN A;  4AUW A;  1URQ B;  1KIL A;  2R5B A;  2W6B A;  3VOP A;  1LT9 B;  2Q5U A;  2R44 A;  1KV4 A;  1NTM E;  3RK3 C;  1IO4 A;  3P8M C;  2FXP A;  3BAS A;  3HE5 A;  1NOH A;  4IFF A;  1VQN P;  1J1D C;  3L73 E;  3H1I E;  3CCU P;  3N7N A;  3USS A;  3I5C A;  1U57 A;  1NU1 D;  3L71 J;  3BVH A;  3VMX A;  3RL0 D;  3TNU A;  1IFM A;  1VDF A;  4RES B;  3AEA C;  4D6T G;  3H32 A;  1P84 I;  3A0B H;  1N73 C;  4Y28 J;  2M8R A;  2JP3 A;  1HVV A;  2AXC A;  1KYO D;  2YNY A;  3AE3 C;  1NTZ G;  4NPD A;  2KSE A;  4D6T D;  1FC2 C;  1AVO A;  3CCV P;  1E5W A;  3MZW B;  3D70 A;  1EDL A;  4JQ0 D;  4O9B A;  3L70 D;  3M0D C;  1KYO H;  1KQS O;  2JDI H;  1CZQ A;  1NHL A;  2NPS A;  3AE4 C;  3E7K A;  4BRY B;  1JY3 O;  4LC1 A;  1BGY J;  4N78 D;  1FZE A;  1PPJ E;  2WPR A;  5H2F H;  3MUD C;  5KLV J;  3PTZ A;  4H13 C;  3Q1M A;  3P8C D;  4DOJ A;  1RH5 B;  3AE5 C;  1LTT C;  1BCC G;  1PP9 D;  3GF3 A;  2KNC A;  3H1H G;  2HOD A;  2BEZ F;  2W6A A;  1HBW A;  3I55 P;  1NH4 A;  5AVY B;  1S4X A;  2J5U A;  4AQR D;  1PFI A;  1BE3 J;  5B5E E;  3L75 G;  2KLV A;  1GL2 C;  1AV1 A;  3CCS P;  2WSF H;  1OVR A;  2QJK B;  4W80 A;  4M3L A;  4JBZ A;  3L75 D;  1IK7 A;  2XV5 A;  3QWO C;  2ZT9 D;  2Y0C A;  1FJP A;  4WY4 A;  1R5S A;  2V4H A;  1H8A A;  2H88 C;  5CCG A;  5AW2 B;  5APV A;  1PZQ A;  3RL0 B;  4XE5 B;  1VQ8 P;  5AW0 B;  2K88 A;  2LKM A;  4XA4 A;  2N1T C;  1QVG O;  3VMA A;  2KS1 A;  1L4A D;  1NTK G;  2P1J A;  2FYU G;  5APX A;  3MTU E;  1NTZ J;  5CJ4 A;  3A0B E;  2Q6Q A;  2YKQ A;  1S9K E;  2FYU D;  2O1K A;  1DD3 A;  5AW3 B;  2YMY A;  3R4Y A;  3KZI H;  2BCC D;  1IFN A;  1KYO E;  5TJH A;  3VYI A;  2O01 H;  2WIT A;  2OYH B;  5TIS E;  1LP1 B;  2WMM A;  2HYN A;  1GD2 E;  2M3E A;  3L70 E;  3CCL P;  2IYP A;  1BCC J;  2YKO A;  1HJ0 A;  4U3F G;  3H1H J;  1YQ3 C;  4PD4 I;  1R5L A;  1S5L H;  1VQM P;  1OZH A;  2ZYD A;  3NXS A;  1X9V A;  1SP4 A;  4N78 E;  4NPF X;  3O8Z A;  1KIL D;  4U3F D;  1RHZ B;  1EZV E;  3D6Z A;  3CCE P;  2IBZ E;  2QVA A;  3SWY A;  2IZ0 A;  1RF0 A;  4LLH A;  1NU1 K;  2OTK E;  2E5Y A;  1PP9 E;  2K9J B;  2ZT9 B;  5KLI B;  1GMJ A;  1N7S C;  1CSB A;  4PV1 C;  3H1K E;  3CWB J;  1P84 H;  5KJ7 C;  3CC7 P;  2WSS H;  1OXZ A;  1FAV A;  2L91 A;  3G6E P;  2YKP A;  2Q3I A;  1NTK J;  2AEM A;  1SQV D;  2Y9Z A;  1HF9 A;  2E74 C;  4KHX