2B88A

Structural basis for molecular recognition in an affibody:affibody complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
58
structure length
58
Chain Sequence
VDNKFNKELGWATWEIFNLPNLNGVQVKAFIDSLRDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords ZTaq affibody
publication title Structural basis for molecular recognition in an affibody:affibody complex.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 18
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2005-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2b88A00
1NVOA 2M5AB 1Y47A 4IOIH 5DJTB 2LR2A 4NPFX 4ZMDA 5DJUB 4GOFA 5K5GB 5CBOA 1EDLA 2KUBA 1U7MA 2QRXA 2M0BA 1MFTA 1SS1A 2KZIA 2K3RA 2QVAA 2SPZA 5C39A 1H0TA 4GOEA 1LP1A 5CBNA 2B89A 4KJMA 4MN4C 1JMBA 3FXDA 1BDCA 2KIKA 1U7JA 1LT1A 2WMMA 2KI7B 1ZW0A 2ZAEB 2P58A 3QWOC 3MHVA 1EDIA 3ZDMA 1H0TB 2I8DA 2LXBA 2HR3A 4K35A 1DEEG 2UWJE 1OVRA 4ASWA 3PH0A 1JM0A 1EC5A 4ASVA 4CPGA 4NPEA 2OTKE 2RKLA 4K3AA 3RGUA 2Q1KA 1S3JA 3S1KA 1Q2NA 4ZNCA 4HJGH 1EDJA 1FC2C 1LP1B 4GODA 2JWDA 4WWIA 1EDKA 4BXLA 2B88A 2B87A 4JBZA 2M5AA 2R44A 5EFWB 2KZJA 4HB1A 3FXEA 2LXCB 1BDDA 2KS1B 1ZXGA 1OVUA 4NPDA 3MZWB 4HKZH 4EYYQ 1X0TA 2B87B 1OVVA
chains in the Genus database with same CATH superfamily
5CCHA 1ZRTE 2BEZF 2K37A 1Y9BA 4EOTA 3GMAA 1RE3A 3EQ2A 5GTHH 4H44C 5E79E 1GK6A 1OMIA 3M9BA 1NAFA 1M1JC 1GW4A 1VQ7P 1OW8A 4PV1C 3H1KD 1K04A 3L35A 2M3BA 1IJDB 2KXPB 1P84D 3MHVA 2ZT9C 4PD4H 5AVRB 4ZKUA 3PRJA 3TGUE 1HBWA 3B4SA 4L74A 2YXRB 1BCCE 1Q90D 2I8DA 5TISE 1GU4A 1DEEG 3L37A 2A06G 1SQXE 1LT9B 1VQ6P 3USSA 3RGUA 1RF1B 1L4AB 4H13D 3V6IA 3CC2P 1BGYE 1AFOA 3IF4A 2OYHC 1KORA 3ABVC 1KN7A 1N73C 2QEXP 1LTIC 1SFCD 1VDFA 2KZJA 5CMZA 1WT6A 2OYHA 1LTTC 1LTGC 4AYCA 2KB7P 2KS1B 1N73A 1AJYA 2P2UA 2FYUE 3F89A 1N8RQ 2XKMA 4XE5B 1NTKJ 1NVOA 1IK9A 2W27A 3D6ZA 4RO0A 2YO2A 2KNCA 2JWAA 1KFMA 2YMYA 1PPJD 4L75A 2RH0A 1BGYG 1GMJA 1YJ9P 2GUSA 3RK2C 2I1JA 2BASA 1BDCA 3K5BA 3V2RA 2PAJA 1L0LE 4Z1MH 3M0AA 1S4XA 3PHLA 1KILB 3AECC 4DCKA 3LIEA 3V4QA 5AW7B 2JEEA 2OYIB 5AVUB 3H1HD 3HD7C 2OGUA 4R4MA 3CX5I 3HUSC 1EC5A 2IZ1A 1AQ5A 3CWBE 1Q86Q 1VQKP 5AVSB 2O01H 2BCCD 2FY8A 1JY3P 1EDKA 2IBZI 3GF7A 3CX5E 3B71A 3H1JE 4OVNF 4UB6E 3G3ZA 4GDOA 1H8AA 3L4FA 1FAVA 1X0TA 1NO4A 3S4RA 4WY4C 2M5AB 2IBZE 3L73G 2E74C 3GG2A 3SSUA 1OZHA 3BATA 5DJUB 2FYNB 4WY4A 3C9IA 1U7MA 2FYZA 2KZIA 3NTNA 2SPZA 1KILD 5CBNA 2B89A 1NYHA 2E5YA 3IFMA 3TGUJ 1LWUC 1BCCJ 2KIKA 2QA4P 1FOSF 3H32A 1ZR4A 2ZAEB 1M1JB 3NMDA 4JYBA 1RE3C 1SQBG 1S1CX 3HE5A 2O01N 5AW1B 2N1TA 1ZMEC 1JOCA 5AW9B 2WPQA 1SQVG 1BGYJ 2P1JA 4NPEA 1ZN5A 2QJYC 3KZIH 1LP1B 2HG5D 1USDA 3FWLA 4L73A 2B88A 3RL0g 2FYUJ 5EFWB 1FJPA 3N7NA 1VQNP 2A06D 3BCCD 2D2CD 5KAIE 4L76A 3IAOA 1SQPD 5KAFH 1CI6A 4EYYQ 4BWNA 1T3JA 3P8MC 4EI2A 2B87B 3TSIA 1NTKK 3CCVP 1IZNB 2HPCA 2FFDA 2AXCA 1S2EA 4PD4I 3R2PA 4IOIH 4A7PA 1JEKA 2P7JA 1K05A 3WU2H 4GOFA 4H13C 1PGPA 3MUDC 2M0BA 1RE4C 5KKZB 4D6TD 2IFNA 3H1KG 1RQUA 2A45H 1G1JA 4MN4C 2NPSD 3FXDA 2WMMA 4PD4E 1SFCC 1RE4A 2P58A 4JF7A 1LTJC 1TU3F 2XV5A 5KTBA 1YBKA 3CWBJ 1H0TB 1SFCA 4TT3H 2UWJE 1LTJA 2WPSA 3B5NB 