3TYYA

Crystal structure of human lamin-b1 coil 2 segment
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
75
structure length
75
Chain Sequence
QKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLEGEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of the coil 2B fragment and the globular tail domain of human lamin B1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Lamin-B1
total genus 34
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3tyyA00
2ZFCA 5AW6B 1YYCA 1HJBA 5APTA 3P7KA 1HUCA 3A2AA 1A02J 4JYBA 1JUNA 4C7NA 2R3CA 3A5TA 2Z5HA 1H88A 2XV5A 2YNYA 4I6MC 4DZOA 1IO4A 2XZRA 3LIEA 3VMXA 1T2KD 2P2UA 5AVYB 5AW5B 2JJLA 3HE4B 2QM8A 1G2CB 5APSA 2P67A 4HYTB 3M0AA 3VN0A 3HE4A 3VMYA 2C9NY 4RESB 3A3YB 3KQGA 1OXZA 5APVA 3M0DA 1CI6A 2R32A 3A7OA 3NXSA 1HWTC 2WTYA 3MGNA 1GK4A 2N9BA 2Z5IA 5AVUB 4B86A 3TYYA 1SP4A 1GK6A 2VRSA 1A02F 2Q5UA 3M9HA 2ZXEB 2Q3IA 2C9LY 5AW0B 3MD0A 3M91A 4AQRD 2P7JA 4I2LC 1GTWA 1MUUA 1KQLA 2IPPA 1J2JB 2BASA 1DH3A 3L37A 2W6AA 3SWFA 3HE5B 3TNUA 4KHXA 5AW2B 5CMZA 5AVZB 5AVXB 4M3LA 1CZQA 3NTNA 5AW9B 4GKGA 1GZLA 1FOSF 3O8ZA 1GD2E 1FOSE 2WPSA 5AVRB 2WPRA 5AW4B 1X8YA 4AUWA 3NFQA 2R5DA 1SLQA 2WT7A 3P32A 1NWQA 3HTKA 5AW8B 3L35A 2R5BA 4LC1A 1NAFA 2YO2A 2WWWA 2W27A 5AW3B 3VMZA 3VYIA 1FAVA 2H7HA 1HBWA 3M9BA 5APYA 3IR9A 3V4WA 2WPQA 3UIAA 5APXA 3NMDA 4GT1A 5AW1B 3I5CA 5AVQB 5AVWB 5AW7B 4C7NB 1CSBA 1OWAA 1CI6B 4AYCA 3OAKA 5AVSB 3TK1A 2XU6A 3V4QA 1H8AA 4XE5B 3L36A 3LIDA 5AVTB 3P8MC 5APQA 1MV8A 2YO3A 2WT7B 1H89A 1S9KD 1GU5A 2Q7CA 2E42A 1MFZA 4C46A 5APWA 1GU4A 2E43A 1S9KE 3T97A 5AVVB 5APUA 1JNMA 3KDPB 2QM7A 1T2KC 4EOTA 3V5BA 3HE5A 4JYCA 2KP8A 3M06A 3TNUB 3VTPC 3B8EB
chains in the Genus database with same CATH superfamily
4H44C 5KLIC 3WUUA 1VQ7P 1YYCA 2A45I 4IFDK 5APTA 2HODB 1VQOP 2XKMA 3G3ZA 1VQPP 2KI7B 1YHQP 3Q3DA 1GW4A 2ZYAA 3H1JE 1LWUC 1JY3N 1SFCA 3AE9C 1A02J 4WBAA 3R4YA 2R3CA 1LTGC 2Z5HA 3GMAA 2XV5A 1KORA 3A5TA 2H8PD 2RH0A 1AV1A 4D6TE 1FZCB 2Q9IA 1IO4A 1NKNA 1NTZD 4UB8E 1SQPE 1FDOA 4WY4D 3RK2C 1LGHB 1L0NJ 1LTSC 1HGVA 2PP6A 2ZYGA 1JY3P 2NPSB 4D6TD 3A0HH 4JPZB 3CX5I 2CPBA 3H1HD 2FYUJ 1W2BO 2JJLA 3BVHA 5APSA 1K04A 1FC2C 1ZV8A 2SPZA 3HD7D 1XTGB 2N1TA 3L75J 1QVGO 3PP5A 3HE4A 3VMYA 3D6ZA 1ZXGA 4TT3H 1IFNA 1Q82Q 2C0XA 2KNCA 4U3FJ 1LP1A 1E79H 1OW6A 1ZW0A 3JCUH 3OJAB 5APVA 1AVYA 3IAOA 1M1KQ 1X0TA 1QGKB 1RE4A 1JEKA 1L4AD 2J5UA 2YXQB 5B5EE 3A7OA 2FFDB 1RQUA 3H32B 1W5CE 4QMAA 1GK4A 1AQTA 1UIXA 2N9BA 2V4HA 3CPWO 1Q2NA 2PRRA 4B86A 2E74C 1HGZA 1SP4A 1GK6A 1ZP0C 4RO0A 5TISE 5B66E 2WSEJ 5CCGA 3SSUA 1PZQA 1FS0E 4IL6X 4EDFA 1VQMP 1AFOA 2ZXEB 1SQBJ 2D2CC 2M3EA 3L72J 4PD4D 3MD0A 4AQRD 5L8RJ 1LNQA 1TU3F 4H13D 1J1DB 2YKQA 5E79H 2WVRA 4I2LC 5KLVG 1GTWA 1MUUA 5B5EH 1VQLP 2OYIA 1PP9G 2IPPA 3TGUG 1QEXA 3N4XA 1YITP 1M90Q 4KT0J 4PD4I 2C9LY 4OWFA 1NU1J 4JQ0D 2XNDH 3L37A 3MUDA 1KZUB 4KHXA 2G3AA 3P8CD 3AE7C 2OYHA 2KSEA 1NTMG 1SS1A 1LTIC 1GMJA 4ZNCA 3CCRP 4U3FE 5AW9B 2B9BA 3A0BE 1RF1B 1NTMD 3O8ZA 2W90A 2ZVNB 1GD2E 1KILD 3PLNA 1G1JA 1JMMA 5AW4B 5M1BA 3V2RA 1FZCA 1L0LJ 3IN6A 5DJUB 1NTME 2R5DA 2LKMA 3G9RA 4PD4E 3WMM0 5KLIB 1YQ4C 4BRYA 1JY2N 3BASA 1RE3A 3AE6C 4H44B 3HTKA 5AW8B 3VOPA 3CCEP 1OW8A 1L0ND 3B5ND 4NPEA 1PPJD 1EC5A 1N7SC 2YIUC 1NAFA 1LTJC 1LWUB 1NVOA 1BCCE 5KAFH 1SQXJ 3G4SP 2BCCD 1M1JC 4I7ZB 1M1JB 1PPJG 4I7ZC 1JM0A 1FAVA 1P84E 2HPCB 1GW3A 2PAJA 3VP8A 2N1TB 4GOEA 4U3FG 5E79E 2H7HA 2OYOA 2KZJA 3LW5J 3GF7A 1JMBA 3H1KJ 2QRXA 1URQD 2M8RA 3IR9A 1P84D 5APYA 1KYOI 4U3FD 1FBMA 4H0LC 5B66H 2FY8A 3L71D 1RF1A 1USDA 2KSJA 3OAKA 3TK1A 3L70J 1NAYA 1A02F 3V2QA 4JF7A 4GOFA 1LTBC 2KIKA 3LIDA 2AEMA 3L71G 1AJYA 1Y9BA 1PGOA 3RL0B 1MV8A 3W67A 2B87A 1KILE 1VQ6P 1NO4A 3L72D 5APWA 1KFMA 1PV3A 3HUSA 2QJKC 1BGYJ 1L0LK 2OYIB 1EDJA 4PV1D 1S9KE 2JR8A 1NU1G 1SQBE 4WY4C 4R4LA 5APUA 5AVVB 3T97A 1VQNP 1KMIZ 3E7KA 1SQQG 2FXPA 2QM7A 3A0BH 3I56P 1KYOD 4YPCA 4CPGA 3Q1MA 1M7LA 3RK3D 3M0DC 3HD7B 3V6IA 3H1LD 1SQBK 2ZFCA 5AW6B 4UB8H 3H1IG 2ZT9B 4MN4C 4XA4A 3BCCD 3H1HJ 2E76C 3C8VA 4Z1MH 3H1LE 5KJ7C 2IBZE 3LW5H 4JYBA 3L75D 2Q3EA 1L0NK 3BCCG 1T3JA 5KAIE 2FYNB 3RK2D 2MKVA 4C7NA 3CMAP 4DZOA 1H88A 2IYPA 3CXHE 5H2FE 1Y8AA 3G6EP 1EZVI 1FJPA 