1NTKK

Crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
53
structure length
53
Chain Sequence
b'MLTRFLGPRYRQLARNWVPTAQLWGAVGAVGLVWATDWRLILDWVPYINGKFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 12
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ntkK00
1NTMK 5KLVK 1SQXK 2WSEH 1NTKK 1NU1K 3G3ZA 2WSCH 1SQQK 1L0LK 2J59M 3CLQA 2FYUK 2OARA 1SQPK 1NTZK 4IFDK 2LKMA 2WSFH 2O01H 1SQBK 3LW5H 3M9QA 1SQVK 1L0NK
chains in the Genus database with same CATH superfamily
1QEXA 3HTKA 5CJ4A 4U7JA 2YO3A 5DJUB 4AUWA 2FYNC 1JY3N 2AXTH 3LIEA 1K04A 2MJZA 3L71E 3AEAC 5AW3B 4R4MA 3T97A 3L72E 3MGNA 2GUVA 1VQ9P 2N9BA 3H1HG 1NU1D 5KAIH 1ZN5A 3LIDA 1NTZD 1LTSC 1YHQP 1KFMA 2NPSB 1FZEA 3JC22 1M1JB 2OYOA 1FOSF 4ASWA 1VQ7P 2JKVA 2QG4A 2KI7B 1RQVA 1SQXK 1KILE 4ASVA 5GTIE 2WITA 2OYIA 2FYUK 1HF9A 1AQ5A 4WY4A 3II6A 3CC7P 2W83C 1L0LE 1M57D 1K9MQ 1OW6A 2QVAA 4IL6X 3I56P 1SQXJ 4JBZA 1FOSE 2OYIC 3K5BA 2FYUJ 1KILD 5AVYB 4WY4C 2H43A 4YXDC 1RQUA 4RKUJ 1OW7A 1N86A 3CXHE 1JMMA 1EZVD 3A0BH 1ZW0A 3AEFC 4PD4I 3TF5A 1RF1A 2ZJSE 5AW2B 1M90Q 1VQ6P 3VP9A 1FC2C 3EFFK 2D2CB 4PV1C 1S5LH 2QJKB 3KHUA 2ZYGA 1A02F 3CXHD 5AVSB 2H8PD 4ZKUA 1IK9A 3H6PA 2BCCJ 3G9RA 1GK6A 1S2EA 3TGUJ 4HB1A 3PTZA 1HVVA 4C46A 1RF1C 4Y99B 2WT7A 1BCCE 2WSEH 2O3JA 2AEFA 5KTBA 2NPSD 3USSA 1Q82Q 4WWIA 1T3UA 3GLMA 4PJ0E 2FYZA 1ZRTE 4LGDE 5KJ7A 3V6IA 2W90A 3AE7C 4Y28J 1UIXA 1L0LK 1FZBA 1NVOA 2KS1A 1AFOA 3TK1A 3S9OA 2N1TD 3PJSK 1OVVA 1IO4A 2V7QJ 3AE9C 5KJ7C 4UB8E 4PD4H 4W80A 2Z5IA 3FWNA 1MZ9A 5AW6B 4C7NA 1N73B 1MFZA 1PP9J 3TYYA 1JY2O 2RH0A 3PHLA 3HD7A 1DX7A 3CL3D 1GW4A 1MFTA 3TNUA 1NOHA 3GF3A 2O1KA 3G4SP 3V2RA 1QVFO 4DCKA 2L5GB 2Z4EA 3H1KG 2OGUA 3T97B 3CPWO 5AVZB 1ZOYC 2ZT9D 2I1JA 5APSA 1JTHA 1JY2N 3HD7C 3C9IA 2D2CD 1OVUA 4HH2A 3V4WA 1SP4A 2W27A 3CCVP 1ZP0C 2PRRA 1YJ9P 3TSIA 3NXSA 1ZLLA 2KIKA 5AW8B 2POHA 1FS0E 3CCSP 1KMIZ 1KILA 2DW3A 1SQBE 2WSCJ 1SQQK 2Q9IA 1S5LX 2XKMA 4UB6H 4DJGA 1YQ3C 1OXZA 1KB9E 1SQPG 1IFIA 1BGYJ 1LTGC 1L4AB 1BSNA 2M8RA 3L75D 1L2PA 2FXPA 1KILC 1BE3D 3CWBJ 1EDLA 3M9HA 1SQQJ 1WRGA 2Y0EA 1SQBD 1HJ0A 2FFDB 2IBZD 1A02J 1GL2B 2Y9ZA 1RY3A 3NMDA 4PV1B 1X9VA 3MIWA 2E74C 2UWJE 1AVYA 1YITP 1HGZA 1HBWA 1T8ZA 2K9JB 1KZUB 2HG5D 1T2KD 3HUSB 3M0DA 3H1HJ 3M9QA 2NPSA 1RE3A 5C39A 1M1JA 3FWLA 2KSEA 1DIPA 2W8ZA 3RK2B 1NWQA 4EOTA 2G8YA 4TT3H 1FBMA 3L70G 2JR8A 3PRJA 1SQVD 3M0DC 3D6ZA 5L8RJ 2E42A 1U7JA 2NPSC 3UIAA 1Q86Q 5APYA 1SS1A 1RE3C 2BASA 3RGUA 1M1JC 1FJKA 1EDKA 3AEBC 3L73G 1USEA 5B66H 1GU5A 2WPRA 5AW4B 3HE4B 3CCQP 3CX5D 2JWDA 4WY4D 1PL5A 4HYTB 2K3RA 5AVRB 2YNYA 5BU5A 2Q3EA 3M0AA 1L4AD 3LW5J 2PGDA 3KXDA 4U3FG 2KUBA 3HD7B 3P8MC 5B5EE 1PPJG 2IYPA 2C0XA 1KQSO 4PV1D 4JF7A 1KC8Q 1VPCA 1E79H 1AJYA 3WUVA 1P84E 3AEGC 3MP7B 2I8DA 2KLVA 1Y47A 3U1AA 1YTZI 1IFJA 1EZVI 1X0TA 1DH3A 2E5YA 1GMJA 2O01H 4W7YA 2H89C 1OMIA 1W2BO 4GOEA 2D2CC 1NGMB 2FYUE 1SQPE 4NPFX 2QJKC 1DEBA 1NYHA 3Q5RA 3GG2A 3P8CE 5AVQB 4H44B 3RK2D 1FJPA 3GF7A 1P84D 2G3AA 3MTUE 1XTGB 1NO4A 4Y99C 3A2AA 1NTKG 2K9YA 3CXHI 1NHLA 4O9BA 5AVTB 1L0NJ 1SQXD 3EWKA 1K05A 1EDJA 5AW7B 2Q3IA 2FYUD 3U59A 5KJ7D 3P8CD 4RESB 3GHGB 4KHXA 1E5WA 3CWBG 3IF4A 1H0TB 2IZ1A 4JYBA 3BCCJ 1VQMP 1N73A 2E74B 5GTIH 5APUA 3O8ZA 2KZIA 2BCCE 5KAFE 2IFNA 3TGUE 3N4XA 5BU8B 2XNDH 4RJTA 1N73C 3L70E 1Y8AA 3HE5B 3H1LG 2QM8A 3FX0A 3H1KJ 1YIJP 3IR9A 4L73A 1Q2NA 1T2KC 2HODB 3HD7D 3G6EP 3H1IG 2OARA 1HGVA 3RL0g 4GIFA 1LGHB 3TGUD 3CXHH 1HWTC 3E7KA 1IC2A 3L71D 2K1AA 3OA7A 2YMKA 1PZQA 3L72D 3KDPB 3IAOA 1SQPK 3WU2H 2QIWA 4GODA 1PP9E 2PFXA 4JPZB 4QMAA 2KOGA 4EIJA 1L4AA 2XDJA 1EQ7A 4D6TJ 2WPSA 1CSBA 1JEKA 4I2LC 1SQPJ 4U3FE 4YPCA 1G1JA 2YMYA 3CI9A 1HUCA 1PPJE 2AXTE 2B9BA 2FFDA 4HJGH 1GL2A 4N78E 3CMAP 4KT0J 1L0LD 1PP9D 1L4AC 5KLVG 4PJ0H 3AEEC 5KAIE 2E74D 1KORA 2LXCB 2K9JA 1OX3A 3VMXA 2FFDC 3HUSA 5TISH 2HFED 3P7KA 1FZAA 1GL2C 1X8YA 