1NTKK

Crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
53
structure length
53
Chain Sequence
MLTRFLGPRYRQLARNWVPTAQLWGAVGAVGLVWATDWRLILDWVPYINGKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
total genus 12
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ntkK00
1SQVK 1L0LK 2FYUK 1NTZK 1NTKK 2OARA 2J59M 3M9QA 5KLVK 3CLQA 1NU1K 1SQBK 1SQXK 2WSFH 3G3ZA 1L0NK 2LKMA 1NTMK 1SQPK 3LW5H 4IFDK 2O01H 1SQQK 2WSCH 2WSEH
chains in the Genus database with same CATH superfamily
2IZ0A 1KC8Q 2FYNC 3L72G 2KSEA 1SQBK 1YJNP 1SQPJ 3R4YA 2IBZD 2BASA 1EC5A 3CCJP 4EI2A 1NTZJ 1QGKB 2FFDC 1NTKJ 3C8VA 1KV4A 4IL6H 3HUSA 3NMDA 1SQQG 1OMIA 5BU5A 4WWIA 2KNCB 1USDA 1N86A 3L74E 3WUVA 1PP9G 2E74D 1FZEA 1OW8A 1JTHB 2K9JB 3N4XA 4PD4I 3KYQA 2OARA 2R44A 1GMJA 3F5HA 2W6JH 2WSEJ 3ZDMA 1EZVD 3I5CA 2HLOA 1KB9I 3KQGA 3HE5B 1S5LX 3HD7D 2FXMA 1FOSE 3BCCE 1LP1A 3L72D 4B86A 3K5BA 4TLFA 1KN7A 1NU1G 5KKZC 2Y9YA 1SQPE 2A45H 2RKLA 4H13C 3WU2E 1NTZE 3A0HH 5GTIH 1N2DC 1EDLA 1YTZT 5CHXA 1FZAA 1YI2P 1VQNP 1SQQD 1AA0A 4OGQC 1KILE 2WMMA 4IFDK 2E43A 1PP9D 2Q3EA 1IFDA 2KI7B 1RF1C 4WVZA 5KLVK 4JYBA 1ZV8A 3EFGA 2FFDA 1FJKA 2KS1B 1RY3A 4RKUJ 3L35A 3QH9A 1YTZI 5H2FH 3EWKA 2A06D 3AE2C 3L73E 2W6AA 2G3AA 4C7NA 2HFED 3AE7C 4GT1A 4H13D 1FOSF 2R3SA 3H1JD 4XFJA 3MZWB 2ZYAA 1IC2A 2UWJE 1S4XA 2P67A 3H1KD 3A0BE 5B66H 1BCCJ 1JMBA 4EDFA 1DD3A 4U3FE 3H25A 3H32B 3Q5SA 2CPSA 2K88A 4NPEA 3CLQA 2QA4P 1VQKP 4BRYA 2BCCE 3T97B 1J1DC 2QJYB 1SFCB 3V5BA 4WB4A 2KOGA 5AVYB 1NKZB 2WPSA 3V2PA 1SQPG 1BSHA 2B87B 3VYIA 3D71A 2O01J 5KAIH 1DX7A 3RL0g 4WY4D 3TNUB 1NTZG 1SQVD 1FE6A 1KFMA 3BRTB 1BSNA 4I7ZB 1AV1A 3AECC 1RF1A 1NJIQ 1HUCA 3RL0C 2NPSD 1L4AB 3H1ID 4Z1MH 2Y0DA 5GTHE 5APSA 1E79H 1L0LD 1J1EC 1BDDA 2KXPB 3JC22 2QJKB 2K1AA 1IFIA 2B89A 1KQFB 3SFEC 3OW2O 1JEKA 1HTLC 4GOFA 4ZNCA 3CCVP 1Q86Q 3WUTA 1N7LA 1M7LA 4H44D 1CI6B 1Q90D 3TF5A 2IX7C 3A7OA 3PRJA 3H6PA 3PH0A 1JB0J 4WY4B 2FXOA 3FXDA 4D6TJ 3G6EP 3VN0A 3CXHH 3L73G 1SQXJ 3GHGB 3L36A 3M9QA 1SQPD 4L75A 3WUUA 4XE5B 4I2LC 5TISE 2H89C 2NPSB 5BU8B 4IL6X 2Z4EA 1AVYA 4IOIH 1VQ8P 1NTZD 1NO4A 1NTKD 1LTBC 3M91A 2N1TD 3VTPC 2BEQD 4EIJA 5CMZA 4U3FG 1ZRTE 3O6QB 1LTAC 1VF5C 3Q2YA 4PD4D 1NTMK 5L8RJ 3U1CA 1AVOA 1RE4A 3MHVA 3AE6C 3GF3A 3S1KA 2ZXXA 1VQ6P 2BCCG 1EDKA 2OTLP 2JO1A 2O01N 1S9KD 2A45I 2WT7A 3AEBC 2NZ2A 5AW0B 3R2PA 5APXA 2FXPA 2K37A 1R8EA 3LIDA 3CD6P 3GMAA 5CBNA 2N1TB 1QX8A 1KD1Q 3A3YB 5C39A 1H0TB 1L0NK 1KILB 1N7SB 4Y99C 4CPGA 4ZKPA 3H1HJ 3M9BA 4U7JA 1PGJA 3AE3C 3A2AA 1DEBA 3NTNA 2H88C 3RK3C 4RESB 3EFFK 3MD0A 1MZ9A 3PLNA 1SQBJ 1BCCG 5CJ4A 1HGZA 2QM7A 3RBZA 3L71J 1W5CE 1BE3J 5AVRB 4H0LD 2WITA 1QL1A 2M3EA 2RMZA 2Y0CA 3FWNA 4BWNA 2M8RA 2KZJA 3V4WA 2XV5A 2E76B 1ZOYC 1GK6A 2CPBA 2HG5D 2OYIB 3HTKB 5KJ7C 4DT0A 1X9VA 4A7PA 5DJTB 5EFWB 2ZT9C 3L4FA 1M1KQ 2B9BA 1VDFA 1GD2E 1EDIA 2YNYA 4KT0J 3CCSP 3C1LA 3V2QA 1M90Q 2A06E 3JCUE 1VQ5P 1URQD 1YYCA 1P84H 4PV1D 3USSA 1OIPA 3II6A 1PIXA 2WQYC 2YMKA 4LLHA 1BCCD 1K9MQ 3H1JE 1MUUA 1GL2B 1LT9C 2WSFH 3KZIE 1JCCA 3CCQP 3H1IJ 3KXDA 2IYPA 3H1KE 3E1IA 3L71E 2AXTE 2IPPA 3CWBJ 3IAOA 2OYOA 1NVOA 2KIKA 4O9BA 2XNXA 4K3AA 3CC4P 4N78D 5AW3B 3CX5I 5AW9B 2JR8A 1URQA 3HE4B 5KJ7D 3V2RA 5AVVB 1QEXA 5KLVJ 1X79B 3CMAP 3PJSK 3RK2B 2ZT9D 4Y28J 1KZUB 4PJ0E 1KYOE 2ZVOB 2M5AB 1JY2N 5K5GB 3L37A 2G8YA 2Q7CA 1T3UA 3VP8A 4DZOA 4HJGH 5E79E 2V7QH 2M0BA 1NU1K 4UB6H 2CK3H 1LT1A 2WPVB 1SQVE 2R3CA 1ZN5A 1ZRTD 1CW5A 2MKVA 1JUNA 2D2CD 1WRGA 4UB8E 5KJ7A 2LXBA 2ITAA 1JY3N 3H1IE 3CXHI 1VQ4P 3HUSB 4GODA 1L0LE 1FU1A 3I56P 1JY2P 2XZRA 2YMYA 4L74A 4D6TD 1Y47A 2L5GB 2Z5HA 3BRVB 2E42A 3OA7A 1ZMEC 3FWLA 1SQXD 1U7JA 3VMAA 2FYUK 5AW5B 2N9BA 3HE5A 2ZYDA 1LT9A 2E5YA 2A06G 5APWA 4R4LA 1T6AA 1LP1B 1T3JA 1PZQA 1JY3P 1FZFA 1N73C 1SVFA 4K35A 1DEEG 3P8CE 1RQUA 3H1JG 2KP8A 4IFFA 2O3JA 5APTA 1QLED 1NTKE 1BDCA 3L75J 1A02J 