2KNCA

Platelet integrin alfaiib-beta3 transmembrane-cytoplasmic heterocomplex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
54
structure length
54
Chain Sequence
GAMGSEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRPPLEEDDEEGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Integrin alpha-IIb
publication title Structure of an integrin alphaIIb beta3 transmembrane-cytoplasmic heterocomplex provides insight into integrin activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00357 Integrin_alpha Integrin alpha cytoplasmic region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.930 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Bicelle-embedded integrin alpha(iib) transmembrane segment 2kncA00
2M3EA 2KNCA 2K1AA 2K9JA
chains in the Genus database with same CATH superfamily
3TYYA 4WY4A 2GM4A 2RKLA 5BU8B 2DW3A 1NYHA 3BCCJ 2E76C 2XDJA 1Y9BA 3EQ2A 3KXDA 3RK3E 2V7QJ 1LP1B 1PZQA 1RF0A 3VOPA 1DIPA 4BRYB 3MP7B 3MUDA 1NU1J 3I5CA 2W90A 2OYIC 1BCCE 3FX0A 1PGQA 1NTMJ 2FKWB 2JDIH 1HTLC 3V2QA 3HE5A 1BE3E 3USSA 1S9KD 3L71G 1ZXGA 1FE6A 3BVHA 4M3LA 1YTZT 3H1KD 1CI6B 5GTIE 3H1JJ 3VTPC 3PTZA 1ZMEC 1ZLLA 1RE4C 2BCCE 1LT9C 2AEJA 2Q5UA 1SQPK 1J1DC 1NKNA 2B87A 1W2EA 2WPQA 2PFXA 3RK2B 2WZ7A 4WY4C 1SQQJ 5APTA 3OW2O 5CBNA 3O6QA 3BCCG 1D7MA 3AEBC 5AW8B 4EOTA 1EZVG 3AE2C 3FWLA 4U3FD 3AEFC 1SQXE 1RF0C 1LTJC 3S1KA 3MUDC 1OVVA 2C9LY 1USDA 3RK3B 1PPJE 2JWDA 3N7NA 2FXMA 1KORA 3E1RA 1NTMG 4GOEA 1Q90D 3ABVC 4GDOA 1IFIA 1GK6A 3L73J 1OW7A 5APUA 2E75D 2QJPC 3TGUJ 1KYOI 1YJNP 1YJWP 3CC4P 3H1JG 3H6PA 4PV1D 5AW0B 3B5NA 3CCQP 5KKZC 1KB9I 2R44A 2OTJP 1SQVD 3N4XA 1KMIZ 2FYUE 3M9BA 1GZLA 3PP5A 2AXTE 2QG4A 2WSEH 3G4SP 1G1IA 2PP6A 2WSSH 2ZT9B 1DD3A 1E5WA 2IYPA 1NHLA 1T2KC 1SQBE 2Y9YA 1JY2N 1OWAA 1IO4A 3M9HA 3B5ND 2IBZE 2NRGA 1N73B 4PV1C 2Y0CA 1VQ6P 3L36A 3LIEA 1X8YA 3H1HE 4LLHA 3RL0B 3CCUP 3CMEP 3RL0g 1KYOH 1Y47A 5AVVB 2HODA 3M0DA 1AVYA 1BGYJ 4PJ0E 1KB9H 1RF1B 3MGNA 1GW4A 3MZWB 1JEKA 1MFTA 5H2FH 3AEAC 1H89A 2YXQB 3H1IE 3CI9A 3P8CD 2WWWA 1BCCG 3TGUG 2W27A 1VQLP 3L71D 2KNCB 5APYA 4OGQB 1JMMA 1Q2NA 2JJLA 3B5NC 2KYVA 1FZFA 1GD2E 1NJIQ 2ZXXA 4UB6H 2J58A 1S5LX 1LP1A 3IN6A 4QMAA 2KSJA 1L4AA 3CCJP 3A2AA 3SWFA 4BRYA 3AE9C 5KLIB 2WSFJ 1WMKA 5KJ7D 1FBMA 2JWAA 1SQXK 5M1BA 5AVSB 3GW6A 1JY2O 2JEEA 3BCCD 4GIFA 3WUUA 3CX5D 2A06E 1M57D 1CI6A 1KILD 2R32A 1VQNP 1OW8A 2K9YA 1YIJP 2FY8A 4W7YA 1L4AD 1EZVI 1BSNA 1AFOA 1X9VA 3A0HH 3CCRP 1A02F 1JUNA 3V4WA 1BGYG 3M0DC 1GU5A 3CXHE 2B9BA 3RBXA 4NPDA 2K3RA 4A7PA 2H43A 1DD4A 1KQFB 2WPRA 3W67A 1NTMD 4D6TJ 4UB8H 2N1TB 4N3YB 1X79B 4N6JA 1PPJG 3GF7A 3QH9A 2FYUK 3L74J 5KLVG 2I1KA 2PRRA 1EXJA 1H8AA 3H1JD 4H44B 2W6JH 1YI2P 2WSEJ 3GF3A 1L4AC 1SQBK 3Q3DA 4R4LA 1KQLA 