2Q3EA 5KLVD 5APXA 1QL1A 1URQD 1KQLA 4C7RA 2YIUC 3HUSB 1SQQE 3H1JJ 1N86A 1QVGO 3V5BA 3BVHA 4XA4A 4WBAA 1E5WA 1NU1D 3H25A 2ZVNB 3RL0B 1LTBC 3PLNA 1M57D 5L8RJ 5TJHA 3SWYA 2HLOA 4DZOA 1J1DB 3CCMP 2WSFH 2KSEA 1KC8Q 3MIWA 1Q81Q 1PPJG 1GL2C 4IFFA 3TYYA 2QRXA 1SS1A 3JSVC 4LGDE 2LKMA 3A2AA 2WQYC 3SFEC 3TK1A 4I2LC 1FZCC 5CJ0A 1KYOH 2W6JH 2G3AA 1ZW0A 5APTA 3TDKA 1LWUB 3L73D 3T97A 1EXIA 3H1HG 1FZCA 2E5TA 2JP3A 3P8CE 3C8VA 1MKMA 1M1KQ 2QJPB 5AW0B 3L72G 1MV8A 3A5TA 2R32A 5BU5A 3H1KJ 1G2CA 2BCCG 2QJKC 4HH2A 5H2FH 3CCEP 1EDJA 2Q3IA 2WPRA 4WWIA 3MTUE 1RHZB 1H89A 3FX0A 1VQOP 1N7LA 1KYOD 1SQBD 1FU1A 2FYUK 2MJZA 3I56P 2W83C 3H1LG 1KILA 3CPWO 1OIPA 3FXEA 4N6JA 1FS0E 1S5LX 2HFED 2YKOA 5CCGD 2O1KA 1GD2E 2XDJA 1IK7A 3M0DC 1DX7A 5KLIB 3HTKA 3AEDC 2CPBA 1YHQP 1NKNA 3L75G 4UB8H 1IFJA 4Y28J 1P84H 1CZQA 4YTPC 4I6MC 1KQSO 1MFTA 3CCUP 2YNYA 2Y9YA 3AEGC 2H43A 1K9MQ 4KJMA 1X9VA 2VRSA 3RK3D 3WMM0 2A06E 3U1CA 4HYTB 1T8ZA 2WT7B 1QX8A 1KQFB 1ZOYC 1HF9A 2E75C 5CJ4A 2P67A 3OAKA 1SQQJ 1YQ4C 1W2BO 1VF5B 3KZIE 3LIDA 1XTGB 3SWKA 4I7ZC 3CXHD 1RQVA 1NAYA 1CSBA 3GHGB 2NPSC 1BE3D 1N7SB 3BCCG 3H1HJ 2KP8A 1OWAA 1SQPG 1T3UA 4BRYA 1L0ND 2LXCB 2A45I 1PFIA 1NTMG 1BDDA 2NPSA 2E42A 1YYCA 3V2NA 3E1IA 4H0LB 1PGOA 3RBZA 2Y0EA 5KLVE 1IO4A 2JR8A 2BCCJ 2XNXA 2OYOA 3WU2E 2Q7CA 1URQC 1PZQA 4D6TG 1ZP0C 2E76D 5K5GB 3A0HH 4N78D 2IDBA 1YI2P 1XTCC 2O1JA 4IFDK 3G9RA 1LP1A 3CC4P 1URQA 1JB0J 3WUVA 1VQ9P 3Q2YA 4GT1A 4IL6E 1PV3A 1OW6A 1LT1A 1JY2O 3A3YB 1YTZI 1FDMA 1GU5A 3II6A 3TNUB 1DEBA 5BVZA 2K9JA 2O01J 5KLVG 2HR3A 2KLUA 3CCLP 2M3EA 1KTMA 2POHA 1OFCX 4PJ0H 2Z5IA 4R4LA 4U7JA 2A45G 1N7SD 3QH9A 1Q2NA 1JY3N 1BSHA 1Q82Q 3AEAC 3GW6A 1NU1G 2YKQA 3G71P 1L4AD 4H0LD 3L73E 4YPCA 2ZJSE 1YIJP 1Y8AA 3A7OA 3L72D 1R8EA 3U59A 4OGQC 1S9KD 3SWFA 1OVUA 2QSIA 3MZWB 2OTLP 1KYOI 2Q9IA 2ZVOB 2OQQA 1PP9G 2AXTH 3BASA 4YXDC 1RF0A 2C0XA 3BCCJ 3H1LD 1JTHB 3PTZA 3M91A 2HODB 1KYOE 2Y0DA 3NXSA 3PP5A 1SQBE 1GDTA 2WSSH 2OARA 1EZVD 1SQVE 3AEEC 2PRRA 1UIXA 2I1KA 3ZDMA 1LNQA 3L75D 2E76B 3Q1MA 5AVVB 4C46A 4D6TJ 2ITAA 4H44B 1SQQK 4C7NA 1AVYA 5H2FE 2N1TC 5AW6B 1JCCA 3CCJP 3NFQA 1HUCA 4PV1B 3SFDC 3C1LA 3RK3E 2XZRA 2ZT9B 1IFDA 3RK3C 3CCSP 3TF5A 1MFZA 1S72P 1P84I 3L36A 1J1EC 3M9QA 2O3JA 5KLVJ 5M1BA 3L74G 2J58A 2GA1A 2Q5UA 1H88A 2R3SA 3H1KE 2C9LY 2PGDA 5AVZB 1K73Q 2KOGA 4UB8E 1P84E 2J5UA 2OYHB 2YKPA 1NU1J 3P7KA 1N73B 2FFDC 5APUA 2ZXEB 4U3FG 3EWKA 3AE5C 5AVWB 3N4XA 2Y0CA 5APQA 1YJNP 2V4HA 1NTMD 1JMBA 3GLMA 3V2PA 1VQ4P 3WUTA 3VTPC 2KNCB 1HTLC 1AVOA 5GTHE 3AE6C 1EDIA 1ZRTD 3L70G 2WVRA 4H44D 1HJ0A 3Q5RA 3LW5J 2AEFA 4JYCA 1NTZD 3PH0A 2C0WA 2MKVA 3RK2B 4N78E 3S1KA 4XFJA 1BE3G 3L73J 3JCUH 2AEMA 5AVXB 3D6YA 3WUUA 1L0NG 2WSFJ 1PPJE 1SQXD 3I5CA 4OH8B 2OTJP 3HD7B 4AQRD 3UIAA 2FXMA 1ZLLA 1VPCA 4NPDA 3LW5H 1NHLA 3E1RA 1NKZB 1OW7A 2R5BA 4OGQB 3FWNA 1KD1Q 1Y47A 5AW5B 1RY3A 4RJTA 3A0HE 1GTWA 5GTIH 1SQBJ 2L5GB 3Q5PA 3I55P 1WMKA 1VQLP 2ZYDA 3MP7B 3H1IG 1LT9C 3H1HE 1KZUB 2H88C 1SQVJ 2NZ2A 4GOEA 2K88A 3W67A 1RF1C 1KV4A 1N7SA 3L72E 1U7JA 2KI7B 1MUUA 1LT9A 1S9KE 4WY4B 1R5LA 2HYNA 1FZAA 1RF1A 1PP9D 1L4AA 2BCCE 3AE1C 2E74B 1FDOA 