3TYYA

Crystal structure of human lamin-b1 coil 2 segment
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
75
structure length
75
Chain Sequence
QKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLEGEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Lamin-B1
publication title Crystal structures of the coil 2B fragment and the globular tail domain of human lamin B1.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3tyyA00
4B86A 2E43A 4I6MC 5APTA 5APSA 3TNUA 3L35A 2N9BA 1SLQA 2WPRA 2R32A 3TK1A 4JYBA 4KHXA 3V5BA 3O8ZA 4RESB 2Q3IA 2P67A 2YNYA 3HTKA 3NMDA 4AUWA 3HE4A 5AW8B 2Q7CA 5AVXB 3L36A 4LC1A 3M0DA 1HBWA 4GKGA 2Z5IA 3P7KA 3TNUB 3SWFA 2WWWA 1FOSE 1GTWA 3M9BA 1HUCA 2H7HA 2W6AA 1A02F 3NXSA 3P32A 2Z5HA 1GD2E 2W27A 1NAFA 3VMXA 1DH3A 3V4WA 3HE4B 3M91A 1KQLA 4DZOA 2IPPA 3VYIA 2VRSA 3HE5A 5AW2B 1G2CB 3NFQA 1GK6A 2WT7A 4M3LA 5AVWB 3VTPC 2XV5A 5AVZB 2P7JA 2XZRA 2YO2A 3A3YB 1T2KD 1FOSF 5AW5B 5AW3B 3VMYA 4HYTB 4GT1A 1JNMA 1H88A 5APWA 5AVSB 4AQRD 3HE5B 4C7NA 3P8MC 3T97A 3M06A 1NWQA 2BASA 3LIEA 2WT7B 1S9KE 1IO4A 5AW1B 2QM8A 5CMZA 1SP4A 3V4QA 5AVQB 3OAKA 3UIAA 5AW9B 2WTYA 2E42A 1FAVA 2ZFCA 4JYCA 1CZQA 5AW0B 5APVA 1J2JB 3KDPB 5APUA 5AW6B 2R5DA 4C7NB 2JJLA 2C9NY 5AW7B 3VN0A 1MFZA 1A02J 2P2UA 1CSBA 2YO3A 4XE5B 2R3CA 1GZLA 3A5TA 4EOTA 3I5CA 5APQA 2Q5UA 2C9LY 5AVYB 3VMZA 3NTNA 5APYA 5AVRB 1GU5A 1OWAA 2R5BA 1JUNA 1CI6A 5AW4B 1GU4A 3KQGA 3IR9A 3MGNA 2WPQA 3A7OA 3TYYA 3M9HA 1T2KC 2XU6A 4C46A 3A2AA 2ZXEB 4I2LC 1YYCA 5APXA 3MD0A 5AVUB 1MV8A 1H8AA 1GK4A 1MUUA 3M0AA 4AYCA 1OXZA 5AVVB 2WPSA 3L37A 1CI6B 3B8EB 2KP8A 1S9KD 1HWTC 1X8YA 3LIDA 2QM7A 1H89A 5AVTB 1HJBA
chains in the Genus database with same CATH superfamily
1SQXG 3L73J 3L70J 2YNYA 2HODA 2WZ7A 3TNUB 2FBWC 1K73Q 2P1JA 1KYOH 2XKMA 1JY2O 2Q9IA 1G2CB 1FZCB 4LGDE 2P7JA 3IAOA 2WSCJ 2M3BA 4O9BA 1LWUC 2W83C 2E74C 4TT3H 3PJSK 3VP9A 3PH0A 4KJMA 3RK3C 1XTGB 2ZYDA 2AEMA 4JPZB 4ASVA 1N73A 1J2JB 1PPJG 5AW6B 1OZHA 1M1JA 2P58A 5KLIB 3W68A 2QG4A 3CXHH 4H0LC 1QVGO 5APQA 2OYHA 3VMZA 1VF5B 3H32A 1JY3O 1X0TA 1JO5A 4K35A 2PFXA 3AEDC 4Y99B 4QMAA 4I2LC 3AE7C 1LT9B 1T3JA 3Q2YA 3TGUD 3CX5H 2KZJA 3AE9C 2B87B 1ZLLA 3H1HD 4WY4C 2FFDC 1NJIQ 4PV1B 4I6MC 1CW5A 4WVZA 3D6ZA 2FYUK 2P67A 5AVXB 1VL2A 1EXJA 3MUDA 5BU8B 1Q90D 4PJ0H 1P84I 4D6TE 1KYOE 2JDIH 1PGJA 2PGDA 2IFNA 1M57D 2OYIC 4L76A 3L71E 2QJPC 3PRJA 1SQBE 2NPSC 1Q81Q 1KC8Q 4C7NA 2WMMA 4RKUJ 1GW3A 5B66H 2HODB 1D7MA 2ZFCA 1JMMA 1JOCA 3RL0D 4OH8B 2FXPA 2FYUG 1L4AD 3CXHE 3PLNA 1X22A 1W2BO 2I1KA 1SQPE 3L73G 1KD1Q 3L70G 2OTKE 3P8CE 2J5UA 3H1KG 3I56P 1BSHA 1FZFA 2BEQD 3CX5E 1NHLA 2YIUC 2XNXA 2D2CD 2O01H 2KNCA 1M7LA 1N73B 5CBOA 3CLQA 4JF7A 4OWFA 2WPVB 4JYBA 2V7QH 1XTCC 2ITAA 3HE4A 1HBWA 2Z5IA 2WWWA 5DJUB 5KLVE 3Q1MA 4PJ0E 4IFFA 3WMM0 2W27A 4C7RA 3BATA 2IPPA 3VYIA 2POHA 5AW2B 1N7SA 4ASWA 3B5NA 3G71P 2N1TC 5AW3B 2ZJSE 2K1AA 2W90A 3BASA 2JR8A 3C8VA 2WT7B 1JY2N 1FZBA 5B66E 1LP1A 3QWOC 2WTYA 2ZYGA 1VQOP 2WITA 2E76B 1FDOA 4BWNA 3IFMA 3A5TA 1KB9E 4EOTA 2UWJE 5KKZC 3H25A 3L71D 1K04A 1RE3C 3RK3B 1Y47A 1SQBD 1LTAC 3TGUG 4D6TJ 3AE4C 3H1HG 3L37A 2K3RA 1KILA 1PGOA 2IZ1A 2KP8A 3OJAB 1HWTC 3BRTB 2E43A 1JY3N 4CPGA 5CCHD 2H88C 4UB8E 1JTHA 1H0TB 1SVFA 2RN0A 3RL0g 3O8ZA 3CWBE 4PV1D 2D2CC 1L0LE 2HYNA 4LC1A 1LTBC 1T3UA 1EZVE 3P7KA 4UB6H 4YPCA 2FFDB 1IFDA 3BCCJ 3B4SA 3NXSA 1NTZK 2A45H 5KJ7A 1PL5A 3II6A 1OW7A 3RBZA 1URQA 4DZOA 2I8DA 2QJYC 2PRRA 5KAIE 3HE5A 3FXDA 3A0BH 1RE4A 1QL1A 1SQPJ 1BDDA 2KNCB 1NU1K 3RK3E 3WU2H 4H13B 3T97A 2HG5D 2L91A 1UIXA 1S9KE 1VQNP 3S4RA 2OYIB 1NO4A 5E79H 1CZQA 4I7ZC 2GA1A 3KDPB 2QJPB 5KLVD 2JJLA 1VQKP 2HLOA 1ZRTE 3KZIH 1PGPA 1P84D 5CCGD 2AXCA 1N7SB 3B5NB 1JCCA 3M9HA 3Q5RA 3FWNA 1RF1B 1YBKA 1OVUA 2ZYAA 5TISH 4ZKUA 3H1IE 2WQYC 4HJGH 2ZT9C 1BGYD 3RK2D 4L74A 2J58A 1RQVA 1LP1B 3AE6C 1SFCC 1X9VA 3TNUA 2N9BA 3GHGC 3AE8C 1N86A 1FE6A 3CC4P 1SQQD 2KYVA 1KB9D 1SQBK 2YIUB 1G2CA 3M9QA 4UB6E 1FZCA 3F5HA 3KYQA 1S5LX 4HB1A 3V2QA 1LGHB 1S5LE 1OX3A 1IFIA 3RGUA 3FWLA 5B5EE 1GL2C 3A0BE 3JSVC 1VQPP 4YXWH 3H6PA 2FYNB 3VMYA 4N3YB 3V2RA 1WRGA 3WU2E 1NYHA 3M06A 3TF5A 5AW1B 1L0LD 1AVOA 2B89A 5E79E 1AA0A 1UIIA 4BRYA 2O01J 4XE5B 1GZLA 1E5WA 2E76D 