4XA4A 1NTMG 3G3ZA 1NH4A 2KYVA 4N78D 3R4YA 1FZCA 3BATA 1KQFB 4UB8H 1NTKE 2KK7A 1WMKA 2IBZI 2Y0CA 1N7SB 3AE1C 4GT1A 5AVXB 4I7ZB 4N3YB 1FAVA 3HUSC 4IFFA 1M1KQ 2VRSA 1BGYE 1NU1J 3L74G 3EFGA 3L4FA 3L70J 1NTZJ 1FZCC 4XE5B 2J58A 2WSSH 3L36A 3B71A 3C8VA 3CWBE 1SQQE 3RK2C 4I6MC 2YIUB 4C7RA 1SQVG 1L0NG 3HE4A 1FDMA 3L73J 2LR2A 1JCCA 1BCCD 1BGYD 5EFWB 2A06G 4H13B 2FXMA 5APXA 3AE8C 5AVWB 1LT9B 3BCCG 3H1JG 1H88A 3H1LE 3MHVA 1SQQD 1ZRTD 3H1HE 1LWUB 1QL1A 1KTMA 2WSFH 3SWFA 1LT1A 2WZ7A 3CX5I 3KYQA 4OGQB 2WPVB 4BRYB 1VL2A 1JMBA 4U3FJ 1LJ2A 4TLFA 1YQ4C 3BRVB 2C9NY 1NAFA 1BDCA 2ZYDA 3VTPC 4RO0A 3NFQA 1OFCX 3WUTA 2MKVA 3L35A 1NTKK 1J1EB 3PH0A 2JJLA 1AA0A 4NPDA 1OW8A 3A5TA 1H8AA 2B87B 3IFMA 2XU6A 1PIXA 1PGQA 4OVNF 1VQ5P 1VQLP 4LLHA 1Q90D 1NTKJ 3EQ2A 1R8EA 2M3EA 2W6AA 5CCHD 3B5NB 3TDKA 2R3CA 2C9LY 2P1JA 2QE7H 4H44C 4D6TG 2KNCB 3GHGA 4K35A 3V2PA 3KZIE 1H0TA 1HJBA 2E5TA 3A3YB 3CX5H 4M3LA 1P84I 2H88C 3B8EB 4H13D 1NTME 4K3AA 1K8AQ 4Z1MH 3RBZA 1URQB 3ABVC 3GHGC 1YJNP 4YXWH 3Q2YA 5GTHE 4GKGA 1KB9D 3WUUA 3CD6P 3HE5A 2Y0DA 3VYIA 1M56D 4GDOA 2IX7C 3SWYA 4WVZA 2OTLP 2BEQD 1DEEG 4MN4C 1VQNP 2HODA 3D6YA 2YKQA 3H1LJ 1KFNA 1GW3A 1IZNB 1RE4A 2W6JH 1VQOP 1ZMEC 1FU1A 5M1BA 1FZCB 1XTCC 2R5DA 3H1IJ 1L0NE 3JSVC 3A0HE 4JQ0D 1NU1G 4AYCA 1T3JA 3RK3B 3W67A 1NTZG 2HR3A 2K37A 1EDIA 3L37A 2XZRA 2WQYC 3V5BA 1KV4A 1YBKA 3AE3C 3AE2C 3F5HA 2KXPB 3M9BA 4A7PA 1RE4C 1LTJB 5B5EH 2WSEJ 1SFCB 3BCCE 2QSIA 5CBOA 2QJPB 3MUDA 1JO5A 1OWAA 1P84H 5CCGD 3L72G 3O6QB 3VMAA 2KLUA 1PGOA 2YKPA 5KLVK 5AW9B 2IDBA 3S4RA 2ZXXA 3B5ND 2Q5UA 5K5GB 2QJYB 3G71P 3SWKA 1JOCA 3KPEA 3MUDC 3H1KE 1LNQA 4GOFA 1TU3F 1NTMK 2OTKE 5KLVJ 1EXIA 1S9KE 1IFNA 3CCMP 1DD3A 1QL2A 3CCJP 3SFEC 4DOJA 2IPPA 3RBXA 1GL2D 2R32A 3R2PA 2FBWC 1LP1B 3VMYA 1EZVG 2M0BA 3H1KD 1W2EA 2FKWB 1NTMJ 3RK3E 1N7SA 2A45I 3MZWB 2JP3A 1G2CB 1ZV8A 1CW5A 5APWA 1GTWA 2PAJA 4ZMDA 2WVRA 5KAFH 2B88A 4EDFA 3AEDC 4D6TE 1SQVK 1L0NK 4XFJA 2GM4A 2GA1A 1PFIA 3GMAA 3L74J 5CCHA 1CZQA 1N7SC 3FXEA 2ZXEB 4BWNA 3RK3D 4I7ZC 2JEEA 3U1CA 1Q7YQ 1KD1Q 1PGJA 2ITAA 1Q81Q 1ZXGA 1D7MA 3I5CA 2KZJA 1SQVJ 1SFCD 4H0LB 1RH5B 1QGKB 5CCHC 1U7MA 1QX8A 1SQPD 2YKOA 1LT9A 1CI6B 2YIUC 1X22A 1DD4A 1LWUA 2RMZA 2YO2A 3VP8A 2V4HA 3JCUE 1FZFA 3H1JJ 2V7QH 3CCLP 1GU4A 4H13C 5CJ0A 1NKNA 2E75B 3H32B 3P32A 5KLIB 1OZHA 4DZOA 1LTTC 1LT9C 4BRYA 1GD2E 2A45H 3H25A 2IFMA 1J1DB 4IL6E 3CC4P 5E79E 1LWUC 1NU1E 1LTBC 2ZAEB 1NTZE 3CCUP 4I1LA 1GZLA 5CMZA 3BRTB 1VQPP 1IFPA 3CLQA 2ZVNB 1K73Q 1YI2P 4OGQC 2BCCD 3L73E 3CC2P 1OVRA 2B89A 2QM7A 2HPCB 1KYOE 1BSHA 4W7ZA 2B87A 1NAYA 5CCGA 3L70D 3M06A 4CPGA 1SLQA 1HTLC 2E76B 5H2FE 2M5AB 1J1EC 5DJTB 2XV5A 3RL0B 3B5NA 2Y9YA 3L73D 4H44D 2KNCA 1KYOD 5CCGC 4N6JA 2N9YB 2WSCH 2WTYA 3FGAD 2RKLA 3SFDC 4H0LD 3B5NC 2N1TB 1EZVE 5KKZB 1URQA 3L75G 2ZVOB 5BVZA 2P2UA 1BE3G 2E75D 1VQ4P 4U3FD 2M3BA 1SQBG 3Q1MA 1KQGB 2W6BA 3QWOC 1PPJD 1URQC 2IBZG 1NU1K 3V2NA 2L91A 1NTZK 4IFDK 2KP8A 1JNMA 1N8RQ 1JCDA 5AVVB 2ZT9B 2IZ0A 3WU2E 3SSUA 2RN0A 3C1LA 1LTIC 1KB9I 1JY3P 1LTJA 4NPEA 1M8OB 2AEJA 2SPZA 3E1RA 1SFCA 1EXJA 1VF5B 2O01J 4BXLA 1R5SA 2P67A 4L76A 3OJAB 2CPSA 2CK3H 1NTKD 3RK3C 3O6QA 2QEXP 3L71J 2QA4P 3BVHA 2E76D 2R3SA 3L72J 3I55P 1LTJC 3RL0D 1SFCC 3ZDMA 2QJPC 3PP5A 3A0BE 1FE6A 4OWFA 3CWBD 3V4QA 5AW1B 3GW6A 1H89A 2OYHB 5TISE 4DT0A 3H1IE 3LW5H 3N7NA 2QJYC 4OH8B 1UIIA 2FYNB 1S5LE 3V2QA 1BDDA 2YXQB 2IYOA 2QRXA 1LP1A 1USDA 1NJIQ 3D70A 2ZYAA 2ZFCA 4AQRD 3NTNA 1KB9H 1L0LJ 2Q1KA 2NRGA 5APQA 3KZIH 1RHZB 3H1LD 4IOIH 1M7LA 5APVA 3H1HD 2E43A 3HTKB 2OTJP 1G2CA 3PLNA 1YJWP 1S3JA 1RF0A 3H1ID 3CCEP 1LTAC 2J59M 4B86A 2Q7CA 1FZGA 1NKZB 2LKMA 5GTHH 1N7SD 3VOPA 3AECC 4R4LA 5AW0B 2PP6A 2AXCA 1RF0C 2XNXA 2CPBA 3VN0A 3OW2O 1VQKP 1MKMA 1N7LA 1VF5D 1X79B 3CMEP 4PD4E 5KLVE 3L75E 1S72P 1CI6A 3BASA 1IK7A 3FXDA 1JB0J 1BE3E 3Q5PA 1VQ8P 2WMMA 3A0HH 2OYIB 