2ZFCA 5AVRB 1QVFO 4L75A 5KAFH 2ZJSE 2YO3A 3CX5H 2FXOA 4EDFA 2ZVNB 1NTZJ 2E74D 1AA0A 3C8VA 1SQQD 1IFJA 2P10A 1L0LE 1KQGB 2QM8A 2Q9IA 3OA7A 1ZOYC 1QX8A 1SQBG 2W83C 2N9BA 1HBWA 2IBZG 2GUVA 3MHVA 3L75J 3CC2P 1URQD 2YXRB 3I56P 2D2CB 4D6TG 4C46A 3RK2C 3L70J 1EDIA 1OIPA 3JSVC 2O1KA 1P84E 3V2RA 1NO4A 2MKVA 4K35A 3TGUD 3L74G 1S72P 3SFDC 4IFDK 1LTSC 1SQPE 1OXZA 1N73A 3AECC 5E79E 1QVGO 1GL2D 3Q5RA 1QL1A 2M5AB 1VQ8P 1J1EC 3TNUB 1FZCA 1RF1A 1JCDA 1T3UA 1NU1E 2G8YA 5CCHA 2YMKA 4GKGA 5B5EE 1PIXA 2KNCA 3A7OA 3AE8C 4L74A 2C9NY 3IF4A 3H1LE 1HUCA 1VQ9P 1DX7A 3L37A 3AE7C 2BASA 3L75G 1S4XA 4H13D 5AW3B 1LNQA 1BGYD 1EDKA 3R2PA 1PP9J 2W6AA 1H0TB 2XNXA 3L70G 3KDPB 1K8AQ 1YQ3C 1PPJD 3NFQA 5GTIH 2W6BA 2MJZA 4OGQD 5KLVD 2YIUB 2A45I 1N73C 1KTMA 3D6ZA 3G9RA 3P32A 1DEEG 3RL0C 2IFMA 1NOHA 3IFMA 1OMIA 1L0LK 4H13C 1FZCC 1RF1C 4GT1A 5AVXB 5APQA 2KIKA 2GA1A 3CWBG 4TLFA 5CCHC 4WY4D 1HF9A 1MZ9A 3HE4B 5APVA 3WMM0 1Q81Q 1NTKE 3F5HA 1WT6A 1EDJA 4OGQC 2OARA 2QIWA 3L73E 1SQBD 1MV8A 3L72E 2K9JB 2FXPA 2OYOA 3TSIA 4ZMDA 1OFCX 4PD4E 1ZRTE 2XZRA 2IBZI 2A45H 1PP9G 2K1AA 1FZGA 2HG5D 3BATA 4CPGA 4D6TD 3V2NA 2WSCH 1JTHB 4RJTA 3S4RA 1M1JB 2KI7B 1Q82Q 1KFNA 3JC22 2XU6A 3HD7B 2K88A 3GHGB 4ZKPA 3L74D 2WMMA 1RE3A 4IFMA 1VQOP 3CD6P 2WSFH 1R8EA 1FJPA 4B86A 1L2PA 3CCEP 1IJDB 1NU1K 1SQPG 2NPSB 2QJKB 2QJYB 1GDTA 3WUVA 1NTZD 2ITAA 2O01N 1XTCC 2BEQD 1N7SB 3M0AA 3NMDA 1DH3A 1L0NE 1VF5B 2IYOA 1R5SA 1T2KD 3CPWO 5CCGA 3CC7P 1KYOD 1BCCJ 4H44C 2P67A 1KB9D 4Z1MH 3L75D 1JY3O 2M5AA 1BE3J 2BEZF 3B4SA 3TNUA 3Q2YA 2QM7A 3AE3C 1EQ7A 2Z5IA 2OTLP 3NXSA 4DCKA 5TJHA 3L70D 3QWOC 2E42A 4HB1A 2Z4EA 2WQYC 2WVRA 4XE5B 4NPFX 2BCCJ 3CXHI 3D6YA 1RE3C 3LW5H 3NTNA 3VMZA 4HH2A 1RQUA 1JM0A 2YMYA 1GTWA 2IZ0A 2WPSA 2ZYAA 1T8ZA 4GODA 1S9KE 1NTKK 4N78E 3H1KE 2J5UA 3S9OA 2D2CC 3VYIA 3CWBD 1SQXJ 1HGZA 4H0LB 1LJ2A 5CCGC 2ZYGA 5BVZA 2SPZA 1VQ5P 2Z5HA 5APSA 3HUSB 1VQ4P 3RBZA 4HJGH 2E5TA 4C7RA 3KYQA 1SP4A 3GG2A 5KTBA 5KLVJ 3KZIE 2YKQA 3CXHH 3IR9A 1YBKA 4ASWA 1BE3G 1K05A 1LT1A 3L72G 5AVYB 2WSCJ 2IZ1A 1EXIA 1Q86Q 1PP9D 1KN7A 2FBWC 2E43A 2RH0A 1OX3A 4WBAA 2HLOA 1S1CX 2QA4P 4U3FE 3TK1A 1RY3A 2BCCG 2FYUJ 1ZP0C 3HE4A 3CCLP 1M1KQ 1X0TA 1HH0A 1MKMA 1USEA 2K9JA 1P84I 1L0NK 5KAIE 1EZVD 1SQBJ 1SQPD 2XV5A 4IL6E 3V6IA 1XTGB 1JY2P 3OAKA 1BSHA 1MUUA 4I1LA 1AVOA 2WITA 3B8EB 1CZQA 3G71P 3VN0A 3L35A 3CCMP 1SQXG 3U59A 1SQVE 2P1JA 3H1HJ 5H2FE 2O01J 5AVUB 2WPVB 3HD7A 1W5CE 1RH5B 3GHGA 5AVQB 1IFNA 4WVZA 3R4YA 2YIUC 2H7HA 3P7KA 3FWNA 1HGVA 2A45G 1LTJB 2H8PD 3K5BA 5AW5B 2E5YA 2KUBA 1KQSO 4JYBA 3H1IJ 2N9YB 2NPSA 1S5LE 5AVTB 1NWQA 3PLNA 3VP8A 1OVUA 1N7SA 3V4QA 4JF7A 3LW5J 1VDFA 3HD7D 1FZBA 3RK2D 1YITP 2CPBA 2FYUG 3G3ZA 3LIDA 1LTAC 5E79H 3TDKA 2JP3A 1ZN5A 1AV1A 2P58A 2HYNA 1K9MQ 4IFFA 2B87B 