3TYYA

Crystal structure of human lamin-b1 coil 2 segment
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
75
structure length
75
Chain Sequence
QKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLEGEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of the coil 2B fragment and the globular tail domain of human lamin B1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Lamin-B1
total genus 34
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3tyyA00
3B8EB 4I6MC 5APXA 1OWAA 3P7KA 5APTA 5AVUB 5AVTB 2P7JA 3TNUA 3TYYA 3I5CA 2ZXEB 1G2CB 2WPQA 1GK6A 3MD0A 2C9LY 1CI6B 5AW2B 3M0DA 3NXSA 1FOSF 1NAFA 5APWA 5AVRB 3M0AA 2QM7A 5AW7B 2R5BA 4XE5B 1CZQA 5AVYB 5CMZA 2WPRA 4HYTB 3M91A 1HBWA 3NTNA 1JNMA 3LIEA 2WPSA 2IPPA 3LIDA 2VRSA 2Q3IA 4AUWA 5APSA 1H8AA 1H88A 2P2UA 5AW8B 2WT7A 2WWWA 3SWFA 3OAKA 3A7OA 1GU4A 1GZLA 1MFZA 1FAVA 2QM8A 2Q5UA 5AW5B 3T97A 1DH3A 1MV8A 2H7HA 4AYCA 3VMXA 1GK4A 5APVA 2W6AA 4JYBA 1T2KD 1S9KD 1NWQA 5AVWB 2P67A 1J2JB 3V4WA 1MUUA 2E42A 5AW9B 2XZRA 3TK1A 3A5TA 2BASA 5AVQB 1SLQA 1A02J 1CI6A 3NMDA 3HTKA 2WTYA 4LC1A 2WT7B 4B86A 3HE5A 1YYCA 3P8MC 3VMZA 2ZFCA 3O8ZA 3VN0A 3MGNA 2R3CA 3M9HA 2Q7CA 4RESB 5AW0B 4M3LA 2JJLA 1HJBA 1HUCA 2R5DA 2XU6A 5AVXB 3P32A 1OXZA 5APUA 1CSBA 5AVVB 2E43A 2XV5A 1A02F 3HE5B 2C9NY 3L36A 1FOSE 1GU5A 4C7NA 2N9BA 3M9BA 1KQLA 2YO3A 1S9KE 3NFQA 4GT1A 1JUNA 3HE4B 4C46A 3V5BA 2YNYA 3TNUB 3L35A 3VTPC 4EOTA 1GD2E 5AW6B 4DZOA 1HWTC 3KQGA 3A3YB 5APQA 5AVZB 4JYCA 1X8YA 3HE4A 3V4QA 3A2AA 5AW3B 4I2LC 3UIAA 4GKGA 1IO4A 1H89A 5AW1B 3VMYA 2KP8A 5AVSB 3KDPB 4KHXA 3L37A 4C7NB 3IR9A 1T2KC 2Z5IA 2Z5HA 2YO2A 5AW4B 5APYA 3M06A 3VYIA 4AQRD 2W27A 1GTWA 2R32A 1SP4A
chains in the Genus database with same CATH superfamily
2KNCA 2KOGA 2E75B 4WB4A 2I8DA 2MJZA 5AVTB 2H88C 4IOIH 3TNUA 3TGUJ 3TYYA 1ZMEC 2M3EA 1BSHA 1NTME 2RMZA 1LNQA 5CHXA 2V7QJ 4I7ZC 3AE5C 1M1JB 1KFMA 2YKPA 3M0DA 3CCMP 3IAOA 3CCRP 1JTHB 4UB6E 5AVRB 1J1DC 3GHGC 4LGDE 4U7JA 5APWA 2K1AA 5KLVE 4JBZA 2QM7A 2M8RA 1KILD 1M7LA 1N7SA 1NOHA 4XE5B 5L8RJ 1GW4A 2FYUG 3L72G 1CZQA 5CCHD 1PPJE 1LWUC 2K37A 1GMJA 1SQPG 2WPVB 3M91A 4HYTB 4OGQC 4W7ZA 3NTNA 2G3AA 1HBWA 1KQSO 1SQVD 1T3UA 1RE4C 1ZOYC 3EFGA 2ZJSE 2VRSA 3L74J 3IFMA 4Y28J 3RL0B 1NKZB 1AFOA 5EFWB 2WSFJ 3L71J 2XNXA 5AW8B 1LTIC 2W6JH 3H1IG 2JR8A 1L2PA 1SQQG 3HRNA 4PD4H 3CWBJ 2HG5D 1GZLA 3I56P 3KPEA 2RKLA 3VP9A 1MFZA 4IL6H 3PHLA 3CCUP 1FAVA 4H0LC 2Q5UA 4BRYA 1M8OB 4YPCA 5KJ7A 1KB9E 3T97A 2UWJE 1GK4A 2FYZA 5KKZB 4R4MA 1IFDA 5APVA 3R4YA 1AVOA 2HYNA 3CWBE 4JYBA 5KLIB 1S5LX 3D6YA 5KLVK 3L74D 3IF4A 1NU1E 3L71E 2JO1A 3D6ZA 1SQVJ 3L70E 1J2JB 2WMMA 5CJ0A 2Y9ZA 1S2EA 1K73Q 2XDJA 1JEKA 1MUUA 1OFCX 1QL1A 2IBZD 3T97B 3L75D 4UB8E 2WSEH 2GA1A 3FXDA 3GW6A 3MUDA 3A5TA 1YHQP 2KLVA 1RF1A 1RF1B 1CI6A 2QJYC 2ZYAA 3SFEC 3HTKA 1PPJG 1RE3C 4IL6E 1QVGO 2FFDC 1PGQA 2BCCG 5E79H 1G2CA 4BWNA 3USSA 1KB9H 3M9QA 4LC1A 5CCGD 3RK2B 4B86A 3HE5A 1KN7A 1KFNA 1JB0J 3VN0A 2R3CA 1XTGB 4PV1D 2QE7H 5B66H 5KLVJ 3SWYA 1VF5C 2YKOA 1HUCA 1PIXA 1PP9J 1KC8Q 2ZAEB 1LJ2A 2AEFA 1OXZA 2O3JA 2YMYA 4WY4B 1NTMJ 1L0NG 1Q2NA 5AVVB 4U3FE 3GLMA 3SSUA 3W67A 5BU5A 4OH8B 3GF3A 2DW3A 1SQBG 3ABVC 3L36A 2JEEA 2M0BA 1VQLP 2PFXA 3H1IJ 1NKNA 3V2RA 1KQLA 3VOPA 2XKMA 5H2FH 3RK3C 3NFQA 1KILC 3L75J 3L75G 1SQBD 3LW5H 1QVFO 2IBZG 2KIKA 2Y9YA 3IN6A 1L0LG 4C46A 1HTLC 2IYPA 1JUNA 3ITKA 3L75E 2KS1B 2YXQB 3RBXA 3H6PA 3L73J 1P84E 1Z56A 4EDFA 2Y0EA 1N73A 1GD2E 2SPZA 1HVVA 1HWTC 2FYUD 3L72D 2OQQA 1HF9A 5CJ4A 2FKWB 2RH0A 3BVHA 4D6TJ 3OA7A 1G1JA 1NTKJ 2A45G 1BGYD 1M57D 2OYOA 2QG4A 2CPSA 3A0HE 2H43A 2E74D 4K3AA 1M1JA 4I2LC 1KMIZ 4BRYB 4WY4D 3H1ID 2XNDH 1LTJB 3CC2P 5AVSB 4KHXA 5CBOA 3L37A 1PL5A 3CL3D 1BE3G 1VDFA 4N3YB 1PGPA 1IFMA 5E79E 1P84H 1SQQK 1SQPJ 2AXTE 3CC7P 1JY3P 5APYA 3M06A 4IFFA 1YQ4C 1AQ5A 4XFJA 2R32A 3VMXA 2ZYGA 4H13D 3WUTA 1T8ZA 3KHUA 1SQXG 5KJ7D 3AEAC 3CCQP 1K9MQ 3CD6P 1KILA 1FS0E 2ZT9C 1EZVG 4RO0A 1Y8AA 2Y0CA 2D2CB 3I5CA 5CCGC 2YIUC 3PP5A 3FWLA 1RY3A 1N8RQ 2C9LY 1U7JA 2P58A 3BCCJ 2YMKA 3H1JJ 5TISE 3EWKA 3WU2H 3G3ZA 3NXSA 2N1TA 2J5UA 1FOSF 1NAFA 3KXDA 2KXPB 4HKZH 2AXTH 1VQ9P 1NTZE 2QSIA 5AW7B 4H44C 1Q7YQ 1FZCA 3CCEP 1NO4A 2KB7P 1IZNB 2V7QH 