1LT9A 1URQB 3L71G 3KZIE 2V7QJ 3CWBJ 5AVRB 1L0LJ 1SQBG 2B87A 5EFWB 2HR3A 1GMJA 3KHUA 4C46A 2ZXEB 4IL6X 5GTIH 4IL6E 4AYCA 2CPSA 3A0HH 3WUTA 1S4XA 4W7ZA 2O01N 5H2FH 4EIJA 3Q5SA 1S9KD 5KKZB 2KLVA 2QM7A 2K37A 5KLVK 3CC2P 3GMAA 1GDTA 1R5SA 3B71A 4MN4C 4KHXA 3L73D 4R4LA 2J59M 3NMDA 1ZRTD 4U7JA 2QA4P 2OARA 3VMXA 3MTUE 2FKWB 3ITKA 2JKVA 2XDJA 3HD7C 3H1ID 1M1KQ 1WMKA 2YO2A 3L74E 1KYOI 1H88A 1SQQK 5CCGA 1VQ8P 4NPEA 1LNQA 4NPDA 3LIEA 3HUSC 4U3FE 2OTJP 3H1IJ 1KZUB 3OAKA 2KS1A 5KLVG 4H44B 2R5DA 2B88A 2IFMA 2JWDA 2CK3H 1VQ9P 2LR2A 1DEEG 2KXPB 5AVYB 5KTBA 1NTKE 1LTJA 3MGNA 2WPQA 2E75B 3SWKA 1N7SD 3B5ND 1YI2P 3CXHI 4OGQC 1OVVA 1OXZA 1BGYG 3TSIA 1IFNA 5GTHH 4IFDK 1H89A 5AVTB 2PP6A 2KK7A 2DW3A 1VQ4P 1SQQG 3TK1A 3VP8A 4BRYB 4DT0A 3CX5I 1AVYA 1HGZA 3FGAD 1BCCJ 3FXEA 4PD4H 2H7HA 4DOJA 3E7KA 4N78D 1KQLA 3CI9A 2C0WA 2WT7A 2Q6QA 2XV5A 1HF9A 1NKNA 1RF0A 3PHLA 2JO1A 1KILD 4JBZA 3I55P 1PP9E 2K9JA 1JY2P 1JM0A 1L0LG 1L0NE 3H1JE 1EZVG 2YMKA 2E42A 5CJ0A 1GL2B 1SQVE 3L72E 1YTZT 2W8ZA 5CJ4A 3CL3D 1OWAA 2Y9ZA 5KJ7D 5AW4B 1URQD 3TYYA 3BCCE 3A2AA 1NAYA 2R44A 1KB9I 1J1DC 1H0TA 4ZNCA 1JY3P 4U3FD 2AEJA 3CCSP 2KS1B 3L35A 2FFDA 4DJGA 1KV4A 3L74J 3G6EP 4RESB 3Q3DA 2W6JH 1S3JA 4U3FJ 1U7MA 3CCUP 1LTJB 4PD4E 1A02F 2YXRB 2NRGA 1DH3A 1ZR4A 3H1IG 1IC2A 2YKOA 4GDOA 1EZVI 1GK6A 4M3LA 3AEAC 1SQXE 2QJKB 2XZRA 1FOSF 1T2KD 1NTKJ 1J1EB 2OYIA 4RJTA 2Y0CA 4HYTB 3EFFK 5AVSB 2NPSA 1Y9BA 3D6YA 3CCLP 5CMZA 3H1LJ 3HD7B 2WSFH 2Z4EA 1KILC 1RF1A 2M8RA 4RO0A 2R5BA 1JUNA 4DCKA 2BEZF 1ZOYC 4IOIH 1N2DC 3N7NA 2FXOA 3AE5C 2BCCE 2GUVA 2K88A 2K9JB 3M0AA 1NTMJ 4D6TD 5AVVB 2RMZA 1KYOD 3S9OA 2M3EA 1LWUB 4ZMDA 2E74B 1PPJE 1EDLA 3GW6A 1MKMA 3RL0C 4L73A 3V5BA 1VF5D 2Y0DA 1PP9J 1L4AC 5AW8B 1L0NJ 3H1JJ 3K5BA 2KIKA 4H0LB 1DX7A 2LKMA 2W6AA 1SS1A 1VQMP 1L2PA 1AQTA 3BCCD 1SQVJ 3L72J 3M91A 3AE2C 2RH0A 1OVRA 3CXHD 1NOHA 3A3YB 2R3SA 1JNMA 1SQPD 4WY4B 1NGMB 4EI2A 2KOGA 2WSCH 3P8CD 2IZ0A 1IJDB 2M0BA 2OYOA 4BXLA 1RH5B 4Z1MH 3CX5D 1Q7YQ 2ZAEB 3IF4A 3VN0A 1FZGA 1DD3A 2P10A 3AEBC 2O3JA 1W5CE 2QEXP 3U1AA 3CCVP 3KQGA 1X79B 2JEEA 5KAFH 1RE3A 1YYCA 5APXA 1FZCC 2B9BA 2QRXA 4U3FG 1KQFB 2NPSB 2ZXXA 2O1KA 1DD4A 1Z56A 1SQXJ 1IFMA 2MJZA 4AUWA 1NTKG 1PV3A 3M0DA 2E5YA 3PP5A 4NPFX 3CMEP 1LTTC 3EFGA 2Z5HA 3CCQP 3ABVC 1LJ2A 2WSSH 4WWIA 4EDFA 3KPEA 3LW5H 3CMAP 4Y99C 1LT9C 5AVZB 3O6QB 5CCHC 4GT1A 2HPCB 5C39A 2Q3EA 2BCCJ 4PV1C 3SFEC 1FDMA 1AV1A 1SP4A 3PTZA 4TLFA 4WB4A 5AW0B 3GG2A 5APVA 2KUBA 1G1IA 2Q5UA 1NH4A 4YTPC 1RHZB 1GU5A 1ZXGA 1HH0A 1BCCE 3CWBD 1VDFA 2QSIA 1SQPK 2ZVOB 2I1JA 3N4XA 1EZVD 5KAFE 4D6TG 2N1TB 1H8AA 2FYZA 3H1JG 4N6JA 1CI6B 1W2EA 1VQLP 1VQ7P 3LIDA 1SQVG 3L72G 2WPRA 1EDJA 1SFCA 2E74D 5CCGC 3RK3D 3SSUA 1EC5A 1FJPA 3R2PA 5TISE 3BCCG 2KSJA 1HUCA 1E79H 2WSFJ 1NAFA 3H1HE 4H0LD 3CCEP 3D71A 2AEFA 1AQ5A 2VRSA 3OW2O 2JWAA 3RK2C 3MZWB 1BE3E 3VTPC 1SQPG 1Q2NA 1Q82Q 1GL2A 1M56D 3OA7A 2C0XA 4ZKPA 1IO4A 4WY4D 1N73C 3RBXA 5AVQB 1M1JC 1KN7A 1QGKB 4JYCA 4W80A 2D2CB 3JCUH 2OYHC 2C9NY 2P2UA 1CSBA 2FYUJ 1R5LA 2KB7P 3NTNA 5APYA 1N8RQ 1IZNB 2KZIA 2YMYA 3BRVB 1NVOA 2QJYB 3C1LA 5DJTB 4H13D 5CBNA 2Q1KA 3JC22 3MD0A 3H1KJ 2KLUA 1JB0J 2WPSA 3B8EB 1X8YA 1Q86Q 1HJBA 2PAJA 3L4FA 4JQ0D 1M90Q 2NPSD 2N9YB 1RF0C 4XA4A 3MUDC 2Q3IA 4I7ZB 2E76C 2Q7CA 1LT1A 3CC7P 1L0LK 5GTIE 3H1LE 3A0HE 1BCCD 1NTZE 1U7JA 5H2FE 2BCCG 3WUVA 2IBZE 1R8EA 1MFTA 1VQ5P 3L75E 1OW6A 2GM4A 1IFJA 3HD7A 4PD4I 1NU1E 1HVVA 1EXIA 2ZT9B 1SFCB 2YKPA 1NTME 3GF7A 3GHGB 1NKZB 2G8YA 3HUSA 1YIJP 1MFZA 1Y8AA 3JCUE 2R3CA 3AEGC 3GF3A 3CWBG 3AE3C 1BE3D 4YXDC 5L8RJ 1HJ0A 1LWUA 2OGUA 3FX0A 2QIWA 3TGUJ 3H1HJ 1IK7A 1FC2C 2A06E 3IN6A 3AEEC 4HH2A 2N1TD 3LW5J 1KMIZ 4H13C 4B86A 1ZN5A 1BE3J 4GOEA 3V2NA 1P84H 2CPBA 1GW4A 3L74D 1DIPA 2IYOA 4GKGA 1QLED 3SWFA 1AJYA 5BVZA 1FOSE 2OTLP 5GTHE 3M9BA 1N7SC 3B5NC 3S1KA 3V6IA 4WY4A 3U59A 2YKQA 1RF1C 3NFQA 3BVHA 5AVWB 1LTGC 4XFJA 1KB9H 1ZMEC 1QEXA 1NTKD 5APWA 3CD6P 1KFNA 2MKVA 1KQSO 2FY8A 3USSA 1FU1A 3KXDA 3H1LD 3RK2B 1RY3A 1NTZD 1ZW0A 1DEBA 5APUA 1S2EA 4K3AA 2YO3A 1KTMA 2IBZD 1AFOA 2WSEH 1PZQA 4UB8H 3L75D 1USDA 1GU4A 3IR9A 1M1JB 2WVRA 3VMAA 2XU6A 1NU1D 1NTZJ 2LXBA 5M1BA 4WBAA 2OYHB 1GK4A 2A45G 3H32B 2FYNC 3D70A 4H44D 1NTMD 