3BRVB 3P8CE 1HJBA 2HPCB 2KS1B 3L71E 3A0BE 2ZYDA 1J2JB 1T6AA 2ZXEB 2FFDB 3RK3D 5B5EH 3H1HG 5AVWB 2R3CA 3T97B 3P8MC 3AEEC 2E75B 1LWUB 2H89C 4DT0A 1VQ7P 1JB0J 1JNMA 3HD7C 4AQRD 2QVAA 3GHGC 1GMJA 1CSBA 1BDCA 1U7JA 1GU4A 1SVFA 1BCCD 2RN0A 2M3BA 1YJ9P 2Q3IA 3OJAB 2QRXA 3VMAA 2KLVA 3H1IG 1BE3D 3MD0A 2NPSC 2QJKC 2QJYC 3BCCE 1IC2A 3C1LA 4OWFA 2J59M 3CX5E 2YNYA 4DOJA 4W80A 1KILE 1KV4A 1FDIA 2M8RA 1N7SC 3HRNA 2Q3EA 3RK3C 4PD4I 1VF5C 2ZT9D 2BCCD 1M56D 2QEXP 3B5NB 3CWBJ 3HUSA 2B89A 3WU2E 2P7JA 2OQQA 1R5LA 1NTME 4ZNCA 2V4HA 1SFCB 2HFED 3VP9A 1SQVK 3RL0D 1FC2C 2AEFA 1GW3A 2A06G 3II6A 1LTTC 3H1JE 1CW5A 3GMAA 1K73Q 1KD1Q 1SQXD 4H0LD 3HTKB 2O3JA 5CCHD 2K37A 2ZT9C 4I7ZB 4TT3H 2KZJA 1PGPA 1U7MA 3JCUE 1WRGA 1SQQE 2QSIA 1BDDA 3WUTA 2B88A 2YO2A 1SQPJ 5TISE 2GUSA 4O9BA 2FYUD 4C7NB 4H0LC 3CL3D 2N1TA 4YPCA 1S2EA 4WWIA 1KILB 3HUSC 3D70A 1IK7A 4U7JA 3AE5C 1FZEA 4ZKUA 1L4AB 1LTJA 4MN4C 4AUWA 5GTHE 4BWNA 2QE7H 3AEGC 1AQTA 1L0LG 1FDOA 5B66E 3TGUE 2R5BA 1JY3N 2IBZD 1EDLA 2Q7CA 1JO5A 2LR2A 4I2LC 3PHLA 3H1LJ 5AW9B 3H1HD 5KLIC 4JPZB 1FDMA 2KP8A 3CCSP 2N1TD 4N78D 4IOIH 2KOGA 2KK7A 4JBZA 1PV3A 1RHZB 1RQVA 3CMAP 3PRJA 1LTIC 4H44D 1W2BO 4XFJA 2KSEA 3H1ID 1N8RQ 3B71A 1X22A 2AXTH 5DJTB 2HPCA 2KS1A 2OYHB 2E74B 4OH8B 2OGUA 3SWYA 2FFDA 5AW6B 5AW7B 1NTMK 3T97A 3VMYA 1LWUA 2KZIA 1VQMP 2H88C 2N1TC 1BGYE 1PL5A 4JQ0D 4YXWH 1QLED 2FYNB 1YHQP 1VQPP 1Q7YQ 1J1EB 4JYCA 1GK4A 5BU5A 5AVZB 1NU1G 1NH4A 2O01H 1G1JA 1HWTC 1URQB 3E1IA 5EFWB 4DJGA 3SFEC 1K04A 4PJ0H 1LTBC 1NTKJ 4RO0A 3KHUA 2A06D 5KLVE 2L91A 3Q5PA 3H1LG 3L72J 2D2CD 1FOSE 1SQQK 2WT7B 2YKOA 5CHXA 1Z56A 1JY3P 1YTZI 1IZNB 4Y99B 5CCGD 3CXHD 3SWKA 3KZIH 1JOCA 2IFNA 1FOSF 5C39A 4EYYQ 4YXDC 4LC1A 1OW6A 1GL2B 1SFCA 2FYZA 2Q6QA 1T3JA 2CPSA 1NAFA 3D71A 1UIXA 3PJSK 3V5BA 2I1JA 1UIIA 1SQQG 1OVRA 2FFDC 2LXCB 4KHXA 5DJUB 1VL2A 1LTGC 2C0WA 3UIAA 2KB7P 1H0TA 3HTKA 3AE1C 2E75C 1LWUC 4W7ZA 1NVOA 2IX7C 4LGDE 4EI2A 5APWA 3U1CA 2E76B 4BXLA 1IK9A 4IL6X 5KAIH 1SFCD 3EWKA 4RESB 4D6TE 4IL6H 4I6MC 4H13B 1L0NJ 1FZCB 1L0LD 1ZW0A 3AEDC 1H88A 1NTKG 3L74E 2VRSA 2W8ZA 1YQ4C 1DEBA 2PGDA 4RKUJ 5L8RJ 2OYIB 1M8OB 1Y8AA 3L73G 1SLQA 3ZDMA 5KJ7A 1JMBA 3Q1MA 4HYTB 3PH0A 1U57A 3FXDA 4OVNF 1KC8Q 2HR3A 3M91A 4AYCA 4C7NA 3M9QA 4HKZH 1KILA 1NTZE 3H32B 3RGUA 1IFPA 2IPPA 2ZVOB 1G2CB 3U1AA 1S5LH 2WTYA 1SFCC 1P84D 2M3EA 2G3AA 1LT9B 3CCVP 1J1DB 1AJYA 3TF5A 2JKVA 3Q5SA 3MTUE 2I8DA 1KYOE 2ZAEB 2POHA 2AXCA 2XKMA 2R5DA 4WY4B 2C0XA 1KB9E 3MIWA 1KZUB 3L75E 1JTHA 4I7ZC 4Y28J 1ZR2A 1M1JA 5CJ0A 3CX5I 1FS0E 1M90Q 3H1KJ 5KLVK 5CBOA 4NPEA 3V2PA 1L0NG 1NU1D 3L70E 1ZR4A 2KLUA 1QEXA 3A0BH 5K5GB 2YKPA 3AE6C 3H25A 3AE4C 1NAYA 4WB4A 3CLQA 4UB6E 2R3SA 1YYCA 3F89A 2OYHA 2Q1KA 1VQKP 1FAVA 3FGAD 3H1LD 5KJ7C 2OTKE 1IFDA 1N7LA 1P84H 