2I1JA 1VF5D 4U7JA 1JOCA 1SQXG 3AE1C 2D2CB 1T2KD 3VP9A 4OGQD 3MP7B 1GL2C 1LT1A 4L76A 5TISH 3BATA 5AW5B 3I55P 1G2CB 2BEZF 2HPCA 4HB1A 1BE3D 1EDLA 4GODA 3CWBD 3L73E 4DT0A 2Z4EA 1RY3A 2P58A 1R5LA 3BRTB 1K9MQ 4RESB 3AEBC 1L0LE 1MFTA 1OXZA 1SQBD 2J59M 3HD7A 3KQGA 1YI2P 1PGQA 3AECC 1RF0A 2XDJA 2Y0CA 3S1KA 1CI6A 4A7PA 3CMEP 1K8AQ 1OIPA 4O9BA 1BSNA 3L71J 3KZIE 2P10A 1HWTC 3L73D 5CCGC 1W2EA 2L5GB 3TYYA 1EZVG 2E75B 2VRSA 1FDIA 3CCQP 2Q5UA 3U1CA 1GL2D 4PV1B 3MIWA 2NPSC 1FZGA 2RMZA 1RE4C 2HYNA 3PTZA 4ASWA 1NU1K 3N7NA 1N2DC 3RK3B 4H44D 1VQ5P 1AA0A 1FZFA 2WSEH 5EFWB 3B5NB 4UB6E 3MUDC 1NTZK 2IBZG 3QWOC 3ZDMA 1J1EB 3HE5B 5GTIE 5CCHA 2HG5D 5KLVJ 5AW2B 1KQFB 3RK2B 1KTMA 1GL2A 5AVXB 2QEXP 4M3LA 1Z56A 2V7QJ 2W6JH 2YKPA 1JB0J 4OH8B 1K73Q 2NRGA 2HODA 2E74D 2RN0A 3BCCJ 1URQB 1SQXD 1FOSE 3FX0A 2I8DA 1VQKP 3WUTA 1KYOE 1NTKJ 1BCCD 2E75C 1NTMK 1QLED 2GM4A 2D2CD 2QJPC 2KB7P 3TSIA 1ZMEC 2N9YB 1PPJE 3CLQA 2OARA 1EQ7A 1SLQA 2CPSA 1U7MA 2PGDA 2WSCH 4H13C 4HJGH 4Y99C 3P32A 1FU1A 3AE4C 1KILA 2DW3A 4ZKUA 4RKUJ 1X79B 4YXDC 3H1JD 1N7SB 1L0LG 2ZAEB 2WWWA 1T8ZA 2W27A 5AW3B 5KKZC 1FDMA 3VMZA 4IL6E 1NGMB 2BEQD 2K9JA 1LTTC 3KXDA 4GIFA 2NZ2A 3B5NA 1EXJA 3FGAD 1SQPJ 2ZVOB 3M9BA 3V4WA 1VL2A 3UIAA 1NU1E 1QL1A 1SQBG 1E5WA 5APXA 2WPVB 4TLFA 5CHXA 1S72P 2KK7A 1RF1C 4AUWA 4WB4A 3IFMA 1RHZB 5AVQB 4C7NB 3S4RA 1OWAA 2FFDA 1CI6B 2JKVA 3TF5A 5AVSB 2CK3H 3V4QA 1KB9E 1SQQD 4NPFX 4PJ0H 3L36A 1WT6A 4L74A 3CCJP 1L4AB 1T3UA 1L4AC 2A45H 3CD6P 3H1LG 3HUSB 4BRYB 1T6AA 2KOGA 1S9KD 1JTHB 1VPCA 1BDDA 2K3RA 2XNXA 1S5LH 3L70G 1GU5A 1R5SA 4C46A 1CW5A 2O3JA 1OVVA 2B87B 2A06D 1KFNA 1LJ2A 1N73C 2O01J 1YBKA 4LLHA 2E43A 3AEAC 2E5TA 3L70D 1OFCX 1NTZE 2LXBA 2WSCJ 1JY3O 3D71A 3CCUP 2A06G 2HFED 4EOTA 3HE5A 3M06A 2OYHC 1BCCG 3VTPC 2OYHB 1VQ4P 1YQ3C 4K35A 1HJ0A 4WVZA 3RGUA 1KQGB 1LTJA 3KYQA 3H1KE 1J1DC 1HJBA 3JSVC 3L75E 4IFFA 1KD1Q 3D6YA 1IZNB 1BGYD 2IZ1A 1HUCA 3P7KA 1YTZI 2YXRB 3RL0D 3CCMP 3FXEA 3E1IA 2IYOA 1N8RQ 4DOJA 1JUNA 2QVAA 3F5HA 3FWNA 1LT9C 3SFDC 2FYNC 1BE3E 3V2PA 4EI2A 1H0TA 2AXTE 3H1KG 2NPSA 2XZRA 5BVZA 3CX5E 3EWKA 3FXDA 1KILB 1P84I 1RQVA 2BCCE 2KLVA 2QG4A 4N6JA 2A06E 1L0NG 3K5BA 2R3SA 2FYUG 4H0LB 2OYIC 2P2UA 3H1JJ 4IOIH 5AVYB 2WITA 2QM8A 5CJ4A 3KHUA 2Q1KA 1NHLA 2P67A 3WUVA 4BXLA 4D6TG 2H43A 2R44A 1OZHA 3M0AA 2IBZI 2KS1A 1SQXK 3L75G 3L72E 2AXCA 3VN0A 1LP1B 3T97B 3HD7C 1IFPA 2B89A 3V2NA 1PP9E 3A3YB 3HUSC 3GHGA 3WU2E 5KJ7D 2N1TD 2WSSH 5KKZB 2IZ0A 3NXSA 1YTZT 1BE3J 3F89A 3MGNA 1GDTA 2Z5IA 1VF5C 3CWBG 1FJKA 5C39A 2K1AA 2KZIA 5KLVD 2Q3IA 1SQVJ 2PFXA 2ZJSE 3O6QB 1U7JA 1RF0C 2FXMA 4L75A 4N78E 1DEBA 3L72G 1M1JA 4W7ZA 4C7RA 1VDFA 4DCKA 2P7JA 2K9YA 4WY4A 4IFMA 2FXOA 2K37A 1KQLA 3L73J 4NPDA 4ZMDA 1H89A 1NTKD 1BCCJ 2OQQA 1L0NE 1FZEA 1EDIA 2M0BA 2MJZA 2N1TC 1LT9B 2W6AA 5BU8B 2H88C 1LTAC 3CXHH 2L91A 3Q5RA 2J58A 5AVZB 1KN7A 1NOHA 3AE5C 1NTKK 1IFIA 2C0WA 2W6BA 3BRVB 3Q5PA 1CZQA 1NTZG 1P84H 2E75D 3H1ID 1GZLA 3NTNA 4GKGA 4EIJA 1ZR4A 1N73B 1FOSF 1GL2B 3MTUE 1YJWP 2WPSA 3H32A 2JWAA 2WPRA 3SWKA 2NPSD 3M9QA 3U59A 1QL2A 1L4AA 5GTHH 3NFQA 1YJ9P 2GA1A 2WT7A 2JP3A 1NWQA 3TGUE 3B71A 3IF4A 1IK9A 2ZT9C 3CI9A 4LC1A 4YTPC 2O01H 4D6TJ 4WWIA 3PJSK 2E76B 2K9JB 3HRNA 1NJIQ 1NYHA 4I1LA 3B5NC 3C9IA 2KS1B 2QJYC 1S5LE 2O1KA 2BCCG 3CX5H 1HBWA 2E74B 3JC22 1S1CX 1USEA 3NMDA 2JWDA 3PRJA 5KAIH 4GT1A 1MZ9A 1X22A 1BE3G 2OGUA 3I5CA 3R2PA 2FKWB 1CSBA 1SQPG 4AYCA 1ZRTE 2JO1A 3U1AA 1JY2P 1URQA 2I1KA 1H8AA 5KTBA 2IX7C 3L74J 1BDCA 1SQPD 5AVTB 4H13B 1PP9D 3CC4P 2ZXXA 3WU2H 1FZCC 2YO3A 2AEJA 2GUVA 2LXCB 2WSFJ 1G2CA 3O6QA 2ITAA 3L73G 1ZRTD 2QJKB 2W8ZA 3AEDC 1NKZB 4WY4B 5K5GB 1SQVE 1ZLLA 1KYOH 4W7YA 1JNMA 1S2EA 1SQQJ 4EYYQ 3AEGC 1Q86Q 1AQ5A 1T2KC 4Y28J 5BU5A 2KP8A 3RL0g 3H1HE 4ZKPA 3B8EB 1NTZJ 3L4FA 2V7QH 3RBXA 1SQVK 3L74E 1R8EA 2QA4P 2AXTH 1N73A 1KV4A 3RK3C 3FWLA 1DEEG 3H1IJ 3MHVA 1LTJB 1RH5B 3A2AA 1FE6A 1FZAA 3TGUJ 3A0HE 2KXPB 1IFJA 3Q2YA 1JCCA 2YNYA 1SFCB 2QE7H 4I6MC 1OX3A 1PL5A 1Q90D 2OTLP 1DIPA 2IDBA 3LIEA 1KC8Q 3MZWB 1S4XA 3VMXA 1RE3C 4UB6H 1KQSO 2W83C 3AE8C 1N86A 1EZVE 1ZN5A 1JCDA 4LGDE 3KPEA 4DJGA 1JTHA 1URQC 2YKOA 3HE4B 2Y9ZA 1HF9A 2BCCJ 1S5LX 2POHA 1FZBA 2QJPB 4HYTB 1KB9I 2WQYC 3CCLP 3CC7P 2HLOA 