1GL2C 3Q5PA 3LW5J 4QMAA 2WPRA 3CXHD 5CMZA 3F5HA 1JY2O 3TNUB 1SVFA 3MIWA 2PRRA 4DJGA 2K9YA 3SFDC 1JNMA 3H1HG 2B9BA 1GL2A 3LIEA 3LIDA 1PV3A 4AUWA 2C0WA 4Y99C 2O01H 2K9JA 5APSA 2KUBA 2RN0A 1H88A 1FZGA 5TISH 2FY8A 1HGZA 3PH0A 3AEEC 1ZRTD 3SWFA 1EXJA 3Q5SA 4JQ0D 1L0LD 3CWBG 4EYYQ 1N86A 1GU4A 3B5ND 1GTWA 1NU1D 4U3FJ 3MTUE 2QM8A 4LLHA 3CX5D 5GTIH 3CMEP 1JY2N 1OIPA 3MHVA 1NWQA 1H0TA 3KYQA 1PP9E 2IBZE 1PP9G 4RKUJ 1MV8A 1NTMD 1OW6A 2R3SA 1BDDA 4O9BA 4AYCA 1EZVD 1YQ3C 1YJNP 3WMM0 1NAYA 3S1KA 1YTZI 1ZP0C 2A45I 2W6AA 1SQXD 5CCGA 3TGUE 1R8EA 1T2KD 3RGUA 2KLUA 3H1KG 1NHLA 3HUSA 1IFPA 2E75D 4L73A 2K3RA 4L74A 1L4AA 1USDA 1LT1A 4R4LA 2QJKC 4W80A 3TK1A 1LTBC 5KLIC 3CXHE 1U57A 2IZ1A 1P84I 4I1LA 3H32B 2E75C 1SQVE 3L70J 1L0LJ 1MZ9A 2H8PD 1NU1J 2W90A 2BCCJ 2FYNB 1SFCD 4U3FD 2I1JA 1J1DB 1NTZJ 1E5WA 1KORA 1Q90D 3GHGB 4H13C 4Z1MH 2WT7B 3O8ZA 3OJAB 2A06G 2Q7CA 4M3LA 1HJBA 3N4XA 1G1IA 2R5DA 2FXPA 3M0DC 5DJUB 3VP8A 4KT0J 2L5GB 1FDMA 5APUA 5KAFE 1VQ8P 3CX5E 1NTMG 4A7PA 1LTTC 2CK3H 4DT0A 2B87A 2XV5A 1FBMA 4UB8H 1YI2P 1FZCB 2C9NY 1QX8A 2B88A 2OYHC 2KZJA 3CWBD 3M9BA 3B5NC 5DJTB 4H44D 2KSEA 2YO3A 3L74E 1LTJA 1NTZK 1ZR2A 4IFMA 1Y47A 3EFFK 3L70D 2HR3A 3MUDC 1JY3O 3C8VA 2IFNA 4GT1A 1BGYE 1LTJC 3RL0g 1SQPE 3N7NA 3V5BA 2YNYA 1AQTA 1SFCB 1SQVK 1L4AC 2E76C 2H89C 2KK7A 3CI9A 3JC22 3L35A 1LP1A 4GODA 2JP3A 4TT3H 1ZV8A 5APQA 1QGKB 1SQVG 5B66E 2BEQD 4D6TG 1HGVA 2AXCA 1VQNP 3HE4A 3RBZA 2P1JA 1FJPA 2ZVNB 2E74C 3UIAA 4GKGA 1URQD 2WVRA 1H0TB 1H89A 3L73D 2KP8A 1YJWP 5B5EE 5GTIE 3AECC 1VL2A 3AE1C 2Y0DA 2M5AA 1FU1A 3AE3C 4C7NB 3C1LA 3AEFC 3IR9A 1KILB 1Q82Q 4RJTA 1NVOA 1NTKD 2JDIH 1RF1C 1JCCA 1QL2A 2YO2A 5AW4B 3BRTB 3VYIA 1OVRA 2QJPB 4AQRD 4C7RA 2R44A 3E1IA 2ITAA 1Q86Q 1SP4A 2FYNC 3KZIE 3CXHI 3L74G 5KAIE 2Q6QA 4NPFX 3K5BA 3P8CE 3BRVB 4CPGA 1OWAA 3P7KA 1SQBJ 1LWUA 5AVUB 5KAFH 3CPWO 2YXRB 2P7JA 2ZT9D 3HD7B 1PFIA 1FZBA 1G2CB 1FOSE 3MD0A 2IX7C 3D70A 2N1TB 1RQVA 3H1LG 1HH0A 4PD4E 2QIWA 3V2PA 1EDLA 4H0LB 1DD4A 3V6IA 4GDOA 3M0AA 2W6BA 3CX5I 2R5BA 3HUSB 2WSSH 1L0ND 4IL6X 2B87B 1VF5B 2OYHB 1ZN5A 3MP7B 4D6TD 3F89A 1BE3D 2WPSA 2IPPA 4ZKUA 2WSFH 4NPEA 1KYOD 2C0XA 1Y9BA 2O1KA 1URQC 5KTBA 2OYHA 1KB9D 1SQBK 1DEEG 3B5NA 4JF7A 2Z4EA 1EZVE 3HUSC 3L71G 3GHGA 2WT7A 3BASA 1PPJD 2Q1KA 1SQXE 1SQPK 3A7OA 3TGUD 3HTKB 1RF0A 4UB6H 1N7SC 3AE8C 1AA0A 3AE7C 3C9IA 1BGYG 1D7MA 2NPSB 4WY4C 2FYUK 1RHZB 1RH5B 5AW5B 2PP6A 1DH3A 3AE4C 2N1TC 3H1LE 3AEBC 2H7HA 3H25A 3O6QB 2B89A 2OARA 1L0NJ 1URQB 1OZHA 1RQUA 1S9KD 1JMBA 1R5LA 2L91A 3MZWB 4ASWA 1ZW0A 2N1TD 2HPCA 1JY2P 1BCCG 2QJPC 4PJ0E 1IK9A 2QJYB 4W7YA 2XZRA 2PAJA 2YIUB 1MFTA 5AVQB 4Y99B 2O1JA 4PV1C 4K35A 3G71P 3NMDA 3U59A 3PTZA 3CCVP 1SQQD 4BXLA 5C39A 3D71A 1VQ5P 3L71D 2OTJP 2WTYA 1BSNA 1HJ0A 3L73G 1EXIA 5CCHC 1IFIA 2LXBA 1YYCA 3VMZA 2ZFCA 2FYUJ 2JKVA 2YKQA 3L72J 3M9HA 2FXMA 4OGQB 4RESB 4OGQD 4IFDK 4DCKA 1FZFA 5KAIH 3U1CA 2XU6A 1LGHB 1OMIA 3RK3D 1CSBA 1M1KQ 1VPCA 2E43A 4WWIA 3Q2YA 2M3BA 2BCCD 2WSEJ 2W83C 1IFNA 1JOCA 2ZYDA 1KD1Q 1SFCA 1IC2A 1SQQJ 2D2CC 3R2PA 4C7NA 1P84D 3A0BE 3TGUG 1GU5A 2OTLP 1OW7A 2IFMA 2OYIB 1TU3F 1KYOH 3EQ2A 3BCCG 2POHA 3H1JG 1BCCD 1NH4A 1DEBA 2CPBA 2KSJA 3H1HE 3HD7C 1KQFB 1K04A 2JWDA 5B5EH 3I55P 1M90Q 2V4HA 1UIXA 2N9YB 3AE6C 3HE4B 1FJKA 3HD7A 5M1BA 1VQMP 1L4AD 1M56D 2E76D 3PLNA 3H1IE 1SQQE 4DZOA 1LP1B 3KQGA 4WBAA 3CCLP 2ZT9B 4KJMA 3OW2O 4JYCA 2E5YA 2WITA 1OVUA 1JTHA 1S3JA 2IYOA 4DOJA 1L0LK 4TLFA 2A06D 3RK3B 3A2AA 5KLVD 4YTPC 1NU1K 4HH2A 2WQYC 5AW3B 1J1EB 2O01J 4JPZB 1IFJA 5H2FE 3QH9A 2Q9IA 1IO4A 2KI7B 3L70G 4MN4C 2FYUE 3KDPB 1NTMK 3H1KE 3L72E 1DD3A 3L4FA 4H13B 1JM0A 1NU1G 4WVZA 3S4RA 1YTZT 3SWKA 3TSIA 1UIIA 2Z5IA 1JCDA 2W8ZA 3AE2C 3B5NB 1VF5D 3CCJP 2O01N 1N73B 2Z5HA 4N78D 1LTSC 1FDIA 2JWAA 1RE4A 5BVZA 1SS1A 2W27A 1L4AB 2E76B 2WSCH 1SFCC 3AE9C 1NJIQ 2ZXXA 2OGUA 2PGDA 3H1HD 1FE6A 3B8EB 2GUVA 4I6MC 2NRGA 3V2NA 4ZMDA 5APXA 3H1KJ 3QWOC 1AV1A 1N2DC 5APTA 1K8AQ 3W68A 2KZIA 2KS1A 2ZXEB 2IDBA 3JCUE 1EDJA 2WPQA 1GK6A 1L0NE 2IZ0A 2HODA 4U3FG 2E74B 1BDCA 1CI6B 3H1LJ 1EZVI 5AW2B 5KJ7C 3A0BH 4D6TE 5CCHA 1S1CX 1BE3E 3E7KA 1OW8A 1AVYA 1KYOE 3B4SA 1K05A 2HPCB 1USEA 4YXWH 5KKZC 1T6AA 3TDKA 3U1AA 1EDKA 3L73E 2FFDB 1RF0C 