1SFCC 3H1KG 3B5NC 2E74B 4M3LA 2WPRA 2K3RA 1KQLA 3L71G 1HJBA 4RJTA 1OFCX 3IF4A 5B5EH 5KLIB 5KAFE 1MV8A 1H8AA 1HJ0A 2QG4A 2P58A 2WSCH 4PD4E 1XTCC 1Q81Q 3HD7B 1RH5B 2OYHC 1BGYJ 4I7ZC 2AXCA 3AE5C 1VPCA 1OVRA 1KB9E 1GU4A 2OTJP 1ZLLA 1SLQA 1S9KE 3BVHA 1AQ5A 1L4AC 2QSIA 3TGUJ 3CI9A 4EYYQ 3NXSA 3JCUH 2QJKC 1T8ZA 2L91A 3H1HD 1JOCA 3P8MC 1SQVG 1NAFA 4L76A 1HGVA 3OJAB 1SQBD 5CJ0A 3P7KA 3JSVC 4C7NB 3H1IG 3G71P 3B5ND 3PP5A 2P2UA 2E5TA 3L71D 1L0LG 1BE3D 3GHGC 4OGQD 2AEMA 1ZW0A 2E75C 4YXWH 3D6ZA 2J58A 1NYHA 3VMYA 1NTMJ 2FYZA 2Q5UA 4PJ0H 1BGYE 1N73A 2ZXEB 1G2CA 3Q5PA 1KYOD 1P84I 5KKZB 3T97A 2HYNA 5AW4B 5E79H 4EOTA 4BRYB 3B5NA 3FX0A 3A5TA 3OAKA 4C7RA 4H13B 1FZCB 2ZYGA 2Q6QA 3TGUE 2HODA 1NTKG 3LW5H 2Q3IA 1LTJC 3TNUA 1FZGA 3GLMA 3AEFC 1CSBA 4OGQB 1K05A 3ABVC 4DCKA 2OYHA 2P1JA 1ZP0C 3V6IA 3CCRP 3CC7P 1ZXGA 1L0NJ 1GW4A 3RK3E 1RF1B 1FC2C 1L4AA 1BCCE 1ZR2A 3CWBD 1PL5A 2KK7A 1YBKA 1GZLA 3CX5D 2E75D 2IBZI 1KILC 2H8PD 1RF0C 2V7QJ 1A02F 3V2NA 5AVWB 1JCDA 1NH4A 3ITKA 2RH0A 1KQSO 5KTBA 1FDMA 4GDOA 1CI6A 4N78E 5KLVD 4ASVA 4NPFX 1W2EA 3MUDC 3WU2H 2I8DA 2ZFCA 2FY8A 2RN0A 1QL2A 3GHGA 3M06A 3H1LJ 1FS0E 3P8CD 3CCEP 1X22A 2Y0EA 5CCHC 2I1JA 2HPCA 1NWQA 5CBOA 1EZVI 1M1JC 2YIUB 2OYIC 4PD4H 3RL0D 3CXHD 1RQVA 3CCMP 3WMM0 2POHA 4GOEA 3KPEA 4H44B 4JBZA 1Q2NA 2WSEH 4WBAA 2YO2A 1BGYG 1J1DB 1PGQA 2OTKE 2KUBA 3E7KA 5APQA 1T2KC 1KB9D 1DIPA 2C0XA 2NRGA 1QVGO 1H89A 4TT3H 2LR2A 1LTJA 1M56D 3TGUG 3HRNA 1GL2C 1IJDB 1LWUB 4D6TE 4BXLA 3EQ2A 1RE3C 1USEA 2WSCJ 1SQXE 4AYCA 1JNMA 2C9NY 1GDTA 3A0BH 3SWFA 1H0TA 4HB1A 3M0AA 3RBXA 2ZJSE 4HYTB 5CCHD 1RF0A 3L75D 1J1EB 2DW3A 2YKPA 3TDKA 1DH3A 1X0TA 2M3BA 1VF5D 3RK2C 3E1RA 1NU1J 1E5WA 1H88A 2J5UA 3GG2A 3W68A 3AE1C 3MUDA 2QJPB 1BGYD 1S1CX 2J59M 3D70A 3SWKA 4ZMDA 1T2KD 1NAYA 2JDIH 1LTIC 5CCHA 3A0HE 5GTIE 3B4SA 1UIXA 1M1JA 3TGUD 5CCGC 3Q3DA 2PRRA 1K73Q 2OQQA 2W8ZA 3S4RA 2XU6A 1FZBA 5AW7B 2FYUJ 5GTHH 3H1HE 1VF5B 3RK3D 4H0LB 3BATA 2AEJA 5AVXB 1SQBE 3I55P 4AQRD 4N6JA 3B71A 2H43A 1SQQK 3N7NA 2B88A 5H2FE 1BE3E 1NTMD 2FKWB 3G3ZA 2JP3A 3L74J 4D6TG 5TISH 2KYVA 2E74C 1Y9BA 2O01H 1SQXG 1YQ4C 3SSUA 3VMZA 4Y99B 5KLIC 5CCGD 2R32A 1WT6A 4LC1A 1URQB 1NHLA 3RK3B 1IFNA 4PV1B 1PPJD 2YXQB 3HD7C 4W80A 1R5SA 3BCCJ 2H7HA 2FYUE 1L0ND 1JM0A 2W90A 4QMAA 3B8EB 3L70D 4JF7A 2IFNA 3KHUA 1FJPA 5M1BA 3MGNA 5CCGA 2A45G 1EXJA 2QRXA 3Q5RA 2KNCA 5KAIE 1SS1A 2JEEA 3CWBE 1Q82Q 1JTHA 3CX5E 2K9JA 1IO4A 1YQ3C 2ZT9B 5APUA 1IFJA 4OWFA 2WVRA 1VQ7P 2XNDH 5KLVE 2IFMA 1AFOA 3H1LD 3IN6A 3H1HG 2MJZA 2PGDA 2D2CB 1KORA 1SQBG 1LT9B 1SQVK 2GA1A 3Q1MA 2WPQA 2JKVA 4OH8B 3G4SP 1OXZA 2QJYC 3L73J 2YKQA 1S2EA 1OW7A 3U59A 2IZ1A 4GKGA 1BE3G 3AE4C 3CXHE 1FDIA 1FZCC 2KZIA 3W67A 4HH2A 1L0LK 2GUVA 1G1JA 1S5LE 1OZHA 4YPCA 3QWOC 1LTGC 3HD7A 4U3FJ 2FYNB 1SP4A 1XTGB 2N9YB 4I6MC 5AW8B 1LGHB 5TJHA 2YXRB 2KS1A 2BCCJ 2FFDB 3TYYA 4YTPC 4HKZH 2FYUG 1Y8AA 1K8AQ 1SQPK 1PGPA 3GW6A 3KZIH 2WSSH 1KTMA 1OVVA 1NTZK 1NTKK 1EDJA 2AXTH 1D7MA 4WY4C 1SFCD 3KDPB 3L75E 3CC2P 1NU1D 4MN4C 2QE7H 3CWBG 2NPSC 3U1AA 1RHZB 1VQLP 3L74G 3H32A 4IFMA 3D6YA 3V4QA 1KYOH 2YIUC 3SFDC 5KLVG 1YHQP 2GUSA 2WSFJ 5AVUB 2C9LY 3NFQA 1AJYA 1L4AD 1WMKA 2O1KA 1SFCA 1N73B 2PAJA 3AE8C 4H44C 1G2CB 1W2BO 1IK7A 4KJMA 1OVUA 3BCCG 1FZCA 2B87A 1J2JB 2ZVNB 2FYUD 3B5NB 2R5DA 2JWDA 4UB8H 1RE4C 2O1JA 2KB7P 2AEFA 4I1LA 2HODB 1Z56A 5AVSB 4OVNF 1LWUC 1VQMP 3L70J 3CX5H 2OYHB 3PTZA 2N1TC 1TU3F 1KFNA 5AVQB 2P10A 2FBWC 3M0DC 1N7SC 1N8RQ 2Q1KA 4N3YB 1IFMA 3VP9A 3L74D 3CCUP 1QVFO 4NPDA 1NTME 1U7MA 4R4MA 4W7YA 1P84E 5APVA 3VMXA 4AUWA 4XA4A 2W27A 5BVZA 2QEXP 3CCLP 4WY4A 3FXEA 1X8YA 1KQGB 1EXIA 5AW1B 4ASWA 4JQ0D 3RGUA 3BCCD 2C0WA 2QJPC 1GU5A 2NPSA 1PPJE 1HWTC 1M8OB 1PV3A 2E76C 3L75G 5KAFH 3AE9C 3AEAC 2P7JA 3O8ZA 2E75B 2W83C 2WTYA 1IZNB 3L72J 2HPCB 1L0NE 2WZ7A 3IFMA 4C46A 1S5LH 2PFXA 5AW2B 4JPZB 3O6QA 2IBZE 