3TYYA

Crystal structure of human lamin-b1 coil 2 segment
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
75
structure length
75
Chain Sequence
QKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLEGEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lamin-B1
publication title Crystal structures of the coil 2B fragment and the globular tail domain of human lamin B1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 34
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3tyyA00
3B8EB 1FOSF 5AW6B 1A02F 1DH3A 4AQRD 1H8AA 3VN0A 2XZRA 3A2AA 5AW1B 1MV8A 3P7KA 5AVRB 5AW0B 2WT7A 4HYTB 2ZXEB 5AVVB 1HUCA 2ZFCA 3V4QA 2E42A 3T97A 4JYBA 1HBWA 1IO4A 2P67A 3TNUB 1J2JB 1SP4A 3A7OA 4I2LC 2N9BA 1H89A 2P2UA 2R3CA 3HE4B 2W6AA 3VMZA 2QM7A 5APTA 2BASA 1MFZA 1SLQA 1KQLA 1GTWA 3NFQA 3NMDA 5AW9B 2Z5IA 1JNMA 2YO2A 2YNYA 5AVYB 2IPPA 4EOTA 2VRSA 5AW3B 3L36A 2XU6A 4AUWA 3TNUA 3TYYA 3VYIA 3O8ZA 3M0AA 4M3LA 4C46A 3A3YB 1G2CB 2KP8A 3HE4A 4KHXA 3SWFA 4B86A 3I5CA 1HWTC 3V5BA 3NXSA 3OAKA 3IR9A 1YYCA 1CSBA 4C7NB 3KDPB 2C9NY 3HE5B 1A02J 5AVTB 5AW5B 5AW7B 1NWQA 3KQGA 4XE5B 5AVXB 1CI6B 1FAVA 2W27A 3M0DA 2YO3A 1HJBA 3MGNA 1CZQA 1MUUA 3LIDA 4JYCA 3M06A 5APSA 2Z5HA 4AYCA 3L35A 2R32A 1T2KC 1GK6A 5AVZB 3NTNA 5AVWB 2C9LY 3VMYA 5AW2B 2R5DA 1GU4A 4I6MC 1GD2E 3P8MC 2H7HA 5AW4B 2WPSA 3M91A 3M9BA 3A5TA 3LIEA 5AVUB 3VTPC 1CI6A 3M9HA 2Q3IA 3TK1A 1S9KE 3VMXA 1GU5A 1T2KD 3V4WA 3HTKA 2R5BA 1GK4A 2QM8A 1OXZA 4GKGA 2JJLA 1NAFA 2P7JA 3L37A 5APWA 5APXA 1X8YA 4RESB 1H88A 5APQA 3MD0A 4DZOA 3P32A 4GT1A 2WT7B 2E43A 5AVQB 2WWWA 2WPRA 2XV5A 2WTYA 3UIAA 1JUNA 5APYA 5AW8B 2Q7CA 1FOSE 1OWAA 2Q5UA 1S9KD 4LC1A 5APUA 5AVSB 4C7NA 2WPQA 5APVA 3HE5A 5CMZA 1GZLA
chains in the Genus database with same CATH superfamily
4D6TE 4WY4A 1LJ2A 3I55P 1LTTC 2XZRA 3L71J 5AW0B 4TLFA 3H1JE 1N73C 2ZXEB 1HBWA 4IFMA 2P67A 5CCHD 1AVYA 1NTME 1Y47A 5B5EE 2QM7A 3HRNA 2RKLA 2I1KA 1BGYJ 5KLVK 2Z5IA 1YQ3C 5AVYB 1D7MA 1JO5A 1LT9C 3TF5A 3G71P 3AE7C 2XNDH 2M5AB 3VYIA 4B86A 3NXSA 2H89C 5CCGA 1YYCA 3VOPA 1CSBA 1QVGO 2KSEA 2YKOA 2QIWA 3M9QA 4PD4H 2M5AA 2O01J 2Z5HA 1T2KC 2Y9ZA 3GHGA 1S3JA 2H7HA 2UWJE 4Z1MH 3GG2A 4N78E 1DD4A 2N1TC 2O1KA 3V4WA 1QGKB 2E5TA 4I7ZB 3L37A 4HH2A 4Y99C 1E5WA 3V2NA 1FZCB 5KAIH 5AW8B 2GUSA 1SS1A 3H32B 1VQ8P 4R4MA 3W67A 3ITKA 1GL2D 3OW2O 3CXHE 3EFGA 3Q2YA 2JDIH 4UB8E 2E76D 1L0NG 1FDOA 1X22A 3WUVA 1AFOA 3S1KA 5BU8B 2W8ZA 3CX5H 4XA4A 2GUVA 3H32A 2P2UA 2IBZG 3CWBJ 3BATA 1YTZT 1T3JA 1R5SA 1L0NE 2FYUG 1Y9BA 5GTHE 2R44A 3A3YB 2OQQA 2IBZE 3KYQA 3AEEC 4NPEA 1Q86Q 2M3BA 1T6AA 3HE5B 1NO4A 3V6IA 1HVVA 2FYUE 1VPCA 3HTKB 2OYIC 1H0TB 3M06A 2WSEH 1NKNA 3T97B 1PGPA 1OMIA 1SQXJ 2JP3A 1DEBA 3CC2P 4U3FD 3M9HA 3HTKA 1N7SD 1H0TA 4RJTA 3BCCJ 1XTGB 3B5NC 1PIXA 1S5LH 1FOSE 1OWAA 2HR3A 1IFMA 2WMMA 2G8YA 1DH3A 5AVRB 3MTUE 1NTKG 1KILD 1LT9A 1IO4A 2E74B 5TJHA 3AE4C 1ZW0A 1W2EA 1L4AB 1IFJA 1FDMA 1GTWA 3TGUG 4YTPC 1SQPJ 3RBZA 1PV3A 3O6QB 2IPPA 4U3FG 1SQBJ 1VQPP 1EQ7A 3TYYA 5KKZC 5KAFE 4IOIH 3M0AA 3CCMP 4KHXA 1X9VA 1EC5A 3TGUE 2BCCJ 4C7NB 3CCVP 2POHA 3O6QA 4U3FE 1U57A 1Q82Q 3LIDA 1JEKA 1RE3C 3G4SP 1LTIC 3RL0B 4WY4D 1GK6A 1LTBC 1N7SC 1GU4A 1VL2A 3PP5A 2FFDC 2ZT9B 3CCEP 3EWKA 2A45G 2QSIA 4H13B 1QL2A 5KLVG 3H1KJ 2JJLA 1KQFB 3AE8C 2P7JA 1KFNA 2LXCB 1KILE 1EZVI 5EFWB 2E75B 1KORA 1SQQJ 2D2CD 3KHUA 2JKVA 2G3AA 3CCJP 4PD4I 2I8DA 1CW5A 1Q7YQ 1SP4A 3A7OA 3L73G 1QVFO 2SPZA 5TISE 2B88A 1KFMA 1ZRTD 3JC22 3FGAD 3NMDA 4Y28J 2YO2A 4OGQD 1RY3A 1M57D 3L70D 4H44B 1KQSO 1BCCD 4AUWA 3L73E 1JMBA 4BXLA 4M3LA 3AE9C 1L0LJ 4W7YA 3L71D 2B9BA 1JB0J 1GW4A 2V7QJ 3II6A 2FYNC 1BGYD 3G3ZA 2R32A 2P10A 1SQPK 1X0TA 3CX5I 1OVVA 3H1LJ 1SQBK 1DIPA 2Q3IA 3CLQA 4UB8H 1FZFA 1YJ9P 1NAFA 2FY8A 1J1EB 2KXPB 1JUNA 3S9OA 3JCUH 2OYHB 2HLOA 2AEFA 3CI9A 4EI2A 2WZ7A 5CCGC 1U7MA 2KNCB 2HFED 3AEAC 3PJSK 2FXMA 3VN0A 2NPSB 3W68A 1YIJP 2HPCB 1BDCA 4KJMA 2OYHA 3TNUB 2KNCA 3V2RA 1BGYG 3WU2E 1MFZA 1URQD 1KYOD 2NPSA 2Y0CA 2C0XA 4ASWA 2WSFJ 2HPCA 1K73Q 3TNUA 3Q3DA 1SQQK 1G1IA 3R4YA 2GM4A 4C46A 1BGYE 5CJ4A 1KD1Q 3HUSB 1ZV8A 1QLED 2HODB 3KDPB 2I1JA 5AW5B 4I7ZC 1J1DB 1S72P 3CWBD 2RH0A 1FZCC 3L35A 2NZ2A 3TSIA 5AW2B 3HUSA 2HODA 1U7JA 1HGZA 4O9BA 