2KNCB 2FYUK 3L70E 3P8CE 1IFMA 1N7SD 2Y9YA 3GHGC 1IC2A 3GF3A 4PD4H 2GUSA 3H1JG 3TDKA 1G1IA 2C9NY 3L71E 3D70A 1Q7YQ 1SQVD 1IFDA 1Y47A 2HR3A 2YIUB 3M0DA 1KB9D 1SQQE 3CXHD 3GG2A 4N3YB 1S3JA 1SQPK 2YMKA 1HTLC 2R32A 4OVNF 2WTYA 5DJTB 3EFFK 1Q81Q 1U57A 1D7MA 1XTCC 1HH0A 1SFCC 2RKLA 1OVRA 1HVVA 2FYUE 3EQ2A 3ABVC 4H0LD 5AVUB 1NU1D 2OTKE 4ASVA 1EDKA 1KILC 3II6A 4PV1C 5KLVK 3CL3D 2AEFA 3HTKB 4R4MA 1DD4A 3M9HA 3AE2C 1EZVD 1MKMA 2M3BA 5AW0B 3RK3E 3M91A 3E1RA 1NH4A 3PH0A 1SVFA 1NTMJ 3KZIH 4YXWH 2K88A 5CBNA 3B4SA 5CBOA 4L73A 4XFJA 1AVOA 1J2JB 2QJYB 2BASA 2E5YA 2WZ7A 2E76D 4HKZH 2LR2A 3RBZA 3SWFA 3TNUA 2Q6QA 1DH3A 4W80A 3H25A 2Y0EA 5CCGD 1PIXA 5CMZA 1DX7A 1PGJA 2UWJE 3QH9A 4HH2A 3CCVP 4IL6H 1OVUA 3USSA 5GTHE 3ITKA 1SFCD 2ZYDA 2KUBA 5KAFE 1BGYG 2G8YA 1ZR2A 2OTJP 2IFMA 1VQ8P 3AE3C 5AVRB 1X9VA 3TGUD 1BSHA 1NTKG 3G71P 4OGQC 4GDOA 1X8YA 4OGQB 5CJ0A 5CCHC 4Y99B 3W68A 1PGPA 2WSFH 3H1KD 1WRGA 2O01N 3L35A 5GTIH 1M57D 2R5BA 1M56D 2P1JA 2FYUD 3Q5SA 2YO2A 2A45G 4PJ0E 3H1HG 1M8OB 4K3AA 1KB9H 2M5AA 1EXIA 5TJHA 2WMMA 4KJMA 3OA7A 3VYIA 4BWNA 2FFDC 1QVFO 1LWUA 1L0LD 1L2PA 1OMIA 3H1IE 1OW7A 3AEFC 2M5AB 1N7LA 3CWBJ 3SFEC 1YIJP 1JO5A 2FBWC 1SQXE 5H2FH 3CC2P 2WPQA 2Y0DA 3C1LA 1SQVG 3BCCE 5AW1B 3VMAA 3OW2O 5AVWB 5AW7B 5CCHD 5KJ7A 3GW6A 1VQ9P 2XU6A 5KLVE 4XE5B 1IK7A 2KYVA 2ZT9D 1H0TB 3PHLA 2FYZA 2B88A 3P8MC 5APQA 1BGYE 3S9OA 3RL0C 2WT7B 3SWYA 3AEEC 1J1EC 2IFNA 3H1LJ 3H6PA 1JY2O 1SQQK 2IBZD 2Q7CA 2E42A 1MFZA 1NTKE 2JDIH 2JEEA 1GU4A 2H89C 3L74G 1N7SA 3CCSP 2QIWA 1DD3A 3EFGA 4RJTA 1UIIA 1WMKA 1VF5B 1IJDB 1K05A 3CWBE 3CX5D 2O1JA 1ZOYC 2QSIA 3GLMA 3JCUE 3KDPB 3L74D 1PFIA 1PP9J 3CXHI 4N78D 4JYCA 3TNUB 4JBZA 2YMYA 3V5BA 1YJNP 1QX8A 2KLUA 1LT9A 3GHGB
chains in the Genus database with same CATH topology
1YYCA 2A45I 4IFDK 5APTA 2HODB 2XKMA 3G3ZA 1GW4A 1LWUC 1JY3N 1SFCA 1A02J 4WBAA 2R3CA 1LTGC 2Z5HA 3A5TA 2XV5A 2H8PD 1FZCB 2Q9IA 1IO4A 1NKNA 4WY4D 3RK2C 1LGHB 1LTSC 1HGVA 2PP6A 1JY3P 2NPSB 2CPBA 2JJLA 3BVHA 5APSA 3HD7D 1ZV8A 1XTGB 2N1TA 3PP5A 3HE4A 3VMYA 1IFNA 2C0XA 3OJAB 5APVA 1RE4A 1L4AD 3A7OA 3H32B 1GK4A 2N9BA 4B86A 1HGZA 1SP4A 1GK6A 5CCGA 1AFOA 2ZXEB 3MD0A 4AQRD 1J1DB 2YKQA 4I2LC 1GTWA 1MUUA 2OYIA 2IPPA 3N4XA 3L37A 3MUDA 1KZUB 4KHXA 3P8CD 2OYHA 1LTIC 5AW9B 1RF1B 3O8ZA 1GD2E 1KILD 1G1JA 1JMMA 5AW4B 3V2RA 1FZCA 2R5DA 2LKMA 3WMM0 1JY2N 3BASA 1RE3A 3HTKA 5AW8B 3VOPA 3B5ND 1N7SC 1NAFA 1LTJC 1LWUB 1M1JC 1M1JB 1FAVA 2HPCB 1GW3A 3VP8A 2N1TB 2H7HA 5APYA 3IR9A 1URQD 2M8RA 1FBMA 1RF1A 2KSJA 3OAKA 3TK1A 3V2QA 4JF7A 1LTBC 3LIDA 3RL0B 1MV8A 1NO4A 5APWA 1KFMA 3HUSA 2OYIB 1L0LK 1S9KE 4WY4C 3T97A 5AVVB 5APUA 2QM7A 1M7LA 3RK3D 3M0DC 3HD7B 1SQBK 2ZFCA 5AW6B 4XA4A 5KJ7C 3LW5H 4JYBA 3RK2D 4C7NA 1L0NK 2FFDB 1T3JA 1H88A 4DZOA 1FJPA 2I1JA 1JOCA 1T2KD 3VP9A 1GL2C 3BATA 5AW5B 1G2CB 2HPCA 2Z4EA 1RY3A 3BRTB 4RESB 3KQGA 1OXZA 3HD7A 2J59M 1RF0A 2XDJA 1CI6A 4O9BA 1HWTC 5CCGC 1W2EA 2L5GB 3TYYA 2VRSA 2Q5UA 3U1CA 1GL2D 3MIWA 2NPSC 1FZGA 1RE4C 2HYNA 1NU1K 3N7NA 1N2DC 3RK3B 1FZFA 2WSEH 3B5NB 1NTZK 1J1EB 3HE5B 5CCHA 2HG5D 5AW2B 3RK2B 1GL2A 5AVXB 4M3LA 1Z56A 2YKPA 4OH8B 2HODA 1URQB 1FOSE 2GM4A 1NTMK 2KB7P 3TSIA 4AUWA 3CLQA 2OARA 1EQ7A 1SLQA 2CPSA 2WSCH 4Y99C 3P32A 1FU1A 1KILA 4ZKUA 1X79B 1N7SB 2WWWA 1T8ZA 2W27A 5AW3B 1FDMA 3VMZA 4GIFA 1LTTC 3B5NA 3M9BA 3V4WA 3UIAA 5APXA 1QL1A 1E5WA 5CHXA 1RF1C 4WB4A 3IFMA 5AVQB 4C7NB 2FFDA 1OWAA 1CI6B 5AVSB 3V4QA 3L36A 1WT6A 1L4AB 1T3UA 1L4AC 2A45H 3HUSB 1S9KD 2KOGA 1GU5A 1H89A 1JTHB 1VPCA 2XNXA 1CW5A 4C46A 2E43A 1KFNA 1N73C 4LLHA 1JY3O 2HFED 4EOTA 3HE5A 3M06A 2OYHC 3VTPC 2OYHB 3KYQA 1LTJA 1J1DC 1HJBA 4IFFA 3P7KA 1HUCA 1YTZI 3RL0D 3E1IA 4DOJA 1JUNA 1LT9C 3V2PA 2NPSA 2XZRA 5BVZA 4N6JA 1KILB 2KLVA 2OYIC 2P2UA 5AVYB 2WITA 2QM8A 5CJ4A 1NHLA 2P67A 2H43A 3M0AA 3VN0A 1SQXK 3HD7C 3V2NA 3A3YB 3HUSC 3GHGA 5KJ7D 2N1TD 3NXSA 1YTZT 3MGNA 1GDTA 2Z5IA 1FJKA 2Q3IA 4N78E 2C9LY 2FXMA 1RF0C 1DEBA 1M1JA 4W7ZA 4C7RA 1VDFA 2P7JA 4WY4A 4IFMA 1KQLA 1FZEA 2MJZA 2N1TC 1LT9B 2W6AA 5BU8B 1LTAC 2J58A 5AVZB 1NOHA 3BRVB 1NTKK 1IFIA 2C0WA 2W6BA 1CZQA 4EIJA 3NTNA 4GKGA 1GZLA 1ZR4A 1N73B 1FOSF 1GL2B 3MTUE 2WPSA 3H32A 2WPRA 2NPSD 3M9QA 3U59A 1QL2A 1L4AA 3NFQA 2WT7A 