2OYIC 4HJGH 1KQGB 5KLVG 1URQA 1W5CE 3H1KD 2NPSC 1L0LE 2D2CD 3KZIH 1IJDB 5AVYB 1NTKG 3H1HJ 1VQKP 1DX7A 3GG2A 1DIPA 3FGAD 2NPSA 2Q3IA 1Q81Q 4GOEA 1LTAC 1NTZD 1PP9D 1H8AA 3FWNA 4N78E 3G6EP 3H1LD 2QA4P 2LKMA 2P2UA 2IBZI 2K88A 3B71A 4PD4I 4PJ0H 3RL0C 1PZQA 5CBNA 2WWWA 1XTCC 3OAKA 2NZ2A 3PJSK 1N7SD 1OX3A 2QJKB 3FX0A 4EI2A 1FZCC 1JO5A 1VQPP 3P8CD 3RK2C 3E1RA 2LR2A 3BCCD 3H1JD 1LTGC 1X22A 2FBWC 3CMAP 4H0LD 2AEJA 2HFED 4XA4A 4YXDC 2ZVOB 5GTHE 1ZRTE 2J58A 3RK2D 4L76A 1JY3N 1N7SB 1QEXA 2QRXA 3GMAA 1SQBE 2P67A 3II6A 5AVWB 3ZDMA 1YIJP 4ASVA 1VQ4P 4EIJA 3AEDC 1VQOP 3BATA 4I7ZB 1X9VA 3V4WA 1ZR4A 1S5LH 2E42A 1WT6A 1BCCJ 3FXEA 3H32A 5AW9B 4NPDA 2BASA 1EC5A 1SLQA 1W2EA 1A02J 2Q3EA 1NTKK 2OYIA 1KYOI 3RK3E 2WSCJ 1KB9I 2HLOA 3WU2E 1YBKA 1FDOA 1OVVA 1LWUB 1ZLLA 3CLQA 1CW5A 1GW3A 2J59M 4L75A 3P8MC 3V2QA 1AJYA 1KV4A 1BE3J 3MGNA 5AW0B 1LT9A 1GL2B 2JJLA 2QVAA 4ZNCA 2FXOA 2BEZF 4OVNF 1X79B 5AVXB 1EDIA 3P32A 1IK7A 3Q3DA 4GOFA 3BCCE 1M1JC 3H1JE 1LT9B 1U7MA 3JCUH 5BU8B 1SQXJ 1A02F 2OTKE 3HE5B 2FFDA 3RL0D 3AEGC 3Q5RA 2GUSA 3A0HH 1EQ7A 2M5AB 3CXHH 2N9BA 2A45H 3WUVA 1W2BO 3VMAA 1FC2C 1S9KE 3HD7D 2GM4A 2K9JB 1VQ6P 2E5TA 1GL2D 1BGYJ 1L0NK 2NPSD 5K5GB 1FZEA 1GDTA 2A06E 1FZAA 3GF7A 4OWFA 3CCSP 1R5SA 3VTPC 4EOTA 2AEMA 1JMMA 5AW6B 4H44B 1VQ7P 3CX5H 2KNCB 2G8YA 3A3YB 3PRJA 3G4SP 1T3JA 1NGMB 3CC4P 3O6QA 4WY4A 2WZ7A 5AVZB 1PGJA 2I1KA 1X8YA 3TF5A 1SQPD 3V4QA 1SQXK 1NTKE 4N6JA 1QLED 1KTMA 1KZUB 3S9OA 1KILE 1S5LE 2HODB 1ZXGA 3JSVC 5AW1B 3VMYA 1J1EC 4GIFA 1WRGA 1LT9C 1PGOA 2P10A 2QEXP 1S72P 1NTZG 2MKVA 1RE3A 2BCCE 4ZKPA 4HB1A 1NYHA 1S4XA 1N7LA 1YITP 1YJ9P 3G9RA 5GTHH 2KYVA 1T2KC 4PV1B 1N73C 1X0TA 2LXCB 3Q1MA 1WMKA 1MKMA 5TJHA 4PD4D 1BCCE 1E79H 3WUUA
chains in the Genus database with same CATH topology
2KOGA 4WB4A 2MJZA 5AVTB 3TNUA 3TYYA 5CHXA 1M1JB 1KFMA 2YKPA 3M0DA 1JTHB 5AVRB 1J1DC 3GHGC 4LGDE 5APWA 2QM7A 2M8RA 1KILD 1M7LA 1N7SA 1NOHA 4XE5B 5CCHD 1GW4A 1CZQA 1LWUC 4HYTB 3M91A 4W7ZA 1HBWA 3NTNA 1T3UA 1RE4C 3EFGA 2VRSA 3IFMA 3RL0B 1NKZB 1AFOA 2XNXA 5AW8B 1LTIC 3HRNA 2HG5D 1GZLA 3KPEA 3VP9A 1MFZA 1FAVA 2Q5UA 5KJ7A 3T97A 1GK4A 2FYZA 1IFDA 5APVA 2HYNA 4JYBA 5KLVK 1J2JB 5CJ0A 2XDJA 1MUUA 1QL1A 3A5TA 2WSEH 3MUDA 1RF1A 2KLVA 1RF1B 1CI6A 3HTKA 1RE3C 2FFDC 1G2CA 5CCGD 4LC1A 3M9QA 3RK2B 4B86A 3HE5A 1KFNA 3VN0A 2R3CA 1XTGB 1N73C 3SWYA 2YKOA 1HUCA 1OXZA 4WY4B 2YMYA 1N73A 5AVVB 5BU5A 4OH8B 3L36A 2JEEA 1NKNA 3V2RA 1KQLA 3VOPA 2XKMA 3RK3C 3NFQA 1KILC 3LW5H 1JUNA 4C46A 1HTLC 3H6PA 1Z56A 1GD2E 1HVVA 1HWTC 5CJ4A 2FKWB 3OA7A 1G1JA 2A45G 2H43A 2CPSA 1M1JA 4I2LC 4WY4D 1LTJB 5AVSB 4KHXA 3L37A 3CL3D 1VDFA 4N3YB 1IFMA 1SQQK 1JY3P 5APYA 3M06A 4IFFA 2R32A 3VMXA 1T8ZA 5KJ7D 1KILA 3I5CA 5CCGC 3PP5A 1RY3A 2C9LY 3G3ZA 3NXSA 2N1TA 1FOSF 1NAFA 5AW7B 1FZCA 1NO4A 2KB7P 1GL2C 5CMZA 2WPRA 1JY2O 1SVFA 3MIWA 1JNMA 3LIDA 1GL2A 3LIEA 4AUWA 2C0WA 4Y99C 2O01H 5APSA 1FZGA 1HGZA 3SWFA 1GU4A 1N86A 3B5ND 3MTUE 2QM8A 1JY2N 3KYQA 1MV8A 4O9BA 4AYCA 3WMM0 1YTZI 2A45I 2W6AA 1FZFA 5CCGA 1T2KD 3HUSA 1NHLA 1L4AA 4W80A 3TK1A 1LTBC 4I1LA 3H32B 1MZ9A 2H8PD 3V2NA 1SFCD 2I1JA 1J1DB 3GHGB 1E5WA 2WT7B 3O8ZA 3OJAB 2Q7CA 4M3LA 1HJBA 3N4XA 1G1IA 2R5DA 3M0DC 1FDMA 3VP8A 2L5GB 5APUA 1LTTC 2XV5A 1FBMA 1FZCB 2C9NY 2OYHC 3M9BA 3B5NC 2YO3A 1LTJA 1NTZK 1ZR2A 4IFMA 1JY3O 2IFNA 4GT1A 1LTJC 3N7NA 3V5BA 2YNYA 1SFCB 1SQVK 4LLHA 1L4AC 3CI9A 3L35A 3TNUB 1ZV8A 5APQA 1HGVA 3HE4A 2P1JA 1FJPA 3UIAA 4GKGA 1URQD 1H89A 2KP8A 1FU1A 4C7NB 3IR9A 1KILB 1RF1C 1JCCA 1QL2A 2YO2A 5AW4B 3BRTB 3VYIA 4AQRD 4C7RA 3E1IA 1SP4A 3P8CE 3BRVB 1OWAA 3P7KA 1LWUA 5AVUB 1PFIA 2P7JA 3HD7B 1FZBA 1G2CB 3MD0A 2IX7C 2N1TB 1HH0A 3V2PA 3M0AA 2W6BA 2R5BA 3HUSB 2OYHB 1ZN5A 2WPSA 2IPPA 4ZKUA 2WSFH 2C0XA 2O1KA 5KTBA 2OYHA 1URQC 1SQBK 3B5NA 4JF7A 2Z4EA 3HUSC 3GHGA 2WT7A 3BASA 1SQPK 3A7OA 3HTKB 1RF0A 1N7SC 3C9IA 2NPSB 4WY4C 2FYUK 5AW5B 1DH3A 2PP6A 2H7HA 2N1TC 2OARA 1URQB 1S9KD 2N1TD 2HPCA 1JY2P 4W7YA 1IK9A 2XZRA 2PAJA 5AVQB 4Y99B 2O1JA 3NMDA 3U59A 2WTYA 5CCHC 1IFIA 1YYCA 3VMZA 2ZFCA 2YKQA 3M9HA 2FXMA 4RESB 4IFDK 3U1CA 2XU6A 1LGHB 3RK3D 1CSBA 1VPCA 2E43A 2M3BA 1IFNA 1JOCA 1FOSE 1SFCA 1IC2A 3R2PA 4C7NA 1GU5A 2IFMA 2OYIB 3EQ2A 3HD7C 2POHA 1NH4A 