2FXMA 3L75J 2XNDH 3GLMA 1VQ6P 1OMIA 5APSA 3HUSB 5KAIH 1SLQA 1P84E 2R32A 1NU1J 1EQ7A 3CPWO 1LTSC 4A7PA 1BCCG 1PP9D 4L75A 3EWKA 3C9IA 1PFIA 5KJ7C 1L0ND 2E75D 3H1JD 1T6AA 1URQC 3MIWA 3O6QA 1BGYE 3V4WA 1JCDA 4HKZH 2HPCA 1SQVD 2M5AA 1RE4C 3L72D 3G3ZA 2A06D 3EQ2A 1FZEA 2H8PD 5CHXA 4OGQB 1SQQE 3Q5PA 2QE7H 3W67A 4OVNF 1FJKA 1QL2A 2L5GB 2JP3A 3P8MC 1NWQA 1KQGB 2ZT9D 2BASA 5AW9B 1SFCD 1IFPA 1FAVA 1ZR2A 2ZVNB 1QVFO 4C7NB 4EYYQ 1A02J 2NZ2A 2A45I 2N1TA 3L71J 3SWYA 1BE3G 1CI6A 1SQBJ 2H43A 3A7OA 1NTKK 3M0DC 1T2KC 1OW8A 5AVUB 1MV8A 2HFED 4PD4D 3CCJP 1GL2D 2RKLA 1U57A 1S5LH 1BDCA 2H89C 1BSNA 3L74G 1KFMA 1YJ9P 1SQXD 5B5EH 4H44C 3HTKA 2Y9YA 1YJNP 2KSEA 3L36A 2AXTH 1FDIA 1T8ZA 1S72P 2GUSA 1L4AA 1GTWA 4LLHA 3U1CA 1RQUA 3HE4B 2KI7B 3CCRP 1NTMK 2FYUE 2E75C 1PIXA 1J1DB 1OFCX 3L73E 5AW5B 5KLIC 3L70E 3R4YA 4GOFA 2E5TA 2Y0EA 1G1JA 2OQQA 1ZP0C 1VF5C 3H1KE 2SPZA 3MHVA 3QH9A 2QM8A 1L0NK 2BCCD 3H1LG 1NTZG 3V4QA 2G3AA 3UIAA 5KLVJ 1HTLC 1ZV8A 4IL6H 3SFDC 1TU3F 1IK9A 2IBZG 1WT6A 5AW7B 1SQVK 1VPCA 1FS0E 1PPJD 3I5CA 3L75G 3G4SP 2M5AB 5TJHA 1K05A 1FBMA 3AE1C 1YTZI 1NU1G 1PGQA 3WUUA 3G9RA 5BU5A 1NTMG 3VOPA 1BGYJ 3HD7D 1OIPA 1S1CX 5APTA 1YQ4C 4KT0J 3ZDMA 1SQQJ 1YITP 1KILB 1PP9G 2YXQB 3HRNA 1L0NG 4GIFA 1M8OB 2AXTE 2K9YA 1JTHB 3P32A 1GD2E 1K9MQ 3AEFC 2A06G 1YJWP 1YQ3C 2V4HA 5K5GB 4IFMA 2WSEJ 2W6BA 1HGVA 3GHGA 1QX8A 1JMBA 1JEKA 1SQXK 1EDIA 1EDKA 3CCMP 2IBZI 1FZAA 3F89A 4AQRD 4OGQD 3TGUE 3HE5B 1N7LA 4I1LA 1YHQP 3TDKA 5CCHA 3HTKB 3RL0B 3E1IA 2IYPA 4N78E 3MP7B 1KORA 1L4AB 3AECC 3T97B 2IDBA 2C9LY 1LTJC 2FYUD 1MZ9A 2IX7C 4Y28J 2LXCB 1KILE 1USEA 2QVAA 4GODA 3V2PA 1K8AQ 2O1JA 3L70D 4W7YA 4R4MA 3E1RA 1MUUA 2QJKC 1LTIC 1J1EC 3H1KD
chains in the Genus database with same CATH topology
4B86A 1SFCC 1ZN5A 1X9VA 3TNUA 3V2NA 2N9BA 2CPBA 3RL0C 3GHGC 1N86A 3V5BA 1GW4A 2YNYA 2KYVA 1L4AC 5AW8B 2HODA 4GKGA 2WZ7A 3TNUB 1SQBK 3SWFA 1G2CA 3M9QA 5BVZA 1DX7A 2LKMA 1FOSE 1FZCA 2P1JA 3M9BA 2W6AA 3KYQA 3V2QA 1N7SC 3B5NC 1LGHB 3M91A 2XKMA 4WY4A 1IFIA 1JY2O 3U59A 2Q9IA 2YKQA 1RF1C 1G2CB 3NFQA 1FZCB 3BVHA 4LGDE 5AVWB 1GL2C 1LTGC 2P7JA 1NOHA 3A3YB 3H6PA 2M3BA 3VMYA 1JNMA 4N3YB 4O9BA 4WY4B 5APWA 1KFNA 3V2RA 2KOGA 1WRGA 1LWUC 2WSCH 3P8CD 3M06A 1IJDB 3VP9A 5AW1B 3RK3C 1XTGB 1FU1A 3RK2B 1RY3A 1N73A 1J2JB 1DEBA 5APUA 5AW6B 1M1JA 3VN0A 2YO3A 4XE5B 1FZGA 1GZLA 1E5WA 1LT9A 1URQB 5APQA 2OYHA 1AFOA 3VMZA 2WSEH 5AVRB 3H32A 1JY3O 3U1AA 1GU4A 3IR9A 3KQGA 1X79B 1JO5A 1M1JB 2XU6A 2JEEA 4Y99B 4C46A 2ZXEB 1RE3A 4I2LC 1YYCA 5APXA 4WBAA 1FZCC 1LT9B 1T3JA 2OYHB 1GK4A 4AYCA 2A45G 2CPSA 3H32B 4W7ZA 4EIJA 2NPSB 1ZLLA 4WY4C 1S9KD 2FFDC 2O1KA 2FXMA 2KLVA 2QM7A 5KLVK 1Z56A 4I6MC 5APSA 1GDTA 3HUSB 1IFMA 1SLQA 1CW5A 2R32A 4KHXA 2MJZA 1EQ7A 2FYUK 2J59M 2P67A 3NMDA 4AUWA 1LTSC 5AVXB 3M0DA 3C9IA 1PFIA 3MUDA 3PP5A 5BU8B 5KJ7C 2OARA 1URQC 1LTTC 3EFGA 2Z5HA 3MIWA 3VMXA 3V4WA 1JCDA 3MTUE 2FKWB 2HPCA 1RE4C 3G3ZA 2XDJA 3KPEA 2IFNA 3HD7C 3LW5H 4Y99C 2OYIC 3EQ2A 1FZEA 1LT9C 2H8PD 5CHXA 5AVZB 2YO2A 5CCHC 4GT1A 1H88A 2NPSC 2HPCB 1FJKA 1SQQK 5CCGA 1QL2A 2L5GB 4C7NA 3P8MC 1NWQA 2BASA 1GW3A 3HUSC 3LIEA 1FDMA 1SP4A 2HODB 1KZUB 3OAKA 5AW9B 1SFCD 4WB4A 1FAVA 2ZFCA 5AW0B 1ZR2A 5APVA 1JMMA 1JOCA 2R5DA 3RL0D 4C7NB 4OH8B 2IFMA 1A02J 1G1IA 2A45I 1L4AD 2N1TA 2Q5UA 1NH4A 5AVYB 3SWYA 5KTBA 1GU5A 2I1KA 1HH0A 1CI6A 1VDFA 1LTJA 3MGNA 2WPQA 3A7OA 2H43A 1SQPK 1NTKK 3P8CE 3M0DC 2I1JA 1T2KC 3N4XA 1N7SD 3B5ND 5AVUB 1MV8A 2N1TB 1H8AA 2FYZA 2HFED 1OXZA 4N6JA 3TSIA 1IFNA 1FZFA 4IFDK 1CI6B 1W2EA 1NHLA 1GL2D 2XNXA 3LIDA 1H89A 5AVTB 2PP6A 2O01H 1M7LA 1N73B 2WPRA 3CLQA 1KFMA 4JF7A 3TK1A 4JYBA 1SFCA 3VP8A 1XTCC 3HTKA 1HGZA 3HE4A 3L36A 5CCGC 3RK3D 1HBWA 2Z5IA 1T8ZA 2WWWA 2GUSA 1FJPA 3R2PA 1L4AA 1GTWA 2KSJA 4LLHA 1HUCA 2H7HA 3U1CA 4IFFA 4DOJA 3WMM0 2W27A 1NAFA 4N78D 4C7RA 3BATA 3HE4B 1KQLA 2IPPA 3VYIA 1AQ5A 2POHA 2VRSA 3CI9A 1NTMK 5AW2B 2C0WA 1N7SA 3B5NA 3RK2C 2WT7A 2N1TC 3VTPC 2XV5A 1J1DB 1NKNA 1RF0A 5AW5B 5AW3B 1KILD 1GL2A 1G1JA 3OA7A 1JY2P 2C0XA 3BASA 4ZKPA 2WT7B 1IO4A 4WY4D 2QM8A 1JY2N 1N73C 1FZBA 1L0NK 3V4QA 5AVQB 1M1JC 3UIAA 2WTYA 2E42A 1HTLC 2WITA 1ZV8A 1GL2B 4JYCA 4W80A 5CJ0A 1IK9A 2OYHC 2C9NY 1WT6A 5AW7B 1SQVK 