1YTZT

Crystal structure of skeletal muscle troponin in the ca2+-activated state
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
90
structure length
90
Chain Sequence
SYSSYLAKADQKRGKKQTARETKKKVLAERRKPLNIDHLNEDKLRDKAKELWDWLYQLQTEKYDFAEQIKRKKYEIVTLRNRIDQAQKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Contractile protein
molecule keywords Troponin T
publication title Ca2+-regulated structural changes in troponin
pubmed doi rcsb
source organism Gallus gallus
total genus 34
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2005-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.350 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ytzT00
4Y99C 1J1EB 1J1EC 1J1DB 1J1DC 1YTZI 1YTZT 4Y99B
chains in the Genus database with same CATH superfamily
1AVOA 3CMEP 4BRYA 1T2KD 2O01J 3BCCD 2HG5D 4HYTB 1L0LE 1EDLA 3MTUE 3OA7A 1WT6A 1OVVA 3VYIA 3HTKA 2N1TB 5AVQB 3H1HE 2BEQD 1MFZA 3CXHE 3CL3D 5AW0B 1GL2A 5CBNA 1VL2A 1FOSE 1L0LJ 1VF5C 3GHGB 4WBAA 1W5CE 1AJYA 1UIXA 1BCCE 2L5GB 4K35A 2AXCA 4PD4E 1FBMA 3T97B 1K04A 3O6QB 4A7PA 3B4SA 1PPJE 1J1DB 1N73A 1OMIA 1N7SC 3VP8A 2QJPB 1SQBK 1IK9A 1G1JA 1JCDA 1IFIA 2B88A 1PFIA 3AECC 4ASWA 1SQVG 1S4XA 5BU8B 1KYOD 1RHZB 1LNQA 4WY4D 3L37A 3HUSC 3ABVC 2Q7CA 2WZ7A 5CMZA 2OYOA 5TISE 1KILE 2CPBA 1VQNP 4PD4I 1K8AQ 3PH0A 4IFFA 2KP8A 2WITA 2P1JA 1PP9J 2Q1KA 1URQC 3F89A 2D2CD 2RMZA 2FKWB 4IOIH 2QJKC 2AXTE 3SWYA 1HVVA 5GTIH 1GZLA 2P58A 1J1EB 2VRSA 5GTHH 4JBZA 5APSA 2QJYC 2JP3A 3S1KA 1ZW0A 5AW6B 1M1JA 5CCHC 1YITP 3M9QA 1OW8A 1VQ8P 2WSFH 1ZR2A 3Q3DA 2E75C 4U3FE 1NTZG 3AE9C 4H13C 5B66E 2M8RA 2PAJA 2H7HA 1NU1K 2SPZA 1BGYG 3L70G 4N78E 5APYA 3B8EB 1GL2D 4GOEA 3CX5D 2A06G 3UIAA 3VMXA 4IL6H 1D7MA 3JC22 3RL0D 4GDOA 1LT1A 2IBZD 4H44C 1KYOH 3AEBC 1NTKE 1OFCX 1VF5B 2BASA 1ZXGA 1S5LH 1PP9D 1OVRA 3SWKA 1UIIA 3LIDA 3A2AA 3G3ZA 3HE5A 1SQBG 1VQ9P 5KJ7C 2O01N 3L75J 2XKMA 3V4QA 2V7QJ 5APQA 2HFED 5CCGA 1N7SB 4HB1A 2KS1B 1H0TB 3L72E 1S1CX 1NTKJ 2I1JA 1RH5B 1KN7A 3A5TA 1KQGB 2I8DA 1WMKA 1H88A 3VMYA 4GKGA 1FZEA 3H32A 3WU2H 1NKNA 5CJ0A 2OTLP 4Y99C 3CCUP 4I7ZC 1PGJA 1G2CB 3HUSB 1CSBA 3KQGA 1L0NK 3TGUE 1SVFA 1BE3E 1PGPA 3AE4C 1CI6A 