A;  5CHX A;  2WT7 A;  1ZW0 A;  3TGU J;  3CI9 A;  1JY3 N;  4RKU J;  1URQ C;  3TF5 A;  4GDO A;  3KQG A;  1LT9 C;  3WUU A;  2NPS D;  3HD7 A;  1JY2 O;  3M06 A;  1FOS E;  1VQ4 P;  5E79 H;  3L74 G;  2IPP A;  1PGP A;  3CXH D;  1OX3 A;  2PRR A;  1SQP D;  1NTM G;  3I56 P;  3AED C;  2OGU A;  3OW2 O;  4A7P A;  1SQB E;  3L73 G;  3NMD A;  3B4S A;  3H1I G;  2BCC E;  1PV3 A;  1N86 A;  1RE4 C;  1GTW A;  2NRG A;  1KQG B;  3L36 A;  4I6M C;  4DZO A;  3V2Q A;  1KIL B;  2H43 A;  4EIJ A;  3L72 G;  2JWA A;  2O1J A;  2HR3 A;  1S5L E;  2KUB A;  1AQ5 A;  1RE3 C;  2XU6 A;  1X8Y A;  3HE5 B;  2ZJS E;  2ZVO B;  4AYC A;  3RK2 B;  2OAR A;  4I1L A;  4WY4 D;  2KOG A;  4L76 A;  5CCG D;  3U59 A;  4ZKP A;  1H89 A;  1JTH B;  4Z1M H;  1VF5 B;  1FZC A;  3GG2 A;  3W67 A;  2K9J A;  3TNU B;  5GTH H;  1GU4 A;  4DCK A;  2HLO A;  3M0D A;  3PP5 A;  3H32 B;  2FYU K;  3V6I A;  2FY8 A;  1P84 E;  3LW5 J;  2YIU B;  2M3B A;  3KHU A;  1PPJ G;  1XTG B;  1L4A A;  2K3R A;  1USE A;  2M5A A;  5AVW B;  4L73 A;  3H25 A;  1PPJ D;  1KB9 D;  2B88 A;  4BXL A;  2JKV A;  1KOR A;  1ZXG A;  1NAY A;  4KT0 J;  2NPS B;  4H44 D;  1SQV E;  4CPG A;  3L74 J;  2Y0D A;  2QJK C;  1SFC C;  3CX5 I;  2FXO A;  3CME P;  5E79 E;  1T3U A;  1SLQ A;  1SQQ E;  4WWI A;  1NKN A;  2W27 A;  2KNC B;  4WVZ A;  4PD4 H;  2HOD B;  3AEC C;  3BCC D;  3R2P A;  3RL0 C;  2XNX A;  2IFM A;  3H1I J;  5DJU B;  4ZKU A;  2A45 I;  1S1C X;  1IFI A;  2P7J A;  3CC2 P;  3L72 J;  1N2D C;  2BEQ D;  2QRX A;  1SQP E;  2OTJ P;  2QM7 A;  1T6A A;  5BU5 A;  2HG5 D;  2QG4 A;  1DIP A;  1GDT A;  4WY4 B;  3A7O A;  4IFD K;  3UIA A;  5AVR B;  3B5N D;  1NU1 G;  2I1K A;  2KK7 A;  2PFX A;  3GHG A;  2OYI A;  1OWA A;  1YTZ I;  4OH8 B;  4HYT B;  2HFE D;  3S9O A;  1VQO P;  1S9K D;  1JTH A;  1LTJ A;  3CC4 P;  2KS1 B;  2OYH C;  4HB1 A;  2I8D A;  5GTH E;  1RF1 B;  2WSC J;  2KSJ A;  2E76 D;  1JY2 N;  1J1E B;  1Q7Y Q;  3CPW O;  3L70 G;  3MGN A;  1A02 J;  1W5C E;  3AE1 C;  1FE6 A;  1IFJ A;  1SQP K;  3HD7 D;  4H44 B;  2FXM A;  1ZRT D;  1S2E A;  2ZYG A;  1XTC C;  4OVN F;  1NTM K;  2IBZ G;  4NPE A;  3MP7 B;  3RK3 D;  2H89 C;  2YO3 A;  2Y9Y A;  5KLI C;  2WTY A;  4YPC A;  3JCU H;  1KB9 E;  1S3J A;  1PP9 G;  3F5H A;  1EZV D;  3H1J J;  4C7R A;  2IBZ D;  2PAJ A;  1JNM A;  1GK4 A;  1RQU A;  4PD4 E;  3II6 A;  1GU5 A;  