3H1HJ 1KQGB 3IN6A 2IFNA 4ZMDA 3AE3C 3PLNA 3FX0A 1OVRA 3BRTB 4GKGA 3RK3B 4TT3H 1VF5B 2AEMA 2WSCJ 4WB4A 2ZYAA 2WTYA 5APYA 2MKVA 1ZOYC 1EDJA 5AVSB 3VMAA 3Q5RA 1KYOE 5KJ7C 4D6TG 3V2PA 3CCUP 2JO1A 1SQXD 4DOJA 5KAFH 3AEBC 5CHXA 2ZFCA 4H0LB 1S1CX 2N1TD 1WRGA 2PP6A 3G9RA 3CWBG 1NOHA 5C39A 3BCCD 1KQLA 4PV1B 2K9YA 2XKMA 4IL6X 3Q1MA 3RK2B 1PGJA 4WVZA 1NVOA 1ZLLA 3AECC 3CWBE 1UIIA 3I5CA 4ZNCA 1NTZJ 4DCKA 1X79B 1CZQA 1JMMA 3ABVC 2A45H 1QX8A 1YHQP 3N7NA 1SQPD 1LNQA 5AW4B 3FWLA 2WPSA 3M9BA 1SQBD 3LW5H 5AVUB 4DJGA 1FZGA 1YTZI 3VP9A 2E75D 1SQVJ 2BCCD 2E74C 3PH0A 2KUBA 1SQXE 2ZAEB 4GT1A 2H88C 2WWWA 5TISH 3AE1C 2QJKB 2WPVB 1L4AC 1QEXA 1FOSF 1M1JB 1VQ9P 3F5HA 2O3JA 4QMAA 3A0HE 1HUCA 3V4QA 4JBZA 1EDLA 3BASA 1RHZB 4H44D 5M1BA 4RKUJ 3H1KD 5BVZA 1M1JA 4DT0A 2K9JB 1VQOP 3CXHI 3B5ND 3KPEA 1SQBG 1JY2N 3RL0C 2NRGA 1SQQD 4NPFX 1FZBA 4ASVA 1FZCA 2ZT9C 2O1JA 1JCCA 2Q1KA 2A06D 3SWFA 1Z56A 2BCCG 4L75A 4C7RA 1LT1A 1SQPE 2K9JA 3JCUE 4H13C 3RBXA 5AVTB 5H2FH 4JQ0D 4HKZH 1SQBE 4XE5B 2IZ1A 1JM0A 1JY2P 1R5LA 1PP9J 3NTNA 2YMKA 2BCCE 2C9LY 2IBZI 2E75C 4I6MC 2ITAA 3WMM0 1LTAC 3B71A 3AEFC 2KLVA 1VQ7P 1JY2O 1L0LD 5KJ7A 2QM8A 1BE3J 1PZQA 5APXA 1X8YA 3L75J 2FXPA 1NTZK 2WT7B 2E43A 4UB6E 3WU2H 2Q7CA 1FJPA 1SQQG 4LC1A 1SVFA 1T3UA 3A0BE 3HE5A 2E42A 4W7ZA 4H44C 2K37A 1MV8A 1P84I 3H1LD 4ZKUA 3C8VA 2WT7A 3GMAA 3T97A 1SQQE 2AXCA 4I2LC 5APTA 4EDFA 2W6JH 2BASA 1SQVK 1T8ZA 3FXEA 1LWUB 1R8EA 1BSHA 4EOTA 4HB1A 2JWAA 1N86A 3CMAP 3GF3A 2E5YA 1NYHA 1LWUA 2O01H 1NWQA 1K8AQ 2QJYB 4W80A 2QJPB 1J1EC 1ZMEC 4K3AA 1EZVD 4CPGA 2OYHC 1N7LA 2LXBA 3H1LG 3KZIE 1EXIA 1L4AA 3LIEA 1M7LA 2NPSC 1KYOH 3B4SA 3CCSP 1GK4A 1UIXA 2IFMA 1L0NJ 2OTJP 3H1LE 2WSSH 2ZVOB 1S9KD 4C7NA 1GZLA 4H0LD 3AE2C 2QVAA 2ZYDA 1HGVA 3P7KA 3H1HD 1N2DC 1SFCC 2FYUJ 2Y9YA 2W83C 3HUSC 3C9IA 1PGQA 4N6JA 2A45I 3WUTA 1H89A 1J1DC 1N8RQ 5CCHA 2AXTE 2K1AA 2KSJA 2B87B 1RF1C 2L91A 1NJIQ 1SQXK 5CCGD 4R4LA 3O8ZA 3K5BA 1PPJD 3OAKA 3IR9A 2J58A 2C9NY 1FC2C 2B87A 1IFIA 1Q90D 3RK3C 2B89A 1VF5C 2IYPA 2WQYC 2YXRB 3ZDMA 3H1HG 1AVOA 1NHLA 1DEEG 1S9KE 3VMXA 2K3RA 3A0HH 3MUDC 4A7PA 1VQ4P 1NTKJ 4H0LC 4KT0J 1FJKA 3FXDA 1NTZD 3H1HE 3MD0A 1GL2B 4IL6E 3CD6P 2KYVA 2H43A 4PV1C 3H1IJ 2E76B 4JF7A 3IF4A 3TGUJ 1PPJG 1HTLC 3RK2C 1G1JA 5H2FE 1KB9D 2KB7P 3E1IA 1GL2A 3BRVB 3RL0g 1IK7A 5DJUB 1ZXGA 3KXDA 3L70G 1BCCG 1SQVD 2LKMA 1PGOA 1PPJE 2IX7C 1VQ5P 1M1KQ 3C1LA 5CBOA 1OIPA 1FBMA 1ZRTE 3L71G 2MJZA 2VRSA 3U59A 3L70E 1IFNA 1BCCE 2W6BA 1MZ9A 4GOFA 1HWTC 5KJ7D 1NTZG 1OW6A 1OW8A 5GTIH 3L71E 2OTLP 3OJAB 3CCLP 5AVXB 1CI6B 2WVRA 5KLVJ 3L4FA 2QE7H 4JYCA 4UB6H 2QJKC 1GMJA 3MIWA 1NTZE 1SFCB 3V2QA 3A0BH 3P8MC 3VP8A 4LLHA 3QH9A 1M1JC 1CI6A 3TK1A 2RN0A 2QEXP 3MHVA 1SQVG 4U7JA 3H25A 1AQTA 4RESB 1SFCA 3P32A 1KB9E 2PFXA 2WPRA 1RF1B 2ZYGA 4IFFA 2OARA 1Q2NA 1VQNP 3AEGC 1KILB 1FS0E 3B8EB 3MZWB 5AW6B 1PP9D 1SQVE 2Y0EA 5CBNA 3IFMA 1WT6A 1RF0A 2YKPA 3A2AA 3P8CD 1VQMP 1L0LK 1NH4A 3PHLA 3U1CA 1RF1A 4OVNF 2JR8A 4WBAA 1KILA 4PJ0E 1BE3D 2PGDA 1USEA 3L75D 2E74D 1KYOI 1IK9A 1IFDA 5B66H 1L4AD 1LP1B 3L36A 5L8RJ 3KZIH 2Z4EA 3L74J 2V7QH 3I56P 4EYYQ 3KQGA 4WY4B 3EQ2A 1FAVA 2OGUA 3M0DA 1LP1A 2QA4P 2W90A 3MUDA 3BVHA 2CPSA 1JCDA 1TU3F 3VMYA 2M3EA 3CCQP 1LTGC 5E79E 3VTPC 2K88A 3RL0D 2WSEJ 1QL1A 3CCRP 2ZT9D 1BE3G 2R5BA 1PP9E 2KLUA 1Y8AA 1OXZA 2QRXA 3P8CE 3L75G 3D6ZA 2D2CB 4HJGH 3SSUA 4H13D 3UIAA 4WWIA 1SQXG 1FE6A 1YJNP 1OX3A 3CXHD 2AXTH 1MFTA 1YJWP 1LWUC 1BE3E 1HF9A 1GDTA 3HD7B 3L75E 1AQ5A 1ZN5A 2PRRA 2Q9IA 3BCCG 3CC7P 5AVVB 3L72J 1M8OB 4JYBA 2WSFH 1RH5B 1J2JB 3GHGB 1IJDB 2R3CA 1XTCC 1K05A 4OGQB 5KTBA 2KZIA 4N3YB 1L0ND 2H8PD 2QJYC 2QJPC 3HD7A 1S2EA 3N4XA 1L2PA 1KZUB 2R3SA 3BCCE 2IBZD 1LTJB 3PRJA 3QWOC 3H6PA 2FYUD 2O01N 5AW7B 3MP7B 1SQPG 1RE4C 2KS1B 1LTJA 4JPZB 4L73A 1MUUA 1LGHB 5APSA 4IL6H 1S5LX 1NU1J 3GF7A 1YQ4C 5AVWB 1KTMA 3AE6C 1FU1A 3E7KA 5CCHC 2KS1A 2YIUB 1P84D 2YKQA 1S4XA 2WSCH 2V4HA 4D6TJ 2KK7A 3SFEC 2ZXXA 2HG5D 3H1JJ 1KV4A 2WPQA 1NTMJ 1OFCX 4IFDK 1H8AA 5GTIE 3H1KG 5KLIB 4GODA 4GDOA 1URQB 2NPSD 3WUUA 1WMKA 3HE4B 3VMZA 1NTKD 4BRYB 1AJYA 1VQLP 3H1KE 1RQVA 2A06G 2M8RA 5AW9B 1VQKP 1URQA 3H1ID 1DD3A 1NGMB 3TGUD 1N73B 2QG4A 3HE4A 4BRYA 3S4RA 2A06E 1IC2A 1SFCD 2IYOA 1P84E 