1DEBA 2CPBA 2KSJA 3HE4B 1FJKA 3HD7A 1L4AD 4DZOA 3KQGA 4WBAA 4JYCA 2WITA 1JTHA 4DOJA 1L0LK 3RK3B 3A2AA 1NU1K 4HH2A 5AW3B 1J1EB 1IFJA 2Q9IA 1IO4A 3KDPB 1NTMK 3L4FA 3TSIA 1YTZT 2Z5IA 1JCDA 3B5NB 1N73B 2Z5HA 4N78D 1LTSC 1RE4A 5BVZA 2W27A 1L4AB 2WSCH 1SFCC 3B8EB 2GUVA 4I6MC 5APXA 1N2DC 5APTA 2ZXEB 2WPQA 1GK6A 2HODA 1CI6B 5KJ7C 5AW2B 5CCHA 2HPCB 2FFDB 1DX7A 3U1AA 2OYIC 1RF0C 1URQA 5AVYB 2NPSC 1IJDB 2NPSA 2Q3IA 1LTAC 1H8AA 4N78E 2LKMA 2P2UA 3RL0C 2WWWA 1XTCC 3OAKA 1N7SD 1FZCC 1JO5A 3P8CD 3RK2C 1LTGC 2HFED 4XA4A 2J58A 3RK2D 1NWQA 1JY3N 1N7SB 5AVWB 2P67A 3II6A 4EIJA 3BATA 1ZR4A 1X9VA 3V4WA 2E42A 1WT6A 3H32A 5AW9B 2BASA 1SLQA 1W2EA 1A02J 1NTKK 2OYIA 2HLOA 1ZLLA 1LWUB 3CLQA 1CW5A 1GW3A 2J59M 3V2QA 3P8MC 3MGNA 5AW0B 1LT9A 1GL2B 2JJLA 1X79B 5AVXB 3P32A 1M1JC 1LT9B 5BU8B 1A02F 3HE5B 2FFDA 3RL0D 2GUSA 1EQ7A 2N9BA 2A45H 1S9KE 3HD7D 2GM4A 1GL2D 1L0NK 2NPSD 1FZEA 1GDTA 1FZAA 3VTPC 4EOTA 1JMMA 5AW6B 3A3YB 1T3JA 4WY4A 2WZ7A 5AVZB 2I1KA 1X8YA 3V4QA 1SQXK 4N6JA 1KZUB 5AW1B 2HODB 3VMYA 1J1EC 4GIFA 1WRGA 1LT9C 1RE3A 4ZKPA 1AQ5A 1T2KC 1N7LA 2KYVA 1GTWA 3BVHA 1H88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B8E B;  4I6M C;  5APX A;  1OWA A;  3P7K A;  5APT A;  5AVU B;  5AVT B;  2P7J A;  3TNU A;  3TYY A;  3I5C A;  2ZXE B;  1G2C B;  2WPQ A;  1GK6 A;  3MD0 A;  2C9L Y;  1CI6 B;  5AW2 B;  3M0D A;  3NXS A;  1FOS F;  1NAF A;  5APW A;  5AVR B;  3M0A A;  2QM7 A;  5AW7 B;  2R5B A;  4XE5 B;  1CZQ A;  5AVY B;  5CMZ A;  2WPR A;  4HYT B;  3M91 A;  1HBW A;  3NTN A;  1JNM A;  3LIE A;  2WPS A;  2IPP A;  3LID A;  2VRS A;  2Q3I A;  4AUW A;  5APS A;  1H8A A;  1H88 A;  2P2U A;  5AW8 B;  2WT7 A;  2WWW A;  3SWF A;  3OAK A;  3A7O A;  1GU4 A;  1GZL A;  1MFZ A;  1FAV A;  2QM8 A;  2Q5U A;  5AW5 B;  3T97 A;  1DH3 A;  1MV8 A;  2H7H A;  4AYC A;  3VMX A;  1GK4 A;  5APV A;  2W6A A;  4JYB A;  1T2K D;  1S9K D;  1NWQ A;  5AVW B;  2P67 A;  1J2J B;  3V4W A;  1MUU A;  2E42 A;  5AW9 B;  2XZR A;  3TK1 A;  3A5T A;  2BAS A;  5AVQ B;  1SLQ A;  1A02 J;  1CI6 A;  3NMD A;  3HTK A;  2WTY A;  4LC1 A;  2WT7 B;  4B86 A;  3HE5 A;  1YYC A;  3P8M C;  3VMZ A;  2ZFC A;  3O8Z A;  3VN0 A;  3MGN A;  2R3C A;  3M9H A;  2Q7C A;  4RES B;  5AW0 B;  4M3L A;  2JJL A;  1HJB A;  1HUC A;  2R5D A;  2XU6 A;  5AVX B;  3P32 A;  1OXZ A;  5APU A;  1CSB A;  5AVV B;  2E43 A;  2XV5 A;  1A02 F;  3HE5 B;  2C9N Y;  3L36 A;  1FOS E;  1GU5 A;  4C7N A;  2N9B A;  3M9B A;  1KQL A;  2YO3 A;  1S9K E;  3NFQ A;  4GT1 A;  1JUN A;  3HE4 B;  4C46 A;  3V5B A;  2YNY A;  3TNU B;  3L35 A;  3VTP C;  4EOT A;  1GD2 E;  5AW6 B;  4DZO A;  1HWT C;  3KQG A;  3A3Y B;  5APQ A;  5AVZ B;  4JYC A;  1X8Y A;  3HE4 A;  3V4Q A;  3A2A A;  5AW3 B;  4I2L C;  3UIA A;  4GKG A;  1IO4 A;  1H89 A;  5AW1 B;  3VMY A;  2KP8 A;  5AVS B;  3KDP B;  4KHX A;  3L37 A;  4C7N B;  3IR9 A;  1T2K C;  2Z5I A;  2Z5H A;  2YO2 A;  5AW4 B;  5APY A;  3M06 A;  3VYI A;  4AQR D;  2W27 A;  1GTW A;  2R32 A;  1SP4 A; 
#chains in the Genus database with same CATH topology
 2KNC A;  2KOG A;  2E75 B;  4WB4 A;  2I8D A;  2MJZ A;  5AVT B;  2H88 C;  4IOI H;  3TNU A;  3TGU J;  3TYY A;  1ZME C;  2M3E A;  1BSH A;  1NTM E;  2RMZ A;  1LNQ A;  5CHX A;  2V7Q J;  4I7Z C;  3AE5 C;  1M1J B;  1KFM A;  2YKP A;  3M0D A;  3CCM P;  3IAO A;  3CCR P;  1JTH B;  4UB6 E;  5AVR B;  1J1D C;  3GHG C;  4LGD E;  4U7J A;  5APW A;  2K1A A;  5KLV E;  4JBZ A;  2QM7 A;  2M8R A;  1KIL D;  1M7L A;  1N7S A;  1NOH A;  4XE5 B;  5L8R J;  1GW4 A;  2FYU G;  3L72 G;  1CZQ A;  5CCH D;  1PPJ E;  1LWU C;  2K37 A;  1GMJ A;  1SQP G;  2WPV B;  3M91 A;  4HYT B;  4OGQ C;  4W7Z A;  3NTN A;  2G3A A;  1HBW A;  1KQS O;  1SQV D;  1T3U A;  1RE4 C;  1ZOY C;  3EFG A;  2ZJS E;  2VRS A;  3L74 J;  3IFM A;  4Y28 J;  3RL0 B;  1NKZ B;  1AFO A;  5EFW B;  2WSF J;  3L71 J;  2XNX A;  5AW8 B;  1LTI C;  2W6J H;  3H1I G;  2JR8 A;  1L2P A;  1SQQ G;  3HRN A;  4PD4 H;  3CWB J;  2HG5 D;  1GZL A;  3I56 P;  3KPE A;  2RKL A;  3VP9 A;  1MFZ A;  4IL6 H;  3PHL A;  3CCU P;  1FAV A;  4H0L C;  2Q5U A;  4BRY A;  1M8O B;  4YPC A;  5KJ7 A;  1KB9 E;  3T97 A;  2UWJ E;  1GK4 A;  2FYZ A;  5KKZ B;  4R4M A;  1IFD A;  5APV A;  3R4Y A;  1AVO