2BCCG 2Q9IA 2QM7A 4BWNA 4HJGH 3P32A 1NU1D 2ZYAA 1URQB 5AVRB 1LWUC 3CC7P 1NAFA 1Z56A 3NXSA 4DOJA 4PJ0E 4YPCA 1T3JA 1KQFB 2QJKB 4YXWH 2Y0EA 5AVXB 1YQ4C 3PRJA 3L74J 5AW9B 2E74C 1EXIA 4IL6X 2QJYB 2OQQA 3A0BH 1NYHA 4JPZB 3CX5H 1YHQP 5CBOA 1PIXA 1IFDA 2Y0CA 1MKMA 1HWTC 1FZFA 1HGVA 3CWBE 1S5LX 2E75B 1YBKA 3L71G 1WRGA 4D6TG 1LTSC 3L75D 3H1KJ 3F5HA 2I1KA 2ZT9C 4H13B 2OYHA 4R4LA 1SFCA 4GIFA 2JWDA 3JSVC 3L73J 1SQPJ 1NTKD 2AEFA 4L76A 3FXEA 1SQPK 1M8OB 3EWKA 3CWBJ 3VMAA 5BVZA 5KAFE 1VQ5P 4ZNCA 2E43A 1JY3O 2R3CA 1L0ND 2FYUG 3GG2A 4RESB 1R5SA 1Y9BA 1L2PA 2HODB 1YI2P 2RKLA 3D6ZA 4H44B 3E1IA 3H1IE 1FZAA 5CCGD 1JTHB 1FZGA 3E1RA 3TNUA 3L4FA 3V5BA 2OTKE 1JOCA 2B87A 1RY3A 4PV1C 3H6PA 1FDMA 1VDFA 1BDDA 4NPEA 1H8AA 1LT9C 3L74D 3HE4B 1E79H 4C7NB 1AA0A 1YTZT 3W68A 2NPSA 2HYNA 3USSA 1Y8AA 4L73A 4Y99B 2IYOA 4I7ZB 3CC4P 2QG4A 3M9BA 1LTJC 1QX8A 2K88A 3AE6C 1NKZB 5KLVJ 3MHVA 3U1AA 2KI7B 5KLVK 3H1KD 2FFDA 1LJ2A 2LXBA 2L91A 4Z1MH 2M0BA 1LWUB 4M3LA 3L73D 3I55P 1SQPD 5H2FE 1YTZI 1EZVD 1LP1B 1GK6A 3D6YA 3CWBD 3PTZA 2WT7B 1SQVE 1QVFO 2Z4EA 3MP7B 1IJDB 2E74B 3QWOC 5AW3B 1X8YA 1A02J 1EC5A 3AE7C 2FBWC 2HODA 4XE5B 4XFJA 1X22A 1P84D 2LKMA 1SFCD 3M0DC 1NTMG 1MUUA 1RE4A 3JCUE 5B5EH 2ITAA 2XNDH 5AVWB 3LW5J 2ZT9B 4JYCA 2ZVNB 1BSNA 1T8ZA 2YKPA 2QEXP 3FX0A 1VQPP 3RK3D 3RK2C 2K37A 2KLVA 3FWLA 1SQXG 1HF9A 1LTTC 4C46A 2KXPB 1RF1B 1RE3C 2IFNA 4OH8B 2XDJA 3PJSK 3H1JD 3HD7A 2OYIC 4K3AA 4HH2A 2JEEA 2E42A 4H0LB 1NHLA 3CCRP 5KLVD 2E76C 1LTGC 3P8CD 1NTZE 3VP9A 2IFMA 1KFMA 3VMZA 3H1LJ 2HPCB 4L75A 1BGYE 3L70E 3S4RA 2P67A 4C7RA 4PV1B 2HR3A 5TJHA 3CCEP 1ZMEC 2NPSD 1A02F 2A06E 1HUCA 1LT9B 1IK7A 1EDIA 1ZV8A 2WT7A 2A45H 2WPSA 1KQLA 3FWNA 2LXCB 5BU5A 1YYCA 1NAYA 1N2DC 1L0LK 1LTJB 5AW5B 4DT0A 3H1HJ 1JMBA 3AEAC 3BCCG 1P84H 3B5NA 3CMAP 2W6BA 1BCCJ 1IFJA 1GDTA 1KILA 3CXHI 1RF0C 5KLIC 3Q5SA 4IFDK 2YMYA 3K5BA 1FZCC 1OZHA 1PV3A 2ZVOB 3KZIE 1BSHA 2BCCE 2Q3EA 1SQQE 4JF7A 3BATA 4OWFA 3R4YA 1KTMA 2WPRA 1PZQA 3H1LD 2NRGA 1VQOP 3V6IA 3D70A 2V4HA 1YJNP 2JKVA 2PRRA 3HD7D 3RK2B 1SQQJ 1KORA 1IFMA 1L4AD 1T2KC 2Q6QA 1QGKB 3GW6A 2N1TA 2M3BA 2KLUA 1M7LA 4WWIA 3W67A 2AEJA 2OYIB 4I6MC 2IDBA 1L0LD 3RBZA 5AVZB 