3SWKA 1VDFA 1KB9H 1GL2C 1W5CE 1N73A 1ZR4A 1KC8Q 1L0LG 1Q81Q 1LT9B 2P1JA 2R5DA 4ZKPA 2E76C 3M91A 3A5TA 2RMZA 1ZR2A 1L0LE 5B66E 4DZOA 2XV5A 4PJ0H 4BWNA 1IZNB 4OWFA 3H1IG 5KLVD 3U1AA 3RK3D 4L74A 1VF5D 3SWYA 1A02F 2KIKA 1NTKE 4AQRD 1NU1K 5AW1B 2N1TB 2WITA 4K35A 2GA1A 4PD4D 4YXDC 3H1IE 4Y99B 4GIFA 3D70A 2W6AA 4I1LA 1KN7A 3EFFK 3NFQA 2N1TA 3FWNA 1RE4A 2FBWC 1JNMA 3L73D 1JTHB 4PV1D 1NAYA 1NTMK 1FZEA 3OA7A 3JSVC 1G2CB 5E79H 4EIJA 3RK2D 1EZVG 2JWDA 5DJTB 5CJ0A 3RGUA 1RF0C 1JTHA 1LTSC 1HJBA 1USDA 1GW3A 1G2CA 3CX5D 5B5EH 1HJ0A 1EZVE 1GD2E 1M56D 1KILC 1PL5A 3GW6A 5KLVE 3RK3E 3Q5SA 1EXJA 2Y0DA 1W2BO 3L74D 1KMIZ 5APWA 1K9MQ 5APQA 3HD7D 4PD4E 2OYIB 5AVQB 2AEJA 2YMYA 3D71A 1JY3N 3TDKA 3M0DC 1RQUA 1YBKA 2ZVNB 2OYIA 4RO0A 2OTKE 2IDBA 3B5NB 2N9BA 1EDKA 2FKWB 2KZJA 5KAIE 4WY4C 2CPBA 2OYOA 2KI7B 1JY3P 3CPWO 2YNYA 2Q6QA 4U3FJ 3AE5C 2BEQD 3B5NA 3L74G 4GOEA 1BDDA 3CX5E 1JY3O 1ZP0C 2JEEA 3CXHH 2FXOA 3L72D 1L0NK 2W27A 2D2CC 1YITP 2YO3A 3MGNA 3L74E 3G6EP 4AYCA 1JOCA 1OW7A 3CL3D 3CC4P 5AVZB 5KKZB 2LR2A 1AV1A 3HD7C 2Q3EA 3SFDC 2FYUK 2XDJA 1BSNA 1AA0A 4L76A 5GTHH 3USSA 3LW5J 2YXQB 3IAOA 3GHGC 2M0BA 4OGQC 1VQ6P 1EDIA 1K04A 1N7SB 2J59M 3PTZA 5APVA 2KOGA 5CMZA 2FFDB 3Q5PA 1NU1D 1FDIA 2IZ0A 2PAJA 1LTJC 3L72G 4HYTB 1RE3A 1KB9I 1FZAA 1N7SA 4LGDE 2FFDA 4D6TD 3L73J 1S5LE 1OZHA 1SLQA 2HYNA 1IFPA 2L5GB 1P84H 3R2PA 3H1JD 3L72E 3E1RA 5AW3B 2XU6A 1NTMD 4NPDA 2KP8A 2XNXA 2FYZA 1MKMA 2YIUC 3AEDC 3V5BA 4XFJA 1A02J 1NKZB 1NTKK 3GLMA 2BEZF 1M90Q 1NU1G 3CMEP 1OVUA 2C0WA 2J5UA 2P58A 3D6YA 2CK3H 5BU5A 5KLIC 1GU5A 1T2KD 1YI2P 1NU1E 1E79H 1PFIA 4YPCA 1URQC 5K5GB 3F89A 4OH8B 1HH0A 4MN4C 1PP9G 1H88A 3H1JG 2FYNB 1DX7A 2ZJSE 4N78D 2Q5UA 3L70J 5APUA 4YXWH 1NTMG 2N9YB 2DW3A 1BCCJ
chains in the Genus database with same CATH topology
2HFED 4WY4A 4IFDK 2FXMA 3VN0A 2NPSB 1LTTC 2XZRA 1H8AA 1HGVA 3P7KA 5AW0B 2HPCB 1N2DC 1SFCC 1N73C 2ZXEB 1URQB 2NPSD 2OYHA 4IFMA 1HBWA 2P67A 3TNUB 3HUSC 5CCHD 3C9IA 4N6JA 2A45I 1H89A 3V2RA 3HE4B 3VMZA 2QM7A 3HRNA 1MFZA 1URQD 2I1KA 1J1DC 2NPSA 5KLVK 5CCHA 2C0XA 2HPCA 2M8RA 2KSJA 5AW9B 2Z5IA 1URQA 5AVYB 1RF1C 1JO5A 1LT9C 1SQXK 3TNUA 1SQQK 1G1IA 5CCGD 3VYIA 3O8ZA 2GM4A 4C46A 1N73B 3HE4A 5CJ4A 4B86A 3HUSB 1ZV8A 2HODB 3NXSA 3OAKA 5CCGA 3IR9A 1YYCA 3VOPA 1CSBA 2J58A 3KDPB 2C9NY 1IC2A 2I1JA 5AW5B 1SFCD 2YKOA 1IFIA 1J1DB 3RK3C 3M9QA 1VDFA 1GL2C 1N73A 2Z5HA 1FZCC 3L35A 1ZR4A 1T2KC 3TSIA 1LT9B 2P1JA 2R5DA 3GHGA 3HUSA 5AW2B 2HODA 4ZKPA 2H7HA 1HGZA 4O9BA 3M91A 3A5TA 2IFNA 4N78E 1NHLA 2N1TC 2O1KA 1S9KE 3VMXA 3V4WA 1ZR2A 3BRTB 4GKGA 3L37A 3RK3B 4HH2A 1FJKA 4Y99C 1E5WA 4DZOA 3MD0A 3V2NA 1GL2B 4WB4A 2XV5A 2WTYA 1FZCB 5APYA 5AW8B 2GUSA 2KYVA 2H43A 3U1AA 5AVSB 3RK3D 3H32B 4JF7A 3SWYA 1A02F 1GL2D 4AQRD 1HTLC 1NU1K 5AW1B 5KJ7C 2N1TB 3EFGA 3RK2C 2WITA 1G1JA 3V2PA 4DOJA 2KB7P 3E1IA 5CHXA 1GL2A 3BRVB 2ZFCA 1AFOA 5BU8B 4Y99B 2N1TD 1WRGA 2PP6A 4XA4A 4GIFA 2GUVA 3H32A 2P2UA 1NOHA 2W6AA 4I1LA 2LKMA 3BATA 1YTZT 1T3JA 1KQLA 2IX7C 3NFQA 2N1TA 1FBMA 1RE4A 2XKMA 1JNMA 1JTHB 2MJZA 3RK2B 2VRSA 3U59A 1ZLLA 1NTMK 1FZEA 3OA7A 3A3YB 1IFNA 1G2CB 2W6BA 1MZ9A 3KYQA 3I5CA 4EIJA 1HWTC 5KJ7D 3RK2D 2M3BA 3HE5B 1NO4A 5CJ0A 1X79B 1RF0C 1HVVA 1JTHA 3OJAB 5AVXB 1CI6B 1LTSC 1VPCA 3HTKB 1HJBA 2OYIC 1CZQA 3L4FA 4JYCA 3M06A 1GW3A 1G2CA 1JMMA 2WSEH 3MIWA 2A45H 1NKNA 3N7NA 1SFCB 3V2QA 1GD2E 1KILC 3P8MC 5AW4B 2WPSA 3M9BA 3VP8A 4LLHA 3LW5H 5AVUB 1M1JC 1DEBA 1CI6A 3M9HA 3TK1A 1FZGA 1YTZI 3HTKA 3VP9A 1N7SD 5APWA 1XTGB 4RESB 5APQA 1SFCA 3B5NC 3HD7D 3P32A 4GT1A 2OYIB 5AVQB 2WWWA 2WPRA 1RF1B 4IFFA 2OARA 1L4AC 2YMYA 1FOSE 1OWAA 1IFMA 1KILB 3B8EB 1JY3N 1FOSF 5AW6B 3IFMA 1DH3A 1M1JB 1WT6A 1RF0A 2YKPA 3A2AA 3P8CD 3M0DC 1L0LK 5AVRB 1NH4A 3MTUE 2OYIA 1KILD 3U1CA 1HUCA 1RF1A 3V4QA 1LT9A 1IO4A 3BASA 3B5NB 4WBAA 2N9BA 1KILA 2FKWB 5BVZA 1W2EA 4WY4C 1L4AB 1IFJA 2CPBA 1FDMA 1M1JA 1GTWA 1JY3P 3B5ND 1IK9A 3KPEA 1IFDA 2YNYA 1JY2N 3RL0C 2IPPA 1L4AD 3L36A 1EQ7A 3TYYA 1FZBA 3B5NA 3M0AA 1FZCA 2O1JA 1JCCA 2Z4EA 4KHXA 3SWFA 1Z56A 1X9VA 1JY3O 4C7RA 2JEEA 4C7NB 5AVTB 1L0NK 3KQGA 4WY4B 3EQ2A 4XE5B 2POHA 1FAVA 2W27A 3M0DA 2YO3A 3MGNA 1JY2P 3LIDA 3MUDA 1RE3C 4AYCA 1JOCA 3CL3D 2CPSA 1LTIC 3RL0B 3BVHA 1JCDA 