3L70E 3G9RA 1KB9H 5AVZB 4YXDC 3MTUE 5DJUB 1KILD 1N7SD 2KLVA 5APYA 4LGDE 1U57A 1YITP 1FAVA 3M9HA 4UB6E 1SQQJ 4H0LC 3MP7B 3TSIA 2Y9ZA 4IL6E 1HBWA 2QVAA 1VQPP 2YKOA 1GW3A 2WT7B 1PP9J 1LTJB 1LWUA 2YO3A 2GM4A 3RL0B 2N1TA 3BASA 3P32A 3H1LE 2XDJA 3M0DA 1VQ9P 1EZVE 1KILA 1N7SA 1Q7YQ 1YJ9P 1PGOA 3L73D 2E76D 1EQ7A 1LNQA 1S3JA 2I1KA 2K9YA 1VL2A 2Q9IA 3FGAD 3CPWO 3L72E 2VRSA 3PHLA 1IFPA 1URQC 4JYCA 3TK1A 1AQTA 4PV1C 4W7ZA 1MKMA 1NTMG 3VOPA 3H1JJ 1R5LA 1CZQA 4U3FD 4DJGA 3H1KJ 2IYOA 1FDOA 3F89A 3C9IA 3CMEP 2JWAA 1SQQE 4GIFA 1M57D 2OYIA 3HTKA 1YIJP 2BCCD 1PFIA 1GL2D 1L2PA 2KLUA 5B5EE 1ZR4A 1SQXK 1PP9E 2V4HA 2WWWA 1PPJG 2LKMA 1M1JB 3HUSC 4KHXA 1S72P 3AEDC 3AEGC 2Z5IA 3LIEA 1L0NG 2LXCB 1HF9A 1JMMA 3S9OA 2HR3A 1UIIA 2PP6A 2ZAEB 2XKMA 1KYOI 2IBZG 4L73A 3L70G 3UIAA 2IDBA 4RO0A 1LJ2A 1KMIZ 1OX3A 1K04A 2KSJA 1MFZA 2R5BA 1SQVJ 3GF7A 1LTTC 3RK2D 1HVVA 1GL2A 1NU1E 2SPZA 4ZKUA 1JY2O 1IK9A 1LTSC 1RE3A 1OW6A 2D2CC 3LW5J 1GK4A 1YJWP 1DD4A 3SWYA 1P84D 2BEZF 5AVTB 3MIWA 2QIWA 1L0LJ 3AEEC 3IR9A 1VQOP 3HE4A 1MFTA 5AW6B 5B66E 1NKNA 2JJLA 2OGUA 3H1LG 2W6BA 1EZVG 1NGMB 1HH0A 4DOJA 1FBMA 1JY3O 1NOHA 2M5AA 3CL3D 2QM8A 1GTWA 1JO5A 1OWAA 1G1IA
chains in the Genus database with same CATH topology
1GZLA 3MD0A 1MZ9A 1KILC 2H8PD 1RF0C 1SQBK 5CJ4A 1A02F 1HGZA 2FFDB 3TYYA 3V2NA 2QM7A 5AVWB 1JCDA 2BASA 1NH4A 1SQPK 5KTBA 1FDMA 1CI6A 5AVRB 4N78E 2FFDC 2WITA 1QL1A 1NTZK 1NTKK 2M8RA 1W2EA 3V4WA 2XV5A 3HUSA 4WY4C 2ZFCA 3NMDA 1SFCD 3KDPB 1QL2A 3GHGA 3M06A 3P8CD 1GK6A 5BU5A 2CPBA 2HG5D 2OYIB 3HTKB 5KJ7C 1N86A 5CCHC 2I1JA 1X9VA 2HPCA 1NWQA 1FZEA 2NPSC 1JTHB 3N4XA 3U1AA 1M1JC 3L4FA 3KYQA 2OARA 2OYIC 3RL0D 1VDFA 1GD2E 2YNYA 3H32A 4IFMA 3WMM0 2POHA 3V4QA 3I5CA 2HLOA 3KPEA 3V2QA 3KQGA 2GUSA 3HE5B 3HD7D 2FXMA 2WSEH 5AVUB 2C9LY 1URQD 4WBAA 2YO2A 3NFQA 1L4AD 1YYCA 1FOSE 1J1DB 2O1KA 1SFCA 1N73B 2PAJA 5APQA 3II6A 1T2KC 4LLHA 1G2CB 2C0XA 4B86A 1MUUA 1GL2B 1LT9C 2WSFH 1H89A 1FZCA 1J2JB 1JCCA 2A45H 1LTJA 3B5NB 2R5DA 3E1IA 1RE4C 2O1JA 2IPPA 3HRNA 1GL2C 2KB7P 1IJDB 1LWUB 1N2DC 1YTZT 4O9BA 4I1LA 5CHXA 3RK3C 3EQ2A 2HODB 1FZAA 1RE3C 2XNXA 4N78D 1Z56A 5AW3B 4AYCA 1JNMA 5AVSB 2C9NY 1GDTA 5AW9B 1LWUC 1URQA 3HE4B 2OYHB 3SWFA 5KJ7D 2N1TC 3M0AA 3V2RA 5AVVB 4IFDK 1KFNA 5AVQB 4HYTB 5CCHD 1RF0A 2E43A 3M0DC 1X79B 1J1EB 1IFDA 1N7SC 3RK2B 1RF1C 1KZUB 5KLVK 4JYBA 4N3YB 1JY2N 1IFMA 2YKPA 3VP9A 1ZV8A 3L37A 2Q7CA 1DH3A 1T3UA 3VP8A 3EFGA 2M3BA 4DZOA 3RK2C 1E5WA 4W7YA 5APVA 2FFDA 1FJKA 3VMXA 1H88A 4AUWA 4XA4A 2W27A 1NU1K 2R3CA 1ZN5A 3MUDA 5BVZA 1CW5A 2J59M 4WY4A 1RY3A 1X8YA 1JUNA 3L35A 5AW1B 1YTZI 1T2KD 1WRGA 5KJ7A 1LTIC 5CCHA 2W6AA 4C7NA 2C0WA 2HFED 1GU5A 2NPSA 1JY3N 4GT1A 1M1JA 3HUSB 1FOSF 1HWTC 5CCGC 1FU1A 2P7JA 1JY2P 1IC2A 2XZRA 3O8ZA 2P67A 2YMYA 2WTYA 2XU6A 2HPCB 2WZ7A 3IFMA 4C46A 1FZBA 5AW2B 2L5GB 2Z5HA 5AW7B 3BRVB 2E42A 3OA7A 5AVZB 3H32B 2FYUK 3RK3D 5AW5B 2N9BA 3MTUE 4RESB 3HE5A 1KILD 1N7SD 2KLVA 2CPSA 3BATA 3CLQA 5APYA 1LT9A 5AVXB 4LGDE 1FAVA 3M9HA 4AQRD 4N6JA 5APWA 1J1DC 2H43A 1T3JA 1JY3P 1SFCB 3V5BA 1FZFA 1SVFA 3TSIA 1N73C 4WB4A 2KOGA 3P8CE 1SQQK 1HBWA 3N7NA 5AVYB 2KP8A 1NKZB 4IFFA 2WPSA 3V2PA 2YKOA 5APTA 1GW3A 2WT7B 1A02J 1SFCC 3VYIA 3B5NC 4M3LA 1LTJB 2FKWB 1DX7A 1LWUA 2WPRA 2YO3A 1HJBA 1KQLA 3G3ZA 2GM4A 4WY4D 3TNUB 3RL0B 2N1TA 1KFMA 3BASA 1MV8A 3P32A 1H8AA 2KYVA 2XDJA 3BRTB 3M0DA 2O01H 2WSCH 1KILA 1N7SA 1RF1A 3VMZA 4Y99B 1HUCA 1XTCC 3RL0C 5CCGD 1EQ7A 2NPSD 2R32A 1WT6A 3HD7B 4LC1A 2OYHC 1URQB 1NHLA 2I1KA 3RK3B 1L4AB 1IFNA 2Q9IA 1VPCA 5APSA 1J1EC 1GU4A 1ZLLA 3HD7C 4W80A 2VRSA 1SLQA 1URQC 4JYCA 1S9KE 3BVHA 1IFIA 2H7HA 1L4AC 1AQ5A 3TK1A 1HTLC 4W7ZA 3VOPA 3CI9A 3NXSA 1CZQA 3B8EB 1N7LA 1M7LA 1T8ZA 4JF7A 1CI6B 1JOCA 3P8MC 2IX7C 2IFNA 1NAFA 3A7OA 1FJPA 3MGNA 3H6PA 3C9IA 4WY4B 2A45G 5CCGA 1HGVA 4GIFA 3OJAB 3VN0A 2OYIA 3HTKA 5CJ0A 3P7KA 1PFIA 