3TF5A 3ITKA 3GHGA 3CCVP 3L71E 2E76B 3AE8C 4D6TE 3H1HD 1FOSF 2MJZA 2R32A 3CXHD 4CPGA 3T97A 3O6QA 1EXJA 1GK4A 3SFDC 4UB6E 3A0HE 3CI9A 2KSJA 5E79E 2XV5A 4YXDC 1BCCD 3WMM0 1GTWA 2CPSA 4PD4D 4U3FJ 1NJIQ 3II6A 1LGHB 1GU4A 2H89C 3CCLP 5C39A 1OVUA 2E74D 1PPJD 1PGOA 1U57A 3C8VA 2FYUE 3IN6A 1U7MA 3KDPB 2HLOA 2IPPA 3PLNA 3GF7A 2QVAA 2M5AB 5KAIE 3B5ND 3SSUA 1MFTA 4UB8H 2WSEJ 2QM8A 3WUVA 2WSCH 1KILD 1E5WA 3R2PA 1Q7YQ 2O01H 5AW2B 2IYPA 5DJTB 3PHLA 1SQQD 1NTKK 2KNCB 2D2CC 2NZ2A 3MGNA 1DD4A 2B9BA 2IBZG 3P7KA 5KLIB 1KD1Q 2OARA 4EI2A 3PP5A 1JCCA 1ZN5A 1FZCB 1JO5A 1AQTA 3L72J 5AW7B 1AV1A 1PP9G 4ZKUA 3AEGC 4BXLA 1N86A 3OJAB 1DIPA 4W7ZA 1KB9E 2KZJA 4IFMA 2YXRB 1CZQA 3CXHH 3MZWB 2JJLA 1QLED 2XNXA 3CCJP 4ZMDA 3G9RA 3TGUJ 1XTCC 1FDIA 2JO1A 4U3FD 1KV4A 1BE3J 2N1TD 2JDIH 2R5DA 1Q86Q 2E5TA 2YKOA 2W90A 4PD4H 1Q82Q 3M06A 2P2UA 5EFWB 2GM4A 4NPFX 3CCQP 2Q3IA 3BVHA 2WMMA 4N78D 1SP4A 5AVTB 1NU1G 5APTA 3HRNA 3RL0C 2K9JB 1NTME 2R5BA 2Z5IA 3A7OA 3MD0A 1NH4A 1N73C 1QEXA 2LR2A 1N7SA 4WVZA 1SQXE 5TISH 3A3YB 3G6EP 2KS1A 1H0TA 1RF1C 2WPVB 3RGUA 2K9YA 4U7JA 2O1KA 2IX7C 4H0LC 3H25A 3CC2P 2W83C 1RF0A 1RQVA 2FXOA 5APVA 3L72D 1G2CA 1K9MQ 2GA1A 1KZUB 3HUSA 3FGAD 2AXTH 3U59A 3L75G 1CW5A 1ZRTE 3AE3C 3GF3A 1OW6A 3L35A 1URQA 2R44A 1NTKG 1S9KE 3TGUD 1NO4A 1BE3D 3H1IJ 3AE5C 1ZP0C 3V2PA 2D2CB 1L0NG 2ZYDA 3U1CA 2K3RA 1KMIZ 3BRTB 5B66H 3N7NA 1VQ4P 3NTNA 1M1JC 5CCHA 1OX3A 2R3SA 2WWWA 4KHXA 1MV8A 1KC8Q 5GTIE 2KB7P 1JY2P 1NGMB 2PFXA 3VTPC 1OWAA 1S2EA 2K9JA 5GTHE 1VQ7P 2V7QH 1M57D 4DJGA 2C0WA 3NMDA 2JR8A 4R4MA 2RH0A 1HJBA 4BRYB 1VQ6P 4TT3H 3L74G 3I56P 1T3UA 4OGQC 5CHXA 1JY2N 3V2RA 2W27A 1EDKA 3QH9A 3GMAA 1PGQA 3P8MC 1K73Q 3HTKB 4HKZH 2P10A 3V4WA 2ZXEB 1VF5D 2YNYA 1RQUA 4LC1A 1JMMA 1SQVJ 3H1KG 1VQMP 1SQVK 3RL0B 2MKVA 5AVUB 1JTHA 3L73G 1N7SD 1SQPG 1EZVG 2P7JA 5KJ7A 2W8ZA 2BEZF 4IL6E 4N3YB 3CWBG 2A45G 1R5LA 5CCGC 2OGUA 3H1ID 4JYBA 1N73B 3IF4A 4DZOA 4QMAA 2C0XA 3M0AA 1KYOE 3Q5PA 2RN0A 1S5LE 3HE4A 2WQYC 5AW8B 4C7NA 1BDCA 3V2QA 5APWA 2KK7A 3IAOA 4PJ0H 1W2EA 4N6JA 1M1KQ 1FDOA 2ZYGA 1X0TA 1URQD 4EYYQ 1ZR4A 3CLQA 2YXQB 5CJ4A 1HJ0A 1LWUA 3TK1A 3AEDC 3WU2E 3CD6P 3KXDA 1KYOI 1LP1A 2C9LY 1NTZJ 2E5YA 