1ZV8A 1S3JA 3HE5B 1LGHB 2QJPB 3G6EP 3VMXA 2M0BA 1M7LA 4ASVA 5AW1B 1KILC 1QGKB 4KJMA 2Y0DA 5KKZB 1OZHA 3KQGA 4U3FJ 3FXEA 3CWBE 2CK3H 1URQA 2PAJA 2V7QH 3BRTB 2NPSD 1VPCA 5CJ4A 2LXBA 3C9IA 3A0HE 3EFGA 1HVVA 2XNDH 2JR8A 1A02J 1N7SD 1VF5D 3WU2H 2WT7A 3O6QB 2Y9ZA 3O8ZA 1PFIA 4UB8E 1M1JC 1TU3F 1PP9E 3H1KG 2LKMA 2KXPB 2UWJE 4PV1B 1PGJA 1SS1A 1GL2A 1KFMA 3EFFK 1SQVJ 4EIJA 1NTKD 1EC5A 2OYHC 4XA4A 1HJ0A 2E74C 3KPEA 3L73D 3L72D 3A5TA 1NTZK 1FZAA 5KAFE 4PD4D 3JCUH 1EZVE 2P2UA 1ZRTD 3ITKA 3L4FA 3GLMA 1FU1A 2FYNC 1MFZA 4DZOA 4YTPC 1JCCA 4U3FG 2AEMA 1NTZG 1PGOA 1URQC 4KT0J 1IFMA 5CMZA 5TISH 1FJKA 4R4MA 2OYIA 1L0LJ 3M06A 2L5GB 4L73A 1NGMB 1NKZB 1N86A 3IAOA 3I55P 1QL2A 2JO1A 2E76D 3SSUA 1E79H 3L71J 4Y99C 5APXA 5GTHH 4L76A 2RMZA 2IDBA 3W68A 3H32A 3A3YB 5B66H 2O1JA 3E7KA 1G2CA 1SQVG 1L0ND 2Y0EA 1GL2C 4K3AA 4GOFA 4PD4H 1RE4A 5AW4B 1N2DC 5AW2B 1LT9A 2HODB 2NZ2A 1AQ5A 3BASA
chains in the Genus database with same CATH topology
2M3EA 2KNCA 2K1AA 2K9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M3E A;  2KNC A;  2K1A A;  2K9J A; 
#chains in the Genus database with same CATH topology
 3TYY A;  4WY4 A;  2GM4 A;  2RKL A;  5BU8 B;  2DW3 A;  1NYH A;  3BCC J;  2E76 C;  2XDJ A;  1Y9B A;  3EQ2 A;  3KXD A;  3RK3 E;  2V7Q J;  1LP1 B;  1PZQ A;  1RF0 A;  3VOP A;  1DIP A;  4BRY B;  3MP7 B;  3MUD A;  1NU1 J;  3I5C A;  2W90 A;  2OYI C;  1BCC E;  3FX0 A;  1PGQ A;  1NTM J;  2FKW B;  2JDI H;  1HTL C;  3V2Q A;  3HE5 A;  1BE3 E;  3USS A;  1S9K D;  3L71 G;  1ZXG A;  1FE6 A;  3BVH A;  4M3L A;  1YTZ T;  3H1K D;  1CI6 B;  5GTI E;  3H1J J;  3VTP C;  3PTZ A;  1ZME C;  1ZLL A;  1RE4 C;  2BCC E;  1LT9 C;  2AEJ A;  2Q5U A;  1SQP K;  1J1D C;  1NKN A;  2B87 A;  1W2E A;  2WPQ A;  2PFX A;  3RK2 B;  2WZ7 A;  4WY4 C;  1SQQ J;  5APT A;  3OW2 O;  5CBN A;  3O6Q A;  3BCC G;  1D7M A;  3AEB C;  5AW8 B;  4EOT A;  1EZV G;  3AE2 C;  3FWL A;  4U3F D;  3AEF C;  1SQX E;  1RF0 C;  1LTJ C;  3S1K A;  3MUD C;  1OVV A;  2C9L Y;  1USD A;  3RK3 B;  1PPJ E;  2JWD A;  3N7N A;  2FXM A;  1KOR A;  3E1R A;  1NTM G;  4GOE A;  1Q90 D;  3ABV C;  4GDO A;  1IFI A;  1GK6 A;  3L73 J;  1OW7 A;  5APU A;  2E75 D;  2QJP C;  3TGU J;  1KYO I;  1YJN P;  1YJW P;  3CC4 P;  3H1J G;  3H6P A;  4PV1 D;  5AW0 B;  3B5N A;  3CCQ P;  5KKZ C;  1KB9 I;  2R44 A;  2OTJ P;  1SQV D;  3N4X A;  1KMI Z;  2FYU E;  3M9B A;  1GZL A;  3PP5 A;  2AXT E;  2QG4 A;  2WSE H;  3G4S P;  1G1I A;  2PP6 A;  2WSS H;  2ZT9 B;  1DD3 A;  1E5W A;  2IYP A;  1NHL A;  1T2K C;  1SQB E;  2Y9Y A;  1JY2 N;  1OWA A;  1IO4 A;  3M9H A;  3B5N D;  2IBZ E;  2NRG A;  1N73 B;  4PV1 C;  2Y0C A;  1VQ6 P;  3L36 A;  3LIE A;  1X8Y A;  3H1H E;  4LLH A;  3RL0 B;  3CCU P;  3CME P;  3RL0 g;  1KYO H;  1Y47 A;  5AVV