2JEEA 1GL2D 3GHGB 3L36A 1ZR4A 3M9QA 4C7NB 4XE5B 4I2LC 1SQXK 1JTHA 3B5ND 2NPSB 3PP5A 5BU8B 2P2UA 2Z4EA 1IO4A 5APUA 2WWWA 1IFJA 2LKMA 1M1JB 3HUSC 4KHXA 3GHGC 1NO4A 1LTBC 3M91A 2N1TD 2Z5IA 3LIEA 2J58A 3VTPC 1JMMA 4EIJA 1AFOA 2IFMA 2PP6A 5CMZA 3VMYA 2FYZA 2XKMA 2Q5UA 1LTAC 3UIAA 2MJZA 1N73A 1NTMK 2ZXEB 1G2CA 3U1CA 2KSJA 1MFZA 2R5BA 1LTTC 1RE4A 3RK2D 1HVVA 1GL2A 1LT9B 3T97A 4ZKUA 1SQVK 2HYNA 1JY2O 5AW4B 4EOTA 1IK9A 2WPQA 3B5NA 1LTSC 1RE3A 3A5TA 3OAKA 4C7RA 4OH8B 1OXZA 1FZCB 1GK4A 2YKQA 3SWYA 1S9KD 2A45I 5AVTB 3U59A 4GKGA 2WT7A 2HODA 3MIWA 5AW0B 1FZCC 3R2PA 5APXA 3LW5H 2Q3IA 1LTJC 3IR9A 3TNUA 1FZGA 4HH2A 3LIDA 1CSBA 1L0LK 3HE4A 2OYHA 5AW6B 2P1JA 1NKNA 2JJLA 2N1TB 2GUVA 1G1JA 1GW4A 2W6BA 3A3YB 1HH0A 4DOJA 1L0NK 1KILB 1N7SB 3HD7A 1LTGC 1FBMA 1JY3O 1NOHA 4Y99C 4ZKPA 1RF1B 3M9BA 1L4AA 1SP4A 3CL3D 1XTGB 3A2AA 1ZR2A 2QM8A 1GTWA 1JO5A 4I6MC 1DEBA 5AW8B 1OWAA 3NTNA 1LGHB 1G1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQV K;  1L0L K;  2FYU K;  1NTZ K;  1NTK K;  2OAR A;  2J59 M;  3M9Q A;  5KLV K;  3CLQ A;  1NU1 K;  1SQB K;  1SQX K;  2WSF H;  3G3Z A;  1L0N K;  2LKM A;  1NTM K;  1SQP K;  3LW5 H;  4IFD K;  2O01 H;  1SQQ K;  2WSC H;  2WSE H; 
#chains in the Genus database with same CATH topology
 2IZ0 A;  1KC8 Q;  2FYN C;  3L72 G;  2KSE A;  1SQB K;  1YJN P;  1SQP J;  3R4Y A;  2IBZ D;  2BAS A;  1EC5 A;  3CCJ P;  4EI2 A;  1NTZ J;  1QGK B;  2FFD C;  1NTK J;  3C8V A;  1KV4 A;  4IL6 H;  3HUS A;  3NMD A;  1SQQ G;  1OMI A;  5BU5 A;  4WWI A;  2KNC B;  1USD A;  1N86 A;  3L74 E;  3WUV A;  1PP9 G;  2E74 D;  1FZE A;  1OW8 A;  1JTH B;  2K9J B;  3N4X A;  4PD4 I;  3KYQ A;  2OAR A;  2R44 A;  1GMJ A;  3F5H A;  2W6J H;  2WSE J;  3ZDM A;  1EZV D;  3I5C A;  2HLO A;  1KB9 I;  3KQG A;  3HE5 B;  1S5L X;  3HD7 D;  2FXM A;  1FOS E;  3BCC E;  1LP1 A;  3L72 D;  4B86 A;  3K5B A;  4TLF A;  1KN7 A;  1NU1 G;  5KKZ C;  2Y9Y A;  1SQP E;  2A45 H;  2RKL A;  4H13 C;  3WU2 E;  1NTZ E;  3A0H H;  5GTI H;  1N2D C;  1EDL A;  1YTZ T;  5CHX A;  1FZA A;  1YI2 P;  1VQN P;  1SQQ D;  1AA0 A;  4OGQ C;  1KIL E;  2WMM A;  4IFD K;  2E43 A;  1PP9 D;  2Q3E A;  1IFD A;  2KI7 B;  1RF1 C;  4WVZ A;  5KLV K;  4JYB A;  1ZV8 A;  3EFG A;  2FFD A;  1FJK A;  2KS1 B;  1RY3 A;  4RKU J;  3L35 A;  3QH9 A;  1YTZ I;  5H2F H;  3EWK A;  2A06 D;  3AE2 C;  3L73 E;  2W6A A;  2G3A A;  4C7N A;  2HFE D;  3AE7 C;  4GT1 A;  4H13 D;  1FOS F;  2R3S A;  3H1J D;  4XFJ A;  3MZW B;  2ZYA A;  1IC2 A;  2UWJ E;  1S4X A;  2P67 A;  3H1K D;  3A0B E;  5B66 H;  1BCC J;  1JMB A;  4EDF A;  1DD3 A;  4U3F E;  3H25 A;  3H32 B;  3Q5S A;  2CPS A;  2K88 A;  4NPE A;  3CLQ A;  2QA4 P;  1VQK P;  4BRY A;  2BCC E;  3T97 B;  1J1D C;  2QJY B;  1SFC B;  3V5B A;  4WB4 A;  2KOG A;  5AVY B;  1NKZ B;  2WPS A;  3V2P A;  1SQP G;  1BSH A;  2B87 B;  3VYI A;  3D71 A;  2O01 J;  5KAI H;  1DX7 A;  3RL0 g;  4WY4 D;  3TNU B;  1NTZ G;  1SQV D;  1FE6 A;  1KFM A;  3BRT B;  1BSN A;  4I7Z B;  1AV1 A;  3AEC C;  1RF1 A;  1NJI Q;  1HUC A;  3RL0 C;  2NPS D;  1L4A B;  3H1I D;  4Z1M H;  2Y0D A;  5GTH E;  5APS A;  1E79 H;  1L0L D;  1J1E C;  1BDD A;  2KXP B;  3JC2 2;  2QJK B;  2K1A A;  1IFI A;  2B89 A;  1KQF B;  3SFE C;  3OW2 O;  1JEK A;  1HTL C;  4GOF A;  4ZNC A;  3CCV P;  1Q86 Q;  3WUT A;  1N7L A;  1M7L A;  4H44 D;  1CI6 B;  1Q90 D;  3TF5 A;  2IX7 C;  3A7O A;  3PRJ A;  3H6P A;  3PH0 A;  1JB0 J;  4WY4 B;  2FXO A;  3FXD A;  4D6T J;  3G6E P;  3VN0 A;  3CXH H;  3L73 G;  1SQX J;  3GHG B;  3L36 A;  3M9Q A;  1SQP D;  4L75 A;  3WUU A;  4XE5 B;  4I2L C;  5TIS E;  2H89 C;  2NPS B;  5BU8 B;  4IL6 X;  2Z4E A;  1AVY A;  4IOI H;  1VQ8 P;  1NTZ D;  1NO4 A;  1NTK D;  1LTB C;  3M91 A;  2N1T D;  3VTP C;  2BEQ D;  4EIJ A;  5CMZ A;  4U3F G;  1ZRT E;  3O6Q B;  1LTA C;  1VF5 C;  3Q2Y A;  4PD4 D;  1NTM K;  5L8R J;  3U1C