3RL0g 3H1JG 2H43A 4LGDE 1NTZK 5CCHD 3G4SP 1DX7A 4I1LA 1IO4A 1BGYJ 3L70J 5KLVG 1M1JB 2E75D 3TYYA 1SQVD 2KIKA 1J2JB 3RBXA 1HTLC 1SQBE 4H13D 1SS1A 3O8ZA 1QL2A 5KAFH 1G1IA 1USEA 1VQLP 1JY2O 2PGDA 2KYVA 1M90Q 2OYHC 1SFCC 1AQ5A 3A0BE 1GW4A 5K5GB 3AE1C 3CX5E 3KHUA 3SWFA 1SQBJ 4OGQB 2IBZE 3LIEA 3L36A 3EFFK 1RF1A 1YIJP 4KJMA 3RK3C 4MN4C 4KT0J 4H44D 4DCKA 1PP9E 3N4XA 1N7LA 4TLFA 1T6AA 2J59M 2H8PD 2WVRA 1N8RQ 1DEEG 3TDKA 5KJ7D 1W2BO 5KKZC 4RJTA 3HE5B 3CX5I 2HPCA 2BCCJ 3AE2C 2FYZA 1FU1A 2PP6A 3E7KA 1NTZD 3KPEA 3MIWA 2GUSA 2IBZI 1Q90D 2H88C 2YIUC 2N9YB 1SQQK 1LT9A 1BGYD 3L70D 1GMJA 2NPSC 3H32B 3MUDC 5H2FH 1H89A 2FXMA 1IFPA 1NU1E 1TU3F 2A06D 1LTJA 2JWAA 4EDFA 2WTYA 3H1LG 1CI6B 1HH0A 3IR9A 2FFDC 3BASA 3B71A 3LW5H 3FXDA 1NVOA 2C9NY 1R8EA 1FE6A 2XZRA 1VPCA 3L71J 1NU1J 2QE7H 4D6TJ 1SQBD 4WB4A 4EOTA 1IZNB 5AW1B 4AUWA 1L0LG 2ZXXA 2GUVA 2FYNC 1YJ9P 3JCUH 3G71P 4GODA 1FC2C 5APUA 1JY3P 2XU6A 5AVVB 3H1HG 3L75E 1OIPA 1FJKA 2IZ1A 4WY4C 4I2LC 2AEMA 2FYUJ 1SLQA 2ZT9D 3Q2YA 4ZKPA 2QIWA 3M0DA 4NPDA 2FYUK 1BCCG 1RE4C 1DH3A 1GU5A 3C1LA 2IZ0A 1FS0E 1IFNA 1JY3N 2K1AA 2BCCD 2W6AA 2OYHB 4W7YA 1SFCB 2ZAEB 4GT1A 2Y0DA 1ZOYC 1PPJG 2FXPA 1L0NE 1NOHA 4H0LD 4RKUJ 1RE3A 3RK3B 3HD7C 2OYIA 5B5EE 1S72P 1L4AC 3NFQA 2YO2A 4OVNF 3WUUA 2CK3H 3V2NA 1L0NJ 1M56D 1USDA 1Y47A 2G8YA 5KKZB 2DW3A 1X79B 4AQRD 1JM0A 2N9BA 3OAKA 4PV1D 3TNUB 1SQQG 3L74E 1KQSO 3L71D 4D6TD 2Y9YA 2B87B 2W6JH 3AEEC 1GD2E 2Q5UA 2YIUB 2YKQA 2Y9ZA 1X9VA 1AVYA 1GL2C 2NPSB 2FY8A 1KB9I 3H1KE 1JEKA 4ASVA 1K05A 2M5AA 1LTAC 2FYUD 3L73E 1SQPE 1PL5A 3CPWO 1EZVE 2OTJP 4B86A 4O9BA 4U3FG 2FFDB 3B5NC 1KFNA 3GLMA 3KZIH 5L8RJ 4OGQD 3BRVB 1NTMJ 2KNCA 1KILC 2KOGA 3ZDMA 1DD3A 5KTBA 1NTMK 2QSIA 1OXZA 2FYNB 3VOPA 1P84E 1FZCA 1AFOA 1SQXJ 4XA4A 1SQXK 1FJPA 1EQ7A 4WY4B 1EZVI 5AVSB 3WUTA 4LLHA 1VQKP 2A45I 3RK3E 2ZFCA 4GOFA 1ZLLA 4L74A 1NWQA 3RK2D 5APXA 1IC2A 1KB9D 3H1JE 5DJUB 1JUNA 2QRXA 3L72G 3CCMP 3Q5RA 5KLVE 1P84I 2N1TC 1HGZA 4UB6H 3HD7B 3P8CE 2QA4P 3A0HH 2E76D 5E79H 5AVYB 4W80A 1L4AB 1JB0J 1GW3A 2UWJE 4EIJA 2O1JA 2WPQA 3H1JJ 2O3JA 2B89A 3BCCE 3GHGC 3MUDA 2POHA 2WSEH 4JQ0D 3TGUG 2J58A 3AEFC 1BE3G 1EDJA 1J1DC 2QJPC 3TSIA 1NTMD 3SFEC 