2BEZF 1SVFA 4WY4B 1SQXG 2IBZE 3Q5SA 4H0LC 2HLOA 2JO1A 3H32A 2FYUG 1BCCJ 4PD4D 1KQLA 5KLVD 3B4SA 1JM0A 2P58A 1GDTA 1ZR4A 3L74E 2E75C 5KLIC 2WWWA 1JUNA 1NTMD 4YTPC 4OGQD 1J1DC 2LXBA 2HPCA 1IFMA 1YTZT 1SQVE 1Z56A 1RF1B 1W5CE 2JDIH 2R44A 1OIPA 3L74D 2BCCG 2A06E 2M5AA 3TGUG 4UB6E 3E1IA 1AQTA 2I1KA 2GUSA 2KB7P 2O1JA 2WPQA 3H1JE 1S4XA 3L71G 1MV8A 5AVUB 3CX5E 2WT7B 1R5LA 1JY2P 1U57A 2K88A 1L0ND 2FXOA 3HRNA 5CBNA 1S1CX 1QVGO 2E76C 4JYCA 3KQGA 2R5BA 2A06D 3RL0C 2N1TA 1N2DC 4L74A 1FDOA 4ZNCA 1J2JB 4L75A 3BCCD 3H1JD 1SQBK 2P10A 3QH9A 2KS1B 4EI2A 3Q3DA 3L75J 3M91A 1KYOI 3S1KA 1GK4A 2N1TC 2KSJA 3WMM0 1BE3J 5KKZC 3A7OA 1URQD 2WSFJ 1L0LG 2A45G 1PP9G 3IN6A 1SQBJ 1MUUA 1T6AA 4IFMA 4C7NB 1YYCA 1EC5A 4EYYQ 2HYNA 5CHXA 5TJHA 1IJDB 2C0WA 3JCUH 1S9KD 2FY8A 4WB4A 4KJMA 1PGPA 1PV3A 4HKZH 1KN7A 3TNUB 2J5UA 1IFDA 2JWAA 2Q6QA 1FDIA 5B66E 3OAKA 2P7JA 3F89A 4IL6H 5E79H 2ZT9C 1JTHB 3W68A 2NZ2A 1SQXE 4LC1A 1ZR2A 1VDFA 3ITKA 1VF5C 4WBAA 1AV1A 4D6TD 2O01N 5AW5B 2AEMA 1KYOH 3D71A 1WT6A 1KILB 2H7HA 1AVOA 2OYHA 4ZKPA 3VMZA 1BCCG 1BGYG 2OQQA 5H2FH 2Z5HA 2YXRB 1JY3O 5APTA 1HH0A 3AE4C 1SQQG 1G1IA 1QLED 3AE5C 1Y9BA 3MD0A 3CCRP 2OYHC 3AE6C
chains in the Genus database with same CATH topology
3HTKA 5CJ4A 4WY4D 1LTIC 4LLHA 4HYTB 2YO3A 1JY3P 4AUWA 3EQ2A 1JY3N 5AVRB 2W6AA 2YNYA 3LIEA 5CCHD 1LTJA 3B5NB 2R3CA 5BU5A 1SFCA 2MJZA 1L4AD 2P1JA 3M0AA 2C9LY 2P67A 3OJAB 5AW3B 3GHGA 2CPSA 3T97A 3V2PA 3MGNA 2GUVA 2N9BA 3RK3C 1ZN5A 1HJBA 3LIDA 3A3YB 4M3LA 3BVHA 3B8EB 1LTSC 1KFMA 2NPSB 1LTJC 1FZEA 3HD7B 3P8MC 3RL0D 1SFCC 2C0XA 1URQB 1M1JB 1FOSF 4JF7A 1VPCA 3GHGC 3PP5A 4GKGA 3V4QA 1SQXK 5AW1B 2KLVA 3HE5A 3VYIA 1H89A 2WITA 3U1AA 2OYIA 1YTZI 2FYUK 1IFJA 2OYHB 2IX7C 3SWYA 1DH3A 1AQ5A 4WY4A 2O01H 3II6A 4W7YA 2HODA 3LW5H 2YKQA 3N7NA 4OH8B 1KFNA 3V2QA 1DEBA 1GW3A 1RE4A 3P8CE 1FU1A 5AVQB 1FZCB 1XTCC 3RK2D 2R5DA 1FJPA 2ZFCA 3NTNA 3MTUE 4AQRD 1XTGB 1FOSE 2OYIC 1NO4A 4Y99C 3A2AA 5APQA 1KILD 1M7LA 5APVA 4AYCA 1T3JA 2E43A 5AVYB 1NHLA 3RK3B 4O9BA 3HTKB 4WY4C 2H43A 5AVTB 1G2CA 3L37A 2XZRA 3V5BA 1RF0A 3M9BA 1RE4C 1LTJB 5AW7B 1N86A 2Q3IA 1LTAC 1SFCB 3U59A 1JMMA 5KJ7D 2J59M 4B86A 3P8CD 2Q7CA 1FZGA 4RESB 3GHGB 4KHXA 3MUDA 1E5WA 1JO5A 1NKZB 1OWAA 5CCGD 2LKMA 1N7SD 3VOPA 4JYBA 5AW0B 1N73A 2PP6A 2YKPA 5APUA 1RF1A 3O8ZA 1RF0C 5AW2B 2XNXA 5KLVK 5AW9B 2CPBA 3VN0A 2IFNA 3VP9A 1N7LA 3B5ND 2Q5UA 1X79B 1JOCA 3N4XA 5BU8B 3KPEA 1A02F 5AVSB 2H8PD 4ZKUA 1IK9A 3H6PA 1CI6A 1GK6A 3BASA 1N73C 3HE5B 2OYIB 1HVVA 4C46A 1NTMK 1RF1C 4Y99B 2WT7A 2QM8A 1S9KE 1SVFA 2WSEH 1IFNA 3IR9A 4WY4B 5KTBA 2NPSD 1T2KC 1QL2A 2HODB 3HD7D 2HLOA 4DOJA 2OARA 3H32A 1HGVA 4GIFA 2IPPA 1LGHB 1GL2D 2R32A 1T3UA 3R2PA 3VMYA 2FYZA 1KQLA 1HWTC 4LGDE 5KJ7A 1W2EA 1IC2A 2FKWB 1GDTA 3OA7A 1N7SA 2A45I 3KDPB 1L0LK 1G2CB 1FZBA 1ZV8A 1CW5A 1SQPK 1ZR4A 5APWA 1GTWA 2PAJA 2WWWA 1AFOA 3TK1A 1JUNA 2N1TD 1SQVK 1L0NK 1IO4A 5KJ7C 1J1DC 2GM4A 1PFIA 5CCHA 4W80A 2KOGA 2Z5IA 4EIJA 2HPCA 1CZQA 1L4AA 2XDJA 1N7SC 1IFMA 1EQ7A 1MZ9A 2ZXEB 1YTZT 2WPSA 1CSBA 3RK3D 5AW6B 4C7NA 2JEEA 3U1CA 1N73B 1MFZA 4I2LC 1Z56A 3TYYA 1RF1B 1JY2O 1G1JA 2YMYA 3CI9A 1HUCA 3I5CA 3HD7A 1DX7A 3CL3D 2FFDA 1SFCD 3E1IA 1GW4A 3TNUA 1GL2A 4N78E 5CCHC 1NOHA 2I1KA 2O1KA 1L4AC 3V2RA 2GUSA 2KB7P 2O1JA 2WPQA 2Z4EA 2L5GB 2YKOA 1LT9A 1CI6B 1MV8A 5AVUB 5AVZB 1LWUA 2WT7B 1JY2P 3HRNA 2YO2A 2I1JA 3VP8A 5APSA 1JTHA 1JY2N 1FZFA 3HD7C 1GU4A 4JYCA 3C9IA 3KQGA 3VMXA 2FFDC 3HUSA 5CJ0A 1NKNA 2HFED 3H32B 3P32A 3P7KA 1FZAA 1GL2C 1X8YA 2R5BA 4XA4A 3RL0C 3G3ZA 4HH2A 1NH4A 3V4WA 4DZOA 1LTTC 1SP4A 2W27A 2N1TA 2KYVA 1N2DC 1LT9C 4N78D 1GD2E 2A45H 1FZCA 3BATA 1J2JB 2IFMA 1J1DB 1LWUC 3TSIA 1LTBC 1SQBK 3NXSA 1ZLLA 1N7SB 5AW8B 2POHA 4GT1A 5AVXB 4I1LA 1GZLA 4N3YB 5CMZA 1FAVA 3BRTB 3HUSC 1KILA 4IFFA 2VRSA 3M91A 3EFGA 1GK4A 3CLQA 1SQQK 2Q9IA 2N1TC 2XKMA 3L4FA 2KSJA 3WMM0 