1GK6A 4WY4D 1LTBC 5AVZB 3NTNA 2C9LY 1N7SC 3VMYA 1GU4A 4I6MC 2FFDC 3PP5A 3WMM0 1LTAC 1LTGC 2A45G 3VTPC 3HD7C 3RL0D 1QL1A 2KLVA 2FYUK 2XDJA 1JY2O 1QL2A 2R5BA 5KJ7A 2QM8A 1OXZA 2JJLA 3P8CE 2P7JA 5APXA 1KFNA 1X8YA 2WT7B 1NTZK 3GHGC 2E43A 3UIAA 2Q7CA 1FJPA 1N7SB 2J59M 4LC1A 1SVFA 1T3UA 5APVA 3HE5A 2KOGA 5CMZA 2FFDB 2E42A 1LWUC 4W7ZA 1GDTA 3HD7B 2PAJA 1AQ5A 1MV8A 1ZN5A 1LTJC 2Q9IA 4ZKUA 2WT7A 4HYTB 1RE3A 5AVVB 1CW5A 3T97A 1FZAA 4JYBA 2WSFH 1N7SA 1J2JB 4LGDE 1SP4A 3A7OA 4I2LC 3GHGB 2FFDA 1IJDB 2R3CA 1XTCC 5KTBA 5APTA 1KFMA 2BASA 4N3YB 1SLQA 1SQVK 2H8PD 2HYNA 3HD7A 3N4XA 1T8ZA 2L5GB 3NMDA 1LWUB 3R2PA 1KZUB 2YO2A 1RY3A 4EOTA 5AW3B 4AUWA 2XU6A 1LTJB 4M3LA 3H6PA 4W7YA 2KP8A 2XNXA 1N86A 2FYZA 3V5BA 1LWUA 1GW4A 2O01H 1A02J 1NKZB 5AW7B 1NTKK 1NWQA 4W80A 1RE4C 3II6A 1J1EC 1LTJA 1MUUA 1LGHB 5APSA 3G3ZA 2R32A 2OYHC 1N7LA 5AVWB 2C0WA 1SQPK 1L4AA 3LIEA 1M7LA 1FU1A 2NPSC 5BU5A 1SQBK 5CCHC 2Q3IA 2YKQA 1GU5A 1T2KD 2WSCH 3CLQA 1PFIA 1GK4A 1URQC 1FZFA 4OH8B 1HH0A 1NAFA 2IFMA 1J1EB 1H88A 2HG5D 1JUNA 1DX7A 2OYHB 4N78D 2HLOA 2Q5UA 3CI9A 5APUA 4C7NA 2WZ7A 1S9KD 5CCGC 2WPQA 1GZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B8E B;  1FOS F;  5AW6 B;  1A02 F;  1DH3 A;  4AQR D;  1H8A A;  3VN0 A;  2XZR A;  3A2A A;  5AW1 B;  1MV8 A;  3P7K A;  5AVR B;  5AW0 B;  2WT7 A;  4HYT B;  2ZXE B;  5AVV B;  1HUC A;  2ZFC A;  3V4Q A;  2E42 A;  3T97 A;  4JYB A;  1HBW A;  1IO4 A;  2P67 A;  3TNU B;  1J2J B;  1SP4 A;  3A7O A;  4I2L C;  2N9B A;  1H89 A;  2P2U A;  2R3C A;  3HE4 B;  2W6A A;  3VMZ A;  2QM7 A;  5APT A;  2BAS A;  1MFZ A;  1SLQ A;  1KQL A;  1GTW A;  3NFQ A;  3NMD A;  5AW9 B;  2Z5I A;  1JNM A;  2YO2 A;  2YNY A;  5AVY B;  2IPP A;  4EOT A;  2VRS A;  5AW3 B;  3L36 A;  2XU6 A;  4AUW A;  3TNU A;  3TYY A;  3VYI A;  3O8Z A;  3M0A A;  4M3L A;  4C46 A;  3A3Y B;  1G2C B;  2KP8 A;  3HE4 A;  4KHX A;  3SWF A;  4B86 A;  3I5C A;  1HWT C;  3V5B A;  3NXS A;  3OAK A;  3IR9 A;  1YYC A;  1CSB A;  4C7N B;  3KDP B;  2C9N Y;  3HE5 B;  1A02 J;  5AVT B;  5AW5 B;  5AW7 B;  1NWQ A;  3KQG A;  4XE5 B;  5AVX B;  1CI6 B;  1FAV A;  2W27 A;  3M0D A;  2YO3 A;  1HJB A;  3MGN A;  1CZQ A;  1MUU A;  3LID A;  4JYC A;  3M06 A;  5APS A;  2Z5H A;  4AYC A;  3L35 A;  2R32 A;  1T2K C;  1GK6 A;  5AVZ B;  3NTN A;  5AVW B;  2C9L Y;  3VMY A;  5AW2 B;  2R5D A;  1GU4 A;  4I6M C;  1GD2 E;  3P8M C;  2H7H A;  5AW4 B;  2WPS A;  3M91 A;  3M9B A;  3A5T A;  3LIE A;  5AVU B;  3VTP C;  1CI6 A;  3M9H A;  2Q3I A;  3TK1 A;  1S9K E;  3VMX A;  1GU5 A;  1T2K D;  3V4W A;  3HTK A;  2R5B A;  1GK4 A;  2QM8 A;  1OXZ A;  4GKG A;  2JJL A;  1NAF A;  2P7J A;  3L37 A;  5APW A;  5APX A;  1X8Y A;  4RES B;  1H88 A;  5APQ A;  3MD0 A;  4DZO A;  3P32 A;  4GT1 A;  2WT7 B;  2E43 A;  5AVQ B;  2WWW A;  2WPR A;  2XV5 A;  2WTY A;  3UIA A;  1JUN A;  5APY A;  5AW8 B;  2Q7C A;  1FOS E;  1OWA A;  2Q5U A;  1S9K D;  4LC1 A;  5APU A;  5AVS B;  4C7N A;  2WPQ A;  5APV A;  3HE5 A;  5CMZ A;  1GZL A; 
#chains in the Genus database with same CATH topology
 4D6T E;  4WY4 A;  1LJ2 A;  3I55 P;  1LTT C;  2XZR A;  3L71 J;  5AW0 B;  4TLF A;  3H1J E;  1N73 C;  2ZXE B;  1HBW A;  4IFM A;  2P67 A;  5CCH D;  1AVY A;  1NTM E;  1Y47 A;  5B5E E;  2QM7 A;  3HRN A;  2RKL A;  2I1K A;  1BGY J;  5KLV K;  2Z5I A;  1YQ3 C;  5AVY B;  1D7M A;  1JO5 A;  1LT9 C;  3TF5 A;  3G71 P;  3AE7 C;  2XND H;  2M5A B;  3VYI A;  4B86 A;  3NXS A;  2H89 C;  5CCG A;  1YYC A;  3VOP A;  1CSB A;  1QVG O;  2KSE A;  2YKO A;  2QIW A;  3M9Q A;  4PD4 H;  2M5A A;  2O01 J;  2Z5H A;  1T2K C;  2Y9Z A;  3GHG A;  1S3J A;  2H7H A;  2UWJ E;  4Z1M H;  3GG2 A;  4N78 E;  1DD4 A;  2N1T C;  2O1K A;  3V4W A;  1QGK B;  2E5T A;  4I7Z B;  3L37 A;  4HH2 A;  4Y99 C;  1E5W A;  3V2N A;  1FZC B;  5KAI H;  5AW8 B;  2GUS A;  1SS1 A;  3H32 B;  1VQ8 P;  4R4M A;  3W67 A;  3ITK A;  1GL2 D;  3OW2 O;  3CXH E;  3EFG A;  3Q2Y A;  2JDI H;  4UB8 E;  2E76 D;  1L0N G;  1FDO A;  1X22 A;  3WUV A;  1AFO A;  3S1K A;  5BU8 B;  2W8Z A;  3CX5 H;  4XA4 A;  2GUV A;  3H32 A;  2P2U A;  2IBZ G;  3CWB J;  3BAT A;  1YTZ T;  1T3J A;  1R5S A;  1L0N E;  2FYU G;  1Y9B A;  5GTH E;  2R44 A;  3A3Y B;  2OQQ A;  2IBZ E;  