3IFMA 4YTPC 3EFGA 5KAIH 3BCCJ 3D71A 3Q1MA 1JNMA 3C9IA 5M1BA 1Q2NA 1SQXD 2WSSH 1GL2B 1FZBA 3EQ2A 3S9OA 2YO3A 5AW4B 3VN0A 3M9HA 2WSFJ 4AYCA 1QL1A 1Q81Q 2YMKA 4Y28J 4WY4A 2M3EA 2KZIA 1HBWA 1LTIC 2G3AA 3B5NB 1U7JA 1DEBA 1ZRTD 2Z5HA 2KUBA 3CCSP 2ZJSE 3I5CA 1KB9H 1KILB 1J1EC 4UB8E 1S9KD 2KSEA 1MZ9A 1YQ3C 1XTGB 1FAVA 1LTBC 1YJWP 2J5UA 1OW7A 3OW2O 4RO0A 1S3JA 3KYQA 3H1LE 1L4AA 1QVGO 3H1IG 3M91A 2WSCJ
chains in the Genus database with same CATH topology
3H32B 1CZQA 1H89A 2JJLA 2XNXA 2FXMA 1T2KD 1XTCC 4Y99B 2HG5D 3M9BA 2N1TD 1LTJC 4HYTB 1LTJA 2WTYA 2R5DA 1NKZB 3MTUE 3OA7A 1WT6A 1CI6B 3U1AA 2YKOA 3VYIA 1HH0A 3IR9A 5KLVK 2FFDC 3BASA 3HTKA 2N1TB 2FFDA 5AVQB 3LW5H 3M06A 1LWUB 2C9NY 1MFZA 2P2UA 4M3LA 2XZRA 1VPCA 3CL3D 5AW0B 2GM4A 1YTZI 3BVHA 1GL2A 2Q3IA 4WB4A 4EOTA 1GK6A 4N78D 1SP4A 1FOSE 5AVTB 3GHGB 4WBAA 5APTA 5AW1B 3HRNA 3RL0C 2WT7B 4AUWA 2L5GB 2R5BA 2Z4EA 1FBMA 2GUVA 2Z5IA 3A7OA 1IJDB 3MD0A 1NH4A 5APUA 1JY3P 2XU6A 5AW3B 5AVVB 1N73C 1J1DB 1X8YA 1A02J 1N73A 1N7SC 3VP8A 1N7SA 1FJKA 4WY4C 3A3YB 1SQBK 4I2LC 1IK9A 1RF1C 2HODA 1G1JA 4XE5B 1SLQA 1JCDA 1IFIA 1PFIA 2LKMA 1SFCD 3M0DC 3M0DA 4ZKPA 2FYUK 2O1KA 2IX7C 1RE4C 1DH3A 1GU5A 1MUUA 1RE4A 1IFNA 1RF0A 5AVWB 1JY3N 5BU8B 5APVA 4JYCA 2W6AA 2OYHB 4W7YA 1T8ZA 4WY4D 2YKPA 1SFCB 1G2CA 3L37A 3HUSC 1KZUB 2Q7CA 3HUSA 4GT1A 2WZ7A 5CMZA 3RK3D 3U59A 3RK2C 2CPBA 2KLVA 1CW5A 4IFFA 1NOHA 2KP8A 2WITA 1LTTC 4C46A 2P1JA 1RF1B 1RE3C 2IFNA 4OH8B 1RE3A 3RK3B 2XDJA 1URQC 3HD7C 3L35A 1URQA 3HD7A 2OYIC 2OYIA 1L4AC 1S9KE 4HH2A 3NFQA 2JEEA 1NO4A 2YO2A 2E42A 2FKWB 1NHLA 3V2NA 3SWYA 3V2PA 1HVVA 1GZLA 1LTGC 3P8CD 3VP9A 1J1EB 3U1CA 1X79B 2VRSA 4AQRD 2N9BA 3BRTB 2IFMA 1KFMA 3OAKA 5APSA 3VMZA 3TNUB 3N7NA 3NTNA 1M1JC 5AW6B 1M1JA 5CCHC 2HPCB 5CCHA 3M9QA 2P67A 4C7RA 2WWWA 1GD2E 4KHXA 2NPSD 2Q5UA 2WSFH 1ZR2A 1MV8A 1A02F 2YKQA 2KB7P 1JY2P 1HUCA 1LT9B 1X9VA 3VTPC 1OWAA 1ZV8A 2WT7A 2A45H 2WPSA 2C0WA 3NMDA 1GL2C 1KQLA 2NPSB 1HJBA 2M8RA 2PAJA 2H7HA 5BU5A 1YYCA 1NU1K 1N2DC 1LTAC 1T3UA 1L0LK 1LTJB 5CHXA 5AW5B 1JY2N 3V2RA 2W27A 4B86A 4N78E 5APYA 3B8EB 1GL2D 3P8MC 4O9BA 3HTKB 2FFDB 3B5NC 3V4WA 3UIAA 2ZXEB 1KFNA 3B5NA 3VMXA 3RL0D 2YNYA 