1FZCC 3A7OA 4XE5B 1URQD 2J58A 3L36A 2A45G 1OXZA 1IFIA 1LTGC 2QM7A 2HPCB 1L4AB 1MUUA 2M8RA 3RK2C 4I6MC 4C7RA 4IFMA 4W7ZA 4C7NB 1YYCA 3HE4A 2HYNA 1KILC 1FDMA 5CCGA 5CHXA 3M06A 1IJDB 3M9HA 1SLQA 2C0WA 1JCCA 1HTLC 1WRGA 1S9KD 4WB4A 2FFDB 1J1EC 2FXMA 2XV5A 3TNUB 1GL2B 1A02J 3RL0B 1IFDA 5APXA 3B5NA 1RY3A 5AVWB 1LT9B 3NMDA 1X9VA 3OAKA 2P7JA 3MIWA 1H88A 5CCGC 1LWUB 4N6JA 2WSCH 1JTHB 2WTYA 1HGZA 1HBWA 1QL1A 1T8ZA 2WSFH 1KZUB 3SWFA 4LC1A 2HG5D 1T2KD 3HUSB 3M0DA 1ZR2A 1VDFA 3M9QA 2NPSA 3B5NC 2N1TB 1RE3A 2WZ7A 3KYQA 1URQA 4WBAA 1M1JA 5AW5B 5BVZA 3RK2B 1NWQA 2P2UA 3BRVB 4EOTA 2C9NY 1NAFA 1FBMA 3VTPC 1WT6A 1KILB 3NFQA 2H7HA 3M0DC 2OYHA 4ZKPA 2E42A 3VMZA 2NPSC 3UIAA 2M3BA 5APYA 1RE3C 2BASA 2W6BA 3L35A 1URQC 1M1JC 1FJKA 1NTKK 1NU1K 1J1EB 2Z5HA 1JY3O 5APTA 2JJLA 3V2NA 1HH0A 1NTZK 4IFDK 3A5TA 1H8AA 2KP8A 1G1IA 1JNMA 1GU5A 2WPRA 1JCDA 5AW4B 3IFMA 2XU6A 5AVVB 3HE4B 3MD0A 2OYHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTM K;  5KLV K;  1SQX K;  2WSE H;  1NTK K;  1NU1 K;  3G3Z A;  2WSC H;  1SQQ K;  1L0L K;  2J59 M;  3CLQ A;  2FYU K;  2OAR A;  1SQP K;  1NTZ K;  4IFD K;  2LKM A;  2WSF H;  2O01 H;  1SQB K;  3LW5 H;  3M9Q A;  1SQV K;  1L0N K; 
#chains in the Genus database with same CATH topology
 1QEX A;  3HTK A;  5CJ4 A;  4U7J A;  2YO3 A;  5DJU B;  4AUW A;  2FYN C;  1JY3 N;  2AXT H;  3LIE A;  1K04 A;  2MJZ A;  3L71 E;  3AEA C;  5AW3 B;  4R4M A;  3T97 A;  3L72 E;  3MGN A;  2GUV A;  1VQ9 P;  2N9B A;  3H1H G;  1NU1 D;  5KAI H;  1ZN5 A;  3LID A;  1NTZ D;  1LTS C;  1YHQ P;  1KFM A;  2NPS B;  1FZE A;  3JC2 2;  1M1J B;  2OYO A;  1FOS F;  4ASW A;  1VQ7 P;  2JKV A;  2QG4 A;  2KI7 B;  1RQV A;  1SQX K;  1KIL E;  4ASV A;  5GTI E;  2WIT A;  2OYI A;  2FYU K;  1HF9 A;  1AQ5 A;  4WY4 A;  3II6 A;  3CC7 P;  2W83 C;  1L0L E;  1M57 D;  1K9M Q;  1OW6 A;  2QVA A;  4IL6 X;  3I56 P;  1SQX J;  4JBZ A;  1FOS E;  2OYI C;  3K5B A;  2FYU J;  1KIL D;  5AVY B;  4WY4 C;  2H43 A;  4YXD C;  1RQU A;  4RKU J;  1OW7 A;  1N86 A;  3CXH E;  1JMM A;  1EZV D;  3A0B H;  1ZW0 A;  3AEF C;  4PD4 I;  3TF5 A;  1RF1 A;  2ZJS E;  5AW2 B;  1M90 Q;  1VQ6 P;  3VP9 A;  1FC2 C;  3EFF K;  2D2C B;  4PV1 C;  1S5L H;  2QJK B;  3KHU A;  2ZYG A;  1A02 F;  3CXH D;  5AVS B;  2H8P D;  4ZKU A;  1IK9 A;  3H6P A;  2BCC J;  3G9R A;  1GK6 A;  1S2E A;  3TGU J;  4HB1 A;  3PTZ A;  1HVV A;  4C46 A;  1RF1 C;  4Y99 B;  2WT7 A;  1BCC E;  2WSE H;  2O3J A;  2AEF A;  5KTB A;  2NPS D;  3USS A;  1Q82 Q;  4WWI A;  1T3U A;  3GLM A;  4PJ0 E;  2FYZ A;  1ZRT E;  4LGD E;  5KJ7 A;  3V6I A;  2W90 A;  3AE7 C;  4Y28 J;  1UIX A;  1L0L K;  1FZB A;  1NVO A;  2KS1 A;  1AFO A;  3TK1 A;  3S9O A;  2N1T D;  3PJS K;  1OVV A;  1IO4 A;  2V7Q J;  3AE9 C;  5KJ7 C;  4UB8 E;  4PD4 H;  4W80 A;  2Z5I A;  3FWN A;  1MZ9 A;  5AW6 B;  4C7N A;  1N73 B;  1MFZ A;  1PP9 J;  3TYY A;  1JY2 O;  2RH0 A;  3PHL A;  3HD7 A;  1DX7 A;  3CL3 D;  1GW4 A;  1MFT A;  3TNU A;  1NOH A;  3GF3 A;  2O1K A;  3G4S P;  3V2R A;  1QVF O;  4DCK A;  2L5G B;  2Z4E A;  3H1K G;  2OGU A;  3T97 B;  3CPW O;  5AVZ B;  1ZOY C;  2ZT9 D;  2I1J A;  5APS A;  1JTH A;  1JY2 N;  3HD7 C;  3C9I A;  2D2C D;  1OVU A;  4HH2 A;  3V4W A;  1SP4 A;  2W27 A;  3CCV P;  1ZP0 C;  2PRR A;  1YJ9 P;  3TSI A;  3NXS A;  1ZLL A;  2KIK A;  5AW8 B;  2POH A;  1FS0 E;  3CCS P;  1KMI Z;  1KIL A;  2DW3 A;  1SQB E;  2WSC J;  1SQQ K;  2Q9I A;  1S5L X;  2XKM A;  4UB6 H;  4DJG A;  1YQ3 C;  1OXZ A;  1KB9 E;  1SQP G;  1IFI A;  1BGY J;  1LTG C;  1L4A B;  1BSN A;  2M8R A;  3L75 D;  1L2P A;  2FXP A;  1KIL C;  1BE3 D;  3CWB J;  1EDL A;  3M9H A;  1SQQ J;  1WRG A;  2Y0E A;  1SQB D;  1HJ0 A;  2FFD B;  2IBZ D;  1A02 J;  1GL2 B;  2Y9Z A;  1RY3 A;  3NMD A;  4PV1 B;  1X9V A;  3MIW A;  2E74 C;  2UWJ E;  1AVY A;  1YIT P;  1HGZ A;  1HBW A;  1T8Z A;  2K9J B;  1KZU B;  