A;  2HYN A;  3CWB E;  4JYB A;  5KLI B;  1S5L X;  3D6Y A;  5KLV K;  3L74 D;  3IF4 A;  1NU1 E;  3L71 E;  2JO1 A;  3D6Z A;  1SQV J;  3L70 E;  1J2J B;  2WMM A;  5CJ0 A;  2Y9Z A;  1S2E A;  1K73 Q;  2XDJ A;  1JEK A;  1MUU A;  1OFC X;  1QL1 A;  2IBZ D;  3T97 B;  3L75 D;  4UB8 E;  2WSE H;  2GA1 A;  3FXD A;  3GW6 A;  3MUD A;  3A5T A;  1YHQ P;  2KLV A;  1RF1 A;  1RF1 B;  1CI6 A;  2QJY C;  2ZYA A;  3SFE C;  3HTK A;  1PPJ G;  1RE3 C;  4IL6 E;  1QVG O;  2FFD C;  1PGQ A;  2BCC G;  5E79 H;  1G2C A;  4BWN A;  3USS A;  1KB9 H;  3M9Q A;  4LC1 A;  5CCG D;  3RK2 B;  4B86 A;  3HE5 A;  1KN7 A;  1KFN A;  1JB0 J;  3VN0 A;  2R3C A;  1XTG B;  4PV1 D;  2QE7 H;  5B66 H;  5KLV J;  3SWY A;  1VF5 C;  2YKO A;  1HUC A;  1PIX A;  1PP9 J;  1KC8 Q;  2ZAE B;  1LJ2 A;  2AEF A;  1OXZ A;  2O3J A;  2YMY A;  4WY4 B;  1NTM J;  1L0N G;  1Q2N A;  5AVV B;  4U3F E;  3GLM A;  3SSU A;  3W67 A;  5BU5 A;  4OH8 B;  3GF3 A;  2DW3 A;  1SQB G;  3ABV C;  3L36 A;  2JEE A;  2M0B A;  1VQL P;  2PFX A;  3H1I J;  1NKN A;  3V2R A;  1KQL A;  3VOP A;  2XKM A;  5H2F H;  3RK3 C;  3NFQ A;  1KIL C;  3L75 J;  3L75 G;  1SQB D;  3LW5 H;  1QVF O;  2IBZ G;  2KIK A;  2Y9Y A;  3IN6 A;  1L0L G;  4C46 A;  1HTL C;  2IYP A;  1JUN A;  3ITK A;  3L75 E;  2KS1 B;  2YXQ B;  3RBX A;  3H6P A;  3L73 J;  1P84 E;  1Z56 A;  4EDF A;  2Y0E A;  1N73 A;  1GD2 E;  2SPZ A;  1HVV A;  1HWT C;  2FYU D;  3L72 D;  2OQQ A;  1HF9 A;  5CJ4 A;  2FKW B;  2RH0 A;  3BVH A;  4D6T J;  3OA7 A;  1G1J A;  1NTK J;  2A45 G;  1BGY D;  1M57 D;  2OYO A;  2QG4 A;  2CPS A;  3A0H E;  2H43 A;  2E74 D;  4K3A A;  1M1J A;  4I2L C;  1KMI Z;  4BRY B;  4WY4 D;  3H1I D;  2XND H;  1LTJ B;  3CC2 P;  5AVS B;  4KHX A;  5CBO A;  3L37 A;  1PL5 A;  3CL3 D;  1BE3 G;  1VDF A;  4N3Y B;  1PGP A;  1IFM A;  5E79 E;  1P84 H;  1SQQ K;  1SQP J;  2AXT E;  3CC7 P;  1JY3 P;  5APY A;  3M06 A;  4IFF A;  1YQ4 C;  1AQ5 A;  4XFJ A;  2R32 A;  3VMX A;  2ZYG A;  4H13 D;  3WUT A;  1T8Z A;  3KHU A;  1SQX G;  5KJ7 D;  3AEA C;  3CCQ P;  1K9M Q;  3CD6 P;  1KIL A;  1FS0 E;  2ZT9 C;  1EZV G;  4RO0 A;  1Y8A A;  2Y0C A;  2D2C B;  3I5C A;  5CCG C;  2YIU C;  3PP5 A;  3FWL A;  1RY3 A;  1N8R Q;  2C9L Y;  1U7J A;  2P58 A;  3BCC J;  2YMK A;  3H1J J;  5TIS E;  3EWK A;  3WU2 H;  3G3Z A;  3NXS A;  2N1T A;  2J5U A;  1FOS F;  1NAF A;  3KXD A;  2KXP B;  4HKZ H;  2AXT H;  1VQ9 P;  1NTZ E;  2QSI A;  5AW7 B;  4H44 C;  1Q7Y Q;  1FZC A;  3CCE P;  1NO4 A;  2KB7 P;  1IZN B;  2V7Q H;  1GL2 C;  3Q5P A;  3LW5 J;  4QMA A;  2WPR A;  3CXH D;  5CMZ A;  3F5H A;  1JY2 O;  3TNU B;  1SVF A;  3MIW A;  2PRR A;  4DJG A;  2K9Y A;  3SFD C;  1JNM A;  3H1H G;  2B9B A;  1GL2 A;  3LIE A;  3LID A;  1PV3 A;  4AUW A;  2C0W A;  4Y99 C;  2O01 H;  2K9J A;  5APS A;  2KUB A;  2RN0 A;  1H88 A;  1FZG A;  5TIS H;  2FY8 A;  1HGZ A;  3PH0 A;  3AEE C;  1ZRT D;  3SWF A;  1EXJ A;  3Q5S A;  4JQ0 D;  1L0L D;  3CWB G;  4EYY Q;  1N86 A;  1GU4 A;  3B5N D;  1GTW A;  1NU1 D;  4U3F J;  3MTU E;  2QM8 A;  4LLH A;  3CX5 D;  5GTI H;  3CME P;  1JY2 N;  1OIP A;  3MHV A;  1NWQ A;  1H0T A;  3KYQ A;  1PP9 E;  2IBZ E;  1PP9 G;  4RKU J;  1MV8 A;  1NTM D;  1OW6 A;  2R3S A;  1BDD A;  4O9B A;  4AYC A;  1EZV D;  1YQ3 C;  1YJN P;  3WMM 0;  1NAY A;  3S1K A;  1YTZ I;  1ZP0 C;  2A45 I;  2W6A A;  1SQX D;  5CCG A;  3TGU E;  1R8E A;  1T2K D;  3RGU A;  2KLU A;  3H1K G;  1NHL A;  3HUS A;  1IFP A;  2E75 D;  4L73 A;  2K3R A;  4L74 A;  1L4A A;  1USD A;  1LT1 A;  4R4L A;  2QJK C;  4W80 A;  3TK1 A;  1LTB C;  5KLI C;  3CXH E;  1U57 A;  2IZ1 A;  1P84 I;  4I1L A;  3H32 B;  2E75 C;  1SQV E;  3L70 J;  1L0L J;  1MZ9 A;  2H8P D;  1NU1 J;  2W90 A;  2BCC J;  2FYN B;  1SFC D;  4U3F D;  2I1J A;  1J1D B;  1NTZ J;  1E5W A;  1KOR A;  1Q90 D;  3GHG B;  4H13 C;  4Z1M H;  2WT7 B;  3O8Z A;  3OJA B;  2A06 G;  2Q7C A;  4M3L A;  1HJB A;  3N4X A;  1G1I A;  2R5D A;  2FXP A;  3M0D C;  5DJU B;  3VP8 A;  4KT0 J;  2L5G B;  1FDM A;  5APU A;  5KAF E;  1VQ8 P;  3CX5 E;  1NTM G;  4A7P A;  1LTT C;  2CK3 H;  4DT0 A;  2B87 A;  2XV5 A;  1FBM A;  4UB8 H;  1YI2 P;  1FZC B;  2C9N Y;  1QX8 A;  2B88 A;  2OYH C;  2KZJ A;  3CWB D;  3M9B A;  3B5N C;  5DJT B;  4H44 D;  2KSE A;  