3KYQ A;  3AEE C;  4NPE A;  1Q86 Q;  2M3B A;  1T6A A;  3HE5 B;  1NO4 A;  3V6I A;  1HVV A;  2FYU E;  1VPC A;  3HTK B;  2OYI C;  1H0T B;  3M06 A;  2WSE H;  1NKN A;  3T97 B;  1PGP A;  1OMI A;  1SQX J;  2JP3 A;  1DEB A;  3CC2 P;  4U3F D;  3M9H A;  3HTK A;  1N7S D;  1H0T A;  4RJT A;  3BCC J;  1XTG B;  3B5N C;  1PIX A;  1S5L H;  1FOS E;  1OWA A;  2HR3 A;  1IFM A;  2WMM A;  2G8Y A;  1DH3 A;  5AVR B;  3MTU E;  1NTK G;  1KIL D;  1LT9 A;  1IO4 A;  2E74 B;  5TJH A;  3AE4 C;  1ZW0 A;  1W2E A;  1L4A B;  1IFJ A;  1FDM A;  1GTW A;  3TGU G;  4YTP C;  1SQP J;  3RBZ A;  1PV3 A;  3O6Q B;  2IPP A;  4U3F G;  1SQB J;  1VQP P;  1EQ7 A;  3TYY A;  5KKZ C;  5KAF E;  4IOI H;  3M0A A;  3CCM P;  4KHX A;  1X9V A;  1EC5 A;  3TGU E;  2BCC J;  4C7N B;  3CCV P;  2POH A;  3O6Q A;  4U3F E;  1U57 A;  1Q82 Q;  3LID A;  1JEK A;  1RE3 C;  3G4S P;  1LTI C;  3RL0 B;  4WY4 D;  1GK6 A;  1LTB C;  1N7S C;  1GU4 A;  1VL2 A;  3PP5 A;  2FFD C;  2ZT9 B;  3CCE P;  3EWK A;  2A45 G;  2QSI A;  4H13 B;  1QL2 A;  5KLV G;  3H1K J;  2JJL A;  1KQF B;  3AE8 C;  2P7J A;  1KFN A;  2LXC B;  1KIL E;  1EZV I;  5EFW B;  2E75 B;  1KOR A;  1SQQ J;  2D2C D;  3KHU A;  2JKV A;  2G3A A;  3CCJ P;  4PD4 I;  2I8D A;  1CW5 A;  1Q7Y Q;  1SP4 A;  3A7O A;  3L73 G;  1QVF O;  2SPZ A;  5TIS E;  2B88 A;  1KFM A;  1ZRT D;  3JC2 2;  3FGA D;  3NMD A;  4Y28 J;  2YO2 A;  4OGQ D;  1RY3 A;  1M57 D;  3L70 D;  4H44 B;  1KQS O;  1BCC D;  4AUW A;  3L73 E;  1JMB A;  4BXL A;  4M3L A;  3AE9 C;  1L0L J;  4W7Y A;  3L71 D;  2B9B A;  1JB0 J;  1GW4 A;  2V7Q J;  3II6 A;  2FYN C;  1BGY D;  3G3Z A;  2R32 A;  2P10 A;  1SQP K;  1X0T A;  3CX5 I;  1OVV A;  3H1L J;  1SQB K;  1DIP A;  2Q3I A;  3CLQ A;  4UB8 H;  1FZF A;  1YJ9 P;  1NAF A;  2FY8 A;  1J1E B;  2KXP B;  1JUN A;  3S9O A;  3JCU H;  2OYH B;  2HLO A;  2AEF A;  3CI9 A;  4EI2 A;  2WZ7 A;  5CCG C;  1U7M A;  2KNC B;  2HFE D;  3AEA C;  3PJS K;  2FXM A;  3VN0 A;  2NPS B;  3W68 A;  1YIJ P;  2HPC B;  1BDC A;  4KJM A;  2OYH A;  3TNU B;  2KNC A;  3V2R A;  1BGY G;  3WU2 E;  1MFZ A;  1URQ D;  1KYO D;  2NPS A;  2Y0C A;  2C0X A;  4ASW A;  2WSF J;  2HPC A;  1K73 Q;  3TNU A;  3Q3D A;  1SQQ K;  1G1I A;  3R4Y A;  2GM4 A;  4C46 A;  1BGY E;  5CJ4 A;  1KD1 Q;  3HUS B;  1ZV8 A;  1QLE D;  2HOD B;  3KDP B;  2I1J A;  5AW5 B;  4I7Z C;  1J1D B;  1S72 P;  3CWB D;  2RH0 A;  1FZC C;  3L35 A;  2NZ2 A;  3TSI A;  5AW2 B;  3HUS A;  2HOD A;  1U7J A;  1HGZ A;  4O9B A;  3H1H J;  1KQG B;  3IN6 A;  2IFN A;  4ZMD A;  3AE3 C;  3PLN A;  3FX0 A;  1OVR A;  3BRT B;  4GKG A;  3RK3 B;  4TT3 H;  1VF5 B;  2AEM A;  2WSC J;  4WB4 A;  2ZYA A;  2WTY A;  5APY A;  2MKV A;  1ZOY C;  1EDJ A;  5AVS B;  3VMA A;  3Q5R A;  1KYO E;  5KJ7 C;  4D6T G;  3V2P A;  3CCU P;  2JO1 A;  1SQX D;  4DOJ A;  5KAF H;  3AEB C;  5CHX A;  2ZFC A;  4H0L B;  1S1C X;  2N1T D;  1WRG A;  2PP6 A;  3G9R A;  3CWB G;  1NOH A;  5C39 A;  3BCC D;  1KQL A;  4PV1 B;  2K9Y A;  2XKM A;  4IL6 X;  3Q1M A;  3RK2 B;  1PGJ A;  4WVZ A;  1NVO A;  1ZLL A;  3AEC C;  3CWB E;  1UII A;  3I5C A;  4ZNC A;  1NTZ J;  4DCK A;  1X79 B;  1CZQ A;  1JMM A;  3ABV C;  2A45 H;  1QX8 A;  1YHQ P;  3N7N A;  1SQP D;  1LNQ A;  5AW4 B;  3FWL A;  2WPS A;  3M9B A;  1SQB D;  3LW5 H;  5AVU B;  4DJG A;  1FZG A;  1YTZ I;  3VP9 A;  2E75 D;  1SQV J;  2BCC D;  2E74 C;  3PH0 A;  2KUB A;  1SQX E;  2ZAE B;  4GT1 A;  2H88 C;  2WWW A;  5TIS H;  3AE1 C;  2QJK B;  2WPV B;  1L4A C;  1QEX A;  1FOS F;  1M1J B;  1VQ9 P;  3F5H A;  2O3J A;  4QMA A;  3A0H E;  1HUC A;  3V4Q A;  4JBZ A;  1EDL A;  3BAS A;  1RHZ B;  4H44 D;  5M1B A;  4RKU J;  3H1K D;  5BVZ A;  1M1J A;  4DT0 A;  2K9J B;  1VQO P;  3CXH I;  3B5N D;  3KPE A;  1SQB G;  1JY2 N;  3RL0 C;  2NRG A;  1SQQ D;  4NPF X;  1FZB A;  4ASV A;  1FZC A;  2ZT9 C;  2O1J A;  1JCC A;  2Q1K A;  2A06 D;  3SWF A;  1Z56 A;  2BCC G;  4L75 A;  4C7R A;  1LT1 A;  1SQP E;  2K9J A;  3JCU E;  4H13 C;  3RBX A;  5AVT B;  5H2F H;  4JQ0 D;  4HKZ H;  1SQB E;  4XE5 B;  2IZ1 A;  1JM0 A;  1JY2 P;  1R5L A;  1PP9 J;  3NTN A;  2YMK A;  2BCC E;  2C9L Y;  2IBZ I;  2E75 C;  4I6M C;  2ITA A;  3WMM 0;  1LTA C;  3B71 A;  3AEF C;  2KLV A;  1VQ7 P;  1JY2 O;  1L0L D;  5KJ7 