1NWQA 1IK9A 3CI9A 4LC1A 2O01H 3HRNA 4I1LA 3B5NC 3C9IA 2O1KA 1HBWA 3NMDA 4GT1A 1MZ9A 3I5CA 3R2PA 2FKWB 1CSBA 4AYCA 3U1AA 1JY2P 1URQA 2I1KA 1H8AA 5KTBA 2IX7C 5AVTB 1FZCC 2YO3A 2GUVA 1G2CA 1NKZB 4WY4B 1ZLLA 4W7YA 1AQ5A 1JNMA 1T2KC 5BU5A 2KP8A 4ZKPA 3B8EB 3L4FA 1SQVK 1N73A 3RK3C 1LTJB 3A2AA 1FZAA 1IFJA 1JCCA 2YNYA 1SFCB 4I6MC 3LIEA 3VMXA 1RE3C 1N86A 1ZN5A 1JCDA 4LGDE 3KPEA 1JTHA 3HE4B 1URQC 2YKOA 4HYTB 2POHA 1FZBA 2HLOA 2FYUK 3P8CE 1IFMA 1N7SD 3GHGC 1IC2A 2GUSA 1G1IA 2C9NY 1IFDA 3M0DA 4N3YB 1SQPK 1HTLC 2R32A 2WTYA 3EQ2A 1XTCC 1HH0A 1SFCC 5AVUB 1HVVA 5KJ7A 5KLVK 1KILC 3II6A 1A02F 3CL3D 3HTKB 3M9HA 2M3BA 5AW0B 3M91A 1NH4A 1SVFA 1J2JB 2WZ7A 2BASA 1DH3A 3SWFA 3TNUA 4W80A 5CCGD 5CMZA 4HH2A 1SFCD 1ZR2A 2IFMA 5AVRB 1X9VA 5CCHC 1X8YA 5CJ0A 4Y99B 2WSFH 1WRGA 3L35A 2R5BA 2P1JA 2YO2A 2A45G 3VYIA 3OA7A 2FFDC 1LWUA 1JO5A 1N7LA 2WPQA 5AW1B 5AVWB 5AW7B 5CCHD 2XU6A 4XE5B 2KYVA 2FYZA 3P8MC 5APQA 3RL0C 2WT7B 3SWYA 1J1EC 2IFNA 3H6PA 1JY2O 1SQQK 2Q7CA 2E42A 1MFZA 1GU4A 2JEEA 1N7SA 1DX7A 3EFGA 1IJDB 2O1JA 3KDPB 1PFIA 4N78D 4JYCA 3TNUB 3V5BA 2YMYA 2PAJA 1LT9A 3GHGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZFC A;  5AW6 B;  1YYC A;  1HJB A;  5APT A;  3P7K A;  1HUC A;  3A2A A;  1A02 J;  4JYB A;  1JUN A;  4C7N A;  2R3C A;  3A5T A;  2Z5H A;  1H88 A;  2XV5 A;  2YNY A;  4I6M C;  4DZO A;  1IO4 A;  2XZR A;  3LIE A;  3VMX A;  1T2K D;  2P2U A;  5AVY B;  5AW5 B;  2JJL A;  3HE4 B;  2QM8 A;  1G2C B;  5APS A;  2P67 A;  4HYT B;  3M0A A;  3VN0 A;  3HE4 A;  3VMY A;  2C9N Y;  4RES B;  3A3Y B;  3KQG A;  1OXZ A;  5APV A;  3M0D A;  1CI6 A;  2R32 A;  3A7O A;  3NXS A;  1HWT C;  2WTY A;  3MGN A;  1GK4 A;  2N9B A;  2Z5I A;  5AVU B;  4B86 A;  3TYY A;  1SP4 A;  1GK6 A;  2VRS A;  1A02 F;  2Q5U A;  3M9H A;  2ZXE B;  2Q3I A;  2C9L Y;  5AW0 B;  3MD0 A;  3M91 A;  4AQR D;  2P7J A;  4I2L C;  1GTW A;  1MUU A;  1KQL A;  2IPP A;  1J2J B;  2BAS A;  1DH3 A;  3L37 A;  2W6A A;  3SWF A;  3HE5 B;  3TNU A;  4KHX A;  5AW2 B;  5CMZ A;  5AVZ B;  5AVX B;  4M3L A;  1CZQ A;  3NTN A;  5AW9 B;  4GKG A;  1GZL A;  1FOS F;  3O8Z A;  1GD2 E;  1FOS E;  2WPS A;  5AVR B;  2WPR A;  5AW4 B;  1X8Y A;  4AUW A;  3NFQ A;  2R5D A;  1SLQ A;  2WT7 A;  3P32 A;  1NWQ A;  3HTK A;  5AW8 B;  3L35 A;  2R5B A;  4LC1 A;  1NAF A;  2YO2 A;  2WWW A;  2W27 A;  5AW3 B;  3VMZ A;  3VYI A;  1FAV A;  2H7H A;  1HBW A;  3M9B A;  5APY A;  3IR9 A;  3V4W A;  2WPQ A;  3UIA A;  5APX A;  3NMD A;  4GT1 A;  5AW1 B;  3I5C A;  5AVQ B;  5AVW B;  5AW7 B;  4C7N B;  1CSB A;  1OWA A;  1CI6 B;  4AYC A;  3OAK A;  5AVS B;  3TK1 A;  2XU6 A;  3V4Q A;  1H8A A;  4XE5 B;  3L36 A;  3LID A;  5AVT B;  3P8M C;  5APQ A;  1MV8 A;  2YO3 A;  2WT7 B;  1H89 A;  1S9K D;  1GU5 A;  2Q7C A;  2E42 A;  1MFZ A;  4C46 A;  5APW A;  1GU4 A;  2E43 A;  1S9K E;  3T97 A;  5AVV B;  5APU A;  1JNM A;  3KDP B;  2QM7 A;  1T2K C;  4EOT A;  3V5B A;  3HE5 A;  4JYC A;  2KP8 A;  3M06 A;  3TNU B;  3VTP C;  3B8E B; 
#chains in the Genus database with same CATH topology
 4H44 C;  5KLI C;  3WUU A;  1VQ7 P;  1YYC A;  2A45 I;  4IFD K;  5APT A;  2HOD B;  1VQO P;  2XKM A;  3G3Z A;  1VQP P;  2KI7 B;  1YHQ P;  3Q3D A;  1GW4 A;  2ZYA A;  3H1J E;  1LWU C;  1JY3 N;  1SFC A;  3AE9 C;  1A02 J;  4WBA A;  3R4Y A;  2R3C A;  1LTG C;  2Z5H A;  3GMA A;  2XV5 A;  1KOR A;  3A5T A;  2H8P D;  2RH0 A;  1AV1 A;  4D6T E;  1FZC B;  2Q9I A;  1IO4 A;  1NKN A;  1NTZ D;  4UB8 E;  1SQP E;  1FDO A;  4WY4 D;  3RK2 C;  1LGH B;  1L0N J;  1LTS C;  1HGV A;  2PP6 A;  2ZYG A;  1JY3 P;  2NPS B;  4D6T D;  3A0H H;  4JPZ B;  3CX5 I;  2CPB A;  3H1H D;  2FYU J;  1W2B O;  2JJL A;  3BVH A;  5APS A;  1K04 A;  1FC2 C;  1ZV8 A;  2SPZ A;  3HD7 D;  1XTG B;  2N1T A;  3L75 J;  1QVG O;  3PP5 A;  3HE4 A;  3VMY A;  3D6Z A;  1ZXG A;  4TT3 H;  1IFN A;  1Q82 Q;  2C0X A;  2KNC A;  4U3F J;  1LP1 A;  1E79 H;  1OW6 A;  1ZW0 A;  3JCU H;  3OJA B;  5APV A;  1AVY A;  3IAO A;  1M1K Q;  1X0T A;  1QGK B;  1RE4 A;  1JEK A;  1L4A D;  2J5U A;  2YXQ B;  5B5E E;  3A7O A;  2FFD B;  1RQU A;  3H32 B;  1W5C E;  4QMA A;  1GK4 A;  1AQT A;  1UIX A;  2N9B A;  2V4H A;  3CPW O;  1Q2N A;  2PRR A;  4B86 A;  2E74 C;  1HGZ A;  1SP4 