2P2UA 1CSBA 3IFMA 1VPCA 3A5TA 2KB7P 4EOTA 3I5CA 1YTZT 3NTNA 5APYA 5CJ4A 3CL3D 1OWAA 1FBMA 5KJ7D 2YMYA 5AW4B 1YTZI 3BRVB 1RE3C 3RK3B 1URQD 3TYYA 1LTAC 3A2AA 3MD0A 5BU5A 1J1DC 3VOPA 3HD7D 1JY3P 2WPSA 3L37A 1KILA 3B8EB 2KP8A 3OJAB 1HWTC 3BRTB 1X8YA 2E43A 1JY3N 1HJBA 2PAJA 3L4FA 5APTA 5CCHD 3L35A 2FFDA 2NPSD 1JTHA 1RF0C 1SVFA 4XA4A 3O8ZA 1KILB 4RESB 2Q3IA 2Q7CA 2HYNA 3HRNA 4LC1A 4GIFA 1LTBC 1T3UA 3P7KA 1L0LK 2FFDB 1IFDA 1LTJB 1JTHB 1A02F 3NXSA 3P32A 1NTZK 2A45H 5KJ7A 1GD2E 3II6A 1DH3A 1ZR4A 1URQA 1IC2A 4DZOA 2YKOA 3HE5A 1GK6A 2GM4A 4IFMA 4M3LA 1RE4A 1QL1A 1IFJA 2W6BA 1HGVA 3HD7A 2XZRA 3GHGA 1T2KD 1FOSF 1J1EB 2OYIA 1HVVA 1SQXK 4HYTB 1NU1K 5AVSB 1FZAA 4AQRD 3HE5B 1N7LA 4I1LA 1SFCB 3T97A 5CCHA 2HG5D 2NPSA 2YKPA 3HTKB 1S9KE 5CMZA 3RL0B 3E1IA 3HD7B 3GHGB 1NKZB 2WSFH 2OYIB 4N78E 1NO4A 2Z4EA 1KILC 3HUSA 1CZQA 1L4AB 3KDPB 2JJLA 1MFZA 2R3CA 1RF1A 2HLOA 2C9LY 2M8RA 1LTJC 5CCGD 1MZ9A 2IX7C 2R5BA 1JUNA 1N7SB 3B5NB 1JCCA 1N2DC 3M9HA 3V2PA 3N7NA 1LWUA 2O1JA 1RF1B 4W7YA 2GUVA 1MUUA 3M0AA 1LTIC 4ZKUA 1J1EC 5AVVB 4HH2A 3RK2D 2N1TD 2J58A 1LWUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B86 A;  2E43 A;  4I6M C;  5APT A;  5APS A;  3TNU A;  3L35 A;  2N9B A;  1SLQ A;  2WPR A;  2R32 A;  3TK1 A;  4JYB A;  4KHX A;  3V5B A;  3O8Z A;  4RES B;  2Q3I A;  2P67 A;  2YNY A;  3HTK A;  3NMD A;  4AUW A;  3HE4 A;  5AW8 B;  2Q7C A;  5AVX B;  3L36 A;  4LC1 A;  3M0D A;  1HBW A;  4GKG A;  2Z5I A;  3P7K A;  3TNU B;  3SWF A;  2WWW A;  1FOS E;  1GTW A;  3M9B A;  1HUC A;  2H7H A;  2W6A A;  1A02 F;  3NXS A;  3P32 A;  2Z5H A;  1GD2 E;  2W27 A;  1NAF A;  3VMX A;  1DH3 A;  3V4W A;  3HE4 B;  3M91 A;  1KQL A;  4DZO A;  2IPP A;  3VYI A;  2VRS A;  3HE5 A;  5AW2 B;  1G2C B;  3NFQ A;  1GK6 A;  2WT7 A;  4M3L A;  5AVW B;  3VTP C;  2XV5 A;  5AVZ B;  2P7J A;  2XZR A;  2YO2 A;  3A3Y B;  1T2K D;  1FOS F;  5AW5 B;  5AW3 B;  3VMY A;  4HYT B;  4GT1 A;  1JNM A;  1H88 A;  5APW A;  5AVS B;  4AQR D;  3HE5 B;  4C7N A;  3P8M C;  3T97 A;  3M06 A;  1NWQ A;  2BAS A;  3LIE A;  2WT7 B;  1S9K E;  1IO4 A;  5AW1 B;  2QM8 A;  5CMZ A;  1SP4 A;  3V4Q A;  5AVQ B;  3OAK A;  3UIA A;  5AW9 B;  2WTY A;  2E42 A;  1FAV A;  2ZFC A;  4JYC A;  1CZQ A;  5AW0 B;  5APV A;  1J2J B;  3KDP B;  5APU A;  5AW6 B;  2R5D A;  4C7N B;  2JJL A;  2C9N Y;  5AW7 B;  3VN0 A;  1MFZ A;  1A02 J;  2P2U A;  1CSB A;  2YO3 A;  4XE5 B;  2R3C A;  1GZL A;  3A5T A;  4EOT A;  3I5C A;  5APQ A;  2Q5U A;  2C9L Y;  5AVY B;  3VMZ A;  3NTN A;  5APY A;  5AVR B;  1GU5 A;  1OWA A;  2R5B A;  1JUN A;  1CI6 A;  5AW4 B;  1GU4 A;  3KQG A;  3IR9 A;  3MGN A;  2WPQ A;  3A7O A;  3TYY A;  3M9H A;  1T2K C;  2XU6 A;  4C46 A;  3A2A A;  2ZXE B;  4I2L C;  1YYC A;  5APX A;  3MD0 A;  5AVU B;  1MV8 A;  1H8A A;  1GK4 A;  1MUU A;  3M0A A;  4AYC A;  1OXZ A;  5AVV B;  2WPS A;  3L37 A;  1CI6 B;  3B8E B;  2KP8 A;  1S9K D;  1HWT C;  1X8Y A;  3LID A;  2QM7 A;  1H89 A;  5AVT B;  1HJB A; 
#chains in the Genus database with same CATH topology
 1SQX G;  3L73 J;  3L70 J;  2YNY A;  2HOD A;  2WZ7 A;  3TNU B;  2FBW C;  1K73 Q;  2P1J A;  1KYO H;  2XKM A;  1JY2 O;  2Q9I A;  1G2C B;  1FZC B;  4LGD E;  2P7J A;  3IAO A;  2WSC J;  2M3B A;  4O9B A;  1LWU C;  2W83 C;  2E74 C;  4TT3 H;  3PJS K;  3VP9 A;  3PH0 A;  4KJM A;  3RK3 C;  1XTG B;  2ZYD A;  2AEM A;  4JPZ B;  4ASV A;  1N73 A;  1J2J B;  1PPJ G;  5AW6 B;  1OZH A;  1M1J A;  2P58 A;  5KLI B;  3W68 A;  2QG4 A;  3CXH H;  4H0L C;  1QVG O;  5APQ A;  2OYH A;  3VMZ A;  1VF5 B;  3H32 A;  1JY3 O;  1X0T A;  1JO5 A;  4K35 A;  2PFX A;  3AED C;  4Y99 B;  4QMA A;  4I2L C;  3AE7 C;  1LT9 B;  1T3J A;  3Q2Y A;  3TGU D;  3CX5 H;  2KZJ A;  3AE9 C;  2B87 B;  1ZLL A;  3H1H D;  4WY4 C;  2FFD C;  1NJI Q;  4PV1 B;  4I6M C;  1CW5 A;  4WVZ A;  3D6Z A;  2FYU K;  2P67 A;  5AVX B;  1VL2 A;  1EXJ A;  3MUD A;  5BU8 B;  1Q90 D;  4PJ0 H;  1P84 I;  4D6T E;  1KYO E;  2JDI H;  1PGJ A;  2PGD A;  2IFN A;  1M57 D;  2OYI C;  4L76 A;  3L71 E;  2QJP C;  3PRJ A;  1SQB E;  2NPS C;  1Q81 Q;  1KC8 Q;  4C7N A;  2WMM A;  4RKU J;  1GW3 A;  5B66 H;  2HOD B;  1D7M A;  2ZFC A;  1JMM A;  1JOC A;  3RL0 D;  4OH8 B;  2FXP A;  2FYU G;  1L4A D;  