A;  1AVO A;  1RE4 A;  3MHV A;  3AE6 C;  3GF3 A;  3S1K A;  2ZXX A;  1VQ6 P;  2BCC G;  1EDK A;  2OTL P;  2JO1 A;  2O01 N;  1S9K D;  2A45 I;  2WT7 A;  3AEB C;  2NZ2 A;  5AW0 B;  3R2P A;  5APX A;  2FXP A;  2K37 A;  1R8E A;  3LID A;  3CD6 P;  3GMA A;  5CBN A;  2N1T B;  1QX8 A;  1KD1 Q;  3A3Y B;  5C39 A;  1H0T B;  1L0N K;  1KIL B;  1N7S B;  4Y99 C;  4CPG A;  4ZKP A;  3H1H J;  3M9B A;  4U7J A;  1PGJ A;  3AE3 C;  3A2A A;  1DEB A;  3NTN A;  2H88 C;  3RK3 C;  4RES B;  3EFF K;  3MD0 A;  1MZ9 A;  3PLN A;  1SQB J;  1BCC G;  5CJ4 A;  1HGZ A;  2QM7 A;  3RBZ A;  3L71 J;  1W5C E;  1BE3 J;  5AVR B;  4H0L D;  2WIT A;  1QL1 A;  2M3E A;  2RMZ A;  2Y0C A;  3FWN A;  4BWN A;  2M8R A;  2KZJ A;  3V4W A;  2XV5 A;  2E76 B;  1ZOY C;  1GK6 A;  2CPB A;  2HG5 D;  2OYI B;  3HTK B;  5KJ7 C;  4DT0 A;  1X9V A;  4A7P A;  5DJT B;  5EFW B;  2ZT9 C;  3L4F A;  1M1K Q;  2B9B A;  1VDF A;  1GD2 E;  1EDI A;  2YNY A;  4KT0 J;  3CCS P;  3C1L A;  3V2Q A;  1M90 Q;  2A06 E;  3JCU E;  1VQ5 P;  1URQ D;  1YYC A;  1P84 H;  4PV1 D;  3USS A;  1OIP A;  3II6 A;  1PIX A;  2WQY C;  2YMK A;  4LLH A;  1BCC D;  1K9M Q;  3H1J E;  1MUU A;  1GL2 B;  1LT9 C;  2WSF H;  3KZI E;  1JCC A;  3CCQ P;  3H1I J;  3KXD A;  2IYP A;  3H1K E;  3E1I A;  3L71 E;  2AXT E;  2IPP A;  3CWB J;  3IAO A;  2OYO A;  1NVO A;  2KIK A;  4O9B A;  2XNX A;  4K3A A;  3CC4 P;  4N78 D;  5AW3 B;  3CX5 I;  5AW9 B;  2JR8 A;  1URQ A;  3HE4 B;  5KJ7 D;  3V2R A;  5AVV B;  1QEX A;  5KLV J;  1X79 B;  3CMA P;  3PJS K;  3RK2 B;  2ZT9 D;  4Y28 J;  1KZU B;  4PJ0 E;  1KYO E;  2ZVO B;  2M5A B;  1JY2 N;  5K5G B;  3L37 A;  2G8Y A;  2Q7C A;  1T3U A;  3VP8 A;  4DZO A;  4HJG H;  5E79 E;  2V7Q H;  2M0B A;  1NU1 K;  4UB6 H;  2CK3 H;  1LT1 A;  2WPV B;  1SQV E;  2R3C A;  1ZN5 A;  1ZRT D;  1CW5 A;  2MKV A;  1JUN A;  2D2C D;  1WRG A;  4UB8 E;  5KJ7 A;  2LXB A;  2ITA A;  1JY3 N;  3H1I E;  3CXH I;  1VQ4 P;  3HUS B;  4GOD A;  1L0L E;  1FU1 A;  3I56 P;  1JY2 P;  2XZR A;  2YMY A;  4L74 A;  4D6T D;  1Y47 A;  2L5G B;  2Z5H A;  3BRV B;  2E42 A;  3OA7 A;  1ZME C;  3FWL A;  1SQX D;  1U7J A;  3VMA A;  2FYU K;  5AW5 B;  2N9B A;  3HE5 A;  2ZYD A;  1LT9 A;  2E5Y A;  2A06 G;  5APW A;  4R4L A;  1T6A A;  1LP1 B;  1T3J A;  1PZQ A;  1JY3 P;  1FZF A;  1N73 C;  1SVF A;  4K35 A;  1DEE G;  3P8C E;  1RQU A;  3H1J G;  2KP8 A;  4IFF A;  2O3J A;  5APT A;  1QLE D;  1NTK E;  1BDC A;  3L75 J;  1A02 J;  1SFC C;  3H1K G;  3B5N C;  2E74 B;  4M3L A;  2WPR A;  2K3R A;  1KQL A;  3L71 G;  1HJB A;  4RJT A;  1OFC X;  3IF4 A;  5B5E H;  5KLI B;  5KAF E;  1MV8 A;  1H8A A;  1HJ0 A;  2QG4 A;  2P58 A;  2WSC H;  4PD4 E;  1XTC C;  1Q81 Q;  3HD7 B;  1RH5 B;  2OYH C;  1BGY J;  4I7Z C;  2AXC A;  3AE5 C;  1VPC A;  1OVR A;  1KB9 E;  1GU4 A;  2OTJ P;  1ZLL A;  1SLQ A;  1S9K E;  3BVH A;  1AQ5 A;  1L4A C;  2QSI A;  3TGU J;  3CI9 A;  4EYY Q;  3NXS A;  3JCU H;  2QJK C;  1T8Z A;  2L91 A;  3H1H D;  1JOC A;  3P8M C;  1SQV G;  1NAF A;  4L76 A;  1HGV A;  3OJA B;  1SQB D;  5CJ0 A;  3P7K A;  3JSV C;  4C7N B;  3H1I G;  3G71 P;  3B5N D;  3PP5 A;  2P2U A;  2E5T A;  3L71 D;  1L0L G;  1BE3 D;  3GHG C;  4OGQ D;  2AEM A;  1ZW0 A;  2E75 C;  4YXW H;  3D6Z A;  2J58 A;  1NYH A;  3VMY A;  1NTM J;  2FYZ A;  2Q5U A;  4PJ0 H;  1BGY E;  1N73 A;  2ZXE B;  1G2C A;  3Q5P A;  1KYO D;  1P84 I;  5KKZ B;  3T97 A;  2HYN A;  5AW4 B;  5E79 H;  4EOT A;  4BRY B;  3B5N A;  3FX0 A;  3A5T A;  3OAK A;  4C7R A;  4H13 B;  1FZC B;  2ZYG A;  2Q6Q A;  3TGU E;  2HOD A;  1NTK G;  3LW5 H;  2Q3I A;  1LTJ C;  3TNU A;  1FZG A;  3GLM A;  3AEF C;  1CSB A;  4OGQ B;  1K05 A;  3ABV C;  4DCK A;  2OYH A;  2P1J A;  1ZP0 C;  3V6I A;  3CCR P;  3CC7 P;  1ZXG A;  1L0N J;  1GW4 A;  3RK3 E;  1RF1 B;  1FC2 C;  1L4A A;  1BCC E;  1ZR2 A;  3CWB D;  1PL5 A;  2KK7 A;  1YBK A;  1GZL A;  3CX5 D;  2E75 D;  