1Q7YQ 4PJ0E 3H32B 1W5CE 1NGMB 2CK3H 1L0LD 3H1LE 1DIPA 3B5ND 2V7QH 2KS1A 4ZNCA 3HE5B 2WSCH 3HD7D 4GIFA 3AE9C 3AEFC 3A0BH 3BRVB 3VMXA 1JY2P 3D70A 5KLVK 4W80A 2K9YA 3L75E 1KILE 1ZXGA 1N2DC 1UIIA 3RL0D 1A02J 3PJSK 1QLED 1KILC 2AXTE 1OVVA 2QJYB 3KQGA 3GF3A 1R5SA 3EFGA 1BE3J 2FBWC 4NPFX 3KXDA 2H7HA 1NU1K 3RBXA 1CI6B 1L0NJ 1EQ7A 3EFFK 4AUWA 1X8YA 1FDIA 2HPCB 1EZVG 2FFDB 2OYIA 3L74D 2K1AA 1VQMP 1IFNA 1NTKG 1VL2A 1HGZA 1AQTA 1HJBA 5AW8B 2DW3A 1RH5B 3CXHH 2IPPA 4JPZB 4W7YA 4H13B 4U3FD 1HH0A 2R5DA 1LTSC 1PL5A 3BCCE 4K3AA 1USEA 3H6PA 1SQPE 3L71D 2D2CC 4DT0A 3G6EP 5APVA 1NTME 1SFCB 2JJLA 2JWDA 1LTJB 1HVVA 3L70D 3R4YA 3V2QA 2M5AA 2WZ7A 4O9BA 1S5LH 3OJAB 3FGAD 4I1LA 2WPVB 2GM4A 4WB4A 1SVFA 5B66H 1ZV8A 5AW2B 4D6TE 1FZEA 4Y99C 1IC2A 1NTZE 1T6AA 1KQGB 3OW2O 2C9NY 3AE4C 4KT0J 1SP4A 2YIUB 3HE4B 1GW3A 1JMMA 2JO1A 4LC1A 1D7MA 1KMIZ 5KAFE 1SQBK 1M1JA 1PGQA 2KUBA 1GK4A 3L72J 2ZYGA 1M90Q 2Q6QA 5CHXA 1YITP 3CMEP 1ZR2A 1SQVK 2H89C 1SLQA 4DJGA 2Y9ZA 5AVYB 1VQPP 1L2PA 4W7ZA 1J2JB 1FJKA 4B86A 1NTZG 1EXJA 3CLQA 3MGNA 2XU6A 3H1LJ 4DOJA 1GL2B 1NU1E 1NJIQ 3H1ID 2OTKE 2PFXA 2YXQB 4N3YB 2QE7H 3TGUG 3AE7C 4PD4D 3JCUE 3T97B 1BCCG 1FZCB 2YMKA 4HJGH 1VF5D 1NOHA 3S9OA 1SQXG 1AV1A 2B87A 3L75J 3ITKA 2R44A 5KKZC 1PP9E 2JDIH 1QVFO 1G2CB 2QM7A 3O6QB 5AW3B 1KB9H 1PGJA 2WITA 3CMAP 3Q5SA 3MD0A 1BSNA 1SQQD 3AE2C 1JCDA 5GTIE 2IZ0A 2QJKB 2H8PD 3V4WA 1T2KD 1FZBA 2FYUG 3B5NC 1L0NK 1W2EA 2E43A 3VP8A 1H0TA 4M3LA 1DD3A 1RF0C 3HTKB 4RKUJ 3B5NA 3JC22 3BRTB 1JO5A 1LTAC 1GL2D 3HD7A 3OA7A 1KB9D 3IR9A 3KPEA 3HUSA 2IFMA 2KK7A 1HGVA 3RL0C 5B5EH 4K35A 1SQPJ 1OVRA 1Z56A 1L0LG 1NTMJ 3AE3C 3CCRP 3CCQP 4JQ0D 3AE8C 1J1DC 2R3CA 5AVTB 5CCGC 2JKVA 1NTKD 2IX7C 4KHXA 4TLFA 3L74E 1LJ2A 3A0BE 2D2CB 3P8CD 4BXLA 1G1IA 2E75B 2YO3A 3CWBG 1HWTC 1YQ3C 1NTZJ 5CCGA 1CW5A 4IFMA 3B8EB 3U1AA 1FOSE 2WTYA 2W6BA 2RN0A 2BEQD 4U3FE 3HRNA 4I7ZB 4Y99B 3H1JG 1U57A 3VYIA 1DH3A 3L71E 5KJ7D 4BRYB 1NH4A 2L91A 3VMZA 4ZMDA 2Z4EA 2QJPC 3CXHI 1WRGA 2NPSB 1SQXJ 1LWUA 5APSA 3L70E 2QVAA 2K3RA 3VN0A 5C39A 2QM8A 1JUNA 3G4SP 3D71A 1LGHB 2IBZG 5E79H 2PP6A 2ZXXA 3QWOC 2FXOA 4IL6X 3CXHE 1OXZA 5CCHD 1BE3E 1URQB 2ZYAA 1A02F 2B9BA 1YJWP 2FKWB 3P32A 5TISH 3L71G 1L0NE 4CPGA 2RKLA 3W68A 5KLIC 2Q1KA 1E79H 2E75D 3F5HA 1GZLA 2M8RA 2K9JB 1KFNA 1PP9J 2IYOA 1YTZT 2WSEJ 4JBZA 1S5LE 4PV1D 5B66E 5APWA 2RMZA 1IFPA 1QGKB 2ZFCA 2W8ZA 1IFMA 2ZT9D 2E76C 2WWWA 1L0LJ 1QEXA 3TGUD 3H1IE 1BCCD 3VOPA 2J59M 3MUDA 1FBMA 1QL2A 4IL6H 5DJTB 2WT7A 3CL3D 5CBOA 1EDLA 2W90A 1VF5C 2WSEH 3CD6P 1JY3O 1BGYD 3VMAA 3AEBC 1AA0A 1X22A 3E7KA 3IN6A 3GHGC 1N7SC 2V7QJ 2LXBA 1SQPK 2FYUD 2WSCJ 1FZGA 1NWQA 3M9HA 1L4AC 3HE4A 3GHGA 1NTMK 1KB9I 4ASVA 3CI9A 4H0LC 2IYPA 3L74J 3M06A 3KDPB 1T2KC 2G8YA 1M56D 4QMAA 1FC2C 4GODA 5APYA 3RK2D 1JY2N 1EZVI 2QG4A 5AVQB 3VP9A 4C7NB 4U3FJ 1KB9E 1NTZK 4HB1A 1MZ9A 3CX5H 4UB6H 1SQQG 4EDFA 3L71J 2N9YB 2W6AA 1FE6A 2AEJA 1FZFA 2N1TB 5BU8B 1IFIA 1GL2A 1EZVE 2CPSA 1VQ5P 3L70J 4ZKPA 2LR2A 1K8AQ 2XNDH 1NTKE 3RK3B 3CWBD 4OGQD 4OWFA 1SQXK 3VMYA 4WVZA 3TNUA 1DD4A 3CC7P 1J1EB 2Z5HA 3KYQA 2KLVA 2NRGA 1OX3A 1M7LA 4EIJA 3KHUA 3CX5D 3H1JD 2OYIC 4RESB 3O6QA 5B5EE 4WY4D 1JNMA 2P10A 3Q3DA 4ASWA 4GKGA 1JM0A 2QIWA 2E74D 5KJ7C 1X79B 2IBZD 1S3JA 1SQVD 3O8ZA 2KYVA 1M8OB 5KJ7A 1VQ8P 2FXPA 1PIXA 4YXWH 4LLHA 3H1IJ 3M0DA 2N1TD 2GUVA 2N9BA 1L0LK 5CCHC 5KAIH 4HKZH 1JTHA 2HODA 2KSJA 5AW4B 2FYNC