3CXH E;  3PLN A;  1X22 A;  1W2B O;  2I1K A;  1SQP E;  3L73 G;  1KD1 Q;  3L70 G;  2OTK E;  3P8C E;  2J5U A;  3H1K G;  3I56 P;  1BSH A;  1FZF A;  2BEQ D;  3CX5 E;  1NHL A;  2YIU C;  2XNX A;  2D2C D;  2O01 H;  2KNC A;  1M7L A;  1N73 B;  5CBO A;  3CLQ A;  4JF7 A;  4OWF A;  2WPV B;  4JYB A;  2V7Q H;  1XTC C;  2ITA A;  3HE4 A;  1HBW A;  2Z5I A;  2WWW A;  5DJU B;  5KLV E;  3Q1M A;  4PJ0 E;  4IFF A;  3WMM 0;  2W27 A;  4C7R A;  3BAT A;  2IPP A;  3VYI A;  2POH A;  5AW2 B;  1N7S A;  4ASW A;  3B5N A;  3G71 P;  2N1T C;  5AW3 B;  2ZJS E;  2K1A A;  2W90 A;  3BAS A;  2JR8 A;  3C8V A;  2WT7 B;  1JY2 N;  1FZB A;  5B66 E;  1LP1 A;  3QWO C;  2WTY A;  2ZYG A;  1VQO P;  2WIT A;  2E76 B;  1FDO A;  4BWN A;  3IFM A;  3A5T A;  1KB9 E;  4EOT A;  2UWJ E;  5KKZ C;  3H25 A;  3L71 D;  1K04 A;  1RE3 C;  3RK3 B;  1Y47 A;  1SQB D;  1LTA C;  3TGU G;  4D6T J;  3AE4 C;  3H1H G;  3L37 A;  2K3R A;  1KIL A;  1PGO A;  2IZ1 A;  2KP8 A;  3OJA B;  1HWT C;  3BRT B;  2E43 A;  1JY3 N;  4CPG A;  5CCH D;  2H88 C;  4UB8 E;  1JTH A;  1H0T B;  1SVF A;  2RN0 A;  3RL0 g;  3O8Z A;  3CWB E;  4PV1 D;  2D2C C;  1L0L E;  2HYN A;  4LC1 A;  1LTB C;  1T3U A;  1EZV E;  3P7K A;  4UB6 H;  4YPC A;  2FFD B;  1IFD A;  3BCC J;  3B4S A;  3NXS A;  1NTZ K;  2A45 H;  5KJ7 A;  1PL5 A;  3II6 A;  1OW7 A;  3RBZ A;  1URQ A;  4DZO A;  2I8D A;  2QJY C;  2PRR A;  5KAI E;  3HE5 A;  3FXD A;  3A0B H;  1RE4 A;  1QL1 A;  1SQP J;  1BDD A;  2KNC B;  1NU1 K;  3RK3 E;  3WU2 H;  4H13 B;  3T97 A;  2HG5 D;  2L91 A;  1UIX A;  1S9K E;  1VQN P;  3S4R A;  2OYI B;  1NO4 A;  5E79 H;  1CZQ A;  4I7Z C;  2GA1 A;  3KDP B;  2QJP B;  5KLV D;  2JJL A;  1VQK P;  2HLO A;  1ZRT E;  3KZI H;  1PGP A;  1P84 D;  5CCG D;  2AXC A;  1N7S B;  3B5N B;  1JCC A;  3M9H A;  3Q5R A;  3FWN A;  1RF1 B;  1YBK A;  1OVU A;  2ZYA A;  5TIS H;  4ZKU A;  3H1I E;  2WQY C;  4HJG H;  2ZT9 C;  1BGY D;  3RK2 D;  4L74 A;  2J58 A;  1RQV A;  1LP1 B;  3AE6 C;  1SFC C;  1X9V A;  3TNU A;  2N9B A;  3GHG C;  3AE8 C;  1N86 A;  1FE6 A;  3CC4 P;  1SQQ D;  2KYV A;  1KB9 D;  1SQB K;  2YIU B;  1G2C A;  3M9Q A;  4UB6 E;  1FZC A;  3F5H A;  3KYQ A;  1S5L X;  4HB1 A;  3V2Q A;  1LGH B;  1S5L E;  1OX3 A;  1IFI A;  3RGU A;  3FWL A;  5B5E E;  1GL2 C;  3A0B E;  3JSV C;  1VQP P;  4YXW H;  3H6P A;  2FYN B;  3VMY A;  4N3Y B;  3V2R A;  1WRG A;  3WU2 E;  1NYH A;  3M06 A;  3TF5 A;  5AW1 B;  1L0L D;  1AVO A;  2B89 A;  5E79 E;  1AA0 A;  1UII A;  4BRY A;  2O01 J;  4XE5 B;  1GZL A;  1E5W A;  2E76 D;  1LT9 A;  1URQ B;  3L71 G;  3KZI E;  2V7Q J;  3CWB J;  5AVR B;  1L0L J;  1SQB G;  2B87 A;  5EFW B;  2HR3 A;  1GMJ A;  3KHU A;  4C46 A;  2ZXE B;  4IL6 X;  5GTI H;  4IL6 E;  4AYC A;  2CPS A;  3A0H H;  3WUT A;  1S4X A;  4W7Z A;  2O01 N;  5H2F H;  4EIJ A;  3Q5S A;  1S9K D;  5KKZ B;  2KLV A;  2QM7 A;  2K37 A;  5KLV K;  3CC2 P;  3GMA A;  1GDT A;  1R5S A;  3B71 A;  4MN4 C;  4KHX A;  3L73 D;  4R4L A;  2J59 M;  3NMD A;  1ZRT D;  4U7J A;  2QA4 P;  2OAR A;  3VMX A;  3MTU E;  2FKW B;  3ITK A;  2JKV A;  2XDJ A;  3HD7 C;  3H1I D;  1M1K Q;  1WMK A;  2YO2 A;  3L74 E;  1KYO I;  1H88 A;  1SQQ K;  5CCG A;  1VQ8 P;  4NPE A;  1LNQ A;  4NPD A;  3LIE A;  3HUS C;  4U3F E;  2OTJ P;  3H1I J;  1KZU B;  3OAK A;  2KS1 A;  5KLV G;  4H44 B;  2R5D A;  2B88 A;  2IFM A;  2JWD A;  2CK3 H;  1VQ9 P;  2LR2 A;  1DEE G;  2KXP B;  5AVY B;  5KTB A;  1NTK E;  1LTJ A;  3MGN A;  2WPQ A;  2E75 B;  3SWK A;  1N7S D;  3B5N D;  1YI2 P;  3CXH I;  4OGQ C;  1OVV A;  1OXZ A;  1BGY G;  3TSI A;  1IFN A;  5GTH H;  4IFD K;  1H89 A;  5AVT B;  2PP6 A;  2KK7 A;  2DW3 A;  1VQ4 P;  1SQQ G;  3TK1 A;  3VP8 A;  4BRY B;  4DT0 A;  3CX5 I;  1AVY A;  1HGZ A;  3FGA D;  1BCC J;  3FXE A;  4PD4 H;  2H7H A;  4DOJ A;  3E7K A;  4N78 D;  1KQL A;  3CI9 A;  2C0W A;  2WT7 A;  2Q6Q A;  2XV5 A;  1HF9 A;  1NKN A;  1RF0 A;  3PHL A;  2JO1 A;  1KIL D;  4JBZ A;  3I55 P;  1PP9 E;  2K9J A;  1JY2 P;  1JM0 A;  1L0L G;  1L0N E;  3H1J E;  1EZV G;  2YMK A;  2E42 A;  5CJ0 A;  1GL2 B;  1SQV E;  3L72 E;  1YTZ T;  2W8Z A;  5CJ4 A;  3CL3 D;  1OWA A;  2Y9Z A;  5KJ7 D;  5AW4 B;  1URQ D;  3TYY A;  3BCC E;  3A2A A;  1NAY A;  2R44 A;  1KB9 I;  1J1D C;  