2IBZ I;  1KIL C;  2H8P D;  1RF0 C;  2V7Q J;  1A02 F;  3V2N A;  5AVW B;  1JCD A;  1NH4 A;  3ITK A;  2RH0 A;  1KQS O;  5KTB A;  1FDM A;  4GDO A;  1CI6 A;  4N78 E;  5KLV D;  4ASV A;  4NPF X;  1W2E A;  3MUD C;  3WU2 H;  2I8D A;  2ZFC A;  2FY8 A;  2RN0 A;  1QL2 A;  3GHG A;  3M06 A;  3H1L J;  1FS0 E;  3P8C D;  3CCE P;  1X22 A;  2Y0E A;  5CCH C;  2I1J A;  2HPC A;  1NWQ A;  5CBO A;  1EZV I;  1M1J C;  2YIU B;  2OYI C;  4PD4 H;  3RL0 D;  3CXH D;  1RQV A;  3CCM P;  3WMM 0;  2POH A;  4GOE A;  3KPE A;  4H44 B;  4JBZ A;  1Q2N A;  2WSE H;  4WBA A;  2YO2 A;  1BGY G;  1J1D B;  1PGQ A;  2OTK E;  2KUB A;  3E7K A;  5APQ A;  1T2K C;  1KB9 D;  1DIP A;  2C0X A;  2NRG A;  1QVG O;  1H89 A;  4TT3 H;  2LR2 A;  1LTJ A;  1M56 D;  3TGU G;  3HRN A;  1GL2 C;  1IJD B;  1LWU B;  4D6T E;  4BXL A;  3EQ2 A;  1RE3 C;  1USE A;  2WSC J;  1SQX E;  4AYC A;  1JNM A;  2C9N Y;  1GDT A;  3A0B H;  3SWF A;  1H0T A;  4HB1 A;  3M0A A;  3RBX A;  2ZJS E;  4HYT B;  5CCH D;  1RF0 A;  3L75 D;  1J1E B;  2DW3 A;  2YKP A;  3TDK A;  1DH3 A;  1X0T A;  2M3B A;  1VF5 D;  3RK2 C;  3E1R A;  1NU1 J;  1E5W A;  1H88 A;  2J5U A;  3GG2 A;  3W68 A;  3AE1 C;  3MUD A;  2QJP B;  1BGY D;  1S1C X;  2J59 M;  3D70 A;  3SWK A;  4ZMD A;  1T2K D;  1NAY A;  2JDI H;  1LTI C;  5CCH A;  3A0H E;  5GTI E;  3B4S A;  1UIX A;  1M1J A;  3TGU D;  5CCG C;  3Q3D A;  2PRR A;  1K73 Q;  2OQQ A;  2W8Z A;  3S4R A;  2XU6 A;  1FZB A;  5AW7 B;  2FYU J;  5GTH H;  3H1H E;  1VF5 B;  3RK3 D;  4H0L B;  3BAT A;  2AEJ A;  5AVX B;  1SQB E;  3I55 P;  4AQR D;  4N6J A;  3B71 A;  2H43 A;  1SQQ K;  3N7N A;  2B88 A;  5H2F E;  1BE3 E;  1NTM D;  2FKW B;  3G3Z A;  2JP3 A;  3L74 J;  4D6T G;  5TIS H;  2KYV A;  2E74 C;  1Y9B A;  2O01 H;  1SQX G;  1YQ4 C;  3SSU A;  3VMZ A;  4Y99 B;  5KLI C;  5CCG D;  2R32 A;  1WT6 A;  4LC1 A;  1URQ B;  1NHL A;  3RK3 B;  1IFN A;  4PV1 B;  1PPJ D;  2YXQ B;  3HD7 C;  4W80 A;  1R5S A;  3BCC J;  2H7H A;  2FYU E;  1L0N D;  1JM0 A;  2W90 A;  4QMA A;  3B8E B;  3L70 D;  4JF7 A;  2IFN A;  3KHU A;  1FJP A;  5M1B A;  3MGN A;  5CCG A;  2A45 G;  1EXJ A;  2QRX A;  3Q5R A;  2KNC A;  5KAI E;  1SS1 A;  2JEE A;  3CWB E;  1Q82 Q;  1JTH A;  3CX5 E;  2K9J A;  1IO4 A;  1YQ3 C;  2ZT9 B;  5APU A;  1IFJ A;  4OWF A;  2WVR A;  1VQ7 P;  2XND H;  5KLV E;  2IFM A;  1AFO A;  3H1L D;  3IN6 A;  3H1H G;  2MJZ A;  2PGD A;  2D2C B;  1KOR A;  1SQB G;  1LT9 B;  1SQV K;  2GA1 A;  3Q1M A;  2WPQ A;  2JKV A;  4OH8 B;  3G4S P;  1OXZ A;  2QJY C;  3L73 J;  2YKQ A;  1S2E A;  1OW7 A;  3U59 A;  2IZ1 A;  4GKG A;  1BE3 G;  3AE4 C;  3CXH E;  1FDI A;  1FZC C;  2KZI A;  3W67 A;  4HH2 A;  1L0L K;  2GUV A;  1G1J A;  1S5L E;  1OZH A;  4YPC A;  3QWO C;  1LTG C;  3HD7 A;  4U3F J;  2FYN B;  1SP4 A;  1XTG B;  2N9Y B;  4I6M C;  5AW8 B;  1LGH B;  5TJH A;  2YXR B;  2KS1 A;  2BCC J;  2FFD B;  3TYY A;  4YTP C;  4HKZ H;  2FYU G;  1Y8A A;  1K8A Q;  1SQP K;  1PGP A;  3GW6 A;  3KZI H;  2WSS H;  1KTM A;  1OVV A;  1NTZ K;  1NTK K;  1EDJ A;  2AXT H;  1D7M A;  4WY4 C;  1SFC D;  3KDP B;  3L75 E;  3CC2 P;  1NU1 D;  4MN4 C;  2QE7 H;  3CWB G;  2NPS C;  3U1A A;  1RHZ B;  1VQL P;  3L74 G;  3H32 A;  4IFM A;  3D6Y A;  3V4Q A;  1KYO H;  2YIU C;  3SFD C;  5KLV G;  1YHQ P;  2GUS A;  2WSF J;  5AVU B;  2C9L Y;  3NFQ A;  1AJY A;  1L4A D;  1WMK A;  2O1K A;  1SFC A;  1N73 B;  2PAJ A;  3AE8 C;  4H44 C;  1G2C B;  1W2B O;  1IK7 A;  4KJM A;  1OVU A;  3BCC G;  1FZC A;  2B87 A;  1J2J B;  2ZVN B;  2FYU D;  3B5N B;  2R5D A;  2JWD A;  4UB8 H;  1RE4 C;  2O1J A;  2KB7 P;  2AEF A;  4I1L A;  2HOD B;  1Z56 A;  5AVS B;  4OVN F;  1LWU C;  1VQM P;  3L70 J;  3CX5 H;  2OYH B;  3PTZ A;  2N1T C;  1TU3 F;  1KFN A;  5AVQ B;  2P10 A;  2FBW C;  3M0D C;  1N7S C;  1N8R Q;  2Q1K A;  4N3Y B;  1IFM A;  3VP9 A;  3L74 D;  3CCU P;  1QVF O;  4NPD A;  1NTM E;  1U7M