A;  2QM8 A;  1BE3 J;  1PZQ A;  5APX A;  1X8Y A;  3L75 J;  2FXP A;  1NTZ K;  2WT7 B;  2E43 A;  4UB6 E;  3WU2 H;  2Q7C A;  1FJP A;  1SQQ G;  4LC1 A;  1SVF A;  1T3U A;  3A0B E;  3HE5 A;  2E42 A;  4W7Z A;  4H44 C;  2K37 A;  1MV8 A;  1P84 I;  3H1L D;  4ZKU A;  3C8V A;  2WT7 A;  3GMA A;  3T97 A;  1SQQ E;  2AXC A;  4I2L C;  5APT A;  4EDF A;  2W6J H;  2BAS A;  1SQV K;  1T8Z A;  3FXE A;  1LWU B;  1R8E A;  1BSH A;  4EOT A;  4HB1 A;  2JWA A;  1N86 A;  3CMA P;  3GF3 A;  2E5Y A;  1NYH A;  1LWU A;  2O01 H;  1NWQ A;  1K8A Q;  2QJY B;  4W80 A;  2QJP B;  1J1E C;  1ZME C;  4K3A A;  1EZV D;  4CPG A;  2OYH C;  1N7L A;  2LXB A;  3H1L G;  3KZI E;  1EXI A;  1L4A A;  3LIE A;  1M7L A;  2NPS C;  1KYO H;  3B4S A;  3CCS P;  1GK4 A;  1UIX A;  2IFM A;  1L0N J;  2OTJ P;  3H1L E;  2WSS H;  2ZVO B;  1S9K D;  4C7N A;  1GZL A;  4H0L D;  3AE2 C;  2QVA A;  2ZYD A;  1HGV A;  3P7K A;  3H1H D;  1N2D C;  1SFC C;  2FYU J;  2Y9Y A;  2W83 C;  3HUS C;  3C9I A;  1PGQ A;  4N6J A;  2A45 I;  3WUT A;  1H89 A;  1J1D C;  1N8R Q;  5CCH A;  2AXT E;  2K1A A;  2KSJ A;  2B87 B;  1RF1 C;  2L91 A;  1NJI Q;  1SQX K;  5CCG D;  4R4L A;  3O8Z A;  3K5B A;  1PPJ D;  3OAK A;  3IR9 A;  2J58 A;  2C9N Y;  1FC2 C;  2B87 A;  1IFI A;  1Q90 D;  3RK3 C;  2B89 A;  1VF5 C;  2IYP A;  2WQY C;  2YXR B;  3ZDM A;  3H1H G;  1AVO A;  1NHL A;  1DEE G;  1S9K E;  3VMX A;  2K3R A;  3A0H H;  3MUD C;  4A7P A;  1VQ4 P;  1NTK J;  4H0L C;  4KT0 J;  1FJK A;  3FXD A;  1NTZ D;  3H1H E;  3MD0 A;  1GL2 B;  4IL6 E;  3CD6 P;  2KYV A;  2H43 A;  4PV1 C;  3H1I J;  2E76 B;  4JF7 A;  3IF4 A;  3TGU J;  1PPJ G;  1HTL C;  3RK2 C;  1G1J A;  5H2F E;  1KB9 D;  2KB7 P;  3E1I A;  1GL2 A;  3BRV B;  3RL0 g;  1IK7 A;  5DJU B;  1ZXG A;  3KXD A;  3L70 G;  1BCC G;  1SQV D;  2LKM A;  1PGO A;  1PPJ E;  2IX7 C;  1VQ5 P;  1M1K Q;  3C1L A;  5CBO A;  1OIP A;  1FBM A;  1ZRT E;  3L71 G;  2MJZ A;  2VRS A;  3U59 A;  3L70 E;  1IFN A;  1BCC E;  2W6B A;  1MZ9 A;  4GOF A;  1HWT C;  5KJ7 D;  1NTZ G;  1OW6 A;  1OW8 A;  5GTI H;  3L71 E;  2OTL P;  3OJA B;  3CCL P;  5AVX B;  1CI6 B;  2WVR A;  5KLV J;  3L4F A;  2QE7 H;  4JYC A;  4UB6 H;  2QJK C;  1GMJ A;  3MIW A;  1NTZ E;  1SFC B;  3V2Q A;  3A0B H;  3P8M C;  3VP8 A;  4LLH A;  3QH9 A;  1M1J C;  1CI6 A;  3TK1 A;  2RN0 A;  2QEX P;  3MHV A;  1SQV G;  4U7J A;  3H25 A;  1AQT A;  4RES B;  1SFC A;  3P32 A;  1KB9 E;  2PFX A;  2WPR A;  1RF1 B;  2ZYG A;  4IFF A;  2OAR A;  1Q2N A;  1VQN P;  3AEG C;  1KIL B;  1FS0 E;  3B8E B;  3MZW B;  5AW6 B;  1PP9 D;  1SQV E;  2Y0E A;  5CBN A;  3IFM A;  1WT6 A;  1RF0 A;  2YKP A;  3A2A A;  3P8C D;  1VQM P;  1L0L K;  1NH4 A;  3PHL A;  3U1C A;  1RF1 A;  4OVN F;  2JR8 A;  4WBA A;  1KIL A;  4PJ0 E;  1BE3 D;  2PGD A;  1USE A;  3L75 D;  2E74 D;  1KYO I;  1IK9 A;  1IFD A;  5B66 H;  1L4A D;  1LP1 B;  3L36 A;  5L8R J;  3KZI H;  2Z4E A;  3L74 J;  2V7Q H;  3I56 P;  4EYY Q;  3KQG A;  4WY4 B;  3EQ2 A;  1FAV A;  2OGU A;  3M0D A;  1LP1 A;  2QA4 P;  2W90 A;  3MUD A;  3BVH A;  2CPS A;  1JCD A;  1TU3 F;  3VMY A;  2M3E A;  3CCQ P;  1LTG C;  5E79 E;  3VTP C;  2K88 A;  3RL0 D;  2WSE J;  1QL1 A;  3CCR P;  2ZT9 D;  1BE3 G;  2R5B A;  1PP9 E;  2KLU A;  1Y8A A;  1OXZ A;  2QRX A;  3P8C E;  3L75 G;  3D6Z A;  2D2C B;  4HJG H;  3SSU A;  4H13 D;  3UIA A;  4WWI A;  1SQX G;  1FE6 A;  1YJN P;  1OX3 A;  3CXH D;  2AXT H;  1MFT A;  1YJW P;  1LWU C;  1BE3 E;  1HF9 A;  1GDT A;  3HD7 B;  3L75 E;  1AQ5 A;  1ZN5 A;  2PRR A;  2Q9I A;  3BCC G;  3CC7 P;  5AVV B;  3L72 J;  1M8O B;  4JYB A;  2WSF H;  1RH5 B;  1J2J B;  3GHG B;  1IJD B;  2R3C A;  1XTC C;  1K05 A;  4OGQ B;  5KTB A;  2KZI A;  4N3Y B;  1L0N D;  2H8P D;  2QJY C;  2QJP C;  3HD7 A;  1S2E A;  3N4X A;  1L2P A;  1KZU B;  2R3S A;  3BCC E;  2IBZ D;  1LTJ B;  3PRJ A;  3QWO C;  3H6P A;  2FYU D;  2O01 N;  5AW7 B;  3MP7 B;  1SQP G;  1RE4 C;  2KS1 B;  1LTJ A;  4JPZ B;  4L73 A;  1MUU A;  1LGH B;  5APS A;  4IL6 H;  1S5L X;  1NU1 J;  3GF7 A;  1YQ4 C;  5AVW B;  1KTM A;  3AE6 C;  1FU1 A;  3E7K A;  5CCH C;  2KS1 A;  2YIU B;  1P84 D;  2YKQ A;  1S4X A;  2WSC H;  2V4H A;  4D6T J;  2KK7 A;  3SFE C;  2ZXX A;  2HG5 D;  3H1J J;  1KV4 A;  2WPQ A;  1NTM J;  1OFC