A;  1GK6 A;  1ZP0 C;  4RO0 A;  5TIS E;  5B66 E;  2WSE J;  5CCG A;  3SSU A;  1PZQ A;  1FS0 E;  4IL6 X;  4EDF A;  1VQM P;  1AFO A;  2ZXE B;  1SQB J;  2D2C C;  2M3E A;  3L72 J;  4PD4 D;  3MD0 A;  4AQR D;  5L8R J;  1LNQ A;  1TU3 F;  4H13 D;  1J1D B;  2YKQ A;  5E79 H;  2WVR A;  4I2L C;  5KLV G;  1GTW A;  1MUU A;  5B5E H;  1VQL P;  2OYI A;  1PP9 G;  2IPP A;  3TGU G;  1QEX A;  3N4X A;  1YIT P;  1M90 Q;  4KT0 J;  4PD4 I;  2C9L Y;  4OWF A;  1NU1 J;  4JQ0 D;  2XND H;  3L37 A;  3MUD A;  1KZU B;  4KHX A;  2G3A A;  3P8C D;  3AE7 C;  2OYH A;  2KSE A;  1NTM G;  1SS1 A;  1LTI C;  1GMJ A;  4ZNC A;  3CCR P;  4U3F E;  5AW9 B;  2B9B A;  3A0B E;  1RF1 B;  1NTM D;  3O8Z A;  2W90 A;  2ZVN B;  1GD2 E;  1KIL D;  3PLN A;  1G1J A;  1JMM A;  5AW4 B;  5M1B A;  3V2R A;  1FZC A;  1L0L J;  3IN6 A;  5DJU B;  1NTM E;  2R5D A;  2LKM A;  3G9R A;  4PD4 E;  3WMM 0;  5KLI B;  1YQ4 C;  4BRY A;  1JY2 N;  3BAS A;  1RE3 A;  3AE6 C;  4H44 B;  3HTK A;  5AW8 B;  3VOP A;  3CCE P;  1OW8 A;  1L0N D;  3B5N D;  4NPE A;  1PPJ D;  1EC5 A;  1N7S C;  2YIU C;  1NAF A;  1LTJ C;  1LWU B;  1NVO A;  1BCC E;  5KAF H;  1SQX J;  3G4S P;  2BCC D;  1M1J C;  4I7Z B;  1M1J B;  1PPJ G;  4I7Z C;  1JM0 A;  1FAV A;  1P84 E;  2HPC B;  1GW3 A;  2PAJ A;  3VP8 A;  2N1T B;  4GOE A;  4U3F G;  5E79 E;  2H7H A;  2OYO A;  2KZJ A;  3LW5 J;  3GF7 A;  1JMB A;  3H1K J;  2QRX A;  1URQ D;  2M8R A;  3IR9 A;  1P84 D;  5APY A;  1KYO I;  4U3F D;  1FBM A;  4H0L C;  5B66 H;  2FY8 A;  3L71 D;  1RF1 A;  1USD A;  2KSJ A;  3OAK A;  3TK1 A;  3L70 J;  1NAY A;  1A02 F;  3V2Q A;  4JF7 A;  4GOF A;  1LTB C;  2KIK A;  3LID A;  2AEM A;  3L71 G;  1AJY A;  1Y9B A;  1PGO A;  3RL0 B;  1MV8 A;  3W67 A;  2B87 A;  1KIL E;  1VQ6 P;  1NO4 A;  3L72 D;  5APW A;  1KFM A;  1PV3 A;  3HUS A;  2QJK C;  1BGY J;  1L0L K;  2OYI B;  1EDJ A;  4PV1 D;  1S9K E;  2JR8 A;  1NU1 G;  1SQB E;  4WY4 C;  4R4L A;  5APU A;  5AVV B;  3T97 A;  1VQN P;  1KMI Z;  3E7K A;  1SQQ G;  2FXP A;  2QM7 A;  3A0B H;  3I56 P;  1KYO D;  4YPC A;  4CPG A;  3Q1M A;  1M7L A;  3RK3 D;  3M0D C;  3HD7 B;  3V6I A;  3H1L D;  1SQB K;  2ZFC A;  5AW6 B;  4UB8 H;  3H1I G;  2ZT9 B;  4MN4 C;  4XA4 A;  3BCC D;  3H1H J;  2E76 C;  3C8V A;  4Z1M H;  3H1L E;  5KJ7 C;  2IBZ E;  3LW5 H;  4JYB A;  3L75 D;  2Q3E A;  1L0N K;  3BCC G;  1T3J A;  5KAI E;  2FYN B;  3RK2 D;  2MKV A;  4C7N A;  3CMA P;  4DZO A;  1H88 A;  2IYP A;  3CXH E;  5H2F E;  1Y8A A;  3G6E P;  1EZV I;  1FJP A;  2I1J A;  1VF5 D;  4U7J A;  1JOC A;  1SQX G;  3AE1 C;  2D2C B;  1T2K D;  3VP9 A;  4OGQ D;  3MP7 B;  1GL2 C;  1LT1 A;  4L76 A;  5TIS H;  3BAT A;  5AW5 B;  3I55 P;  1G2C B;  2BEZ F;  2HPC A;  4HB1 A;  1BE3 D;  1EDL A;  4GOD A;  3CWB D;  3L73 E;  4DT0 A;  2Z4E A;  1RY3 A;  2P58 A;  1R5L A;  3BRT B;  1K9M Q;  4RES B;  3AEB C;  1L0L E;  1MFT A;  1OXZ A;  1SQB D;  2J59 M;  3HD7 A;  3KQG A;  1YI2 P;  1PGQ A;  3AEC C;  1RF0 A;  2XDJ A;  2Y0C A;  3S1K A;  1CI6 A;  4A7P A;  3CME P;  1K8A Q;  1OIP A;  4O9B A;  1BSN A;  3L71 J;  3KZI E;  2P10 A;  1HWT C;  3L73 D;  5CCG C;  1W2E A;  2L5G B;  3TYY A;  1EZV G;  2E75 B;  2VRS A;  1FDI A;  3CCQ P;  2Q5U A;  3U1C A;  1GL2 D;  4PV1 B;  3MIW A;  2NPS C;  1FZG A;  2RMZ A;  1RE4 C;  2HYN A;  3PTZ A;  4ASW A;  1NU1 K;  3N7N A;  1N2D C;  3RK3 B;  4H44 D;  1VQ5 P;  1AA0 A;  1FZF A;  2WSE H;  5EFW B;  3B5N B;  4UB6 E;  3MUD C;  1NTZ K;  2IBZ G;  3QWO C;  3ZDM A;  1J1E B;  3HE5 B;  5GTI E;  5CCH A;  2HG5 D;  5KLV J;  5AW2 B;  1KQF B;  3RK2 B;  1KTM A;  1GL2 A;  5AVX B;  2QEX P;  4M3L A;  1Z56 A;  2V7Q J;  2W6J H;  2YKP A;  1JB0 J;  4OH8 B;  1K73 Q;  2NRG A;  2HOD A;  2E74 D;  2RN0 A;  3BCC J;  1URQ B;  1SQX D;  1FOS E;  3FX0 A;  2I8D A;  1VQK P;  3WUT A;  1KYO E;  1NTK J;  1BCC D;  2E75 C;  1NTM K;  1QLE D;  2GM4 A;  2D2C D;  2QJP C;  2KB7 P;  3TSI A;  1ZME C;  2N9Y B;  1PPJ E;  3CLQ A;  2OAR A;  1EQ7 A;  1SLQ A;  2CPS A;  1U7M A;  2PGD A;  2WSC H;  4H13 C;  4HJG H;  4Y99 C;  3P32 A;  1FU1 A;  3AE4 C;  1KIL A;  2DW3 A;  4ZKU A;  4RKU J;  1X79 B;  4YXD C;  3H1J D;  1N7S B;  1L0L G;  2ZAE B;  2WWW A;  1T8Z A;  2W27 A;  5AW3 B;  5KKZ C;  1FDM A;  3VMZ A;  4IL6 E;  