A;  4R4M A;  4W7Y A;  1P84 E;  5APV A;  3VMX A;  4AUW A;  4XA4 A;  2W27 A;  5BVZ A;  2QEX P;  3CCL P;  4WY4 A;  3FXE A;  1X8Y A;  1KQG B;  1EXI A;  5AW1 B;  4ASW A;  4JQ0 D;  3RGU A;  3BCC D;  2C0W A;  2QJP C;  1GU5 A;  2NPS A;  1PPJ E;  1HWT C;  1M8O B;  1PV3 A;  2E76 C;  3L75 G;  5KAF H;  3AE9 C;  3AEA C;  2P7J A;  3O8Z A;  2E75 B;  2W83 C;  2WTY A;  1IZN B;  3L72 J;  2HPC B;  1L0N E;  2WZ7 A;  3IFM A;  4C46 A;  1S5L H;  2PFX A;  5AW2 B;  4JPZ B;  3O6Q A;  2IBZ E;  3L70 E;  3G9R A;  1KB9 H;  5AVZ B;  4YXD C;  3MTU E;  5DJU B;  1KIL D;  1N7S D;  2KLV A;  5APY A;  4LGD E;  1U57 A;  1YIT P;  1FAV A;  3M9H A;  4UB6 E;  1SQQ J;  4H0L C;  3MP7 B;  3TSI A;  2Y9Z A;  4IL6 E;  1HBW A;  2QVA A;  1VQP P;  2YKO A;  1GW3 A;  2WT7 B;  1PP9 J;  1LTJ B;  1LWU A;  2YO3 A;  2GM4 A;  3RL0 B;  2N1T A;  3BAS A;  3P32 A;  3H1L E;  2XDJ A;  3M0D A;  1VQ9 P;  1EZV E;  1KIL A;  1N7S A;  1Q7Y Q;  1YJ9 P;  1PGO A;  3L73 D;  2E76 D;  1EQ7 A;  1LNQ A;  1S3J A;  2I1K A;  2K9Y A;  1VL2 A;  2Q9I A;  3FGA D;  3CPW O;  3L72 E;  2VRS A;  3PHL A;  1IFP A;  1URQ C;  4JYC A;  3TK1 A;  1AQT A;  4PV1 C;  4W7Z A;  1MKM A;  1NTM G;  3VOP A;  3H1J J;  1R5L A;  1CZQ A;  4U3F D;  4DJG A;  3H1K J;  2IYO A;  1FDO A;  3F89 A;  3C9I A;  3CME P;  2JWA A;  1SQQ E;  4GIF A;  1M57 D;  2OYI A;  3HTK A;  1YIJ P;  2BCC D;  1PFI A;  1GL2 D;  1L2P A;  2KLU A;  5B5E E;  1ZR4 A;  1SQX K;  1PP9 E;  2V4H A;  2WWW A;  1PPJ G;  2LKM A;  1M1J B;  3HUS C;  4KHX A;  1S72 P;  3AED C;  3AEG C;  2Z5I A;  3LIE A;  1L0N G;  2LXC B;  1HF9 A;  1JMM A;  3S9O A;  2HR3 A;  1UII A;  2PP6 A;  2ZAE B;  2XKM A;  1KYO I;  2IBZ G;  4L73 A;  3L70 G;  3UIA A;  2IDB A;  4RO0 A;  1LJ2 A;  1KMI Z;  1OX3 A;  1K04 A;  2KSJ A;  1MFZ A;  2R5B A;  1SQV J;  3GF7 A;  1LTT C;  3RK2 D;  1HVV A;  1GL2 A;  1NU1 E;  2SPZ A;  4ZKU A;  1JY2 O;  1IK9 A;  1LTS C;  1RE3 A;  1OW6 A;  2D2C C;  3LW5 J;  1GK4 A;  1YJW P;  1DD4 A;  3SWY A;  1P84 D;  2BEZ F;  5AVT B;  3MIW A;  2QIW A;  1L0L J;  3AEE C;  3IR9 A;  1VQO P;  3HE4 A;  1MFT A;  5AW6 B;  5B66 E;  1NKN A;  2JJL A;  2OGU A;  3H1L G;  2W6B A;  1EZV G;  1NGM B;  1HH0 A;  4DOJ A;  1FBM A;  1JY3 O;  1NOH A;  2M5A A;  3CL3 D;  2QM8 A;  1GTW A;  1JO5 A;  1OWA A;  1G1I A; 
#chains in the Genus database with same CATH homology
 1GZL A;  3MD0 A;  1MZ9 A;  1KIL C;  2H8P D;  1RF0 C;  1SQB K;  5CJ4 A;  1A02 F;  1HGZ A;  2FFD B;  3TYY A;  3V2N A;  2QM7 A;  5AVW B;  1JCD A;  2BAS A;  1NH4 A;  1SQP K;  5KTB A;  1FDM A;  1CI6 A;  5AVR B;  4N78 E;  2FFD C;  2WIT A;  1QL1 A;  1NTZ K;  1NTK K;  2M8R A;  1W2E A;  3V4W A;  2XV5 A;  3HUS A;  4WY4 C;  2ZFC A;  3NMD A;  1SFC D;  3KDP B;  1QL2 A;  3GHG A;  3M06 A;  3P8C D;  1GK6 A;  5BU5 A;  2CPB A;  2HG5 D;  2OYI B;  3HTK B;  5KJ7 C;  1N86 A;  5CCH C;  2I1J A;  1X9V A;  2HPC A;  1NWQ A;  1FZE A;  2NPS C;  1JTH B;  3N4X A;  3U1A A;  1M1J C;  3L4F A;  3KYQ A;  2OAR A;  2OYI C;  3RL0 D;  1VDF A;  1GD2 E;  2YNY A;  3H32 A;  4IFM A;  3WMM 0;  2POH A;  3V4Q A;  3I5C A;  2HLO A;  3KPE A;  3V2Q A;  3KQG A;  2GUS A;  3HE5 B;  3HD7 D;  2FXM A;  2WSE H;  5AVU B;  2C9L Y;  1URQ D;  4WBA A;  2YO2 A;  3NFQ A;  1L4A D;  1YYC A;  1FOS E;  1J1D B;  2O1K A;  1SFC A;  1N73 B;  2PAJ A;  5APQ A;  3II6 A;  1T2K C;  4LLH A;  1G2C B;  2C0X A;  4B86 A;  1MUU A;  1GL2 B;  1LT9 C;  2WSF H;  1H89 A;  1FZC A;  1J2J B;  1JCC A;  2A45 H;  1LTJ A;  3B5N B;  2R5D A;  3E1I A;  1RE4 C;  2O1J A;  2IPP A;  3HRN A;  1GL2 C;  2KB7 P;  1IJD B;  1LWU B;  1N2D C;  1YTZ T;  4O9B A;  4I1L A;  5CHX A;  3RK3 C;  3EQ2 A;  2HOD B;  1FZA A;  1RE3 C;  2XNX A;  4N78 D;  1Z56 A;  5AW3 B;  4AYC A;  1JNM A;  5AVS B;  2C9N Y;  1GDT A;  5AW9 B;  1LWU C;  1URQ A;  3HE4 B;  2OYH B;  3SWF A;  5KJ7 D;  2N1T C;  3M0A A;  3V2R A;  5AVV B;  