2HG5 D;  1T2K D;  3HUS B;  3M0D A;  3H1H J;  3M9Q A;  2NPS A;  1RE3 A;  5C39 A;  1M1J A;  3FWL A;  2KSE A;  1DIP A;  2W8Z A;  3RK2 B;  1NWQ A;  4EOT A;  2G8Y A;  4TT3 H;  1FBM A;  3L70 G;  2JR8 A;  3PRJ A;  1SQV D;  3M0D C;  3D6Z A;  5L8R J;  2E42 A;  1U7J A;  2NPS C;  3UIA A;  1Q86 Q;  5APY A;  1SS1 A;  1RE3 C;  2BAS A;  3RGU A;  1M1J C;  1FJK A;  1EDK A;  3AEB C;  3L73 G;  1USE A;  5B66 H;  1GU5 A;  2WPR A;  5AW4 B;  3HE4 B;  3CCQ P;  3CX5 D;  2JWD A;  4WY4 D;  1PL5 A;  4HYT B;  2K3R A;  5AVR B;  2YNY A;  5BU5 A;  2Q3E A;  3M0A A;  1L4A D;  3LW5 J;  2PGD A;  3KXD A;  4U3F G;  2KUB A;  3HD7 B;  3P8M C;  5B5E E;  1PPJ G;  2IYP A;  2C0X A;  1KQS O;  4PV1 D;  4JF7 A;  1KC8 Q;  1VPC A;  1E79 H;  1AJY A;  3WUV A;  1P84 E;  3AEG C;  3MP7 B;  2I8D A;  2KLV A;  1Y47 A;  3U1A A;  1YTZ I;  1IFJ A;  1EZV I;  1X0T A;  1DH3 A;  2E5Y A;  1GMJ A;  2O01 H;  4W7Y A;  2H89 C;  1OMI A;  1W2B O;  4GOE A;  2D2C C;  1NGM B;  2FYU E;  1SQP E;  4NPF X;  2QJK C;  1DEB A;  1NYH A;  3Q5R A;  3GG2 A;  3P8C E;  5AVQ B;  4H44 B;  3RK2 D;  1FJP A;  3GF7 A;  1P84 D;  2G3A A;  3MTU E;  1XTG B;  1NO4 A;  4Y99 C;  3A2A A;  1NTK G;  2K9Y A;  3CXH I;  1NHL A;  4O9B A;  5AVT B;  1L0N J;  1SQX D;  3EWK A;  1K05 A;  1EDJ A;  5AW7 B;  2Q3I A;  2FYU D;  3U59 A;  5KJ7 D;  3P8C D;  4RES B;  3GHG B;  4KHX A;  1E5W A;  3CWB G;  3IF4 A;  1H0T B;  2IZ1 A;  4JYB A;  3BCC J;  1VQM P;  1N73 A;  2E74 B;  5GTI H;  5APU A;  3O8Z A;  2KZI A;  2BCC E;  5KAF E;  2IFN A;  3TGU E;  3N4X A;  5BU8 B;  2XND H;  4RJT A;  1N73 C;  3L70 E;  1Y8A A;  3HE5 B;  3H1L G;  2QM8 A;  3FX0 A;  3H1K J;  1YIJ P;  3IR9 A;  4L73 A;  1Q2N A;  1T2K C;  2HOD B;  3HD7 D;  3G6E P;  3H1I G;  2OAR A;  1HGV A;  3RL0 g;  4GIF A;  1LGH B;  3TGU D;  3CXH H;  1HWT C;  3E7K A;  1IC2 A;  3L71 D;  2K1A A;  3OA7 A;  2YMK A;  1PZQ A;  3L72 D;  3KDP B;  3IAO A;  1SQP K;  3WU2 H;  2QIW A;  4GOD A;  1PP9 E;  2PFX A;  4JPZ B;  4QMA A;  2KOG A;  4EIJ A;  1L4A A;  2XDJ A;  1EQ7 A;  4D6T J;  2WPS A;  1CSB A;  1JEK A;  4I2L C;  1SQP J;  4U3F E;  4YPC A;  1G1J A;  2YMY A;  3CI9 A;  1HUC A;  1PPJ E;  2AXT E;  2B9B A;  2FFD A;  4HJG H;  1GL2 A;  4N78 E;  3CMA P;  4KT0 J;  1L0L D;  1PP9 D;  1L4A C;  5KLV G;  4PJ0 H;  3AEE C;  5KAI E;  2E74 D;  1KOR A;  2LXC B;  2K9J A;  1OX3 A;  3VMX A;  2FFD C;  3HUS A;  5TIS H;  2HFE D;  3P7K A;  1FZA A;  1GL2 C;  1X8Y A;  4XA4 A;  1NTM G;  3G3Z A;  1NH4 A;  2KYV A;  4N78 D;  3R4Y A;  1FZC A;  3BAT A;  1KQF B;  4UB8 H;  1NTK E;  2KK7 A;  1WMK A;  2IBZ I;  2Y0C A;  1N7S B;  3AE1 C;  4GT1 A;  5AVX B;  4I7Z B;  4N3Y B;  1FAV A;  3HUS C;  4IFF A;  1M1K Q;  2VRS A;  1BGY E;  1NU1 J;  3L74 G;  3EFG A;  3L4F A;  3L70 J;  1NTZ J;  1FZC C;  4XE5 B;  2J58 A;  2WSS H;  3L36 A;  3B71 A;  3C8V A;  3CWB E;  1SQQ E;  3RK2 C;  4I6M C;  2YIU B;  4C7R A;  1SQV G;  1L0N G;  3HE4 A;  1FDM A;  3L73 J;  2LR2 A;  1JCC A;  1BCC D;  1BGY D;  5EFW B;  2A06 G;  4H13 B;  2FXM A;  5APX A;  3AE8 C;  5AVW B;  1LT9 B;  3BCC G;  3H1J G;  1H88 A;  3H1L E;  3MHV A;  1SQQ D;  1ZRT D;  3H1H E;  1LWU B;  1QL1 A;  1KTM A;  2WSF H;  3SWF A;  1LT1 A;  2WZ7 A;  3CX5 I;  3KYQ A;  4OGQ B;  2WPV B;  4BRY B;  1VL2 A;  1JMB A;  4U3F J;  1LJ2 A;  4TLF A;  1YQ4 C;  3BRV B;  2C9N Y;  1NAF A;  1BDC A;  2ZYD A;  3VTP C;  4RO0 A;  3NFQ A;  1OFC X;  3WUT A;  2MKV A;  3L35 A;  1NTK K;  1J1E B;  3PH0 A;  2JJL A;  1AA0 A;  4NPD A;  1OW8 A;  3A5T A;  1H8A A;  2B87 B;  3IFM A;  2XU6 A;  1PIX A;  1PGQ A;  4OVN F;  1VQ5 P;  1VQL P;  4LLH A;  1Q90 D;  1NTK J;  3EQ2 A;  1R8E A;  2M3E A;  2W6A A;  5CCH D;  3B5N B;  3TDK A;  2R3C A;  2C9L Y;  2P1J A;  2QE7 H;  4H44 C;  4D6T G;  2KNC B;  3GHG A;  4K35 A;  3V2P A;  3KZI E;  1H0T A;  1HJB A;  2E5T A;  3A3Y B;  3CX5 H;  4M3L A;  1P84 I;  2H88 