chains in the Genus database with same CATH topology
1NVOA 2M5AB 1Y47A 4IOIH 5DJTB 2LR2A 4NPFX 4ZMDA 5DJUB 4GOFA 5K5GB 5CBOA 1EDLA 2KUBA 1U7MA 2QRXA 2M0BA 1MFTA 1SS1A 2KZIA 2K3RA 2QVAA 2SPZA 5C39A 1H0TA 4GOEA 1LP1A 5CBNA 2B89A 4KJMA 4MN4C 1JMBA 3FXDA 1BDCA 2KIKA 1U7JA 1LT1A 2WMMA 2KI7B 1ZW0A 2ZAEB 2P58A 3QWOC 3MHVA 1EDIA 3ZDMA 1H0TB 2I8DA 2LXBA 2HR3A 4K35A 1DEEG 2UWJE 1OVRA 4ASWA 3PH0A 1JM0A 1EC5A 4ASVA 4CPGA 4NPEA 2OTKE 2RKLA 4K3AA 3RGUA 2Q1KA 1S3JA 3S1KA 1Q2NA 4ZNCA 4HJGH 1EDJA 1FC2C 1LP1B 4GODA 2JWDA 4WWIA 1EDKA 4BXLA 2B88A 2B87A 4JBZA 2M5AA 2R44A 5EFWB 2KZJA 4HB1A 3FXEA 2LXCB 1BDDA 2KS1B 1ZXGA 1OVUA 4NPDA 3MZWB 4HKZH 4EYYQ 1X0TA 2B87B 1OVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NVO A;  2M5A B;  1Y47 A;  4IOI H;  5DJT B;  2LR2 A;  4NPF X;  4ZMD A;  5DJU B;  4GOF A;  5K5G B;  5CBO A;  1EDL A;  2KUB A;  1U7M A;  2QRX A;  2M0B A;  1MFT A;  1SS1 A;  2KZI A;  2K3R A;  2QVA A;  2SPZ A;  5C39 A;  1H0T A;  4GOE A;  1LP1 A;  5CBN A;  2B89 A;  4KJM A;  4MN4 C;  1JMB A;  3FXD A;  1BDC A;  2KIK A;  1U7J A;  1LT1 A;  2WMM A;  2KI7 B;  1ZW0 A;  2ZAE B;  2P58 A;  3QWO C;  3MHV A;  1EDI A;  3ZDM A;  1H0T B;  2I8D A;  2LXB A;  2HR3 A;  4K35 A;  1DEE G;  2UWJ E;  1OVR A;  4ASW A;  3PH0 A;  1JM0 A;  1EC5 A;  4ASV A;  4CPG A;  4NPE A;  2OTK E;  2RKL A;  4K3A A;  3RGU A;  2Q1K A;  1S3J A;  3S1K A;  1Q2N A;  4ZNC A;  4HJG H;  1EDJ A;  1FC2 C;  1LP1 B;  4GOD A;  2JWD A;  4WWI A;  1EDK A;  4BXL A;  2B88 A;  2B87 A;  4JBZ A;  2M5A A;  2R44 A;  5EFW B;  2KZJ A;  4HB1 A;  3FXE A;  2LXC B;  1BDD A;  2KS1 B;  1ZXG A;  1OVU A;  4NPD A;  3MZW B;  4HKZ H;  4EYY Q;  1X0T A;  2B87 B;  1OVV A; 
#chains in the Genus database with same CATH topology
 5CCH A;  1ZRT E;  2BEZ F;  2K37 A;  1Y9B A;  4EOT A;  3GMA A;  1RE3 A;  3EQ2 A;  5GTH H;  4H44 C;  5E79 E;  1GK6 A;  1OMI A;  3M9B A;  1NAF A;  1M1J C;  1GW4 A;  1VQ7 P;  1OW8 A;  4PV1 C;  3H1K D;  1K04 A;  3L35 A;  2M3B A;  1IJD B;  2KXP B;  1P84 D;  3MHV A;  2ZT9 C;  4PD4 H;  5AVR B;  4ZKU A;  3PRJ A;  3TGU E;  1HBW A;  3B4S A;  4L74 A;  2YXR B;  1BCC E;  1Q90 D;  2I8D A;  5TIS E;  1GU4 A;  1DEE G;  3L37 A;  2A06 G;  1SQX E;  1LT9 B;  1VQ6 P;  3USS A;  3RGU A;  1RF1 B;  1L4A B;  4H13 D;  3V6I A;  3CC2 P;  1BGY E;  1AFO A;  3IF4 A;  2OYH C;  1KOR A;  3ABV C;  1KN7 A;  1N73 C;  2QEX P;  1LTI C;  1SFC D;  1VDF A;  2KZJ A;  5CMZ A;  1WT6 A;  2OYH A;  1LTT C;  1LTG C;  4AYC A;  2KB7 P;  2KS1 B;  1N73 A;  1AJY A;  2P2U A;  2FYU E;  3F89 A;  1N8R Q;  2XKM A;  4XE5 B;  1NTK J;  1NVO A;  1IK9 A;  2W27 A;  3D6Z A;  4RO0 A;  2YO2 A;  2KNC A;  2JWA A;  1KFM A;  2YMY A;  1PPJ D;  4L75 A;  2RH0 A;  1BGY G;  1GMJ A;  1YJ9 P;  2GUS A;  3RK2 C;  2I1J A;  2BAS A;  1BDC A;  3K5B A;  3V2R A;  2PAJ A;  1L0L E;  4Z1M H;  3M0A A;  1S4X A;  3PHL