1NGM B;  2BEQ D;  2K9J A;  1LTT C;  3KXD A;  4GIF A;  2NZ2 A;  3B5N A;  1EXJ A;  3FGA D;  1SQP J;  2ZVO B;  3M9B A;  3V4W A;  1VL2 A;  3UIA A;  1NU1 E;  1QL1 A;  1SQB G;  1E5W A;  5APX A;  2WPV B;  4TLF A;  5CHX A;  1S72 P;  2KK7 A;  1RF1 C;  4AUW A;  4WB4 A;  3IFM A;  1RHZ B;  5AVQ B;  4C7N B;  3S4R A;  1OWA A;  2FFD A;  1CI6 B;  2JKV A;  3TF5 A;  5AVS B;  2CK3 H;  3V4Q A;  1KB9 E;  1SQQ D;  4NPF X;  4PJ0 H;  3L36 A;  1WT6 A;  4L74 A;  3CCJ P;  1L4A B;  1T3U A;  1L4A C;  2A45 H;  3CD6 P;  3H1L G;  3HUS B;  4BRY B;  1T6A A;  2KOG A;  1S9K D;  1JTH B;  1VPC A;  1BDD A;  2K3R A;  2XNX A;  1S5L H;  3L70 G;  1GU5 A;  1R5S A;  4C46 A;  1CW5 A;  2O3J A;  1OVV A;  2B87 B;  2A06 D;  1KFN A;  1LJ2 A;  1N73 C;  2O01 J;  1YBK A;  4LLH A;  2E43 A;  3AEA C;  2E5T A;  3L70 D;  1OFC X;  1NTZ E;  2LXB A;  2WSC J;  1JY3 O;  3D71 A;  3CCU P;  2A06 G;  2HFE D;  4EOT A;  3HE5 A;  3M06 A;  2OYH C;  1BCC G;  3VTP C;  2OYH B;  1VQ4 P;  1YQ3 C;  4K35 A;  1HJ0 A;  4WVZ A;  3RGU A;  1KQG B;  1LTJ A;  3KYQ A;  3H1K E;  1J1D C;  1HJB A;  3JSV C;  3L75 E;  4IFF A;  1KD1 Q;  3D6Y A;  1IZN B;  1BGY D;  2IZ1 A;  1HUC A;  3P7K A;  1YTZ I;  2YXR B;  3RL0 D;  3CCM P;  3FXE A;  3E1I A;  2IYO A;  1N8R Q;  4DOJ A;  1JUN A;  2QVA A;  3F5H A;  3FWN A;  1LT9 C;  3SFD C;  2FYN C;  1BE3 E;  3V2P A;  4EI2 A;  1H0T A;  2AXT E;  3H1K G;  2NPS A;  2XZR A;  5BVZ A;  3CX5 E;  3EWK A;  3FXD A;  1KIL B;  1P84 I;  1RQV A;  2BCC E;  2KLV A;  2QG4 A;  4N6J A;  2A06 E;  1L0N G;  3K5B A;  2R3S A;  2FYU G;  4H0L B;  2OYI C;  2P2U A;  3H1J J;  4IOI H;  5AVY B;  2WIT A;  2QM8 A;  5CJ4 A;  3KHU A;  2Q1K A;  1NHL A;  2P67 A;  3WUV A;  4BXL A;  4D6T G;  2H43 A;  2R44 A;  1OZH A;  3M0A A;  2IBZ I;  2KS1 A;  1SQX K;  3L75 G;  3L72 E;  2AXC A;  3VN0 A;  1LP1 B;  3T97 B;  3HD7 C;  1IFP A;  2B89 A;  3V2N A;  1PP9 E;  3A3Y B;  3HUS C;  3GHG A;  3WU2 E;  5KJ7 D;  2N1T D;  2WSS H;  5KKZ B;  2IZ0 A;  3NXS A;  1YTZ T;  1BE3 J;  3F89 A;  3MGN A;  1GDT A;  2Z5I A;  1VF5 C;  3CWB G;  1FJK A;  5C39 A;  2K1A A;  2KZI A;  5KLV D;  2Q3I A;  1SQV J;  2PFX A;  2ZJS E;  3O6Q B;  1U7J A;  1RF0 C;  2FXM A;  4L75 A;  4N78 E;  1DEB A;  3L72 G;  1M1J A;  4W7Z A;  4C7R A;  1VDF A;  4DCK A;  2P7J A;  2K9Y A;  4WY4 A;  4IFM A;  2FXO A;  2K37 A;  1KQL A;  3L73 J;  4NPD A;  4ZMD A;  1H89 A;  1NTK D;  1BCC J;  2OQQ A;  1L0N E;  1FZE A;  1EDI A;  2M0B A;  2MJZ A;  2N1T C;  1LT9 B;  2W6A A;  5BU8 B;  2H88 C;  1LTA C;  3CXH H;  2L91 A;  3Q5R A;  2J58 A;  5AVZ B;  1KN7 A;  1NOH A;  3AE5 C;  1NTK K;  1IFI A;  2C0W A;  2W6B A;  3BRV B;  3Q5P A;  1CZQ A;  1NTZ G;  1P84 H;  2E75 D;  3H1I D;  1GZL A;  3NTN A;  4GKG A;  4EIJ A;  1ZR4 A;  1N73 B;  1FOS F;  1GL2 B;  3MTU E;  1YJW P;  2WPS A;  3H32 A;  2JWA A;  2WPR A;  3SWK A;  2NPS D;  3M9Q A;  3U59 A;  1QL2 A;  1L4A A;  5GTH H;  3NFQ A;  1YJ9 P;  2GA1 A;  2WT7 A;  2JP3 A;  1NWQ A;  3TGU E;  3B71 A;  3IF4 A;  1IK9 A;  2ZT9 C;  3CI9 A;  4LC1 A;  4YTP C;  2O01 H;  4D6T J;  4WWI A;  3PJS K;  2E76 B;  2K9J B;  3HRN A;  1NJI Q;  1NYH A;  4I1L A;  3B5N C;  3C9I A;  2KS1 B;  2QJY C;  1S5L E;  2O1K A;  2BCC G;  3CX5 H;  1HBW A;  2E74 B;  3JC2 2;  1S1C X;  1USE A;  3NMD A;  2JWD A;  3PRJ A;  5KAI H;  4GT1 A;  1MZ9 A;  1X22 A;  1BE3 G;  2OGU A;  3I5C A;  3R2P A;  2FKW B;  1CSB A;  1SQP G;  4AYC A;  1ZRT E;  2JO1 A;  3U1A A;  1JY2 P;  1URQ A;  2I1K A;  1H8A A;  5KTB A;  2IX7 C;  3L74 J;  1BDC A;  1SQP D;  5AVT B;  4H13 B;  1PP9 D;  3CC4 P;  2ZXX A;  3WU2 H;  1FZC C;  2YO3 A;  2AEJ A;  2GUV A;  2LXC B;  2WSF J;  1G2C A;  3O6Q A;  2ITA A;  3L73 G;  1ZRT D;  2QJK B;  2W8Z A;  3AED C;  1NKZ B;  4WY4 B;  5K5G B;  1SQV E;  1ZLL A;  1KYO H;  4W7Y A;  1JNM A;  1S2E A;  1SQQ J;  4EYY Q;  3AEG C;  1Q86 Q;  1AQ5 A;  1T2K C;  4Y28 J;  5BU5 A;  2KP8 A;  3RL0 g;  3H1H E;  4ZKP A;  3B8E B;  1NTZ J;  3L4F A;  2V7Q H;  3RBX A;  1SQV K;  3L74 E;  1R8E A;  2QA4 P;  2AXT H;  1N73 A;  1KV4 A;  3RK3 C;  3FWL A;  1DEE G;  3H1I J;  3MHV A;  1LTJ B;  1RH5 B;  3A2A A;  1FE6 A;  1FZA A;  3TGU J;  3A0H E;  2KXP B;  1IFJ A;  3Q2Y A;  1JCC A;  2YNY A;  1SFC B;  2QE7 H;  