X;  4IFD K;  1H8A A;  5GTI E;  3H1K G;  5KLI B;  4GOD A;  4GDO A;  1URQ B;  2NPS D;  3WUU A;  1WMK A;  3HE4 B;  3VMZ A;  1NTK D;  4BRY B;  1AJY A;  1VQL P;  3H1K E;  1RQV A;  2A06 G;  2M8R A;  5AW9 B;  1VQK P;  1URQ A;  3H1I D;  1DD3 A;  1NGM B;  3TGU D;  1N73 B;  2QG4 A;  3HE4 A;  4BRY A;  3S4R A;  2A06 E;  1IC2 A;  1SFC D;  2IYO A;  1P84 E;  3SWK A;  1VDF A;  1KB9 H;  1GL2 C;  1W5C E;  1N73 A;  1ZR4 A;  1KC8 Q;  1L0L G;  1Q81 Q;  1LT9 B;  2P1J A;  2R5D A;  4ZKP A;  2E76 C;  3M91 A;  3A5T A;  2RMZ A;  1ZR2 A;  1L0L E;  5B66 E;  4DZO A;  2XV5 A;  4PJ0 H;  4BWN A;  1IZN B;  4OWF A;  3H1I G;  5KLV D;  3U1A A;  3RK3 D;  4L74 A;  1VF5 D;  3SWY A;  1A02 F;  2KIK A;  1NTK E;  4AQR D;  1NU1 K;  5AW1 B;  2N1T B;  2WIT A;  4K35 A;  2GA1 A;  4PD4 D;  4YXD C;  3H1I E;  4Y99 B;  4GIF A;  3D70 A;  2W6A A;  4I1L A;  1KN7 A;  3EFF K;  3NFQ A;  2N1T A;  3FWN A;  1RE4 A;  2FBW C;  1JNM A;  3L73 D;  1JTH B;  4PV1 D;  1NAY A;  1NTM K;  1FZE A;  3OA7 A;  3JSV C;  1G2C B;  5E79 H;  4EIJ A;  3RK2 D;  1EZV G;  2JWD A;  5DJT B;  5CJ0 A;  3RGU A;  1RF0 C;  1JTH A;  1LTS C;  1HJB A;  1USD A;  1GW3 A;  1G2C A;  3CX5 D;  5B5E H;  1HJ0 A;  1EZV E;  1GD2 E;  1M56 D;  1KIL C;  1PL5 A;  3GW6 A;  5KLV E;  3RK3 E;  3Q5S A;  1EXJ A;  2Y0D A;  1W2B O;  3L74 D;  1KMI Z;  5APW A;  1K9M Q;  5APQ A;  3HD7 D;  4PD4 E;  2OYI B;  5AVQ B;  2AEJ A;  2YMY A;  3D71 A;  1JY3 N;  3TDK A;  3M0D C;  1RQU A;  1YBK A;  2ZVN B;  2OYI A;  4RO0 A;  2OTK E;  2IDB A;  3B5N B;  2N9B A;  1EDK A;  2FKW B;  2KZJ A;  5KAI E;  4WY4 C;  2CPB A;  2OYO A;  2KI7 B;  1JY3 P;  3CPW O;  2YNY A;  2Q6Q A;  4U3F J;  3AE5 C;  2BEQ D;  3B5N A;  3L74 G;  4GOE A;  1BDD A;  3CX5 E;  1JY3 O;  1ZP0 C;  2JEE A;  3CXH H;  2FXO A;  3L72 D;  1L0N K;  2W27 A;  2D2C C;  1YIT P;  2YO3 A;  3MGN A;  3L74 E;  3G6E P;  4AYC A;  1JOC A;  1OW7 A;  3CL3 D;  3CC4 P;  5AVZ B;  5KKZ B;  2LR2 A;  1AV1 A;  3HD7 C;  2Q3E A;  3SFD C;  2FYU K;  2XDJ A;  1BSN A;  1AA0 A;  4L76 A;  5GTH H;  3USS A;  3LW5 J;  2YXQ B;  3IAO A;  3GHG C;  2M0B A;  4OGQ C;  1VQ6 P;  1EDI A;  1K04 A;  1N7S B;  2J59 M;  3PTZ A;  5APV A;  2KOG A;  5CMZ A;  2FFD B;  3Q5P A;  1NU1 D;  1FDI A;  2IZ0 A;  2PAJ A;  1LTJ C;  3L72 G;  4HYT B;  1RE3 A;  1KB9 I;  1FZA A;  1N7S A;  4LGD E;  2FFD A;  4D6T D;  3L73 J;  1S5L E;  1OZH A;  1SLQ A;  2HYN A;  1IFP A;  2L5G B;  1P84 H;  3R2P A;  3H1J D;  3L72 E;  3E1R A;  5AW3 B;  2XU6 A;  1NTM D;  4NPD A;  2KP8 A;  2XNX A;  2FYZ A;  1MKM A;  2YIU C;  3AED C;  3V5B A;  4XFJ A;  1A02 J;  1NKZ B;  1NTK K;  3GLM A;  2BEZ F;  1M90 Q;  1NU1 G;  3CME P;  1OVU A;  2C0W A;  2J5U A;  2P58 A;  3D6Y A;  2CK3 H;  5BU5 A;  5KLI C;  1GU5 A;  1T2K D;  1YI2 P;  1NU1 E;  1E79 H;  1PFI A;  4YPC A;  1URQ C;  5K5G B;  3F89 A;  4OH8 B;  1HH0 A;  4MN4 C;  1PP9 G;  1H88 A;  3H1J G;  2FYN B;  1DX7 A;  2ZJS E;  4N78 D;  2Q5U A;  3L70 J;  5APU A;  4YXW H;  1NTM G;  2N9Y B;  2DW3 A;  1BCC J; 
#chains in the Genus database with same CATH homology
 2HFE D;  4WY4 A;  4IFD K;  2FXM A;  3VN0 A;  2NPS B;  1LTT C;  2XZR A;  1H8A A;  1HGV A;  3P7K A;  5AW0 B;  2HPC B;  1N2D C;  1SFC C;  1N73 C;  2ZXE B;  1URQ B;  2NPS D;  2OYH A;  4IFM A;  1HBW A;  2P67 A;  3TNU B;  3HUS C;  5CCH D;  3C9I A;  4N6J A;  2A45 I;  1H89 A;  3V2R A;  3HE4 B;  3VMZ A;  2QM7 A;  3HRN A;  1MFZ A;  1URQ D;  2I1K A;  1J1D C;  2NPS A;  5KLV K;  5CCH A;  2C0X A;  2HPC A;  2M8R A;  2KSJ A;  5AW9 B;  2Z5I A;  1URQ A;  5AVY B;  1RF1 C;  1JO5 A;  1LT9 C;  1SQX K;  3TNU A;  1SQQ K;  1G1I A;  5CCG D;  3VYI A;  3O8Z A;  2GM4 A;  4C46 A;  1N73 B;  3HE4 A;  5CJ4 A;  4B86 A;  3HUS B;  1ZV8 A;  2HOD B;  3NXS A;  3OAK A;  5CCG A;  3IR9 A;  1YYC A;  3VOP A;  1CSB A;  2J58 A;  3KDP B;  2C9N Y;  1IC2 A;  2I1J A;  5AW5 B;  1SFC D;  2YKO A;  1IFI A;  1J1D B;  3RK3 C;  3M9Q A;  1VDF A;  1GL2 C;  1N73 A;  2Z5H A;  1FZC C;  3L35 A;  1ZR4 A;  1T2K C;  3TSI A;  1LT9 B;  2P1J A;  2R5D A;  3GHG A;  3HUS A;  5AW2 B;  2HOD A;  4ZKP A;  2H7H A;  1HGZ A;  4O9B A;  3M91 A;  3A5T A;  2IFN A;  4N78 E;  1NHL A;  2N1T C;  2O1K A;  1S9K E;  3VMX A;  3V4W A;  1ZR2 A;  3BRT B;  