A;  1KIL B;  3AEC C;  4DCK A;  3LIE A;  3V4Q A;  5AW7 B;  2JEE A;  2OYI B;  5AVU B;  3H1H D;  3HD7 C;  2OGU A;  4R4M A;  3CX5 I;  3HUS C;  1EC5 A;  2IZ1 A;  1AQ5 A;  3CWB E;  1Q86 Q;  1VQK P;  5AVS B;  2O01 H;  2BCC D;  2FY8 A;  1JY3 P;  1EDK A;  2IBZ I;  3GF7 A;  3CX5 E;  3B71 A;  3H1J E;  4OVN F;  4UB6 E;  3G3Z A;  4GDO A;  1H8A A;  3L4F A;  1FAV A;  1X0T A;  1NO4 A;  3S4R A;  4WY4 C;  2M5A B;  2IBZ E;  3L73 G;  2E74 C;  3GG2 A;  3SSU A;  1OZH A;  3BAT A;  5DJU B;  2FYN B;  4WY4 A;  3C9I A;  1U7M A;  2FYZ A;  2KZI A;  3NTN A;  2SPZ A;  1KIL D;  5CBN A;  2B89 A;  1NYH A;  2E5Y A;  3IFM A;  3TGU J;  1LWU C;  1BCC J;  2KIK A;  2QA4 P;  1FOS F;  3H32 A;  1ZR4 A;  2ZAE B;  1M1J B;  3NMD A;  4JYB A;  1RE3 C;  1SQB G;  1S1C X;  3HE5 A;  2O01 N;  5AW1 B;  2N1T A;  1ZME C;  1JOC A;  5AW9 B;  2WPQ A;  1SQV G;  1BGY J;  2P1J A;  4NPE A;  1ZN5 A;  2QJY C;  3KZI H;  1LP1 B;  2HG5 D;  1USD A;  3FWL A;  4L73 A;  2B88 A;  3RL0 g;  2FYU J;  5EFW B;  1FJP A;  3N7N A;  1VQN P;  2A06 D;  3BCC D;  2D2C D;  5KAI E;  4L76 A;  3IAO A;  1SQP D;  5KAF H;  1CI6 A;  4EYY Q;  4BWN A;  1T3J A;  3P8M C;  4EI2 A;  2B87 B;  3TSI A;  1NTK K;  3CCV P;  1IZN B;  2HPC A;  2FFD A;  2AXC A;  1S2E A;  4PD4 I;  3R2P A;  4IOI H;  4A7P A;  1JEK A;  2P7J A;  1K05 A;  3WU2 H;  4GOF A;  4H13 C;  1PGP A;  3MUD C;  2M0B A;  1RE4 C;  5KKZ B;  4D6T D;  2IFN A;  3H1K G;  1RQU A;  2A45 H;  1G1J A;  4MN4 C;  2NPS D;  3FXD A;  2WMM A;  4PD4 E;  1SFC C;  1RE4 A;  2P58 A;  4JF7 A;  1LTJ C;  1TU3 F;  2XV5 A;  5KTB A;  1YBK A;  3CWB J;  1H0T B;  1SFC A;  4TT3 H;  2UWJ E;  1LTJ A;  2WPS A;  3B5N B;  2Q3E A;  5KLV D;  5APX A;  1QL1 A;  1URQ D;  1KQL A;  4C7R A;  2YIU C;  3HUS B;  1SQQ E;  3H1J J;  1N86 A;  1QVG O;  3V5B A;  3BVH A;  4XA4 A;  4WBA A;  1E5W A;  1NU1 D;  3H25 A;  2ZVN B;  3RL0 B;  1LTB C;  3PLN A;  1M57 D;  5L8R J;  5TJH A;  3SWY A;  2HLO A;  4DZO A;  1J1D B;  3CCM P;  2WSF H;  2KSE A;  1KC8 Q;  3MIW A;  1Q81 Q;  1PPJ G;  1GL2 C;  4IFF A;  3TYY A;  2QRX A;  1SS1 A;  3JSV C;  4LGD E;  2LKM A;  3A2A A;  2WQY C;  3SFE C;  3TK1 A;  4I2L C;  1FZC C;  5CJ0 A;  1KYO H;  2W6J H;  2G3A A;  1ZW0 A;  5APT A;  3TDK A;  1LWU B;  3L73 D;  3T97 A;  1EXI A;  3H1H G;  1FZC A;  2E5T A;  2JP3 A;  3P8C E;  3C8V A;  1MKM A;  1M1K Q;  2QJP B;  5AW0 B;  3L72 G;  1MV8 A;  3A5T A;  2R32 A;  5BU5 A;  3H1K J;  1G2C A;  2BCC G;  2QJK C;  4HH2 A;  5H2F H;  3CCE P;  1EDJ A;  2Q3I A;  2WPR A;  4WWI A;  3MTU E;  1RHZ B;  1H89 A;  3FX0 A;  1VQO P;  1N7L A;  1KYO D;  1SQB D;  1FU1 A;  2FYU K;  2MJZ A;  3I56 P;  2W83 C;  3H1L G;  1KIL A;  3CPW O;  1OIP A;  3FXE A;  4N6J A;  1FS0 E;  1S5L X;  2HFE D;  2YKO A;  5CCG D;  2O1K A;  1GD2 E;  2XDJ A;  1IK7 A;  3M0D C;  1DX7 A;  5KLI B;  3HTK A;  3AED C;  2CPB A;  1YHQ P;  1NKN A;  3L75 G;  4UB8 H;  1IFJ A;  4Y28 J;  1P84 H;  1CZQ A;  4YTP C;  4I6M C;  1KQS O;  1MFT A;  3CCU P;  2YNY A;  2Y9Y A;  3AEG C;  2H43 A;  1K9M Q;  4KJM A;  1X9V A;  2VRS A;  3RK3 D;  3WMM 0;  2A06 E;  3U1C A;  4HYT B;  1T8Z A;  2WT7 B;  1QX8 A;  1KQF B;  