4I6M C;  1OX3 A;  1PL5 A;  1Q90 D;  2OTL P;  1DIP A;  2IDB A;  3LIE A;  1KC8 Q;  3MZW B;  1S4X A;  3VMX A;  1RE3 C;  4UB6 H;  1KQS O;  2W83 C;  3AE8 C;  1N86 A;  1EZV E;  1ZN5 A;  1JCD A;  4LGD E;  3KPE A;  4DJG A;  1JTH A;  1URQ C;  2YKO A;  3HE4 B;  2Y9Z A;  1HF9 A;  2BCC J;  1S5L X;  2POH A;  1FZB A;  2QJP B;  4HYT B;  1KB9 I;  2WQY C;  3CCL P;  3CC7 P;  2HLO A;  2KNC B;  2FYU K;  3L70 E;  3P8C E;  1IFM A;  1N7S D;  2Y9Y A;  3GHG C;  1IC2 A;  3GF3 A;  4PD4 H;  2GUS A;  3H1J G;  3TDK A;  1G1I A;  2C9N Y;  3L71 E;  3D70 A;  1Q7Y Q;  1SQV D;  1IFD A;  1Y47 A;  2HR3 A;  2YIU B;  3M0D A;  1KB9 D;  1SQQ E;  3CXH D;  3GG2 A;  4N3Y B;  1S3J A;  1SQP K;  2YMK A;  1HTL C;  2R32 A;  4OVN F;  2WTY A;  5DJT B;  3EFF K;  1Q81 Q;  1U57 A;  1D7M A;  1XTC C;  1HH0 A;  1SFC C;  2RKL A;  1OVR A;  1HVV A;  2FYU E;  3EQ2 A;  3ABV C;  4H0L D;  5AVU B;  1NU1 D;  2OTK E;  4ASV A;  1EDK A;  1KIL C;  3II6 A;  4PV1 C;  5KLV K;  3CL3 D;  2AEF A;  3HTK B;  4R4M A;  1DD4 A;  3M9H A;  3AE2 C;  1EZV D;  1MKM A;  2M3B A;  5AW0 B;  3RK3 E;  3M91 A;  3E1R A;  1NH4 A;  3PH0 A;  1SVF A;  1NTM J;  3KZI H;  4YXW H;  2K88 A;  5CBN A;  3B4S A;  5CBO A;  4L73 A;  4XFJ A;  1AVO A;  1J2J B;  2QJY B;  2BAS A;  2E5Y A;  2WZ7 A;  2E76 D;  4HKZ H;  2LR2 A;  3RBZ A;  3SWF A;  3TNU A;  2Q6Q A;  1DH3 A;  4W80 A;  3H25 A;  2Y0E A;  5CCG D;  1PIX A;  5CMZ A;  1DX7 A;  1PGJ A;  2UWJ E;  3QH9 A;  4HH2 A;  3CCV P;  4IL6 H;  1OVU A;  3USS A;  5GTH E;  3ITK A;  1SFC D;  2ZYD A;  2KUB A;  5KAF E;  1BGY G;  2G8Y A;  1ZR2 A;  2OTJ P;  2IFM A;  1VQ8 P;  3AE3 C;  5AVR B;  1X9V A;  3TGU D;  1BSH A;  1NTK G;  3G71 P;  4OGQ C;  4GDO A;  1X8Y A;  4OGQ B;  5CJ0 A;  5CCH C;  4Y99 B;  3W68 A;  1PGP A;  2WSF H;  3H1K D;  1WRG A;  2O01 N;  3L35 A;  5GTI H;  1M57 D;  2R5B A;  1M56 D;  2P1J A;  2FYU D;  3Q5S A;  2YO2 A;  2A45 G;  4PJ0 E;  3H1H G;  1M8O B;  4K3A A;  1KB9 H;  2M5A A;  1EXI A;  5TJH A;  2WMM A;  4KJM A;  3OA7 A;  3VYI A;  4BWN A;  2FFD C;  1QVF O;  1LWU A;  1L0L D;  1L2P A;  1OMI A;  3H1I E;  1OW7 A;  3AEF C;  2M5A B;  1N7L A;  3CWB J;  3SFE C;  1YIJ P;  1JO5 A;  2FBW C;  1SQX E;  5H2F H;  3CC2 P;  2WPQ A;  2Y0D A;  3C1L A;  1SQV G;  3BCC E;  5AW1 B;  3VMA A;  3OW2 O;  5AVW B;  5AW7 B;  5CCH D;  5KJ7 A;  3GW6 A;  1VQ9 P;  2XU6 A;  5KLV E;  4XE5 B;  1IK7 A;  2KYV A;  2ZT9 D;  1H0T B;  3PHL A;  2FYZ A;  2B88 A;  3P8M C;  5APQ A;  1BGY E;  3S9O A;  3RL0 C;  2WT7 B;  3SWY A;  3AEE C;  1J1E C;  2IFN A;  3H1L J;  3H6P A;  1JY2 O;  1SQQ K;  2IBZ D;  2Q7C A;  2E42 A;  1MFZ A;  1NTK E;  2JDI H;  2JEE A;  1GU4 A;  2H89 C;  3L74 G;  1N7S A;  3CCS P;  2QIW A;  1DD3 A;  3EFG A;  4RJT A;  1UII A;  1WMK A;  1VF5 B;  1IJD B;  1K05 A;  3CWB E;  3CX5 D;  2O1J A;  1ZOY C;  2QSI A;  3GLM A;  3JCU E;  3KDP B;  3L74 D;  1PFI A;  1PP9 J;  3CXH I;  4N78 D;  4JYC A;  3TNU B;  4JBZ A;  2YMY A;  3V5B A;  1YJN P;  1QX8 A;  2KLU A;  1LT9 A;  3GHG B; 
#chains in the Genus database with same CATH homology
 1YYC A;  2A45 I;  4IFD K;  5APT A;  2HOD B;  2XKM A;  3G3Z A;  1GW4 A;  1LWU C;  1JY3 N;  1SFC A;  1A02 J;  4WBA A;  2R3C A;  1LTG C;  2Z5H A;  3A5T A;  2XV5 A;  2H8P D;  1FZC B;  2Q9I A;  1IO4 A;  1NKN A;  4WY4 D;  3RK2 C;  1LGH B;  1LTS C;  1HGV A;  2PP6 A;  1JY3 P;  2NPS B;  2CPB A;  2JJL A;  3BVH A;  5APS A;  3HD7 D;  1ZV8 A;  1XTG B;  2N1T A;  3PP5 A;  3HE4 A;  3VMY A;  1IFN A;  2C0X A;  3OJA B;  5APV A;  1RE4 A;  1L4A D;  3A7O A;  3H32 B;  1GK4 A;  2N9B A;  4B86 A;  1HGZ A;  1SP4 A;  1GK6 A;  5CCG A;  1AFO A;  2ZXE B;  3MD0 A;  4AQR D;  1J1D B;  2YKQ A;  4I2L C;  1GTW A;  1MUU A;  2OYI A;  2IPP A;  3N4X A;  3L37 A;  3MUD A;  1KZU B;  4KHX A;  3P8C D;  2OYH A;  1LTI C;  5AW9 B;  1RF1 B;  3O8Z A;  1GD2 E;  1KIL D;  1G1J A;  1JMM A;  5AW4 B;  3V2R A;  1FZC A;  2R5D A;  2LKM A;  3WMM 0;  1JY2 N;  3BAS A;  1RE3 A;  3HTK A;  5AW8 B;  3VOP A;  3B5N D;  1N7S C;  1NAF A;  1LTJ C;  1LWU B;  1M1J C;  1M1J B;  1FAV A;  2HPC B;  1GW3 A;  3VP8 A;  2N1T B;  2H7H A;  5APY A;  3IR9 A;  1URQ D;  2M8R A;  1FBM A;  1RF1 A;  2KSJ A;  3OAK A;  3TK1 A;  3V2Q A;  4JF7 A;  1LTB C;  3LID