4GKG A;  3L37 A;  3RK3 B;  4HH2 A;  1FJK A;  4Y99 C;  1E5W A;  4DZO A;  3MD0 A;  3V2N A;  1GL2 B;  4WB4 A;  2XV5 A;  2WTY A;  1FZC B;  5APY A;  5AW8 B;  2GUS A;  2KYV A;  2H43 A;  3U1A A;  5AVS B;  3RK3 D;  3H32 B;  4JF7 A;  3SWY A;  1A02 F;  1GL2 D;  4AQR D;  1HTL C;  1NU1 K;  5AW1 B;  5KJ7 C;  2N1T B;  3EFG A;  3RK2 C;  2WIT A;  1G1J A;  3V2P A;  4DOJ A;  2KB7 P;  3E1I A;  5CHX A;  1GL2 A;  3BRV B;  2ZFC A;  1AFO A;  5BU8 B;  4Y99 B;  2N1T D;  1WRG A;  2PP6 A;  4XA4 A;  4GIF A;  2GUV A;  3H32 A;  2P2U A;  1NOH A;  2W6A A;  4I1L A;  2LKM A;  3BAT A;  1YTZ T;  1T3J A;  1KQL A;  2IX7 C;  3NFQ A;  2N1T A;  1FBM A;  1RE4 A;  2XKM A;  1JNM A;  1JTH B;  2MJZ A;  3RK2 B;  2VRS A;  3U59 A;  1ZLL A;  1NTM K;  1FZE A;  3OA7 A;  3A3Y B;  1IFN A;  1G2C B;  2W6B A;  1MZ9 A;  3KYQ A;  3I5C A;  4EIJ A;  1HWT C;  5KJ7 D;  3RK2 D;  2M3B A;  3HE5 B;  1NO4 A;  5CJ0 A;  1X79 B;  1RF0 C;  1HVV A;  1JTH A;  3OJA B;  5AVX B;  1CI6 B;  1LTS C;  1VPC A;  3HTK B;  1HJB A;  2OYI C;  1CZQ A;  3L4F A;  4JYC A;  3M06 A;  1GW3 A;  1G2C A;  1JMM A;  2WSE H;  3MIW A;  2A45 H;  1NKN A;  3N7N A;  1SFC B;  3V2Q A;  1GD2 E;  1KIL C;  3P8M C;  5AW4 B;  2WPS A;  3M9B A;  3VP8 A;  4LLH A;  3LW5 H;  5AVU B;  1M1J C;  1DEB A;  1CI6 A;  3M9H A;  3TK1 A;  1FZG A;  1YTZ I;  3HTK A;  3VP9 A;  1N7S D;  5APW A;  1XTG B;  4RES B;  5APQ A;  1SFC A;  3B5N C;  3HD7 D;  3P32 A;  4GT1 A;  2OYI B;  5AVQ B;  2WWW A;  2WPR A;  1RF1 B;  4IFF A;  2OAR A;  1L4A C;  2YMY A;  1FOS E;  1OWA A;  1IFM A;  1KIL B;  3B8E B;  1JY3 N;  1FOS F;  5AW6 B;  3IFM A;  1DH3 A;  1M1J B;  1WT6 A;  1RF0 A;  2YKP A;  3A2A A;  3P8C D;  3M0D C;  1L0L K;  5AVR B;  1NH4 A;  3MTU E;  2OYI A;  1KIL D;  3U1C A;  1HUC A;  1RF1 A;  3V4Q A;  1LT9 A;  1IO4 A;  3BAS A;  3B5N B;  4WBA A;  2N9B A;  1KIL A;  2FKW B;  5BVZ A;  1W2E A;  4WY4 C;  1L4A B;  1IFJ A;  2CPB A;  1FDM A;  1M1J A;  1GTW A;  1JY3 P;  3B5N D;  1IK9 A;  3KPE A;  1IFD A;  2YNY A;  1JY2 N;  3RL0 C;  2IPP A;  1L4A D;  3L36 A;  1EQ7 A;  3TYY A;  1FZB A;  3B5N A;  3M0A A;  1FZC A;  2O1J A;  1JCC A;  2Z4E A;  4KHX A;  3SWF A;  1Z56 A;  1X9V A;  1JY3 O;  4C7R A;  2JEE A;  4C7N B;  5AVT B;  1L0N K;  3KQG A;  4WY4 B;  3EQ2 A;  4XE5 B;  2POH A;  1FAV A;  2W27 A;  3M0D A;  2YO3 A;  3MGN A;  1JY2 P;  3LID A;  3MUD A;  1RE3 C;  4AYC A;  1JOC A;  3CL3 D;  2CPS A;  1LTI C;  3RL0 B;  3BVH A;  1JCD A;  1GK6 A;  4WY4 D;  1LTB C;  5AVZ B;  3NTN A;  2C9L Y;  1N7S C;  3VMY A;  1GU4 A;  4I6M C;  2FFD C;  3PP5 A;  3WMM 0;  1LTA C;  1LTG C;  2A45 G;  3VTP C;  3HD7 C;  3RL0 D;  1QL1 A;  2KLV A;  2FYU K;  2XDJ A;  1JY2 O;  1QL2 A;  2R5B A;  5KJ7 A;  2QM8 A;  1OXZ A;  2JJL A;  3P8C E;  2P7J A;  5APX A;  1KFN A;  1X8Y A;  2WT7 B;  1NTZ K;  3GHG C;  2E43 A;  3UIA A;  2Q7C A;  1FJP A;  1N7S B;  2J59 M;  4LC1 A;  1SVF A;  1T3U A;  5APV A;  3HE5 A;  2KOG A;  5CMZ A;  2FFD B;  2E42 A;  1LWU C;  4W7Z A;  1GDT A;  3HD7 B;  2PAJ A;  1AQ5 A;  1MV8 A;  1ZN5 A;  1LTJ C;  2Q9I A;  4ZKU A;  2WT7 A;  4HYT B;  1RE3 A;  5AVV B;  1CW5 A;  3T97 A;  1FZA A;  4JYB A;  2WSF H;  1N7S A;  1J2J B;  4LGD E;  1SP4 A;  3A7O A;  4I2L C;  3GHG B;  2FFD A;  1IJD B;  2R3C A;  1XTC C;  5KTB A;  5APT A;  1KFM A;  2BAS A;  4N3Y B;  1SLQ A;  1SQV K;  2H8P D;  2HYN A;  3HD7 A;  3N4X A;  1T8Z A;  2L5G B;  3NMD A;  1LWU B;  3R2P A;  1KZU B;  2YO2 A;  1RY3 A;  4EOT A;  5AW3 B;  4AUW A;  2XU6 A;  1LTJ B;  4M3L A;  3H6P A;  4W7Y A;  2KP8 A;  2XNX A;  1N86 A;  2FYZ A;  3V5B A;  1LWU A;  1GW4 A;  2O01 H;  1A02 J;  1NKZ B;  5AW7 B;  1NTK K;  1NWQ A;  4W80 A;  1RE4 C;  3II6 A;  1J1E C;  1LTJ A;  1MUU A;  1LGH B;  5APS A;  3G3Z A;  2R32 A;  2OYH C;  1N7L A;  5AVW B;  2C0W A;  1SQP K;  1L4A A;  3LIE A;  1M7L A;  1FU1 A;  2NPS C;  5BU5 A;  1SQB K;  5CCH C;  2Q3I A;  2YKQ A;  1GU5 A;  1T2K D;  2WSC H;  3CLQ A;  1PFI A;  1GK4 A;  1URQ C;  1FZF A;  4OH8 B;  1HH0 A;  1NAF A;  2IFM A;  1J1E B;  1H88 A;  2HG5 D;  1JUN A;  1DX7 A;  2OYH B;  4N78 D;  2HLO A;  2Q5U A;  3CI9 A;  5APU A;  4C7N A;  2WZ7 A;  1S9K D;  5CCG C;  2WPQ A;  1GZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...