C;  3B8E B;  4H13 D;  1NTM E;  4K3A A;  1K8A Q;  4Z1M H;  3RBZ A;  1URQ B;  3ABV C;  3GHG C;  1YJN P;  4YXW H;  3Q2Y A;  5GTH E;  4GKG A;  1KB9 D;  3WUU A;  3CD6 P;  3HE5 A;  2Y0D A;  3VYI A;  1M56 D;  4GDO A;  2IX7 C;  3SWY A;  4WVZ A;  2OTL P;  2BEQ D;  1DEE G;  4MN4 C;  1VQN P;  2HOD A;  3D6Y A;  2YKQ A;  3H1L J;  1KFN A;  1GW3 A;  1IZN B;  1RE4 A;  2W6J H;  1VQO P;  1ZME C;  1FU1 A;  5M1B A;  1FZC B;  1XTC C;  2R5D A;  3H1I J;  1L0N E;  3JSV C;  3A0H E;  4JQ0 D;  1NU1 G;  4AYC A;  1T3J A;  3RK3 B;  3W67 A;  1NTZ G;  2HR3 A;  2K37 A;  1EDI A;  3L37 A;  2XZR A;  2WQY C;  3V5B A;  1KV4 A;  1YBK A;  3AE3 C;  3AE2 C;  3F5H A;  2KXP B;  3M9B A;  4A7P A;  1RE4 C;  1LTJ B;  5B5E H;  2WSE J;  1SFC B;  3BCC E;  2QSI A;  5CBO A;  2QJP B;  3MUD A;  1JO5 A;  1OWA A;  1P84 H;  5CCG D;  3L72 G;  3O6Q B;  3VMA A;  2KLU A;  1PGO A;  2YKP A;  5KLV K;  5AW9 B;  2IDB A;  3S4R A;  2ZXX A;  3B5N D;  2Q5U A;  5K5G B;  2QJY B;  3G71 P;  3SWK A;  1JOC A;  3KPE A;  3MUD C;  3H1K E;  1LNQ A;  4GOF A;  1TU3 F;  1NTM K;  2OTK E;  5KLV J;  1EXI A;  1S9K E;  1IFN A;  3CCM P;  1DD3 A;  1QL2 A;  3CCJ P;  3SFE C;  4DOJ A;  2IPP A;  3RBX A;  1GL2 D;  2R32 A;  3R2P A;  2FBW C;  1LP1 B;  3VMY A;  1EZV G;  2M0B A;  3H1K D;  1W2E A;  2FKW B;  1NTM J;  3RK3 E;  1N7S A;  2A45 I;  3MZW B;  2JP3 A;  1G2C B;  1ZV8 A;  1CW5 A;  5APW A;  1GTW A;  2PAJ A;  4ZMD A;  2WVR A;  5KAF H;  2B88 A;  4EDF A;  3AED C;  4D6T E;  1SQV K;  1L0N K;  4XFJ A;  2GM4 A;  2GA1 A;  1PFI A;  3GMA A;  3L74 J;  5CCH A;  1CZQ A;  1N7S C;  3FXE A;  2ZXE B;  4BWN A;  3RK3 D;  4I7Z C;  2JEE A;  3U1C A;  1Q7Y Q;  1KD1 Q;  1PGJ A;  2ITA A;  1Q81 Q;  1ZXG A;  1D7M A;  3I5C A;  2KZJ A;  1SQV J;  1SFC D;  4H0L B;  1RH5 B;  1QGK B;  5CCH C;  1U7M A;  1QX8 A;  1SQP D;  2YKO A;  1LT9 A;  1CI6 B;  2YIU C;  1X22 A;  1DD4 A;  1LWU A;  2RMZ A;  2YO2 A;  3VP8 A;  2V4H A;  3JCU E;  1FZF A;  3H1J J;  2V7Q H;  3CCL P;  1GU4 A;  4H13 C;  5CJ0 A;  1NKN A;  2E75 B;  3H32 B;  3P32 A;  5KLI B;  1OZH A;  4DZO A;  1LTT C;  1LT9 C;  4BRY A;  1GD2 E;  2A45 H;  3H25 A;  2IFM A;  1J1D B;  4IL6 E;  3CC4 P;  5E79 E;  1LWU C;  1NU1 E;  1LTB C;  2ZAE B;  1NTZ E;  3CCU P;  4I1L A;  1GZL A;  5CMZ A;  3BRT B;  1VQP P;  1IFP A;  3CLQ A;  2ZVN B;  1K73 Q;  1YI2 P;  4OGQ C;  2BCC D;  3L73 E;  3CC2 P;  1OVR A;  2B89 A;  2QM7 A;  2HPC B;  1KYO E;  1BSH A;  4W7Z A;  2B87 A;  1NAY A;  5CCG A;  3L70 D;  3M06 A;  4CPG A;  1SLQ A;  1HTL C;  2E76 B;  5H2F E;  2M5A B;  1J1E C;  5DJT B;  2XV5 A;  3RL0 B;  3B5N A;  2Y9Y A;  3L73 D;  4H44 D;  2KNC A;  1KYO D;  5CCG C;  4N6J A;  2N9Y B;  2WSC H;  2WTY A;  3FGA D;  2RKL A;  3SFD C;  4H0L D;  3B5N C;  2N1T B;  1EZV E;  5KKZ B;  1URQ A;  3L75 G;  2ZVO B;  5BVZ A;  2P2U A;  1BE3 G;  2E75 D;  1VQ4 P;  4U3F D;  2M3B A;  1SQB G;  3Q1M A;  1KQG B;  2W6B A;  3QWO C;  1PPJ D;  1URQ C;  2IBZ G;  1NU1 K;  3V2N A;  2L91 A;  1NTZ K;  4IFD K;  2KP8 A;  1JNM A;  1N8R Q;  1JCD A;  5AVV B;  2ZT9 B;  2IZ0 A;  3WU2 E;  3SSU A;  2RN0 A;  3C1L A;  1LTI C;  1KB9 I;  1JY3 P;  1LTJ A;  4NPE A;  1M8O B;  2AEJ A;  2SPZ A;  3E1R A;  1SFC A;  1EXJ A;  1VF5 B;  2O01 J;  4BXL A;  1R5S A;  2P67 A;  4L76 A;  3OJA B;  2CPS A;  2CK3 H;  1NTK D;  3RK3 C;  3O6Q A;  2QEX P;  3L71 J;  2QA4 P;  3BVH A;  2E76 D;  2R3S A;  3L72 J;  3I55 P;  1LTJ C;  3RL0 D;  1SFC C;  3ZDM A;  2QJP C;  3PP5 A;  3A0B E;  1FE6 A;  4OWF A;  3CWB D;  3V4Q A;  5AW1 B;  3GW6 A;  1H89 A;  2OYH B;  5TIS E;  4DT0 A;  3H1I E;  3LW5 H;  3N7N A;  2QJY C;  4OH8 B;  1UII A;  2FYN B;  1S5L E;  3V2Q A;  1BDD A;  2YXQ B;  2IYO A;  2QRX A;  1LP1 A;  1USD A;  1NJI Q;  3D70 A;  2ZYA A;  2ZFC A;  4AQR D;  3NTN A;  1KB9 H;  1L0L J;  2Q1K A;  2NRG A;  5APQ A;  3KZI H;  1RHZ B;  3H1L D;  4IOI H;  1M7L A;  