B;  2HOD A;  3M0D A;  1AVY A;  1BGY J;  4PJ0 E;  1KB9 H;  1RF1 B;  3MGN A;  1GW4 A;  3MZW B;  1JEK A;  1MFT A;  5H2F H;  3AEA C;  1H89 A;  2YXQ B;  3H1I E;  3CI9 A;  3P8C D;  2WWW A;  1BCC G;  3TGU G;  2W27 A;  1VQL P;  3L71 D;  2KNC B;  5APY A;  4OGQ B;  1JMM A;  1Q2N A;  2JJL A;  3B5N C;  2KYV A;  1FZF A;  1GD2 E;  1NJI Q;  2ZXX A;  4UB6 H;  2J58 A;  1S5L X;  1LP1 A;  3IN6 A;  4QMA A;  2KSJ A;  1L4A A;  3CCJ P;  3A2A A;  3SWF A;  4BRY A;  3AE9 C;  5KLI B;  2WSF J;  1WMK A;  5KJ7 D;  1FBM A;  2JWA A;  1SQX K;  5M1B A;  5AVS B;  3GW6 A;  1JY2 O;  2JEE A;  3BCC D;  4GIF A;  3WUU A;  3CX5 D;  2A06 E;  1M57 D;  1CI6 A;  1KIL D;  2R32 A;  1VQN P;  1OW8 A;  2K9Y A;  1YIJ P;  2FY8 A;  4W7Y A;  1L4A D;  1EZV I;  1BSN A;  1AFO A;  1X9V A;  3A0H H;  3CCR P;  1A02 F;  1JUN A;  3V4W A;  1BGY G;  3M0D C;  1GU5 A;  3CXH E;  2B9B A;  3RBX A;  4NPD A;  2K3R A;  4A7P A;  2H43 A;  1DD4 A;  1KQF B;  2WPR A;  3W67 A;  1NTM D;  4D6T J;  4UB8 H;  2N1T B;  4N3Y B;  1X79 B;  4N6J A;  1PPJ G;  3GF7 A;  3QH9 A;  2FYU K;  3L74 J;  5KLV G;  2I1K A;  2PRR A;  1EXJ A;  1H8A A;  3H1J D;  4H44 B;  2W6J H;  1YI2 P;  2WSE J;  3GF3 A;  1L4A C;  1SQB K;  3Q3D A;  4R4L A;  1KQL A;  2ZFC A;  5AVR B;  1QVF O;  4L75 A;  5KAF H;  2ZJS E;  2YO3 A;  3CX5 H;  2FXO A;  4EDF A;  2ZVN B;  1NTZ J;  2E74 D;  1AA0 A;  3C8V A;  1SQQ D;  1IFJ A;  2P10 A;  1L0L E;  1KQG B;  2QM8 A;  2Q9I A;  3OA7 A;  1ZOY C;  1QX8 A;  1SQB G;  2W83 C;  2N9B A;  1HBW A;  2IBZ G;  2GUV A;  3MHV A;  3L75 J;  3CC2 P;  1URQ D;  2YXR B;  3I56 P;  2D2C B;  4D6T G;  4C46 A;  3RK2 C;  3L70 J;  1EDI A;  1OIP A;  3JSV C;  2O1K A;  1P84 E;  3V2R A;  1NO4 A;  2MKV A;  4K35 A;  3TGU D;  3L74 G;  1S72 P;  3SFD C;  4IFD K;  1LTS C;  1SQP E;  1OXZ A;  1N73 A;  3AEC C;  5E79 E;  1QVG O;  1GL2 D;  3Q5R A;  1QL1 A;  2M5A B;  1VQ8 P;  1J1E C;  3TNU B;  1FZC A;  1RF1 A;  1JCD A;  1T3U A;  1NU1 E;  2G8Y A;  5CCH A;  2YMK A;  4GKG A;  5B5E E;  1PIX A;  2KNC A;  3A7O A;  3AE8 C;  4L74 A;  2C9N Y;  3IF4 A;  3H1L E;  1HUC A;  1VQ9 P;  1DX7 A;  3L37 A;  3AE7 C;  2BAS A;  3L75 G;  1S4X A;  4H13 D;  5AW3 B;  1LNQ A;  1BGY D;  1EDK A;  3R2P A;  1PP9 J;  2W6A A;  1H0T B;  2XNX A;  3L70 G;  3KDP B;  1K8A Q;  1YQ3 C;  1PPJ D;  3NFQ A;  5GTI H;  2W6B A;  2MJZ A;  4OGQ D;  5KLV D;  2YIU B;  2A45 I;  1N73 C;  1KTM A;  3D6Z A;  3G9R A;  3P32 A;  1DEE G;  3RL0 C;  2IFM A;  1NOH A;  3IFM A;  1OMI A;  1L0L K;  4H13 C;  1FZC C;  1RF1 C;  4GT1 A;  5AVX B;  5APQ A;  2KIK A;  2GA1 A;  3CWB G;  4TLF A;  5CCH C;  4WY4 D;  1HF9 A;  1MZ9 A;  3HE4 B;  5APV A;  3WMM 0;  1Q81 Q;  1NTK E;  3F5H A;  1WT6 A;  1EDJ A;  4OGQ C;  2OAR A;  2QIW A;  3L73 E;  1SQB D;  1MV8 A;  3L72 E;  2K9J