A;  3RL0 B;  1MV8 A;  1NO4 A;  5APW A;  1KFM A;  3HUS A;  2OYI B;  1L0L K;  1S9K E;  4WY4 C;  3T97 A;  5AVV B;  5APU A;  2QM7 A;  1M7L A;  3RK3 D;  3M0D C;  3HD7 B;  1SQB K;  2ZFC A;  5AW6 B;  4XA4 A;  5KJ7 C;  3LW5 H;  4JYB A;  3RK2 D;  4C7N A;  1L0N K;  2FFD B;  1T3J A;  1H88 A;  4DZO A;  1FJP A;  2I1J A;  1JOC A;  1T2K D;  3VP9 A;  1GL2 C;  3BAT A;  5AW5 B;  1G2C B;  2HPC A;  2Z4E A;  1RY3 A;  3BRT B;  4RES B;  3KQG A;  1OXZ A;  3HD7 A;  2J59 M;  1RF0 A;  2XDJ A;  1CI6 A;  4O9B A;  1HWT C;  5CCG C;  1W2E A;  2L5G B;  3TYY A;  2VRS A;  2Q5U A;  3U1C A;  1GL2 D;  3MIW A;  2NPS C;  1FZG A;  1RE4 C;  2HYN A;  1NU1 K;  3N7N A;  1N2D C;  3RK3 B;  1FZF A;  2WSE H;  3B5N B;  1NTZ K;  1J1E B;  3HE5 B;  5CCH A;  2HG5 D;  5AW2 B;  3RK2 B;  1GL2 A;  5AVX B;  4M3L A;  1Z56 A;  2YKP A;  4OH8 B;  2HOD A;  1URQ B;  1FOS E;  2GM4 A;  1NTM K;  2KB7 P;  3TSI A;  4AUW A;  3CLQ A;  2OAR A;  1EQ7 A;  1SLQ A;  2CPS A;  2WSC H;  4Y99 C;  3P32 A;  1FU1 A;  1KIL A;  4ZKU A;  1X79 B;  1N7S B;  2WWW A;  1T8Z A;  2W27 A;  5AW3 B;  1FDM A;  3VMZ A;  4GIF A;  1LTT C;  3B5N A;  3M9B A;  3V4W A;  3UIA A;  5APX A;  1QL1 A;  1E5W A;  5CHX A;  1RF1 C;  4WB4 A;  3IFM A;  5AVQ B;  4C7N B;  2FFD A;  1OWA A;  1CI6 B;  5AVS B;  3V4Q A;  3L36 A;  1WT6 A;  1L4A B;  1T3U A;  1L4A C;  2A45 H;  3HUS B;  1S9K D;  2KOG A;  1GU5 A;  1H89 A;  1JTH B;  1VPC A;  2XNX A;  1CW5 A;  4C46 A;  2E43 A;  1KFN A;  1N73 C;  4LLH A;  1JY3 O;  2HFE D;  4EOT A;  3HE5 A;  3M06 A;  2OYH C;  3VTP C;  2OYH B;  3KYQ A;  1LTJ A;  1J1D C;  1HJB A;  4IFF A;  3P7K A;  1HUC A;  1YTZ I;  3RL0 D;  3E1I A;  4DOJ A;  1JUN A;  1LT9 C;  3V2P A;  2NPS A;  2XZR A;  5BVZ A;  4N6J A;  1KIL B;  2KLV A;  2OYI C;  2P2U A;  5AVY B;  2WIT A;  2QM8 A;  5CJ4 A;  1NHL A;  2P67 A;  2H43 A;  3M0A A;  3VN0 A;  1SQX K;  3HD7 C;  3V2N A;  3A3Y B;  3HUS C;  3GHG A;  5KJ7 D;  2N1T D;  3NXS A;  1YTZ T;  3MGN A;  1GDT A;  2Z5I A;  1FJK A;  2Q3I A;  4N78 E;  2C9L Y;  2FXM A;  1RF0 C;  1DEB A;  1M1J A;  4W7Z A;  4C7R A;  1VDF A;  2P7J A;  4WY4 A;  4IFM A;  1KQL A;  1FZE A;  2MJZ A;  2N1T C;  1LT9 B;  2W6A A;  5BU8 B;  1LTA C;  2J58 A;  5AVZ B;  1NOH A;  3BRV B;  1NTK K;  1IFI A;  2C0W A;  2W6B A;  1CZQ A;  4EIJ A;  3NTN A;  4GKG A;  1GZL A;  1ZR4 A;  1N73 B;  1FOS F;  1GL2 B;  3MTU E;  2WPS A;  3H32 A;  2WPR A;  2NPS D;  3M9Q A;  3U59 A;  1QL2 A;  1L4A A;  3NFQ A;  2WT7 A;  1NWQ A;  1IK9 A;  3CI9 A;  4LC1 A;  2O01 H;  3HRN A;  4I1L A;  3B5N C;  3C9I A;  2O1K A;  1HBW A;  3NMD A;  4GT1 A;  1MZ9 A;  3I5C A;  3R2P A;  2FKW B;  1CSB A;  4AYC A;  3U1A A;  1JY2 P;  1URQ A;  2I1K A;  1H8A A;  5KTB A;  2IX7 C;  5AVT B;  1FZC C;  2YO3 A;  2GUV A;  1G2C A;  1NKZ B;  4WY4 B;  1ZLL A;  4W7Y A;  1AQ5 A;  1JNM A;  1T2K C;  5BU5 A;  2KP8 A;  4ZKP A;  3B8E B;  3L4F A;  1SQV K;  1N73 A;  3RK3 C;  1LTJ B;  3A2A A;  1FZA A;  1IFJ A;  1JCC A;  2YNY A;  1SFC B;  4I6M C;  3LIE A;  3VMX A;  1RE3 C;  1N86 A;  1ZN5 A;  1JCD A;  4LGD E;  3KPE A;  1JTH A;  3HE4 B;  1URQ C;  2YKO A;  4HYT B;  2POH A;  1FZB A;  2HLO A;  2FYU K;  3P8C E;  1IFM A;  1N7S D;  3GHG C;  1IC2 A;  2GUS A;  1G1I A;  2C9N Y;  1IFD A;  3M0D A;  4N3Y B;  1SQP K;  1HTL C;  2R32 A;  2WTY A;  3EQ2 A;  1XTC C;  1HH0 A;  1SFC C;  5AVU B;  1HVV A;  5KJ7 A;  5KLV K;  1KIL C;  3II6 A;  1A02 F;  3CL3 D;  3HTK B;  3M9H A;  2M3B A;  5AW0 B;  3M91 A;  1NH4 A;  1SVF A;  1J2J B;  2WZ7 A;  2BAS A;  1DH3 A;  3SWF A;  3TNU A;  4W80 A;  5CCG D;  5CMZ A;  4HH2 A;  1SFC D;  1ZR2 A;  2IFM A;  5AVR B;  1X9V A;  5CCH C;  1X8Y A;  5CJ0 A;  4Y99 B;  2WSF H;  1WRG A;  3L35 A;  2R5B A;  2P1J A;  2YO2 A;  2A45 G;  3VYI A;  3OA7 A;  2FFD C;  1LWU A;  1JO5 A;  1N7L A;  2WPQ A;  5AW1 B;  5AVW B;  5AW7 B;  5CCH D;  2XU6 A;  4XE5 B;  2KYV A;  2FYZ A;  3P8M C;  5APQ A;  3RL0 C;  2WT7 B;  3SWY A;  1J1E C;  2IFN A;  3H6P A;  1JY2 O;  1SQQ K;  2Q7C A;  2E42 A;  1MFZ A;  1GU4 A;  2JEE A;  1N7S A;  1DX7 A;  3EFG A;  1IJD B;  2O1J A;  3KDP B;  1PFI A;  4N78 D;  4JYC A;  3TNU B;  3V5B A;  2YMY A;  2PAJ A;  1LT9 A;  3GHG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...