2YO3 A;  3L74 E;  1LTJ A;  1NTZ K;  1ZR2 A;  4IFM A;  1Y47 A;  3EFF K;  3L70 D;  2HR3 A;  3MUD C;  1JY3 O;  3C8V A;  2IFN A;  4GT1 A;  1BGY E;  1LTJ C;  3RL0 g;  1SQP E;  3N7N A;  3V5B A;  2YNY A;  1AQT A;  1SFC B;  1SQV K;  1L4A C;  2E76 C;  2H89 C;  2KK7 A;  3CI9 A;  3JC2 2;  3L35 A;  1LP1 A;  4GOD A;  2JP3 A;  4TT3 H;  1ZV8 A;  5APQ A;  1QGK B;  1SQV G;  5B66 E;  2BEQ D;  4D6T G;  1HGV A;  2AXC A;  1VQN P;  3HE4 A;  3RBZ A;  2P1J A;  1FJP A;  2ZVN B;  2E74 C;  3UIA A;  4GKG A;  1URQ D;  2WVR A;  1H0T B;  1H89 A;  3L73 D;  2KP8 A;  1YJW P;  5B5E E;  5GTI E;  3AEC C;  1VL2 A;  3AE1 C;  2Y0D A;  2M5A A;  1FU1 A;  3AE3 C;  4C7N B;  3C1L A;  3AEF C;  3IR9 A;  1KIL B;  1Q82 Q;  4RJT A;  1NVO A;  1NTK D;  2JDI H;  1RF1 C;  1JCC A;  1QL2 A;  2YO2 A;  5AW4 B;  3BRT B;  3VYI A;  1OVR A;  2QJP B;  4AQR D;  4C7R A;  2R44 A;  3E1I A;  2ITA A;  1Q86 Q;  1SP4 A;  2FYN C;  3KZI E;  3CXH I;  3L74 G;  5KAI E;  2Q6Q A;  4NPF X;  3K5B A;  3P8C E;  3BRV B;  4CPG A;  1OWA A;  3P7K A;  1SQB J;  1LWU A;  5AVU B;  5KAF H;  3CPW O;  2YXR B;  2P7J A;  2ZT9 D;  3HD7 B;  1PFI A;  1FZB A;  1G2C B;  1FOS E;  3MD0 A;  2IX7 C;  3D70 A;  2N1T B;  1RQV A;  3H1L G;  1HH0 A;  4PD4 E;  2QIW A;  3V2P A;  1EDL A;  4H0L B;  1DD4 A;  3V6I A;  4GDO A;  3M0A A;  2W6B A;  3CX5 I;  2R5B A;  3HUS B;  2WSS H;  1L0N D;  4IL6 X;  2B87 B;  1VF5 B;  2OYH B;  1ZN5 A;  3MP7 B;  4D6T D;  3F89 A;  1BE3 D;  2WPS A;  2IPP A;  4ZKU A;  2WSF H;  4NPE A;  1KYO D;  2C0X A;  1Y9B A;  2O1K A;  1URQ C;  5KTB A;  2OYH A;  1KB9 D;  1SQB K;  1DEE G;  3B5N A;  4JF7 A;  2Z4E A;  1EZV E;  3HUS C;  3L71 G;  3GHG A;  2WT7 A;  3BAS A;  1PPJ D;  2Q1K A;  1SQX E;  1SQP K;  3A7O A;  3TGU D;  3HTK B;  1RF0 A;  4UB6 H;  1N7S C;  3AE8 C;  1AA0 A;  3AE7 C;  3C9I A;  1BGY G;  1D7M A;  2NPS B;  4WY4 C;  2FYU K;  1RHZ B;  1RH5 B;  5AW5 B;  2PP6 A;  1DH3 A;  3AE4 C;  2N1T C;  3H1L E;  3AEB C;  2H7H A;  3H25 A;  3O6Q B;  2B89 A;  2OAR A;  1L0N J;  1URQ B;  1OZH A;  1RQU A;  1S9K D;  1JMB A;  1R5L A;  2L91 A;  3MZW B;  4ASW A;  1ZW0 A;  2N1T D;  2HPC A;  1JY2 P;  1BCC G;  2QJP C;  4PJ0 E;  1IK9 A;  2QJY B;  4W7Y A;  2XZR A;  2PAJ A;  2YIU B;  1MFT A;  5AVQ B;  4Y99 B;  2O1J A;  4PV1 C;  4K35 A;  3G71 P;  3NMD A;  3U59 A;  3PTZ A;  3CCV P;  1SQQ D;  4BXL A;  5C39 A;  3D71 A;  1VQ5 P;  3L71 D;  2OTJ P;  2WTY A;  1BSN A;  1HJ0 A;  3L73 G;  1EXI A;  5CCH C;  1IFI A;  2LXB A;  1YYC A;  3VMZ A;  2ZFC A;  2FYU J;  2JKV A;  2YKQ A;  3L72 J;  3M9H A;  2FXM A;  4OGQ B;  4RES B;  4OGQ D;  4IFD K;  4DCK A;  1FZF A;  5KAI H;  3U1C A;  2XU6 A;  1LGH B;  1OMI A;  3RK3 D;  1CSB A;  1M1K Q;  1VPC A;  2E43 A;  4WWI A;  3Q2Y A;  2M3B A;  2BCC D;  2WSE J;  2W83 C;  1IFN A;  1JOC A;  2ZYD A;  1KD1 Q;  1SFC A;  1IC2 A;  1SQQ J;  2D2C C;  3R2P A;  4C7N A;  1P84 D;  3A0B E;  3TGU G;  1GU5 A;  2OTL P;  1OW7 A;  2IFM A;  2OYI B;  1TU3 F;  1KYO H;  3EQ2 A;  3BCC G;  2POH A;  3H1J G;  1BCC D;  1NH4 A;  1DEB A;  2CPB A;  2KSJ A;  3H1H E;  3HD7 C;  1KQF B;  1K04 A;  2JWD A;  5B5E H;  3I55 P;  1M90 Q;  2V4H A;  1UIX A;  2N9Y B;  3AE6 C;  3HE4 B;  1FJK A;  3HD7 A;  5M1B A;  1VQM P;  1L4A D;  1M56 D;  2E76 D;  3PLN A;  3H1I E;  1SQQ E;  4DZO A;  1LP1 B;  3KQG A;  4WBA A;  3CCL P;  2ZT9 B;  4KJM A;  3OW2 O;  4JYC A;  2E5Y A;  2WIT A;  1OVU A;  1JTH A;  1S3J A;  2IYO A;  4DOJ A;  1L0L K;  4TLF A;  2A06 D;  3RK3 B;  3A2A A;  5KLV D;  4YTP C;  1NU1 K;  4HH2 A;  2WQY C;  5AW3 B;  1J1E B;  2O01 J;  4JPZ B;  1IFJ A;  5H2F E;  3QH9 A;  2Q9I A;  1IO4 A;  2KI7 B;  3L70 G;  4MN4 C;  2FYU E;  3KDP B;  1NTM K;  3H1K E;  3L72 E;  1DD3 A;  3L4F A;  4H13 B;  1JM0 A;  1NU1 G;  4WVZ A;  3S4R A;  1YTZ T;  3SWK A;  3TSI A;  1UII A;  2Z5I A;  1JCD A;  2W8Z A;  3AE2 C;  3B5N B;  1VF5 D;  3CCJ P;  2O01 N;  1N73 B;  2Z5H A;  4N78 D;  1LTS C;  1FDI A;  2JWA A;  1RE4 A;  5BVZ A;  1SS1 A;  2W27 A;  1L4A B;  2E76 B;  2WSC H;  1SFC C;  3AE9 C;  1NJI Q;  2ZXX A;  2OGU A;  2PGD A;  3H1H D;  1FE6 A;  3B8E B;  2GUV A;  4I6M C;  2NRG A;  3V2N A;  4ZMD A;  5APX A;  3H1K J;  3QWO C;  1AV1 A;  1N2D C;  5APT A;  1K8A Q;  3W68 A;  