B;  2FXP A;  2OYO A;  3TSI A;  4ZMD A;  1OFC X;  4PD4 E;  1ZRT E;  2XZR A;  2IBZ I;  2A45 H;  1PP9 G;  2K1A A;  1FZG A;  2HG5 D;  3BAT A;  4CPG A;  4D6T D;  3V2N A;  2WSC H;  1JTH B;  4RJT A;  3S4R A;  1M1J B;  2KI7 B;  1Q82 Q;  1KFN A;  3JC2 2;  2XU6 A;  3HD7 B;  2K88 A;  3GHG B;  4ZKP A;  3L74 D;  2WMM A;  1RE3 A;  4IFM A;  1VQO P;  3CD6 P;  2WSF H;  1R8E A;  1FJP A;  4B86 A;  1L2P A;  3CCE P;  1IJD B;  1NU1 K;  1SQP G;  2NPS B;  2QJK B;  2QJY B;  1GDT A;  3WUV A;  1NTZ D;  2ITA A;  2O01 N;  1XTC C;  2BEQ D;  1N7S B;  3M0A A;  3NMD A;  1DH3 A;  1L0N E;  1VF5 B;  2IYO A;  1R5S A;  1T2K D;  3CPW O;  5CCG A;  3CC7 P;  1KYO D;  1BCC J;  4H44 C;  2P67 A;  1KB9 D;  4Z1M H;  3L75 D;  1JY3 O;  2M5A A;  1BE3 J;  2BEZ F;  3B4S A;  3TNU A;  3Q2Y A;  2QM7 A;  3AE3 C;  1EQ7 A;  2Z5I A;  2OTL P;  3NXS A;  4DCK A;  5TJH A;  3L70 D;  3QWO C;  2E42 A;  4HB1 A;  2Z4E A;  2WQY C;  2WVR A;  4XE5 B;  4NPF X;  2BCC J;  3CXH I;  3D6Y A;  1RE3 C;  3LW5 H;  3NTN A;  3VMZ A;  4HH2 A;  1RQU A;  1JM0 A;  2YMY A;  1GTW A;  2IZ0 A;  2WPS A;  2ZYA A;  1T8Z A;  4GOD A;  1S9K E;  1NTK K;  4N78 E;  3H1K E;  2J5U A;  3S9O A;  2D2C C;  3VYI A;  3CWB D;  1SQX J;  1HGZ A;  4H0L B;  1LJ2 A;  5CCG C;  2ZYG A;  5BVZ A;  2SPZ A;  1VQ5 P;  2Z5H A;  5APS A;  3HUS B;  1VQ4 P;  3RBZ A;  4HJG H;  2E5T A;  4C7R A;  3KYQ A;  1SP4 A;  3GG2 A;  5KTB A;  5KLV J;  3KZI E;  2YKQ A;  3CXH H;  3IR9 A;  1YBK A;  4ASW A;  1BE3 G;  1K05 A;  1LT1 A;  3L72 G;  5AVY B;  2WSC J;  2IZ1 A;  1EXI A;  1Q86 Q;  1PP9 D;  1KN7 A;  2FBW C;  2E43 A;  2RH0 A;  1OX3 A;  4WBA A;  2HLO A;  1S1C X;  2QA4 P;  4U3F E;  3TK1 A;  1RY3 A;  2BCC G;  2FYU J;  1ZP0 C;  3HE4 A;  3CCL P;  1M1K Q;  1X0T A;  1HH0 A;  1MKM A;  1USE A;  2K9J A;  1P84 I;  1L0N K;  5KAI E;  1EZV D;  1SQB J;  1SQP D;  2XV5 A;  4IL6 E;  3V6I A;  1XTG B;  1JY2 P;  3OAK A;  1BSH A;  1MUU A;  4I1L A;  1AVO A;  2WIT A;  3B8E B;  1CZQ A;  3G71 P;  3VN0 A;  3L35 A;  3CCM P;  1SQX G;  3U59 A;  1SQV E;  2P1J A;  3H1H J;  5H2F E;  2O01 J;  5AVU B;  2WPV B;  3HD7 A;  1W5C E;  1RH5 B;  3GHG A;  5AVQ B;  1IFN A;  4WVZ A;  3R4Y A;  2YIU C;  2H7H A;  3P7K A;  3FWN A;  1HGV A;  2A45 G;  1LTJ B;  2H8P D;  3K5B A;  5AW5 B;  2E5Y A;  2KUB A;  1KQS O;  4JYB A;  3H1I J;  2N9Y B;  2NPS A;  1S5L E;  5AVT B;  1NWQ A;  3PLN A;  3VP8 A;  1OVU A;  1N7S A;  3V4Q A;  4JF7 A;  3LW5 J;  1VDF A;  3HD7 D;  1FZB A;  3RK2 D;  1YIT P;  2CPB A;  2FYU G;  3G3Z A;  3LID A;  1LTA C;  5E79 H;  3TDK A;  2JP3 A;  1ZN5 A;  1AV1 A;  2P58 A;  2HYN A;  1K9M Q;  4IFF A;  2B87 B;  3BRV B;  3P8C E;  1HJB A;  2HPC B;  2KS1 B;  3L71 E;  3A0B E;  2ZYD A;  1J2J B;  1T6A A;  2ZXE B;  2FFD B;  3RK3 D;  5B5E H;  3H1H G;  