4LC1A 1JMMA 2W6BA 3BRVB 1IFJA 1GDTA 1KILC 2KOGA 1KILA 2BASA 1SQVK 5KTBA 3RL0B 1NTMK 1RF0C 5AVUB 1JTHA 1N7SD 3LIDA 3A2AA 1OXZA 3G3ZA 3HE5A 3VOPA 4IFDK 5KJ7C 2P7JA 2YMYA 2XKMA 3V4QA 5KJ7A 1FZCC 1FZCA 1AFOA 5APQA 4N3YB 2A45G 2HFED 5CCGC 4XA4A 5CCGA 4JYBA 1N73B 1N7SB 4DZOA 1SQXK 1FJPA 1EQ7A 2C0XA 4WY4B 3M0AA 5AVSB 2I1JA 4LLHA 3A5TA 4JF7A 3BATA 2A45I 3HE4A 2WPRA 2ZFCA 1H88A 5AW8B 3VMYA 4C7NA 1ZLLA 1FZEA 4GKGA 1NWQA 3RK2D 3V2QA 3H32A 1NKNA 5APWA 5APXA 5CJ0A 4Y99C 1IC2A 1G2CB 1W2EA 4N6JA 3HUSB 1CSBA 3KQGA 1L0NK 1JUNA 1URQD 3HD7D 1SVFA 3RK2B 1ZR4A 1CI6A 1L4AD 1IFMA 1T2KC 2Q9IA 3CLQA 2N1TC 2QM7A 1HGZA 2N1TA 2M3BA 3P32A 1M7LA 1URQB 3HD7B 5AVRB 1LWUC 3P8CE 2OYIB 5CJ4A 1LWUA 3TK1A 4I6MC 5AVYB 1NAFA 4W80A 1L4AB 1Z56A 1GW3A 4EIJA 2O1JA 2WPQA 3NXSA 4DOJA 5AVZB 1T3JA 2C9LY 3GHGC 3MUDA 3GHGA 5AVXB 2H43A 2POHA 4LGDE 1NTZK 2WSEH 1FOSF 5CCHD 2MJZA 1DX7A 2R32A 2J58A 4I1LA 1IO4A 3T97A 5AW9B 1GK4A 1J1DC 3CI9A 2KSJA 1M1JB 3TYYA 2XV5A 3WMM0 3TSIA 1J2JB 3IFMA 1GTWA 2CPSA 1IFDA 3EFGA 1HTLC 3II6A 1LGHB 1HWTC 1FZFA 1JNMA 1GU4A 1HGVA 3C9IA 3O8ZA 1QL2A 1G1IA 1WRGA 1LTSC 1JY2O 2KYVA 2I1KA 3KDPB 2OYHC 1GL2B 2HLOA 2OYHA 2IPPA 1FZBA 3EQ2A 1SFCC 1AQ5A 1SFCA 2YO3A 4GIFA 1GW4A 5AW4B 3VN0A 3M9HA 4AYCA 3SWFA 1QL1A 3B5ND 1SQPK 3LIEA 4WY4A 3L36A 5BVZA 1RF1A 2QM8A 3RK3C 1HBWA 2WSCH 1LTIC 2E43A 1JY3O 3B5NB 2R3CA 1KILD 1DEBA 4RESB 1E5WA 3N4XA 1N7LA 3R2PA 2O01H 2HODB 5AW2B 2J59M 2Z5HA 2H8PD 1NTKK 3I5CA 5KJ7D 3E1IA 1KILB 3MGNA 1FZAA 1J1EC 1S9KD 5CCGD 1MZ9A 1JTHB 3P7KA 1XTGB 1FAVA 1FZGA 3HE5B 1LTBC 2OARA 3TNUA 3PP5A 1JCCA 3L4FA 1ZN5A 1FZCB 3V5BA 2HPCA 1JO5A 1JOCA 3KYQA 5AW7B 2FYZA 1FU1A 2PP6A 3KPEA 3MIWA 4ZKUA 1RY3A 2GUSA 1L4AA 3H6PA 1FDMA 1VDFA 1N86A 3OJAB 1SQQK 4W7ZA 1H8AA 1LT9C 1LT9A 3HE4B 4IFMA 3M91A 4C7NB 2NPSC 1YTZT 2NPSA 2HYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y99 C;  1J1E B;  1J1E C;  1J1D B;  1J1D C;  1YTZ I;  1YTZ T;  4Y99 B; 
#chains in the Genus database with same CATH topology