5APU A;  3H1K G;  4R4L A;  4KJM A;  1E79 H;  3TDK A;  2C0W A;  3H1K D;  1Q81 Q;  3BCC E;  1BDD A;  1SQX D;  4W7Z A;  2E42 A;  2FYN B;  2O3J A;  1NYH A;  3VMZ A;  3PJS K;  3B5N B;  1T2K D;  1DD4 A;  3D71 A;  1R8E A;  1NU1 J;  2WSE H;  4R4M A;  1Q2N A;  1CI6 A;  1UII A;  5CBO A;  3FWL A;  1LTI C;  4C7N A;  2IX7 C;  1KQF B;  5KLV E;  1M57 D;  1JCD A;  2LR2 A;  5BU8 B;  1ZP0 C;  5CCH A;  3GLM A;  4D6T J;  3HRN A;  1KD1 Q;  3A3Y B;  2WT7 B;  2E76 B;  3AE9 C;  2H7H A;  3CX5 D;  4H13 D;  1RF1 A;  4GIF A;  5KKZ B;  1KIL C;  2C9L Y;  1HGZ A;  1BE3 E;  2ZYA A;  1NAF A;  4ASW A;  1WT6 A;  1SQB G;  1HGV A;  3HD7 B;  1DEB A;  2BCC G;  1PIX A;  3CX5 H;  2RMZ A;  1JMB A;  1GW4 A;  3Q5R A;  1K9M Q;  1QX8 A;  3O6Q A;  3PH0 A;  1SQB D;  3M9B A;  3RK2 C;  1IFD A;  3RK3 B;  2IZ1 A;  2KYV A;  2N9B A;  1PP9 J;  1VF5 C;  2A45 H;  2E75 D;  2WZ7 A;  1LTB C;  1LJ2 A;  3M9Q A;  1L2P A;  1YTZ T;  3JCU E;  5CJ0 A;  3B71 A;  1ZRT E;  4JPZ B;  5H2F E;  4ZMD A;  2J58 A;  5K5G B;  2YO2 A;  2W6J H;  4I2L C;  3RK3 E;  2YIU C;  1NTZ E;  4WBA A;  2E43 A;  3L75 J;  4K35 A;  1JY3 P;  1L0N D;  3EFF K;  3V5B A;  2RN0 A;  2Y0E A;  1OIP A;  1EXJ A;  1LWU A;  1FZC B;  1P84 D;  1YI2 P;  2NPS C;  2GM4 A;  2GUS A;  3B5N A;  3C1L A;  4N3Y B;  1DEE G;  5AVZ B;  1JMM A;  1SQX E;  5APQ A;  2NZ2 A;  3H1L D;  4EOT A;  1QL2 A;  1SQV G;  1ZR2 A;  2C0X A;  1N7L A;  2CPB A;  3MD0 A;  4ASV A;  5KAF H;  2E5T A;  3TK1 A;  4H0L D;  1L4A B;  2FYU J;  2M5A B;  3HTK B;  1W2B O;  1EDJ A;  1SQQ G;  2CPS A;  1M1J A;  1OW6 A;  2O01 J;  1ZR4 A;  3EWK A;  3CCM P;  2WVR A;  3KYQ A;  3G4S P;  3HUS A;  2QSI A;  2QEX P;  1SQQ D;  2BCC J;  2FFD A;  3M91 A;  3KPE A;  1X0T A;  1LNQ A;  1NO4 A;  4L75 A;  2PP6 A;  1Z56 A;  3BAT A;  4XFJ A;  3CX5 E;  2XKM A;  4WY4 C;  1SQP G;  1LTS C;  3U1C A;  1Q86 Q;  3RBX A;  3OJA B;  4RJT A;  1VQL P;  5CCG C;  3KZI E;  3SFD C;  3VN0 A;  4GOE A;  2R3S A;  3L4F A;  2E75 B;  3CWB E;  3Q5S A;  1T8Z A;  5L8R J;  3A5T A;  3C9I A;  1PGQ A;  3LW5 H;  3E1R A;  1YQ4 C;  1KQL A;  3AE2 C;  3T97 A;  4PV1 D;  4U3F J;  1SQX K;  1M7L A;  5AW1 B;  1NTK E;  3FXE A;  5AVS B;  1Y8A A;  5KJ7 D;  4HH2 A;  2D2C D;  2P10 A;  5APS A;  5DJT B;  1YHQ P;  1BSN A;  3TGU E;  2XZR A;  1Q90 D;  1J1E C;  1G2C A;  1IC2 A;  3QH9 A;  2ZAE B;  