5APV A;  3H1H D;  2E43 A;  3HTK B;  2OTJ P;  1G2C A;  3PLN A;  1YJW P;  1S3J A;  1RF0 A;  3H1I D;  3CCE P;  1LTA C;  2J59 M;  4B86 A;  2Q7C A;  1FZG A;  1NKZ B;  2LKM A;  5GTH H;  1N7S D;  3VOP A;  3AEC C;  4R4L A;  5AW0 B;  2PP6 A;  2AXC A;  1RF0 C;  2XNX A;  2CPB A;  3VN0 A;  3OW2 O;  1VQK P;  1MKM A;  1N7L A;  1VF5 D;  1X79 B;  3CME P;  4PD4 E;  5KLV E;  3L75 E;  1S72 P;  1CI6 A;  3BAS A;  1IK7 A;  3FXD A;  1JB0 J;  1BE3 E;  3Q5P A;  1VQ8 P;  2WMM A;  3A0H H;  2OYI B;  2BEZ F;  1SVF A;  4WY4 B;  1SQX G;  2IBZ E;  3Q5S A;  4H0L C;  2HLO A;  2JO1 A;  3H32 A;  2FYU G;  1BCC J;  4PD4 D;  1KQL A;  5KLV D;  3B4S A;  1JM0 A;  2P58 A;  1GDT A;  1ZR4 A;  3L74 E;  2E75 C;  5KLI C;  2WWW A;  1JUN A;  1NTM D;  4YTP C;  4OGQ D;  1J1D C;  2LXB A;  2HPC A;  1IFM A;  1YTZ T;  1SQV E;  1Z56 A;  1RF1 B;  1W5C E;  2JDI H;  2R44 A;  1OIP A;  3L74 D;  2BCC G;  2A06 E;  2M5A A;  3TGU G;  4UB6 E;  3E1I A;  1AQT A;  2I1K A;  2GUS A;  2KB7 P;  2O1J A;  2WPQ A;  3H1J E;  1S4X A;  3L71 G;  1MV8 A;  5AVU B;  3CX5 E;  2WT7 B;  1R5L A;  1JY2 P;  1U57 A;  2K88 A;  1L0N D;  2FXO A;  3HRN A;  5CBN A;  1S1C X;  1QVG O;  2E76 C;  4JYC A;  3KQG A;  2R5B A;  2A06 D;  3RL0 C;  2N1T A;  1N2D C;  4L74 A;  1FDO A;  4ZNC A;  1J2J B;  4L75 A;  3BCC D;  3H1J D;  1SQB K;  2P10 A;  3QH9 A;  2KS1 B;  4EI2 A;  3Q3D A;  3L75 J;  3M91 A;  1KYO I;  3S1K A;  1GK4 A;  2N1T C;  2KSJ A;  3WMM 0;  1BE3 J;  5KKZ C;  3A7O A;  1URQ D;  2WSF J;  1L0L G;  2A45 G;  1PP9 G;  3IN6 A;  1SQB J;  1MUU A;  1T6A A;  4IFM A;  4C7N B;  1YYC A;  1EC5 A;  4EYY Q;  2HYN A;  5CHX A;  5TJH A;  1IJD B;  2C0W A;  3JCU H;  1S9K D;  2FY8 A;  4WB4 A;  4KJM A;  1PGP A;  1PV3 A;  4HKZ H;  1KN7 A;  3TNU B;  2J5U A;  1IFD A;  2JWA A;  2Q6Q A;  1FDI A;  5B66 E;  3OAK A;  2P7J A;  3F89 A;  4IL6 H;  5E79 H;  2ZT9 C;  1JTH B;  3W68 A;  2NZ2 A;  1SQX E;  4LC1 A;  1ZR2 A;  1VDF A;  3ITK A;  1VF5 C;  4WBA A;  1AV1 A;  4D6T D;  2O01 N;  5AW5 B;  2AEM A;  1KYO H;  3D71 A;  1WT6 A;  1KIL B;  2H7H A;  1AVO A;  2OYH A;  4ZKP A;  3VMZ A;  1BCC G;  1BGY G;  2OQQ A;  5H2F H;  2Z5H A;  2YXR B;  1JY3 O;  5APT A;  1HH0 A;  3AE4 C;  1SQQ G;  1G1I A;  1QLE D;  3AE5 C;  1Y9B A;  3MD0 A;  3CCR P;  2OYH C;  3AE6 C; 
#chains in the Genus database with same CATH homology
 3HTK A;  5CJ4 A;  4WY4 D;  1LTI C;  4LLH A;  4HYT B;  2YO3 A;  1JY3 P;  4AUW A;  3EQ2 A;  1JY3 N;  5AVR B;  2W6A A;  2YNY A;  3LIE A;  5CCH D;  1LTJ A;  3B5N B;  2R3C A;  5BU5 A;  1SFC A;  2MJZ A;  1L4A D;  2P1J A;  3M0A A;  2C9L Y;  2P67 A;  3OJA B;  5AW3 B;  3GHG A;  2CPS A;  3T97 A;  3V2P A;  3MGN A;  2GUV A;  2N9B A;  3RK3 C;  1ZN5 A;  1HJB A;  3LID A;  3A3Y B;  4M3L A;  3BVH A;  3B8E B;  1LTS C;  1KFM A;  2NPS B;  1LTJ C;  1FZE A;  3HD7 B;  3P8M C;  3RL0 D;  1SFC C;  2C0X A;  1URQ B;  1M1J B;  1FOS F;  4JF7 A;  1VPC A;  3GHG C;  3PP5 A;  4GKG A;  3V4Q A;  1SQX K;  5AW1 B;  2KLV A;  3HE5 A;  3VYI A;  1H89 A;  2WIT A;  3U1A A;  2OYI A;  1YTZ I;  2FYU K;  1IFJ A;  2OYH B;  2IX7 C;  3SWY A;  1DH3 A;  1AQ5 A;  4WY4 A;  2O01 H;  3II6 A;  4W7Y A;  2HOD A;  3LW5 H;  2YKQ A;  3N7N A;  4OH8 B;  1KFN A;  3V2Q A;  1DEB A;  1GW3 A;  1RE4 A;  3P8C E;  1FU1 A;  5AVQ B;  1FZC B;  1XTC C;  3RK2 D;  2R5D A;  1FJP A;  2ZFC A;  3NTN A;  3MTU E;  4AQR D;  1XTG B;  1FOS E;  2OYI C;  1NO4 A;  4Y99 C;  3A2A A;  5APQ A;  1KIL D;  1M7L A;  5APV A;  4AYC A;  1T3J A;  2E43 A;  5AVY B;  1NHL A;  3RK3 B;  4O9B A;  3HTK B;  4WY4 C;  2H43 A;  5AVT B;  1G2C A;  3L37 A;  2XZR A;  3V5B A;  1RF0 A;  3M9B A;  1RE4 C;  1LTJ B;  5AW7 B;  1N86 A;  2Q3I A;  1LTA C;  1SFC B;  3U59 A;  1JMM A;  5KJ7 D;  2J59 M;  4B86 A;  3P8C D;  2Q7C A;  1FZG A;  4RES B;  3GHG B;  4KHX A;  3MUD A;  1E5W A;  1JO5 A;  1NKZ B;  1OWA A;  5CCG D;  2LKM