 1AVO A;  3CME P;  4BRY A;  1T2K D;  2O01 J;  3BCC D;  2HG5 D;  4HYT B;  1L0L E;  1EDL A;  3MTU E;  3OA7 A;  1WT6 A;  1OVV A;  3VYI A;  3HTK A;  2N1T B;  5AVQ B;  3H1H E;  2BEQ D;  1MFZ A;  3CXH E;  3CL3 D;  5AW0 B;  1GL2 A;  5CBN A;  1VL2 A;  1FOS E;  1L0L J;  1VF5 C;  3GHG B;  4WBA A;  1W5C E;  1AJY A;  1UIX A;  1BCC E;  2L5G B;  4K35 A;  2AXC A;  4PD4 E;  1FBM A;  3T97 B;  1K04 A;  3O6Q B;  4A7P A;  3B4S A;  1PPJ E;  1J1D B;  1N73 A;  1OMI A;  1N7S C;  3VP8 A;  2QJP B;  1SQB K;  1IK9 A;  1G1J A;  1JCD A;  1IFI A;  2B88 A;  1PFI A;  3AEC C;  4ASW A;  1SQV G;  1S4X A;  5BU8 B;  1KYO D;  1RHZ B;  1LNQ A;  4WY4 D;  3L37 A;  3HUS C;  3ABV C;  2Q7C A;  2WZ7 A;  5CMZ A;  2OYO A;  5TIS E;  1KIL E;  2CPB A;  1VQN P;  4PD4 I;  1K8A Q;  3PH0 A;  4IFF A;  2KP8 A;  2WIT A;  2P1J A;  1PP9 J;  2Q1K A;  1URQ C;  3F89 A;  2D2C D;  2RMZ A;  2FKW B;  4IOI H;  2QJK C;  2AXT E;  3SWY A;  1HVV A;  5GTI H;  1GZL A;  2P58 A;  1J1E B;  2VRS A;  5GTH H;  4JBZ A;  5APS A;  2QJY C;  2JP3 A;  3S1K A;  1ZW0 A;  5AW6 B;  1M1J A;  5CCH C;  1YIT P;  3M9Q A;  1OW8 A;  1VQ8 P;  2WSF H;  1ZR2 A;  3Q3D A;  2E75 C;  4U3F E;  1NTZ G;  3AE9 C;  4H13 C;  5B66 E;  2M8R A;  2PAJ A;  2H7H A;  1NU1 K;  2SPZ A;  1BGY G;  3L70 G;  4N78 E;  5APY A;  3B8E B;  1GL2 D;  4GOE A;  3CX5 D;  2A06 G;  3UIA A;  3VMX A;  4IL6 H;  1D7M A;  3JC2 2;  3RL0 D;  4GDO A;  1LT1 A;  2IBZ D;  4H44 C;  1KYO H;  3AEB C;  1NTK E;  1OFC X;  1VF5 B;  2BAS A;  1ZXG A;  1S5L H;  1PP9 D;  1OVR A;  3SWK A;  1UII A;  3LID A;  3A2A A;  3G3Z A;  3HE5 A;  1SQB G;  1VQ9 P;  5KJ7 C;  2O01 N;  3L75 J;  2XKM A;  3V4Q A;  2V7Q J;  5APQ A;  2HFE D;  5CCG A;  1N7S B;  4HB1 A;  2KS1 B;  1H0T B;  3L72 E;  1S1C X;  1NTK J;  2I1J A;  1RH5 B;  1KN7 A;  3A5T A;  1KQG B;  2I8D A;  1WMK A;  1H88 A;  3VMY A;  4GKG A;  1FZE A;  3H32 A;  3WU2 H;  1NKN A;  5CJ0 A;  2OTL P;  4Y99 C;  3CCU P;  4I7Z C;  1PGJ A;  1G2C B;  3HUS B;  1CSB A;  3KQG A;  1L0N K;  3TGU E;  1SVF A;  1BE3 E;  1PGP A;  3AE4 C;  1CI6 A;  2BCC G;  2Q9I A;  2QM7 A;  4BWN A;  4HJG H;  3P32 A;  1NU1 D;  2ZYA A;  1URQ B;  5AVR B;  1LWU C;  3CC7 P;  1NAF A;  1Z56 A;  3NXS A;  4DOJ A;  4PJ0 E;  4YPC A;  1T3J A;  1KQF B;  2QJK B;  4YXW H;  2Y0E A;  5AVX B;  1YQ4 C;  3PRJ A;  3L74 J;  5AW9 B;  2E74 C;  1EXI A;  4IL6 X;  2QJY B;  