1H0T A;  4ZNC A;  1JY3 P;  4U3F D;  2AEJ A;  3CCS P;  2KS1 B;  3L35 A;  2FFD A;  4DJG A;  1KV4 A;  3L74 J;  3G6E P;  4RES B;  3Q3D A;  2W6J H;  1S3J A;  4U3F J;  1U7M A;  3CCU P;  1LTJ B;  4PD4 E;  1A02 F;  2YXR B;  2NRG A;  1DH3 A;  1ZR4 A;  3H1I G;  1IC2 A;  2YKO A;  4GDO A;  1EZV I;  1GK6 A;  4M3L A;  3AEA C;  1SQX E;  2QJK B;  2XZR A;  1FOS F;  1T2K D;  1NTK J;  1J1E B;  2OYI A;  4RJT A;  2Y0C A;  4HYT B;  3EFF K;  5AVS B;  2NPS A;  1Y9B A;  3D6Y A;  3CCL P;  5CMZ A;  3H1L J;  3HD7 B;  2WSF H;  2Z4E A;  1KIL C;  1RF1 A;  2M8R A;  4RO0 A;  2R5B A;  1JUN A;  4DCK A;  2BEZ F;  1ZOY C;  4IOI H;  1N2D C;  3N7N A;  2FXO A;  3AE5 C;  2BCC E;  2GUV A;  2K88 A;  2K9J B;  3M0A A;  1NTM J;  4D6T D;  5AVV B;  2RMZ A;  1KYO D;  3S9O A;  2M3E A;  1LWU B;  4ZMD A;  2E74 B;  1PPJ E;  1EDL A;  3GW6 A;  1MKM A;  3RL0 C;  4L73 A;  3V5B A;  1VF5 D;  2Y0D A;  1PP9 J;  1L4A C;  5AW8 B;  1L0N J;  3H1J J;  3K5B A;  2KIK A;  4H0L B;  1DX7 A;  2LKM A;  2W6A A;  1SS1 A;  1VQM P;  1L2P A;  1AQT A;  3BCC D;  1SQV J;  3L72 J;  3M91 A;  3AE2 C;  2RH0 A;  1OVR A;  3CXH D;  1NOH A;  3A3Y B;  2R3S A;  1JNM A;  1SQP D;  4WY4 B;  1NGM B;  4EI2 A;  2KOG A;  2WSC H;  3P8C D;  2IZ0 A;  1IJD B;  2M0B A;  2OYO A;  4BXL A;  1RH5 B;  4Z1M H;  3CX5 D;  1Q7Y Q;  2ZAE B;  3IF4 A;  3VN0 A;  1FZG A;  1DD3 A;  2P10 A;  3AEB C;  2O3J A;  1W5C E;  2QEX P;  3U1A A;  3CCV P;  3KQG A;  1X79 B;  2JEE A;  5KAF H;  1RE3 A;  1YYC A;  5APX A;  1FZC C;  2B9B A;  2QRX A;  4U3F G;  1KQF B;  2NPS B;  2ZXX A;  2O1K A;  1DD4 A;  1Z56 A;  1SQX J;  1IFM A;  2MJZ A;  4AUW A;  1NTK G;  1PV3 A;  3M0D A;  2E5Y A;  3PP5 A;  4NPF X;  3CME P;  1LTT C;  3EFG A;  2Z5H A;  3CCQ P;  3ABV C;  1LJ2 A;  2WSS H;  4WWI A;  4EDF A;  3KPE A;  3LW5 H;  3CMA P;  4Y99 C;  1LT9 C;  5AVZ B;  3O6Q B;  5CCH C;  4GT1 A;  2HPC B;  5C39 A;  2Q3E A;  2BCC J;  4PV1 C;  3SFE C;  1FDM A;  1AV1 A;  1SP4 A;  3PTZ A;  4TLF A;  4WB4 A;  5AW0 B;  3GG2 A;  5APV A;  2KUB A;  1G1I A;  2Q5U A;  1NH4 A;  4YTP C;  1RHZ B;  1GU5 A;  1ZXG A;  1HH0 A;  1BCC E;  3CWB D;  1VDF A;  2QSI A;  1SQP K;  2ZVO B;  2I1J A;  3N4X A;  1EZV D;  5KAF E;  4D6T G;  2N1T B;  1H8A A;  2FYZ A;  3H1J G;  4N6J A;  1CI6 B;  1W2E A;  1VQL P;  1VQ7 P;  3LID A;  1SQV G;  3L72 G;  2WPR A;  1EDJ A;  1SFC A;  2E74 D;  5CCG C;  3RK3 D;  3SSU A;  1EC5 A;  1FJP A;  3R2P A;  5TIS E;  3BCC G;  2KSJ A;  1HUC A;  1E79 H;  2WSF J;  1NAF A;  3H1H E;  4H0L D;  3CCE P;  3D71 A;  2AEF A;  1AQ5 A;  2VRS A;  3OW2 O;  2JWA A;  3RK2 C;  3MZW B;  1BE3 E;  3VTP C;  1SQP G;  1Q2N A;  1Q82 Q;  1GL2 A;  1M56 D;  3OA7 A;  2C0X A;  4ZKP A;  1IO4 A;  4WY4 D;  1N73 C;  3RBX A;  5AVQ B;  1M1J C;  1KN7 A;  1QGK B;  4JYC A;  4W80 A;  2D2C B;  3JCU H;  2OYH C;  2C9N Y;  2P2U A;  1CSB A;  2FYU J;  1R5L A;  2KB7 P;  3NTN A;  5APY A;  1N8R Q;  1IZN B;  2KZI A;  2YMY A;  3BRV B;  1NVO A;  2QJY B;  3C1L A;  5DJT B;  4H13 D;  5CBN A;  2Q1K A;  3JC2 2;  3MD0 A;  3H1K J;  2KLU A;  1JB0 J;  2WPS A;  3B8E B;  1X8Y A;  1Q86 Q;  1HJB A;  2PAJ A;  3L4F A;  4JQ0 D;  1M90 Q;  2NPS D;  2N9Y B;  1RF0 C;  4XA4 A;  3MUD C;  2Q3I A;  4I7Z B;  2E76 C;  2Q7C A;  1LT1 A;  3CC7 P;  1L0L K;  5GTI E;  3H1L E;  3A0H E;  1BCC D;  1NTZ E;  1U7J A;  5H2F E;  2BCC G;  3WUV A;  2IBZ E;  1R8E A;  1MFT A;  1VQ5 P;  3L75 E;  1OW6 A;  2GM4 A;  1IFJ A;  3HD7 A;  4PD4 I;  1NU1 E;  1HVV A;  1EXI A;  2ZT9 B;  1SFC B;  2YKP A;  1NTM E;  3GF7 A;  3GHG B;  1NKZ B;  2G8Y A;  3HUS A;  1YIJ P;  1MFZ A;  1Y8A A;  3JCU E;  2R3C A;  3AEG C;  3GF3 A;  3CWB G;  3AE3 C;  1BE3 D;  4YXD C;  5L8R J;  1HJ0 A;  1LWU A;  2OGU A;  3FX0 A;  2QIW A;  3TGU J;  3H1H J;  1IK7 A;  1FC2 C;  2A06 E;  3IN6 A;  3AEE C;  4HH2 A;  2N1T D;  3LW5 J;  1KMI Z;  4H13 C;  4B86 A;  1ZN5 A;  1BE3 J;  4GOE A;  3V2N A;  1P84 H;  2CPB A;  1GW4 A;  3L74 D;  1DIP A;  2IYO A;  4GKG A;  1QLE D;  3SWF A;  1AJY A;  5BVZ A;  1FOS E;  2OTL P;  5GTH E;  3M9B A;  1N7S C;  3B5N C;  3S1K A;  3V6I A;  4WY4 A;  3U59 A;  2YKQ A;  1RF1 C;  3NFQ A;  3BVH A;  5AVW B;  1LTG C;  4XFJ A;  1KB9 H;  1ZME C;  1QEX A;  1NTK D;  5APW A;  3CD6 P;  