5AVW B;  2R3C A;  3T97 B;  3P8M C;  3AEE C;  2E75 B;  1LWU B;  2H89 C;  4DT0 A;  1VQ7 P;  1JB0 J;  1JNM A;  3HD7 C;  4AQR D;  2QVA A;  3GHG C;  1GMJ A;  1CSB A;  1BDC A;  1U7J A;  1GU4 A;  1SVF A;  1BCC D;  2RN0 A;  2M3B A;  1YJ9 P;  2Q3I A;  3OJA B;  2QRX A;  3VMA A;  2KLV A;  3H1I G;  1BE3 D;  3MD0 A;  2NPS C;  2QJK C;  2QJY C;  3BCC E;  1IC2 A;  3C1L A;  4OWF A;  2J59 M;  3CX5 E;  2YNY A;  4DOJ A;  4W80 A;  1KIL E;  1KV4 A;  1FDI A;  2M8R A;  1N7S C;  3HRN A;  2Q3E A;  3RK3 C;  4PD4 I;  1VF5 C;  2ZT9 D;  2BCC D;  1M56 D;  2QEX P;  3B5N B;  3CWB J;  3HUS A;  2B89 A;  3WU2 E;  2P7J A;  2OQQ A;  1R5L A;  1NTM E;  4ZNC A;  2V4H A;  1SFC B;  2HFE D;  3VP9 A;  1SQV K;  3RL0 D;  1FC2 C;  2AEF A;  1GW3 A;  2A06 G;  3II6 A;  1LTT C;  3H1J E;  1CW5 A;  3GMA A;  1K73 Q;  1KD1 Q;  1SQX D;  4H0L D;  3HTK B;  2O3J A;  5CCH D;  2K37 A;  2ZT9 C;  4I7Z B;  4TT3 H;  2KZJ A;  1PGP A;  1U7M A;  3JCU E;  1WRG A;  1SQQ E;  2QSI A;  1BDD A;  3WUT A;  2B88 A;  2YO2 A;  1SQP J;  5TIS E;  2GUS A;  4O9B A;  2FYU D;  4C7N B;  4H0L C;  3CL3 D;  2N1T A;  4YPC A;  1S2E A;  4WWI A;  1KIL B;  3HUS C;  3D70 A;  1IK7 A;  4U7J A;  3AE5 C;  1FZE A;  4ZKU A;  1L4A B;  1LTJ A;  4MN4 C;  4AUW A;  5GTH E;  4BWN A;  2QE7 H;  3AEG C;  1AQT A;  1L0L G;  1FDO A;  5B66 E;  3TGU E;  2R5B A;  1JY3 N;  2IBZ D;  1EDL A;  2Q7C A;  1JO5 A;  2LR2 A;  4I2L C;  3PHL A;  3H1L J;  5AW9 B;  3H1H D;  5KLI C;  4JPZ B;  1FDM A;  2KP8 A;  3CCS P;  2N1T D;  4N78 D;  4IOI H;  2KOG A;  2KK7 A;  4JBZ A;  1PV3 A;  1RHZ B;  1RQV A;  3CMA P;  3PRJ A;  1LTI C;  4H44 D;  1W2B O;  4XFJ A;  2KSE A;  3H1I D;  1N8R Q;  3B71 A;  1X22 A;  2AXT H;  5DJT B;  2HPC A;  2KS1 A;  2OYH B;  2E74 B;  4OH8 B;  2OGU A;  3SWY A;  2FFD A;  5AW6 B;  5AW7 B;  1NTM K;  3T97 A;  3VMY A;  1LWU A;  2KZI A;  1VQM P;  2H88 C;  2N1T C;  1BGY E;  1PL5 A;  4JQ0 D;  4YXW H;  1QLE D;  2FYN B;  1YHQ P;  1VQP P;  1Q7Y Q;  1J1E B;  4JYC A;  1GK4 A;  5BU5 A;  5AVZ B;  1NU1 G;  1NH4 A;  2O01 H;  1G1J A;  1HWT C;  1URQ B;  3E1I A;  5EFW B;  4DJG A;  3SFE C;  1K04 A;  4PJ0 H;  1LTB C;  1NTK J;  4RO0 A;  3KHU A;  2A06 D;  5KLV E;  2L91 A;  3Q5P A;  3H1L G;  3L72 J;  2D2C D;  1FOS E;  1SQQ K;  2WT7 B;  2YKO A;  5CHX A;  1Z56 A;  1JY3 P;  1YTZ I;  1IZN B;  4Y99 B;  5CCG D;  3CXH D;  3SWK A;  3KZI H;  1JOC A;  2IFN A;  1FOS F;  5C39 A;  4EYY Q;  4YXD C;  4LC1 A;  1OW6 A;  1GL2 B;  1SFC A;  2FYZ A;  2Q6Q A;  1T3J A;  2CPS A;  1NAF A;  3D71 A;  1UIX A;  3PJS K;  3V5B A;  2I1J A;  1UII A;  1SQQ G;  1OVR A;  2FFD C;  2LXC B;  4KHX A;  5DJU B;  1VL2 A;  1LTG C;  2C0W A;  3UIA A;  2KB7 P;  1H0T A;  3HTK A;  3AE1 C;  2E75 C;  1LWU C;  4W7Z A;  1NVO A;  2IX7 C;  4LGD E;  4EI2 A;  