1ZOY C;  1HF9 A;  2E75 C;  5CJ4 A;  2P67 A;  3OAK A;  1SQQ J;  1YQ4 C;  1W2B O;  1VF5 B;  3KZI E;  3LID A;  1XTG B;  3SWK A;  4I7Z C;  3CXH D;  1RQV A;  1NAY A;  1CSB A;  3GHG B;  2NPS C;  1BE3 D;  1N7S B;  3BCC G;  3H1H J;  2KP8 A;  1OWA A;  1SQP G;  1T3U A;  4BRY A;  1L0N D;  2LXC B;  2A45 I;  1PFI A;  1NTM G;  1BDD A;  2NPS A;  2E42 A;  1YYC A;  3V2N A;  3E1I A;  4H0L B;  1PGO A;  3RBZ A;  2Y0E A;  5KLV E;  1IO4 A;  2JR8 A;  2BCC J;  2XNX A;  2OYO A;  3WU2 E;  2Q7C A;  1URQ C;  1PZQ A;  4D6T G;  1ZP0 C;  2E76 D;  5K5G B;  3A0H H;  4N78 D;  2IDB A;  1YI2 P;  1XTC C;  2O1J A;  4IFD K;  3G9R A;  1LP1 A;  3CC4 P;  1URQ A;  1JB0 J;  3WUV A;  1VQ9 P;  3Q2Y A;  4GT1 A;  4IL6 E;  1PV3 A;  1OW6 A;  1LT1 A;  1JY2 O;  3A3Y B;  1YTZ I;  1FDM A;  1GU5 A;  3II6 A;  3TNU B;  1DEB A;  5BVZ A;  2K9J A;  2O01 J;  5KLV G;  2HR3 A;  2KLU A;  3CCL P;  2M3E A;  1KTM A;  2POH A;  1OFC X;  4PJ0 H;  2Z5I A;  4R4L A;  4U7J A;  2A45 G;  1N7S D;  3QH9 A;  1Q2N A;  1JY3 N;  1BSH A;  1Q82 Q;  3AEA C;  3GW6 A;  1NU1 G;  2YKQ A;  3G71 P;  1L4A D;  4H0L D;  3L73 E;  4YPC A;  2ZJS E;  1YIJ P;  1Y8A A;  3A7O A;  3L72 D;  1R8E A;  3U59 A;  4OGQ C;  1S9K D;  3SWF A;  1OVU A;  2QSI A;  3MZW B;  2OTL P;  1KYO I;  2Q9I A;  2ZVO B;  2OQQ A;  1PP9 G;  2AXT H;  3BAS A;  4YXD C;  1RF0 A;  2C0X A;  3BCC J;  3H1L D;  1JTH B;  3PTZ A;  3M91 A;  2HOD B;  1KYO E;  2Y0D A;  3NXS A;  3PP5 A;  1SQB E;  1GDT A;  2WSS H;  2OAR A;  1EZV D;  1SQV E;  3AEE C;  2PRR A;  1UIX A;  2I1K A;  3ZDM A;  1LNQ A;  3L75 D;  2E76 B;  3Q1M A;  5AVV B;  4C46 A;  4D6T J;  2ITA A;  4H44 B;  1SQQ K;  4C7N A;  1AVY A;  5H2F E;  2N1T C;  5AW6 B;  1JCC A;  3CCJ P;  3NFQ A;  1HUC A;  4PV1 B;  3SFD C;  3C1L A;  3RK3 E;  2XZR A;  2ZT9 B;  1IFD A;  3RK3 C;  3CCS P;  3TF5 A;  1MFZ A;  1S72 P;  1P84 I;  3L36 A;  1J1E C;  3M9Q A;  2O3J A;  5KLV J;  5M1B A;  3L74 G;  2J58 A;  2GA1 A;  2Q5U A;  1H88 A;  2R3S A;  3H1K E;  2C9L Y;  2PGD A;  5AVZ B;  1K73 Q;  2KOG A;  4UB8 E;  1P84 E;  2J5U A;  2OYH B;  2YKP A;  1NU1 J;  3P7K A;  1N73 B;  2FFD C;  5APU A;  2ZXE B;  4U3F G;  3EWK A;  3AE5 C;  5AVW B;  3N4X A;  2Y0C A;  5APQ A;  1YJN P;  2V4H A;  1NTM D;  1JMB A;  3GLM A;  3V2P A;  1VQ4 P;  3WUT A;  3VTP C;  2KNC B;  1HTL C;  1AVO A;  5GTH E;  3AE6 C;  1EDI A;  1ZRT D;  3L70 G;  2WVR A;  4H44 D;  1HJ0 A;  3Q5R A;  3LW5 J;  2AEF A;  4JYC A;  1NTZ D;  3PH0 A;  2C0W A;  2MKV A;  3RK2 B;  4N78 E;  3S1K A;  4XFJ A;  1BE3 G;  3L73 J;  3JCU H;  2AEM A;  5AVX B;  3D6Y A;  3WUU A;  1L0N G;  2WSF J;  1PPJ E;  1SQX D;  3I5C A;  4OH8 B;  2OTJ P;  3HD7 B;  4AQR D;  3UIA A;  2FXM A;  1ZLL A;  1VPC A;  4NPD A;  3LW5 H;  1NHL A;  3E1R A;  1NKZ B;  1OW7 A;  2R5B A;  4OGQ B;  3FWN A;  1KD1 Q;  1Y47 A;  5AW5 B;  1RY3 A;  4RJT A;  3A0H E;  1GTW A;  5GTI H;  1SQB J;  2L5G B;  3Q5P A;  3I55 P;  1WMK A;  1VQL P;  2ZYD A;  3MP7 B;  3H1I G;  1LT9 C;  3H1H E;  1KZU B;  2H88 C;  1SQV J;  2NZ2 A;  4GOE A;  2K88 A;  3W67 A;  1RF1 C;  1KV4 A;  1N7S A;  3L72 E;  1U7J A;  2KI7 B;  1MUU A;  1LT9 A;  1S9K E;  