1KFN A;  2MKV A;  1KQS O;  2FY8 A;  3USS A;  1FU1 A;  3KXD A;  3H1L D;  3RK2 B;  1RY3 A;  1NTZ D;  1ZW0 A;  1DEB A;  5APU A;  1S2E A;  4K3A A;  2YO3 A;  1KTM A;  2IBZ D;  1AFO A;  2WSE H;  1PZQ A;  4UB8 H;  3L75 D;  1USD A;  1GU4 A;  3IR9 A;  1M1J B;  2WVR A;  3VMA A;  2XU6 A;  1NU1 D;  1NTZ J;  2LXB A;  5M1B A;  4WBA A;  2OYH B;  1GK4 A;  2A45 G;  3H32 B;  2FYN C;  3D70 A;  4H44 D;  1NTM D;  2FXM A;  3L75 J;  2XND H;  3GLM A;  1VQ6 P;  1OMI A;  5APS A;  3HUS B;  5KAI H;  1SLQ A;  1P84 E;  2R32 A;  1NU1 J;  1EQ7 A;  3CPW O;  1LTS C;  4A7P A;  1BCC G;  1PP9 D;  4L75 A;  3EWK A;  3C9I A;  1PFI A;  5KJ7 C;  1L0N D;  2E75 D;  3H1J D;  1T6A A;  1URQ C;  3MIW A;  3O6Q A;  1BGY E;  3V4W A;  1JCD A;  4HKZ H;  2HPC A;  1SQV D;  2M5A A;  1RE4 C;  3L72 D;  3G3Z A;  2A06 D;  3EQ2 A;  1FZE A;  2H8P D;  5CHX A;  4OGQ B;  1SQQ E;  3Q5P A;  2QE7 H;  3W67 A;  4OVN F;  1FJK A;  1QL2 A;  2L5G B;  2JP3 A;  3P8M C;  1NWQ A;  1KQG B;  2ZT9 D;  2BAS A;  5AW9 B;  1SFC D;  1IFP A;  1FAV A;  1ZR2 A;  2ZVN B;  1QVF O;  4C7N B;  4EYY Q;  1A02 J;  2NZ2 A;  2A45 I;  2N1T A;  3L71 J;  3SWY A;  1BE3 G;  1CI6 A;  1SQB J;  2H43 A;  3A7O A;  1NTK K;  3M0D C;  1T2K C;  1OW8 A;  5AVU B;  1MV8 A;  2HFE D;  4PD4 D;  3CCJ P;  1GL2 D;  2RKL A;  1U57 A;  1S5L H;  1BDC A;  2H89 C;  1BSN A;  3L74 G;  1KFM A;  1YJ9 P;  1SQX D;  5B5E H;  4H44 C;  3HTK A;  2Y9Y A;  1YJN P;  2KSE A;  3L36 A;  2AXT H;  1FDI A;  1T8Z A;  1S72 P;  2GUS A;  1L4A A;  1GTW A;  4LLH A;  3U1C A;  1RQU A;  3HE4 B;  2KI7 B;  3CCR P;  1NTM K;  2FYU E;  2E75 C;  1PIX A;  1J1D B;  1OFC X;  3L73 E;  5AW5 B;  5KLI C;  3L70 E;  3R4Y A;  4GOF A;  2E5T A;  2Y0E A;  1G1J A;  2OQQ A;  1ZP0 C;  1VF5 C;  3H1K E;  2SPZ A;  3MHV A;  3QH9 A;  2QM8 A;  1L0N K;  2BCC D;  3H1L G;  1NTZ G;  3V4Q A;  2G3A A;  3UIA A;  5KLV J;  1HTL C;  1ZV8 A;  4IL6 H;  3SFD C;  1TU3 F;  1IK9 A;  2IBZ G;  1WT6 A;  5AW7 B;  1SQV K;  1VPC A;  1FS0 E;  1PPJ D;  3I5C A;  3L75 G;  3G4S P;  2M5A B;  5TJH A;  1K05 A;  1FBM A;  3AE1 C;  1YTZ I;  1NU1 G;  1PGQ A;  3WUU A;  3G9R A;  5BU5 A;  1NTM G;  3VOP A;  1BGY J;  3HD7 D;  1OIP A;  1S1C X;  5APT A;  1YQ4 C;  4KT0 J;  3ZDM A;  1SQQ J;  1YIT P;  1KIL B;  1PP9 G;  2YXQ B;  3HRN A;  1L0N G;  4GIF A;  1M8O B;  2AXT E;  2K9Y A;  1JTH B;  3P32 A;  1GD2 E;  1K9M Q;  3AEF C;  2A06 G;  1YJW P;  1YQ3 C;  2V4H A;  5K5G B;  4IFM A;  2WSE J;  2W6B A;  1HGV A;  3GHG A;  1QX8 A;  1JMB A;  1JEK A;  1SQX K;  1EDI A;  1EDK A;  3CCM P;  2IBZ I;  1FZA A;  3F89 A;  4AQR D;  4OGQ D;  3TGU E;  3HE5 B;  1N7L A;  4I1L A;  1YHQ P;  3TDK A;  5CCH A;  3HTK B;  3RL0 B;  3E1I A;  2IYP A;  4N78 E;  3MP7 B;  1KOR A;  1L4A B;  3AEC C;  3T97 B;  2IDB A;  2C9L Y;  1LTJ C;  2FYU D;  1MZ9 A;  2IX7 C;  4Y28 J;  2LXC B;  1KIL E;  1USE A;  2QVA A;  4GOD A;  3V2P A;  1K8A Q;  2O1J A;  3L70 D;  4W7Y A;  4R4M A;  3E1R A;  1MUU A;  2QJK C;  1LTI C;  1J1E C;  3H1K D; 
#chains in the Genus database with same CATH homology
 4B86 A;  1SFC C;  1ZN5 A;  1X9V A;  3TNU A;  3V2N A;  2N9B A;  2CPB A;  3RL0 C;  3GHG C;  1N86 A;  3V5B A;  1GW4 A;  2YNY A;  2KYV A;  1L4A C;  5AW8 B;  2HOD A;  4GKG A;  2WZ7 A;  3TNU B;  1SQB K;  3SWF A;  1G2C A;  3M9Q A;  5BVZ A;  1DX7 A;  2LKM A;  1FOS E;  1FZC A;  2P1J A;  3M9B A;  2W6A A;  3KYQ A;  3V2Q A;  1N7S C;  3B5N C;  1LGH B;  3M91 A;  2XKM A;  4WY4 A;  1IFI A;  1JY2 O;  3U59 A;  2Q9I A;  2YKQ A;  1RF1 C;  1G2C B;  3NFQ A;  1FZC B;  3BVH A;  4LGD E;  5AVW B;  1GL2 C;  1LTG C;  2P7J A;  1NOH A;  3A3Y B;  3H6P A;  2M3B A;  3VMY A;  1JNM A;  4N3Y B;  4O9B A;  4WY4 B;  5APW A;  1KFN A;  3V2R A;  2KOG A;  1WRG A;  1LWU C;  2WSC H;  3P8C D;  3M06 A;  1IJD B;  3VP9 A;  5AW1 B;  3RK3 C;  1XTG B;  1FU1 A;  3RK2 B;  1RY3 A;  1N73 A;  1J2J B;  1DEB A;  5APU A;  5AW6 B;  1M1J A;  3VN0 A;  2YO3 A;  4XE5 B;  1FZG A;  1GZL A;  1E5W A;  1LT9 A;  1URQ B;  5APQ A;  2OYH A;  1AFO A;  3VMZ A;  2WSE H;  5AVR B;  3H32 A;  1JY3 O;  3U1A A;  1GU4 A;  3IR9 A;  3KQG A;  1X79 B;  1JO5 A;  1M1J B;  2XU6 A;  2JEE A;  4Y99 B;  4C46 A;  2ZXE B;  1RE3 A;  4I2L C;  1YYC A;  5APX A;  4WBA