A;  1N7S D;  3VOP A;  4JYB A;  5AW0 B;  1N73 A;  2PP6 A;  2YKP A;  5APU A;  1RF1 A;  3O8Z A;  1RF0 C;  5AW2 B;  2XNX A;  5KLV K;  5AW9 B;  2CPB A;  3VN0 A;  2IFN A;  3VP9 A;  1N7L A;  3B5N D;  2Q5U A;  1X79 B;  1JOC A;  3N4X A;  5BU8 B;  3KPE A;  1A02 F;  5AVS B;  2H8P D;  4ZKU A;  1IK9 A;  3H6P A;  1CI6 A;  1GK6 A;  3BAS A;  1N73 C;  3HE5 B;  2OYI B;  1HVV A;  4C46 A;  1NTM K;  1RF1 C;  4Y99 B;  2WT7 A;  2QM8 A;  1S9K E;  1SVF A;  2WSE H;  1IFN A;  3IR9 A;  4WY4 B;  5KTB A;  2NPS D;  1T2K C;  1QL2 A;  2HOD B;  3HD7 D;  2HLO A;  4DOJ A;  2OAR A;  3H32 A;  1HGV A;  4GIF A;  2IPP A;  1LGH B;  1GL2 D;  2R32 A;  1T3U A;  3R2P A;  3VMY A;  2FYZ A;  1KQL A;  1HWT C;  4LGD E;  5KJ7 A;  1W2E A;  1IC2 A;  2FKW B;  1GDT A;  3OA7 A;  1N7S A;  2A45 I;  3KDP B;  1L0L K;  1G2C B;  1FZB A;  1ZV8 A;  1CW5 A;  1SQP K;  1ZR4 A;  5APW A;  1GTW A;  2PAJ A;  2WWW A;  1AFO A;  3TK1 A;  1JUN A;  2N1T D;  1SQV K;  1L0N K;  1IO4 A;  5KJ7 C;  1J1D C;  2GM4 A;  1PFI A;  5CCH A;  4W80 A;  2KOG A;  2Z5I A;  4EIJ A;  2HPC A;  1CZQ A;  1L4A A;  2XDJ A;  1N7S C;  1IFM A;  1EQ7 A;  1MZ9 A;  2ZXE B;  1YTZ T;  2WPS A;  1CSB A;  3RK3 D;  5AW6 B;  4C7N A;  2JEE A;  3U1C A;  1N73 B;  1MFZ A;  4I2L C;  1Z56 A;  3TYY A;  1RF1 B;  1JY2 O;  1G1J A;  2YMY A;  3CI9 A;  1HUC A;  3I5C A;  3HD7 A;  1DX7 A;  3CL3 D;  2FFD A;  1SFC D;  3E1I A;  1GW4 A;  3TNU A;  1GL2 A;  4N78 E;  5CCH C;  1NOH A;  2I1K A;  2O1K A;  1L4A C;  3V2R A;  2GUS A;  2KB7 P;  2O1J A;  2WPQ A;  2Z4E A;  2L5G B;  2YKO A;  1LT9 A;  1CI6 B;  1MV8 A;  5AVU B;  5AVZ B;  1LWU A;  2WT7 B;  1JY2 P;  3HRN A;  2YO2 A;  2I1J A;  3VP8 A;  5APS A;  1JTH A;  1JY2 N;  1FZF A;  3HD7 C;  1GU4 A;  4JYC A;  3C9I A;  3KQG A;  3VMX A;  2FFD C;  3HUS A;  5CJ0 A;  1NKN A;  2HFE D;  3H32 B;  3P32 A;  3P7K A;  1FZA A;  1GL2 C;  1X8Y A;  2R5B A;  4XA4 A;  3RL0 C;  3G3Z A;  4HH2 A;  1NH4 A;  3V4W A;  4DZO A;  1LTT C;  1SP4 A;  2W27 A;  2N1T A;  2KYV A;  1N2D C;  1LT9 C;  4N78 D;  1GD2 E;  2A45 H;  1FZC A;  3BAT A;  1J2J B;  2IFM A;  1J1D B;  1LWU C;  3TSI A;  1LTB C;  1SQB K;  3NXS A;  1ZLL A;  1N7S B;  5AW8 B;  2POH A;  4GT1 A;  5AVX B;  4I1L A;  1GZL A;  4N3Y B;  5CMZ A;  1FAV A;  3BRT B;  3HUS C;  1KIL A;  4IFF A;  2VRS A;  3M91 A;  3EFG A;  1GK4 A;  3CLQ A;  1SQQ K;  2Q9I A;  2N1T C;  2XKM A;  3L4F A;  2KSJ A;  3WMM 0;  1FZC C;  3A7O A;  4XE5 B;  1URQ D;  2J58 A;  3L36 A;  2A45 G;  1OXZ A;  1IFI A;  1LTG C;  2QM7 A;  2HPC B;  1L4A B;  1MUU A;  2M8R A;  3RK2 C;  4I6M C;  4C7R A;  4IFM A;  4W7Z A;  4C7N B;  1YYC A;  3HE4 A;  2HYN A;  1KIL C;  1FDM A;  5CCG A;  5CHX A;  3M06 A;  1IJD B;  3M9H A;  1SLQ A;  2C0W A;  1JCC A;  1HTL C;  1WRG A;  1S9K D;  4WB4 A;  2FFD B;  1J1E C;  2FXM A;  2XV5 A;  3TNU B;  1GL2 B;  1A02 J;  3RL0 B;  1IFD A;  5APX A;  3B5N A;  1RY3 A;  5AVW B;  1LT9 B;  3NMD A;  1X9V A;  3OAK A;  2P7J A;  3MIW A;  1H88 A;  5CCG C;  1LWU B;  4N6J A;  2WSC H;  1JTH B;  2WTY A;  1HGZ A;  1HBW A;  1QL1 A;  1T8Z A;  2WSF H;  1KZU B;  3SWF A;  4LC1 A;  2HG5 D;  1T2K D;  3HUS B;  3M0D A;  1ZR2 A;  1VDF A;  3M9Q A;  2NPS A;  3B5N C;  2N1T B;  1RE3 A;  2WZ7 A;  3KYQ A;  1URQ A;  4WBA A;  1M1J A;  5AW5 B;  5BVZ A;  3RK2 B;  1NWQ A;  2P2U A;  3BRV B;  4EOT A;  2C9N Y;  1NAF A;  1FBM A;  3VTP C;  1WT6 A;  1KIL B;  3NFQ A;  2H7H A;  3M0D C;  2OYH A;  4ZKP A;  2E42 A;  3VMZ A;  2NPS C;  3UIA A;  2M3B A;  5APY A;  1RE3 C;  2BAS A;  2W6B A;  3L35 A;  1URQ C;  1M1J C;  1FJK A;  1NTK K;  1NU1 K;  1J1E B;  2Z5H A;  1JY3 O;  5APT A;  2JJL A;  3V2N A;  1HH0 A;  1NTZ K;  4IFD K;  3A5T A;  1H8A A;  2KP8 A;  1G1I A;  1JNM A;  1GU5 A;  2WPR A;  1JCD A;  5AW4 B;  3IFM A;  2XU6 A;  5AVV B;  3HE4 B;  3MD0 A;  2OYH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...