4WY4 B;  1R5L A;  2HYN A;  1FZA A;  1RF1 A;  1PP9 D;  1L4A A;  2BCC E;  3AE1 C;  2E74 B;  1FDO A;  1Q7Y Q;  4PJ0 E;  3H32 B;  1W5C E;  1NGM B;  2CK3 H;  1L0L D;  3H1L E;  1DIP A;  3B5N D;  2V7Q H;  2KS1 A;  4ZNC A;  3HE5 B;  2WSC H;  3HD7 D;  4GIF A;  3AE9 C;  3AEF C;  3A0B H;  3BRV B;  3VMX A;  1JY2 P;  3D70 A;  5KLV K;  4W80 A;  2K9Y A;  3L75 E;  1KIL E;  1ZXG A;  1N2D C;  1UII A;  3RL0 D;  1A02 J;  3PJS K;  1QLE D;  1KIL C;  2AXT E;  1OVV A;  2QJY B;  3KQG A;  3GF3 A;  1R5S A;  3EFG A;  1BE3 J;  2FBW C;  4NPF X;  3KXD A;  2H7H A;  1NU1 K;  3RBX A;  1CI6 B;  1L0N J;  1EQ7 A;  3EFF K;  4AUW A;  1X8Y A;  1FDI A;  2HPC B;  1EZV G;  2FFD B;  2OYI A;  3L74 D;  2K1A A;  1VQM P;  1IFN A;  1NTK G;  1VL2 A;  1HGZ A;  1AQT A;  1HJB A;  5AW8 B;  2DW3 A;  1RH5 B;  3CXH H;  2IPP A;  4JPZ B;  4W7Y A;  4H13 B;  4U3F D;  1HH0 A;  2R5D A;  1LTS C;  1PL5 A;  3BCC E;  4K3A A;  1USE A;  3H6P A;  1SQP E;  3L71 D;  2D2C C;  4DT0 A;  3G6E P;  5APV A;  1NTM E;  1SFC B;  2JJL A;  2JWD A;  1LTJ B;  1HVV A;  3L70 D;  3R4Y A;  3V2Q A;  2M5A A;  2WZ7 A;  4O9B A;  1S5L H;  3OJA B;  3FGA D;  4I1L A;  2WPV B;  2GM4 A;  4WB4 A;  1SVF A;  5B66 H;  1ZV8 A;  5AW2 B;  4D6T E;  1FZE A;  4Y99 C;  1IC2 A;  1NTZ E;  1T6A A;  1KQG B;  3OW2 O;  2C9N Y;  3AE4 C;  4KT0 J;  1SP4 A;  2YIU B;  3HE4 B;  1GW3 A;  1JMM A;  2JO1 A;  4LC1 A;  1D7M A;  1KMI Z;  5KAF E;  1SQB K;  1M1J A;  1PGQ A;  2KUB A;  1GK4 A;  3L72 J;  2ZYG A;  1M90 Q;  2Q6Q A;  5CHX A;  1YIT P;  3CME P;  1ZR2 A;  1SQV K;  2H89 C;  1SLQ A;  4DJG A;  2Y9Z A;  5AVY B;  1VQP P;  1L2P A;  4W7Z A;  1J2J B;  1FJK A;  4B86 A;  1NTZ G;  1EXJ A;  3CLQ A;  3MGN A;  2XU6 A;  3H1L J;  4DOJ A;  1GL2 B;  1NU1 E;  1NJI Q;  3H1I D;  2OTK E;  2PFX A;  2YXQ B;  4N3Y B;  2QE7 H;  3TGU G;  3AE7 C;  4PD4 D;  3JCU E;  3T97 B;  1BCC G;  1FZC B;  2YMK A;  4HJG H;  1VF5 D;  1NOH A;  3S9O A;  1SQX G;  1AV1 A;  2B87 A;  3L75 J;  3ITK A;  2R44 A;  5KKZ C;  1PP9 E;  2JDI H;  1QVF O;  1G2C B;  2QM7 A;  3O6Q B;  5AW3 B;  1KB9 H;  1PGJ A;  2WIT A;  3CMA P;  3Q5S A;  3MD0 A;  1BSN A;  1SQQ D;  3AE2 C;  1JCD A;  5GTI E;  2IZ0 A;  2QJK B;  2H8P D;  3V4W A;  1T2K D;  1FZB A;  2FYU G;  3B5N C;  1L0N K;  1W2E A;  2E43 A;  3VP8 A;  1H0T A;  4M3L A;  1DD3 A;  1RF0 C;  3HTK B;  4RKU J;  3B5N A;  3JC2 2;  3BRT B;  1JO5 A;  1LTA C;  1GL2 D;  3HD7 A;  3OA7 A;  1KB9 D;  3IR9 A;  3KPE A;  3HUS A;  2IFM A;  2KK7 A;  1HGV A;  3RL0 C;  5B5E H;  4K35 A;  1SQP J;  1OVR A;  1Z56 A;  1L0L G;  1NTM J;  3AE3 C;  3CCR P;  3CCQ P;  4JQ0 D;  3AE8 C;  1J1D C;  2R3C A;  5AVT B;  5CCG C;  2JKV A;  1NTK D;  2IX7 C;  4KHX A;  4TLF A;  3L74 E;  1LJ2 A;  3A0B E;  2D2C B;  3P8C D;  4BXL A;  1G1I A;  2E75 B;  2YO3 A;  3CWB G;  1HWT C;  1YQ3 C;  1NTZ J;  5CCG A;  1CW5 A;  4IFM A;  3B8E B;  3U1A A;  1FOS E;  2WTY A;  2W6B A;  2RN0 A;  2BEQ D;  4U3F E;  3HRN A;  4I7Z B;  4Y99 B;  3H1J G;  1U57 A;  3VYI A;  1DH3 A;  3L71 E;  5KJ7 D;  4BRY B;  1NH4 A;  2L91 A;  3VMZ A;  4ZMD A;  2Z4E A;  2QJP C;  3CXH I;  1WRG A;  2NPS B;  1SQX J;  1LWU A;  5APS