2R3C A;  2E74 D;  3GHG B;  4MN4 C;  1JOC A;  1N73 A;  2OYI B;  1L0L D;  4GKG A;  3W68 A;  1N8R Q;  1KFM A;  2XDJ A;  4H44 C;  1FZA A;  2L5G B;  2VRS A;  3ABV C;  1LTJ B;  1MZ9 A;  5C39 A;  3CCQ P;  5EFW B;  2QM8 A;  3V4W A;  1L0N E;  4UB6 H;  1JM0 A;  2CK3 H;  5CCH D;  3VP9 A;  5AW4 B;  3C8V A;  1FDI A;  4H0L B;  2K37 A;  4TT3 H;  3JSV C;  1M90 Q;  2IDB A;  3EFG A;  3FXD A;  5GTI H;  2KIK A;  2R5D A;  1JB0 J;  3GF7 A;  2V7Q J;  3S4R A;  1SQB K;  1QVF O;  1OVU A;  2SPZ A;  3MUD A;  1ZOY C;  1FS0 E;  3H1L E;  3HTK A;  1K05 A;  2WWW A;  1U7J A;  1S72 P;  5AW5 B;  5KAI H;  3V2P A;  3FWN A;  2OYO A;  3L71 D;  5B66 H;  1KMI Z;  1W2E A;  2JR8 A;  3TSI A;  2WPV B;  2P58 A;  1SQP J;  4PD4 D;  2FYN C;  1BSH A;  3TYY A;  3IFM A;  3CD6 P;  2QIW A;  1FDM A;  1VPC A;  3BCC G;  1GL2 A;  3F89 A;  1FJK A;  4GT1 A;  1NTM J;  3V2N A;  1CW5 A;  2QJY B;  1VQ7 P;  4IL6 X;  2N9Y B;  2WPS A;  2AEJ A;  3WUT A;  2H8P D;  4PV1 B;  2KB7 P;  1VQ5 P;  1L0N K;  1OW8 A;  3L73 J;  2G3A A;  4YXD C;  1Y9B A;  2POH A;  1RY3 A;  1X79 B;  2D2C B;  4I7Z B;  3M9H A;  2W8Z A;  4IL6 H;  2G8Y A;  3CMA P;  5KLV G;  4DT0 A;  1FZG A;  2E76 C;  4B86 A;  2J59 M;  3IF4 A;  1BGY D;  3Q5P A;  2M0B A;  2A06 D;  3Q2Y A;  5KKZ C;  2N1T A;  3G71 P;  2R32 A;  4OGQ D;  2E74 B;  5KLV D;  1Q82 Q;  1KFN A;  5B5E H;  1CI6 B;  3HD7 C;  1KC8 Q;  2FBW C;  1YJW P;  3L74 E;  3V2R A;  4C7N B;  2I1J A;  1BE3 G;  3FGA D;  1EDI A;  5BVZ A;  2YXQ B;  1SQV K;  1KZU B;  3CCJ P;  3N4X A;  1IFP A;  4PJ0 H;  1UIX A;  3V4Q A;  3Q3D A;  1SFC D;  1BE3 D;  2Z5H A;  2ZXX A;  4UB6 E;  1SQQ K;  4LGD E;  1L0L E;  1ZLL A;  3IR9 A;  1HJB A;  1NWQ A;  2AXT H;  2QJP B;  1GW3 A;  3L72 E;  1JCC A;  2K9Y A;  5GTI E;  2GUV A;  3GW6 A;  3B8E B;  3O6Q B;  2FYZ A;  4ZNC A;  1M8O B;  1LTA C;  5KAI E;  1IZN B;  3CL3 D;  1T2K C;  5B66 E;  1EZV G;  2O01 N;  1FZC C;  4OWF A;  3CLQ A;  3BCC J;  2ZT9 C;  1HUC A;  1HH0 A;  1MKM A;  3L37 A;  1NTZ D;  1FBM A;  5AW7 B;  1FZB A;  5AVV B;  3L71 E;  1LGH B;  4HJG H;  1AA0 A;  1FDO A;  5AW6 B;  1AQT A;  5APT A;  2HPC A;  1M56 D;  5TIS H;  1ZN5 A;  1N7S A;  3AEB C;  2UWJ E;  1L0L K;  1EDK A;  1U7M A;  4JYB A;  1L4A C;  1SQX G;  3E1I A;  3HE4 B;  3RGU A;  2ITA A;  5KJ7 A;  4IL6 E;  1LWU B;  4OGQ B;  2WQY C;  1FZF A;  1MFZ A;  5AVT