4IFD K;  1KFN A;  5AVQ B;  4HYT B;  5CCH D;  1RF0 A;  2E43 A;  3M0D C;  1X79 B;  1J1E B;  1IFD A;  1N7S C;  3RK2 B;  1RF1 C;  1KZU B;  5KLV K;  4JYB A;  4N3Y B;  1JY2 N;  1IFM A;  2YKP A;  3VP9 A;  1ZV8 A;  3L37 A;  2Q7C A;  1DH3 A;  1T3U A;  3VP8 A;  3EFG A;  2M3B A;  4DZO A;  3RK2 C;  1E5W A;  4W7Y A;  5APV A;  2FFD A;  1FJK A;  3VMX A;  1H88 A;  4AUW A;  4XA4 A;  2W27 A;  1NU1 K;  2R3C A;  1ZN5 A;  3MUD A;  5BVZ A;  1CW5 A;  2J59 M;  4WY4 A;  1RY3 A;  1X8Y A;  1JUN A;  3L35 A;  5AW1 B;  1YTZ I;  1T2K D;  1WRG A;  5KJ7 A;  1LTI C;  5CCH A;  2W6A A;  4C7N A;  2C0W A;  2HFE D;  1GU5 A;  2NPS A;  1JY3 N;  4GT1 A;  1M1J A;  3HUS B;  1FOS F;  1HWT C;  5CCG C;  1FU1 A;  2P7J A;  1JY2 P;  1IC2 A;  2XZR A;  3O8Z A;  2P67 A;  2YMY A;  2WTY A;  2XU6 A;  2HPC B;  2WZ7 A;  3IFM A;  4C46 A;  1FZB A;  5AW2 B;  2L5G B;  2Z5H A;  5AW7 B;  3BRV B;  2E42 A;  3OA7 A;  5AVZ B;  3H32 B;  2FYU K;  3RK3 D;  5AW5 B;  2N9B A;  3MTU E;  4RES B;  3HE5 A;  1KIL D;  1N7S D;  2KLV A;  2CPS A;  3BAT A;  3CLQ A;  5APY A;  1LT9 A;  5AVX B;  4LGD E;  1FAV A;  3M9H A;  4AQR D;  4N6J A;  5APW A;  1J1D C;  2H43 A;  1T3J A;  1JY3 P;  1SFC B;  3V5B A;  1FZF A;  1SVF A;  3TSI A;  1N73 C;  4WB4 A;  2KOG A;  3P8C E;  1SQQ K;  1HBW A;  3N7N A;  5AVY B;  2KP8 A;  1NKZ B;  4IFF A;  2WPS A;  3V2P A;  2YKO A;  5APT A;  1GW3 A;  2WT7 B;  1A02 J;  1SFC C;  3VYI A;  3B5N C;  4M3L A;  1LTJ B;  2FKW B;  1DX7 A;  1LWU A;  2WPR A;  2YO3 A;  1HJB A;  1KQL A;  3G3Z A;  2GM4 A;  4WY4 D;  3TNU B;  3RL0 B;  2N1T A;  1KFM A;  3BAS A;  1MV8 A;  3P32 A;  1H8A A;  2KYV A;  2XDJ A;  3BRT B;  3M0D A;  2O01 H;  2WSC H;  1KIL A;  1N7S A;  1RF1 A;  3VMZ A;  4Y99 B;  1HUC A;  1XTC C;  3RL0 C;  5CCG D;  1EQ7 A;  2NPS D;  2R32 A;  1WT6 A;  3HD7 B;  4LC1 A;  2OYH C;  1URQ B;  1NHL A;  2I1K A;  3RK3 B;  1L4A B;  1IFN A;  2Q9I A;  1VPC A;  5APS A;  1J1E C;  1GU4 A;  1ZLL A;  3HD7 C;  4W80 A;  2VRS A;  1SLQ A;  1URQ C;  4JYC A;  1S9K E;  3BVH A;  1IFI A;  2H7H A;  1L4A C;  1AQ5 A;  3TK1 A;  1HTL C;  4W7Z A;  3VOP A;  3CI9 A;  3NXS A;  1CZQ A;  3B8E B;  1N7L A;  1M7L A;  1T8Z A;  4JF7 A;  1CI6 B;  1JOC A;  3P8M C;  2IX7 C;  2IFN A;  1NAF A;  3A7O A;  1FJP A;  3MGN A;  3H6P A;  3C9I A;  4WY4 B;  2A45 G;  5CCG A;  1HGV A;  4GIF A;  3OJA B;  3VN0 A;  2OYI A;  3HTK A;  5CJ0 A;  3P7K A;  1PFI A;  2JEE A;  1GL2 D;  3GHG B;  3L36 A;  1ZR4 A;  3M9Q A;  4C7N B;  4XE5 B;  4I2L C;  1SQX K;  1JTH A;  3B5N D;  2NPS B;  3PP5 A;  5BU8 B;  2P2U A;  2Z4E A;  1IO4 A;  5APU A;  2WWW A;  1IFJ A;  2LKM A;  1M1J B;  3HUS C;  4KHX A;  3GHG C;  1NO4 A;  1LTB C;  3M91 A;  2N1T D;  2Z5I A;  3LIE A;  2J58 A;  3VTP C;  1JMM A;  4EIJ A;  1AFO A;  2IFM A;  2PP6 A;  5CMZ A;  3VMY A;  2FYZ A;  2XKM A;  2Q5U A;  1LTA C;  3UIA A;  2MJZ A;  1N73 A;  1NTM K;  2ZXE B;  1G2C A;  3U1C A;  2KSJ A;  1MFZ A;  2R5B A;  1LTT C;  1RE4 A;  3RK2 D;  1HVV A;  1GL2 A;  1LT9 B;  3T97 A;  4ZKU A;  1SQV K;  2HYN A;  1JY2 O;  5AW4 B;  4EOT A;  1IK9 A;  2WPQ A;  3B5N A;  1LTS C;  1RE3 A;  3A5T A;  3OAK A;  4C7R A;  4OH8 B;  1OXZ A;  1FZC B;  1GK4 A;  2YKQ A;  3SWY A;  1S9K D;  2A45 I;  5AVT B;  3U59 A;  4GKG A;  2WT7 A;  2HOD A;  3MIW A;  5AW0 B;  1FZC C;  3R2P A;  5APX A;  3LW5 H;  2Q3I A;  1LTJ C;  3IR9 A;  3TNU A;  1FZG A;  4HH2 A;  3LID A;  1CSB A;  1L0L K;  3HE4 A;  2OYH A;  5AW6 B;  2P1J A;  1NKN A;  2JJL A;  2N1T B;  2GUV A;  1G1J A;  1GW4 A;  2W6B A;  3A3Y B;  1HH0 A;  4DOJ A;  1L0N K;  1KIL B;  1N7S B;  3HD7 A;  1LTG C;  1FBM A;  1JY3 O;  1NOH A;  4Y99 C;  4ZKP A;  1RF1 B;  3M9B A;  1L4A A;  1SP4 A;  3CL3 D;  1XTG B;  3A2A A;  1ZR2 A;  2QM8 A;  1GTW A;  1JO5 A;  4I6M C;  1DEB A;  5AW8 B;  1OWA A;  3NTN A;  1LGH B;  1G1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...