A;  3L70 E;  2QVA A;  2K3R A;  3VN0 A;  5C39 A;  2QM8 A;  1JUN A;  3G4S P;  3D71 A;  1LGH B;  2IBZ G;  5E79 H;  2PP6 A;  2ZXX A;  3QWO C;  2FXO A;  4IL6 X;  3CXH E;  1OXZ A;  5CCH D;  1BE3 E;  1URQ B;  2ZYA A;  1A02 F;  2B9B A;  1YJW P;  2FKW B;  3P32 A;  5TIS H;  3L71 G;  1L0N E;  4CPG A;  2RKL A;  3W68 A;  5KLI C;  2Q1K A;  1E79 H;  2E75 D;  3F5H A;  1GZL A;  2M8R A;  2K9J B;  1KFN A;  1PP9 J;  2IYO A;  1YTZ T;  2WSE J;  4JBZ A;  1S5L E;  4PV1 D;  5B66 E;  5APW A;  2RMZ A;  1IFP A;  1QGK B;  2ZFC A;  2W8Z A;  1IFM A;  2ZT9 D;  2E76 C;  2WWW A;  1L0L J;  1QEX A;  3TGU D;  3H1I E;  1BCC D;  3VOP A;  2J59 M;  3MUD A;  1FBM A;  1QL2 A;  4IL6 H;  5DJT B;  2WT7 A;  3CL3 D;  5CBO A;  1EDL A;  2W90 A;  1VF5 C;  2WSE H;  3CD6 P;  1JY3 O;  1BGY D;  3VMA A;  3AEB C;  1AA0 A;  1X22 A;  3E7K A;  3IN6 A;  3GHG C;  1N7S C;  2V7Q J;  2LXB A;  1SQP K;  2FYU D;  2WSC J;  1FZG A;  1NWQ A;  3M9H A;  1L4A C;  3HE4 A;  3GHG A;  1NTM K;  1KB9 I;  4ASV A;  3CI9 A;  4H0L C;  2IYP A;  3L74 J;  3M06 A;  3KDP B;  1T2K C;  2G8Y A;  1M56 D;  4QMA A;  1FC2 C;  4GOD A;  5APY A;  3RK2 D;  1JY2 N;  1EZV I;  2QG4 A;  5AVQ B;  3VP9 A;  4C7N B;  4U3F J;  1KB9 E;  1NTZ K;  4HB1 A;  1MZ9 A;  3CX5 H;  4UB6 H;  1SQQ G;  4EDF A;  3L71 J;  2N9Y B;  2W6A A;  1FE6 A;  2AEJ A;  1FZF A;  2N1T B;  5BU8 B;  1IFI A;  1GL2 A;  1EZV E;  2CPS A;  1VQ5 P;  3L70 J;  4ZKP A;  2LR2 A;  1K8A Q;  2XND H;  1NTK E;  3RK3 B;  3CWB D;  4OGQ D;  4OWF A;  1SQX K;  3VMY A;  4WVZ A;  3TNU A;  1DD4 A;  3CC7 P;  1J1E B;  2Z5H A;  3KYQ A;  2KLV A;  2NRG A;  1OX3 A;  1M7L A;  4EIJ A;  3KHU A;  3CX5 D;  3H1J D;  2OYI C;  4RES B;  3O6Q A;  5B5E E;  4WY4 D;  1JNM A;  2P10 A;  3Q3D A;  4ASW A;  4GKG A;  1JM0 A;  2QIW A;  2E74 D;  5KJ7 C;  1X79 B;  2IBZ D;  1S3J A;  1SQV D;  3O8Z A;  2KYV A;  1M8O B;  5KJ7 A;  1VQ8 P;  2FXP A;  1PIX A;  4YXW H;  4LLH A;  3H1I J;  3M0D A;  2N1T D;  2GUV A;  2N9B A;  1L0L K;  5CCH C;  5KAI H;  4HKZ H;  1JTH A;  2HOD A;  2KSJ A;  5AW4 B;  2FYN C; 
#chains in the Genus database with same CATH homology
 1NVO A;  2M5A B;  1Y47 A;  4IOI H;  5DJT B;  2LR2 A;  4NPF X;  4ZMD A;  5DJU B;  4GOF A;  5K5G B;  5CBO A;  1EDL A;  2KUB A;  1U7M A;  2QRX A;  2M0B A;  1MFT A;  1SS1 A;  2KZI A;  2K3R A;  2QVA A;  2SPZ A;  5C39 A;  1H0T A;  4GOE A;  1LP1 A;  5CBN A;  2B89 A;  4KJM A;  4MN4 C;  1JMB A;  3FXD A;  1BDC A;  2KIK A;  1U7J A;  1LT1 A;  2WMM A;  2KI7 B;  1ZW0 A;  2ZAE B;  2P58 A;  3QWO C;  3MHV A;  1EDI A;  3ZDM A;  1H0T B;  2I8D A;  2LXB A;  2HR3 A;  4K35 A;  1DEE G;  2UWJ E;  1OVR A;  4ASW A;  3PH0 A;  1JM0 A;  1EC5 A;  4ASV A;  4CPG A;  4NPE A;  2OTK E;  2RKL A;  4K3A A;  3RGU A;  2Q1K A;  1S3J A;  3S1K A;  1Q2N A;  4ZNC A;  4HJG H;  1EDJ A;  1FC2 C;  1LP1 B;  4GOD A;  2JWD A;  4WWI A;  1EDK A;  4BXL A;  2B88 A;  2B87 A;  4JBZ A;  2M5A A;  2R44 A;  5EFW B;  2KZJ A;  4HB1 A;  3FXE A;  2LXC B;  1BDD A;  2KS1 B;  1ZXG A;  1OVU A;  4NPD A;  3MZW B;  4HKZ H;  4EYY Q;  1X0T A;  2B87 B;  1OVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...