B;  2LXC B;  3VTP C;  2RKL A;  1BCC D;  1YIJ P;  1PL5 A;  3CXH I;  1SVF A;  1NJI Q;  1H0T A;  3H1H D;  1RQV A;  1ZV8 A;  5APW A;  2IYO A;  1YBK A;  1JUN A;  1TU3 F;  2KXP B;  4Y99 B;  1BGY E;  2A06 E;  1URQ A;  1SFC B;  2FKW B;  2GA1 A;  3KDP B;  3H1J E;  1LT9 A;  2DW3 A;  4EDF A;  1IK9 A;  3WU2 H;  2E75 C;  1PGJ A;  4PJ0 E;  3AE8 C;  2BAS A;  1M1J B;  1MUU A;  4GOD A;  1G1I A;  3JC2 2;  1M1K Q;  3IN6 A;  3HUS B;  3CWB G;  2FFD B;  2MJZ A;  3L70 J;  3SSU A;  2AXT E;  1EXI A;  2A45 G;  3CWB D;  4IOI H;  1RE4 A;  2KP8 A;  1NU1 E;  5CBN A;  1OVV A;  1USD A;  3GHG C;  3OA7 A;  1G1J A;  1AJY A;  2OYI C;  1GL2 D;  1NTK D;  3TGU G;  1RE3 A;  1LT1 A;  1FU1 A;  2QE7 H;  3T97 B;  2P67 A;  3SWF A;  2Z4E A;  1J1D B;  1LTJ C;  1DX7 A;  2Q7C A;  3TGU D;  5CMZ A;  2WSF J;  1OMI A;  1T3J A;  1VQ6 P;  5APY A;  1YIT P;  5KLV K;  1VL2 A;  4D6T E;  3ITK A;  2WSE J;  3H1K J;  1S5L X;  3PRJ A;  4H0L C;  1PGO A;  1L0N G;  1SQX J;  2ZFC A;  1KB9 I;  3A0H H;  4BRY A;  2N1T D;  1G2C B;  1JEK A;  2KLU A;  1K04 A;  3KXD A;  3LID A;  2Q3E A;  1N73 B;  4N6J A;  3G3Z A;  3AE7 C;  1OFC X;  1HTL C;  1A02 F;  3HE4 A;  3AEF C;  2QA4 P;  2AEF A;  2Q1K A;  1VQ9 P;  1MFT A;  3H1L G;  3P8C E;  3CCR P;  2OQQ A;  1HWT C;  3MHV A;  3RK2 D;  1X22 A;  2XND H;  3NFQ A;  3U1A A;  2KZI A;  3L35 A;  4RO0 A;  2QJY C;  1BCC E;  1KN7 A;  1SFC A;  2PGD A;  3H1H E;  4EI2 A;  3WU2 E;  3AEG C;  1VF5 D;  4H13 B;  2K1A A;  3S1K A;  2D2C C;  4I7Z C;  4EYY Q;  3L75 E;  1SQB J;  4UB8 H;  1NTZ K;  3P7K A;  1GZL A;  2OTL P;  1GL2 B;  5KTB A;  4C46 A;  1JO5 A;  2KZJ A;  1YJN P;  2MKV A;  4IFM A;  1AFO A;  4W7Y A;  5AW9 B;  4U7J A;  1OW7 A;  1N7S D;  2RH0 A;  3PLN A;  5CCH C;  1IJD B;  2ZVN B;  2JWD A;  2B89 A;  3AE6 C;  2V7Q H;  3VMY A;  1KYO I;  1EC5 A;  3AEE C;  2B87 B;  5AVU B;  3RBZ A;  2FYU E;  1L0N J;  3L74 D;  1RF1 C;  2N1T B;  5AVQ B;  1H88 A;  1DH3 A;  1WMK A;  1NGM B;  2QJP C;  2OYH A;  3ZDM A;  1L0L G;  1LP1 A;  3A0H E;  1AVY A;  3CXH H;  1NTM D;  4HKZ H;  4YXW H;  2KI7 B;  2Z5I A;  2C9N Y;  3WMM 0;  3A2A A;  1WRG A;  1NKZ B;  3L73 D;  3H1I D;  3H1L J;  1EZV I;  1URQ D;  2IBZ I; 
#chains in the Genus database with same CATH homology
 2K9J A;  2M3E A;  2K1A A;  2KNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...