2KZI A;  2KS1 A;  2ZXE B;  2IDB A;  3JCU E;  1EDJ A;  2WPQ A;  1GK6 A;  1L0N E;  2IZ0 A;  2HOD A;  4U3F G;  2E74 B;  1BDC A;  1CI6 B;  3H1L J;  1EZV I;  5AW2 B;  5KJ7 C;  3A0B H;  4D6T E;  5CCH A;  1S1C X;  1BE3 E;  3E7K A;  1OW8 A;  1AVY A;  1KYO E;  3B4S A;  1K05 A;  2HPC B;  1USE A;  4YXW H;  5KKZ C;  1T6A A;  3TDK A;  3U1A A;  1EDK A;  3L73 E;  2FFD B;  1RF0 C;  2OYI C;  4HJG H;  1KQG B;  5KLV G;  1URQ A;  1W5C E;  3H1K D;  2NPS C;  1L0L E;  2D2C D;  3KZI H;  1IJD B;  5AVY B;  1NTK G;  3H1H J;  1VQK P;  1DX7 A;  3GG2 A;  1DIP A;  3FGA D;  2NPS A;  2Q3I A;  1Q81 Q;  4GOE A;  1LTA C;  1NTZ D;  1PP9 D;  1H8A A;  3FWN A;  4N78 E;  3G6E P;  3H1L D;  2QA4 P;  2LKM A;  2P2U A;  2IBZ I;  2K88 A;  3B71 A;  4PD4 I;  4PJ0 H;  3RL0 C;  1PZQ A;  5CBN A;  2WWW A;  1XTC C;  3OAK A;  2NZ2 A;  3PJS K;  1N7S D;  1OX3 A;  2QJK B;  3FX0 A;  4EI2 A;  1FZC C;  1JO5 A;  1VQP P;  3P8C D;  3RK2 C;  3E1R A;  2LR2 A;  3BCC D;  3H1J D;  1LTG C;  1X22 A;  2FBW C;  3CMA P;  4H0L D;  2AEJ A;  2HFE D;  4XA4 A;  4YXD C;  2ZVO B;  5GTH E;  1ZRT E;  2J58 A;  3RK2 D;  4L76 A;  1JY3 N;  1N7S B;  1QEX A;  2QRX A;  3GMA A;  1SQB E;  2P67 A;  3II6 A;  5AVW B;  3ZDM A;  1YIJ P;  4ASV A;  1VQ4 P;  4EIJ A;  3AED C;  1VQO P;  3BAT A;  4I7Z B;  1X9V A;  3V4W A;  1ZR4 A;  1S5L H;  2E42 A;  1WT6 A;  1BCC J;  3FXE A;  3H32 A;  5AW9 B;  4NPD A;  2BAS A;  1EC5 A;  1SLQ A;  1W2E A;  1A02 J;  2Q3E A;  1NTK K;  2OYI A;  1KYO I;  3RK3 E;  2WSC J;  1KB9 I;  2HLO A;  3WU2 E;  1YBK A;  1FDO A;  1OVV A;  1LWU B;  1ZLL A;  3CLQ A;  1CW5 A;  1GW3 A;  2J59 M;  4L75 A;  3P8M C;  3V2Q A;  1AJY A;  1KV4 A;  1BE3 J;  3MGN A;  5AW0 B;  1LT9 A;  1GL2 B;  2JJL A;  2QVA A;  4ZNC A;  2FXO A;  2BEZ F;  4OVN F;  1X79 B;  5AVX B;  1EDI A;  3P32 A;  1IK7 A;  3Q3D A;  4GOF A;  3BCC E;  1M1J C;  3H1J E;  1LT9 B;  1U7M A;  3JCU H;  5BU8 B;  1SQX J;  1A02 F;  2OTK E;  3HE5 B;  2FFD A;  3RL0 D;  3AEG C;  3Q5R A;  2GUS A;  3A0H H;  1EQ7 A;  2M5A B;  3CXH H;  2N9B A;  2A45 H;  3WUV A;  1W2B O;  3VMA A;  1FC2 C;  1S9K E;  3HD7 D;  2GM4 A;  2K9J B;  1VQ6 P;  2E5T A;  1GL2 D;  1BGY J;  1L0N K;  2NPS D;  5K5G B;  1FZE A;  1GDT A;  2A06 E;  1FZA A;  3GF7 A;  4OWF A;  3CCS P;  1R5S A;  3VTP C;  4EOT A;  2AEM A;  1JMM A;  5AW6 B;  4H44 B;  1VQ7 P;  3CX5 H;  2KNC B;  2G8Y A;  3A3Y B;  3PRJ A;  3G4S P;  1T3J A;  1NGM B;  3CC4 P;  3O6Q A;  4WY4 A;  2WZ7 A;  5AVZ B;  1PGJ A;  2I1K A;  1X8Y A;  3TF5 A;  1SQP D;  3V4Q A;  1SQX K;  1NTK E;  4N6J A;  1QLE D;  1KTM A;  1KZU B;  3S9O A;  1KIL E;  1S5L E;  2HOD B;  1ZXG A;  3JSV C;  5AW1 B;  3VMY A;  1J1E C;  4GIF A;  1WRG A;  1LT9 C;  1PGO A;  2P10 A;  2QEX P;  1S72 P;  1NTZ G;  2MKV A;  1RE3 A;  2BCC E;  4ZKP A;  4HB1 A;  1NYH A;  1S4X A;  1N7L A;  1YIT P;  1YJ9 P;  3G9R A;  5GTH H;  2KYV A;  1T2K C;  4PV1 B;  1N73 C;  1X0T A;  2LXC B;  3Q1M A;  1WMK A;  1MKM A;  5TJH A;  4PD4 D;  1BCC E;  1E79 H;  3WUU A; 
#chains in the Genus database with same CATH homology
 2KOG A;  4WB4 A;  2MJZ A;  5AVT B;  3TNU A;  3TYY A;  5CHX A;  1M1J B;  1KFM A;  2YKP A;  3M0D A;  1JTH B;  5AVR B;  1J1D C;  3GHG C;  4LGD E;  5APW A;  2QM7 A;  2M8R A;  1KIL D;  1M7L A;  1N7S A;  1NOH A;  4XE5 B;  5CCH D;  1GW4 A;  1CZQ A;  1LWU C;  4HYT B;  3M91 A;  4W7Z A;  1HBW A;  3NTN A;  1T3U A;  1RE4 C;  3EFG A;  2VRS A;  3IFM A;  3RL0 B;  1NKZ B;  1AFO A;  2XNX A;  5AW8 B;  1LTI C;  3HRN A;  2HG5 D;  1GZL A;  3KPE A;  3VP9 A;  1MFZ A;  1FAV A;  2Q5U A;  5KJ7 A;  3T97 A;  1GK4 A;  2FYZ A;  1IFD A;  5APV A;  2HYN A;  4JYB A;  5KLV K;  1J2J B;  5CJ0 A;  2XDJ A;  1MUU A;  1QL1 A;  3A5T A;  2WSE H;  3MUD A;  1RF1 A;  2KLV A;  1RF1 B;  1CI6 A;  3HTK A;  1RE3 C;  2FFD C;  1G2C A;  5CCG D;  4LC1 A;  3M9Q A;  3RK2 B;  4B86 A;  3HE5 A;  1KFN A;  3VN0 A;  2R3C A;  1XTG B;  1N73 C;  3SWY A;  2YKO A;  1HUC A;  1OXZ A;  4WY4 B;  2YMY A;  1N73 A;  5AVV B;  5BU5 A;  4OH8 B;  3L36 A;  2JEE A;  1NKN A;  3V2R A;  1KQL A;  3VOP A;  2XKM A;  3RK3 C;  3NFQ A;  1KIL C;  3LW5 H;  1JUN A;  4C46 A;  1HTL C;  3H6P A;  1Z56 A;  1GD2 E;  1HVV A;  1HWT C;  5CJ4 A;  2FKW B;  3OA7 A;  1G1J