A;  1FZC C;  1LT9 B;  1T3J A;  2OYH B;  1GK4 A;  4AYC A;  2A45 G;  2CPS A;  3H32 B;  4W7Z A;  4EIJ A;  2NPS B;  1ZLL A;  4WY4 C;  1S9K D;  2FFD C;  2O1K A;  2FXM A;  2KLV A;  2QM7 A;  5KLV K;  1Z56 A;  4I6M C;  5APS A;  1GDT A;  3HUS B;  1IFM A;  1SLQ A;  1CW5 A;  2R32 A;  4KHX A;  2MJZ A;  1EQ7 A;  2FYU K;  2J59 M;  2P67 A;  3NMD A;  4AUW A;  1LTS C;  5AVX B;  3M0D A;  3C9I A;  1PFI A;  3MUD A;  3PP5 A;  5BU8 B;  5KJ7 C;  2OAR A;  1URQ C;  1LTT C;  3EFG A;  2Z5H A;  3MIW A;  3VMX A;  3V4W A;  1JCD A;  3MTU E;  2FKW B;  2HPC A;  1RE4 C;  3G3Z A;  2XDJ A;  3KPE A;  2IFN A;  3HD7 C;  3LW5 H;  4Y99 C;  2OYI C;  3EQ2 A;  1FZE A;  1LT9 C;  2H8P D;  5CHX A;  5AVZ B;  2YO2 A;  5CCH C;  4GT1 A;  1H88 A;  2NPS C;  2HPC B;  1FJK A;  1SQQ K;  5CCG A;  1QL2 A;  2L5G B;  4C7N A;  3P8M C;  1NWQ A;  2BAS A;  1GW3 A;  3HUS C;  3LIE A;  1FDM A;  1SP4 A;  2HOD B;  1KZU B;  3OAK A;  5AW9 B;  1SFC D;  4WB4 A;  1FAV A;  2ZFC A;  5AW0 B;  1ZR2 A;  5APV A;  1JMM A;  1JOC A;  2R5D A;  3RL0 D;  4C7N B;  4OH8 B;  2IFM A;  1A02 J;  1G1I A;  2A45 I;  1L4A D;  2N1T A;  2Q5U A;  1NH4 A;  5AVY B;  3SWY A;  5KTB A;  1GU5 A;  2I1K A;  1HH0 A;  1CI6 A;  1VDF A;  1LTJ A;  3MGN A;  2WPQ A;  3A7O A;  2H43 A;  1SQP K;  1NTK K;  3P8C E;  3M0D C;  2I1J A;  1T2K C;  3N4X A;  1N7S D;  3B5N D;  5AVU B;  1MV8 A;  2N1T B;  1H8A A;  2FYZ A;  2HFE D;  1OXZ A;  4N6J A;  3TSI A;  1IFN A;  1FZF A;  4IFD K;  1CI6 B;  1W2E A;  1NHL A;  1GL2 D;  2XNX A;  3LID A;  1H89 A;  5AVT B;  2PP6 A;  2O01 H;  1M7L A;  1N73 B;  2WPR A;  3CLQ A;  1KFM A;  4JF7 A;  3TK1 A;  4JYB A;  1SFC A;  3VP8 A;  1XTC C;  3HTK A;  1HGZ A;  3HE4 A;  3L36 A;  5CCG C;  3RK3 D;  1HBW A;  2Z5I A;  1T8Z A;  2WWW A;  2GUS A;  1FJP A;  3R2P A;  1L4A A;  1GTW A;  2KSJ A;  4LLH A;  1HUC A;  2H7H A;  3U1C A;  4IFF A;  4DOJ A;  3WMM 0;  2W27 A;  1NAF A;  4N78 D;  4C7R A;  3BAT A;  3HE4 B;  1KQL A;  2IPP A;  3VYI A;  1AQ5 A;  2POH A;  2VRS A;  3CI9 A;  1NTM K;  5AW2 B;  2C0W A;  1N7S A;  3B5N A;  3RK2 C;  2WT7 A;  2N1T C;  3VTP C;  2XV5 A;  1J1D B;  1NKN A;  1RF0 A;  5AW5 B;  5AW3 B;  1KIL D;  1GL2 A;  1G1J A;  3OA7 A;  1JY2 P;  2C0X A;  3BAS A;  4ZKP A;  2WT7 B;  1IO4 A;  4WY4 D;  2QM8 A;  1JY2 N;  1N73 C;  1FZB A;  1L0N K;  3V4Q A;  5AVQ B;  1M1J C;  3UIA A;  2WTY A;  2E42 A;  1HTL C;  2WIT A;  1ZV8 A;  1GL2 B;  4JYC A;  4W80 A;  5CJ0 A;  1IK9 A;  2OYH C;  2C9N Y;  1WT6 A;  5AW7 B;  1SQV K;  2P2U A;  1CSB A;  3IFM A;  1VPC A;  3A5T A;  2KB7 P;  4EOT A;  3I5C A;  1YTZ T;  3NTN A;  5APY A;  5CJ4 A;  3CL3 D;  1OWA A;  1FBM A;  5KJ7 D;  2YMY A;  5AW4 B;  1YTZ I;  3BRV B;  1RE3 C;  3RK3 B;  1URQ D;  3TYY A;  1LTA C;  3A2A A;  3MD0 A;  5BU5 A;  1J1D C;  3VOP A;  3HD7 D;  1JY3 P;  2WPS A;  3L37 A;  1KIL A;  3B8E B;  2KP8 A;  3OJA B;  1HWT C;  3BRT B;  1X8Y A;  2E43 A;  1JY3 N;  1HJB A;  2PAJ A;  3L4F A;  5APT A;  5CCH D;  3L35 A;  2FFD A;  2NPS D;  1JTH A;  1RF0 C;  1SVF A;  4XA4 A;  3O8Z A;  1KIL B;  4RES B;  2Q3I A;  2Q7C A;  2HYN A;  3HRN A;  4LC1 A;  4GIF A;  1LTB C;  1T3U A;  3P7K A;  1L0L K;  2FFD B;  1IFD A;  1LTJ B;  1JTH B;  1A02 F;  3NXS A;  3P32 A;  1NTZ K;  2A45 H;  5KJ7 A;  1GD2 E;  3II6 A;  1DH3 A;  1ZR4 A;  1URQ A;  1IC2 A;  4DZO A;  2YKO A;  3HE5 A;  1GK6 A;  2GM4 A;  4IFM A;  4M3L A;  1RE4 A;  1QL1 A;  1IFJ A;  2W6B A;  1HGV A;  3HD7 A;  2XZR A;  3GHG A;  1T2K D;  1FOS F;  1J1E B;  2OYI A;  1HVV A;  1SQX K;  4HYT B;  1NU1 K;  5AVS B;  1FZA A;  4AQR D;  3HE5 B;  1N7L A;  4I1L A;  1SFC B;  3T97 A;  5CCH A;  2HG5 D;  2NPS A;  2YKP A;  3HTK B;  1S9K E;  5CMZ A;  3RL0 B;  3E1I A;  3HD7 B;  3GHG B;  1NKZ B;  2WSF H;  2OYI B;  4N78 E;  1NO4 A;  2Z4E A;  1KIL C;  3HUS A;  1CZQ A;  1L4A B;  3KDP B;  2JJL A;  1MFZ A;  2R3C A;  1RF1 A;  2HLO A;  2C9L Y;  2M8R A;  1LTJ C;  5CCG D;  1MZ9 A;  2IX7 C;  2R5B A;  1JUN A;  1N7S B;  3B5N B;  1JCC A;  1N2D C;  3M9H A;  3V2P A;  3N7N A;  1LWU A;  2O1J A;  1RF1 B;  4W7Y A;  2GUV A;  1MUU A;  3M0A A;  1LTI C;  4ZKU A;  1J1E C;  5AVV B;  4HH2 A;  3RK2 D;  2N1T D;  2J58 A;  1LWU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...