5APW A;  3U1C A;  2E76 B;  4BXL A;  1IK9 A;  4IL6 X;  5KAI H;  1SFC D;  3EWK A;  4RES B;  4D6T E;  4IL6 H;  4I6M C;  4H13 B;  1L0N J;  1FZC B;  1L0L D;  1ZW0 A;  3AED C;  1H88 A;  1NTK G;  3L74 E;  2VRS A;  2W8Z A;  1YQ4 C;  1DEB A;  2PGD A;  4RKU J;  5L8R J;  2OYI B;  1M8O B;  1Y8A A;  3L73 G;  1SLQ A;  3ZDM A;  5KJ7 A;  1JMB A;  3Q1M A;  4HYT B;  3PH0 A;  1U57 A;  3FXD A;  4OVN F;  1KC8 Q;  2HR3 A;  3M91 A;  4AYC A;  4C7N A;  3M9Q A;  4HKZ H;  1KIL A;  1NTZ E;  3H32 B;  3RGU A;  1IFP A;  2IPP A;  2ZVO B;  1G2C B;  3U1A A;  1S5L H;  2WTY A;  1SFC C;  1P84 D;  2M3E A;  2G3A A;  1LT9 B;  3CCV P;  1J1D B;  1AJY A;  3TF5 A;  2JKV A;  3Q5S A;  3MTU E;  2I8D A;  1KYO E;  2ZAE B;  2POH A;  2AXC A;  2XKM A;  2R5D A;  4WY4 B;  2C0X A;  1KB9 E;  3MIW A;  1KZU B;  3L75 E;  1JTH A;  4I7Z C;  4Y28 J;  1ZR2 A;  1M1J A;  5CJ0 A;  3CX5 I;  1FS0 E;  1M90 Q;  3H1K J;  5KLV K;  5CBO A;  4NPE A;  3V2P A;  1L0N G;  1NU1 D;  3L70 E;  1ZR4 A;  2KLU A;  1QEX A;  3A0B H;  5K5G B;  2YKP A;  3AE6 C;  3H25 A;  3AE4 C;  1NAY A;  4WB4 A;  3CLQ A;  4UB6 E;  2R3S A;  1YYC A;  3F89 A;  2OYH A;  2Q1K A;  1VQK P;  1FAV A;  3FGA D;  3H1L D;  5KJ7 C;  2OTK E;  1IFD A;  1N7L A;  1P84 H;  1ZV8 A;  1S3J A;  3HE5 B;  1LGH B;  2QJP B;  3G6E P;  3VMX A;  2M0B A;  1M7L A;  4ASV A;  5AW1 B;  1KIL C;  1QGK B;  4KJM A;  2Y0D A;  5KKZ B;  1OZH A;  3KQG A;  4U3F J;  3FXE A;  3CWB E;  2CK3 H;  1URQ A;  2PAJ A;  2V7Q H;  3BRT B;  2NPS D;  1VPC A;  5CJ4 A;  2LXB A;  3C9I A;  3A0H E;  3EFG A;  1HVV A;  2XND H;  2JR8 A;  1A02 J;  1N7S D;  1VF5 D;  3WU2 H;  2WT7 A;  3O6Q B;  2Y9Z A;  3O8Z A;  1PFI A;  4UB8 E;  1M1J C;  1TU3 F;  1PP9 E;  3H1K G;  2LKM A;  2KXP B;  2UWJ E;  4PV1 B;  1PGJ A;  1SS1 A;  1GL2 A;  1KFM A;  3EFF K;  1SQV J;  4EIJ A;  1NTK D;  1EC5 A;  2OYH C;  4XA4 A;  1HJ0 A;  2E74 C;  3KPE A;  3L73 D;  3L72 D;  3A5T A;  1NTZ K;  1FZA A;  5KAF E;  4PD4 D;  3JCU H;  1EZV E;  2P2U A;  1ZRT D;  3ITK A;  3L4F A;  3GLM A;  1FU1 A;  2FYN C;  1MFZ A;  4DZO A;  4YTP C;  1JCC A;  4U3F G;  2AEM A;  1NTZ G;  1PGO A;  1URQ C;  4KT0 J;  1IFM A;  5CMZ A;  5TIS H;  1FJK A;  4R4M A;  2OYI A;  1L0L J;  3M06 A;  2L5G B;  4L73 A;  1NGM B;  1NKZ B;  1N86 A;  3IAO A;  3I55 P;  1QL2 A;  2JO1 A;  2E76 D;  3SSU A;  1E79 H;  3L71 J;  4Y99 C;  5APX A;  5GTH H;  4L76 A;  2RMZ A;  2IDB A;  3W68 A;  3H32 A;  3A3Y B;  5B66 H;  2O1J A;  3E7K A;  1G2C A;  1SQV G;  1L0N D;  2Y0E A;  1GL2 C;  4K3A A;  4GOF A;  4PD4 H;  1RE4 A;  5AW4 B;  1N2D C;  5AW2 B;  1LT9 A;  2HOD B;  2NZ2 A;  1AQ5 A;  3BAS A; 
#chains in the Genus database with same CATH homology
 2M3E A;  2KNC A;  2K1A A;  2K9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...