A;  2A45 G;  2H43 A;  2CPS A;  1M1J A;  4I2L C;  4WY4 D;  1LTJ B;  5AVS B;  4KHX A;  3L37 A;  3CL3 D;  1VDF A;  4N3Y B;  1IFM A;  1SQQ K;  1JY3 P;  5APY A;  3M06 A;  4IFF A;  2R32 A;  3VMX A;  1T8Z A;  5KJ7 D;  1KIL A;  3I5C A;  5CCG C;  3PP5 A;  1RY3 A;  2C9L Y;  3G3Z A;  3NXS A;  2N1T A;  1FOS F;  1NAF A;  5AW7 B;  1FZC A;  1NO4 A;  2KB7 P;  1GL2 C;  5CMZ A;  2WPR A;  1JY2 O;  1SVF A;  3MIW A;  1JNM A;  3LID A;  1GL2 A;  3LIE A;  4AUW A;  2C0W A;  4Y99 C;  2O01 H;  5APS A;  1FZG A;  1HGZ A;  3SWF A;  1GU4 A;  1N86 A;  3B5N D;  3MTU E;  2QM8 A;  1JY2 N;  3KYQ A;  1MV8 A;  4O9B A;  4AYC A;  3WMM 0;  1YTZ I;  2A45 I;  2W6A A;  1FZF A;  5CCG A;  1T2K D;  3HUS A;  1NHL A;  1L4A A;  4W80 A;  3TK1 A;  1LTB C;  4I1L A;  3H32 B;  1MZ9 A;  2H8P D;  3V2N A;  1SFC D;  2I1J A;  1J1D B;  3GHG B;  1E5W A;  2WT7 B;  3O8Z A;  3OJA B;  2Q7C A;  4M3L A;  1HJB A;  3N4X A;  1G1I A;  2R5D A;  3M0D C;  1FDM A;  3VP8 A;  2L5G B;  5APU A;  1LTT C;  2XV5 A;  1FBM A;  1FZC B;  2C9N Y;  2OYH C;  3M9B A;  3B5N C;  2YO3 A;  1LTJ A;  1NTZ K;  1ZR2 A;  4IFM A;  1JY3 O;  2IFN A;  4GT1 A;  1LTJ C;  3N7N A;  3V5B A;  2YNY A;  1SFC B;  1SQV K;  4LLH A;  1L4A C;  3CI9 A;  3L35 A;  3TNU B;  1ZV8 A;  5APQ A;  1HGV A;  3HE4 A;  2P1J A;  1FJP A;  3UIA A;  4GKG A;  1URQ D;  1H89 A;  2KP8 A;  1FU1 A;  4C7N B;  3IR9 A;  1KIL B;  1RF1 C;  1JCC A;  1QL2 A;  2YO2 A;  5AW4 B;  3BRT B;  3VYI A;  4AQR D;  4C7R A;  3E1I A;  1SP4 A;  3P8C E;  3BRV B;  1OWA A;  3P7K A;  1LWU A;  5AVU B;  1PFI A;  2P7J A;  3HD7 B;  1FZB A;  1G2C B;  3MD0 A;  2IX7 C;  2N1T B;  1HH0 A;  3V2P A;  3M0A A;  2W6B A;  2R5B A;  3HUS B;  2OYH B;  1ZN5 A;  2WPS A;  2IPP A;  4ZKU A;  2WSF H;  2C0X A;  2O1K A;  5KTB A;  2OYH A;  1URQ C;  1SQB K;  3B5N A;  4JF7 A;  2Z4E A;  3HUS C;  3GHG A;  2WT7 A;  3BAS A;  1SQP K;  3A7O A;  3HTK B;  1RF0 A;  1N7S C;  3C9I A;  2NPS B;  4WY4 C;  2FYU K;  5AW5 B;  1DH3 A;  2PP6 A;  2H7H A;  2N1T C;  2OAR A;  1URQ B;  1S9K D;  2N1T D;  2HPC A;  1JY2 P;  4W7Y A;  1IK9 A;  2XZR A;  2PAJ A;  5AVQ B;  4Y99 B;  2O1J A;  3NMD A;  3U59 A;  2WTY A;  5CCH C;  1IFI A;  1YYC A;  3VMZ A;  2ZFC A;  2YKQ A;  3M9H A;  2FXM A;  4RES B;  4IFD K;  3U1C A;  2XU6 A;  1LGH B;  3RK3 D;  1CSB A;  1VPC A;  2E43 A;  2M3B A;  1IFN A;  1JOC A;  1FOS E;  1SFC A;  1IC2 A;  3R2P A;  4C7N A;  1GU5 A;  2IFM A;  2OYI B;  3EQ2 A;  3HD7 C;  2POH A;  1NH4 A;  1DEB A;  2CPB A;  2KSJ A;  3HE4 B;  1FJK A;  3HD7 A;  1L4A D;  4DZO A;  3KQG A;  4WBA A;  4JYC A;  2WIT A;  1JTH A;  4DOJ A;  1L0L K;  3RK3 B;  3A2A A;  1NU1 K;  4HH2 A;  5AW3 B;  1J1E B;  1IFJ A;  2Q9I A;  1IO4 A;  3KDP B;  1NTM K;  3L4F A;  3TSI A;  1YTZ T;  2Z5I A;  1JCD A;  3B5N B;  1N73 B;  2Z5H A;  4N78 D;  1LTS C;  1RE4 A;  5BVZ A;  2W27 A;  1L4A B;  2WSC H;  1SFC C;  3B8E B;  2GUV A;  4I6M C;  5APX A;  1N2D C;  5APT A;  2ZXE B;  2WPQ A;  1GK6 A;  2HOD A;  1CI6 B;  5KJ7 C;  5AW2 B;  5CCH A;  2HPC B;  2FFD B;  1DX7 A;  3U1A A;  2OYI C;  1RF0 C;  1URQ A;  5AVY B;  2NPS C;  1IJD B;  2NPS A;  2Q3I A;  1LTA C;  1H8A A;  4N78 E;  2LKM A;  2P2U A;  3RL0 C;  2WWW A;  1XTC C;  3OAK A;  1N7S D;  1FZC C;  1JO5 A;  3P8C D;  3RK2 C;  1LTG C;  2HFE D;  4XA4 A;  2J58 A;  3RK2 D;  1NWQ A;  1JY3 N;  1N7S B;  5AVW B;  2P67 A;  3II6 A;  4EIJ A;  3BAT A;  1ZR4 A;  1X9V A;  3V4W A;  2E42 A;  1WT6 A;  3H32 A;  5AW9 B;  2BAS A;  1SLQ A;  1W2E A;  1A02 J;  1NTK K;  2OYI A;  2HLO A;  1ZLL A;  1LWU B;  3CLQ A;  1CW5 A;  1GW3 A;  2J59 M;  3V2Q A;  3P8M C;  3MGN A;  5AW0 B;  1LT9 A;  1GL2 B;  2JJL A;  1X79 B;  5AVX B;  3P32 A;  1M1J C;  1LT9 B;  5BU8 B;  1A02 F;  3HE5 B;  2FFD A;  3RL0 D;  2GUS A;  1EQ7 A;  2N9B A;  2A45 H;  1S9K E;  3HD7 D;  2GM4 A;  1GL2 D;  1L0N K;  2NPS D;  1FZE A;  1GDT A;  1FZA A;  3VTP C;  4EOT A;  1JMM A;  5AW6 B;  3A3Y B;  1T3J A;  4WY4 A;  2WZ7 A;  5AVZ B;  2I1K A;  1X8Y A;  3V4Q A;  1SQX K;  4N6J A;  1KZU B;  5AW1 B;  2HOD B;  3VMY A;  1J1E C;  4GIF A;  1WRG A;  1LT9 C;  1RE3 A;  4ZKP A;  1AQ5 A;  1T2K C;  1N7L A;  2KYV A;  1GTW A;  3BVH A;  1H88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...