2OQQ A;  3A0B H;  1NYH A;  4JPZ B;  3CX5 H;  1YHQ P;  5CBO A;  1PIX A;  1IFD A;  2Y0C A;  1MKM A;  1HWT C;  1FZF A;  1HGV A;  3CWB E;  1S5L X;  2E75 B;  1YBK A;  3L71 G;  1WRG A;  4D6T G;  1LTS C;  3L75 D;  3H1K J;  3F5H A;  2I1K A;  2ZT9 C;  4H13 B;  2OYH A;  4R4L A;  1SFC A;  4GIF A;  2JWD A;  3JSV C;  3L73 J;  1SQP J;  1NTK D;  2AEF A;  4L76 A;  3FXE A;  1SQP K;  1M8O B;  3EWK A;  3CWB J;  3VMA A;  5BVZ A;  5KAF E;  1VQ5 P;  4ZNC A;  2E43 A;  1JY3 O;  2R3C A;  1L0N D;  2FYU G;  3GG2 A;  4RES B;  1R5S A;  1Y9B A;  1L2P A;  2HOD B;  1YI2 P;  2RKL A;  3D6Z A;  4H44 B;  3E1I A;  3H1I E;  1FZA A;  5CCG D;  1JTH B;  1FZG A;  3E1R A;  3TNU A;  3L4F A;  3V5B A;  2OTK E;  1JOC A;  2B87 A;  1RY3 A;  4PV1 C;  3H6P A;  1FDM A;  1VDF A;  1BDD A;  4NPE A;  1H8A A;  1LT9 C;  3L74 D;  3HE4 B;  1E79 H;  4C7N B;  1AA0 A;  1YTZ T;  3W68 A;  2NPS A;  2HYN A;  3USS A;  1Y8A A;  4L73 A;  4Y99 B;  2IYO A;  4I7Z B;  3CC4 P;  2QG4 A;  3M9B A;  1LTJ C;  1QX8 A;  2K88 A;  3AE6 C;  1NKZ B;  5KLV J;  3MHV A;  3U1A A;  2KI7 B;  5KLV K;  3H1K D;  2FFD A;  1LJ2 A;  2LXB A;  2L91 A;  4Z1M H;  2M0B A;  1LWU B;  4M3L A;  3L73 D;  3I55 P;  1SQP D;  5H2F E;  1YTZ I;  1EZV D;  1LP1 B;  1GK6 A;  3D6Y A;  3CWB D;  3PTZ A;  2WT7 B;  1SQV E;  1QVF O;  2Z4E A;  3MP7 B;  1IJD B;  2E74 B;  3QWO C;  5AW3 B;  1X8Y A;  1A02 J;  1EC5 A;  3AE7 C;  2FBW C;  2HOD A;  4XE5 B;  4XFJ A;  1X22 A;  1P84 D;  2LKM A;  1SFC D;  3M0D C;  1NTM G;  1MUU A;  1RE4 A;  3JCU E;  5B5E H;  2ITA A;  2XND H;  5AVW B;  3LW5 J;  2ZT9 B;  4JYC A;  2ZVN B;  1BSN A;  1T8Z A;  2YKP A;  2QEX P;  3FX0 A;  1VQP P;  3RK3 D;  3RK2 C;  2K37 A;  2KLV A;  3FWL A;  1SQX G;  1HF9 A;  1LTT C;  4C46 A;  2KXP B;  1RF1 B;  1RE3 C;  2IFN A;  4OH8 B;  2XDJ A;  3PJS K;  3H1J D;  3HD7 A;  2OYI C;  4K3A A;  4HH2 A;  2JEE A;  2E42 A;  4H0L B;  1NHL A;  3CCR P;  5KLV D;  2E76 C;  1LTG C;  3P8C D;  1NTZ E;  3VP9 A;  2IFM A;  1KFM A;  3VMZ A;  3H1L J;  2HPC B;  4L75 A;  1BGY E;  3L70 E;  3S4R A;  2P67 A;  4C7R A;  4PV1 B;  2HR3 A;  5TJH A;  3CCE P;  1ZME C;  2NPS D;  1A02 F;  2A06 E;  1HUC A;  1LT9 B;  1IK7 A;  1EDI A;  1ZV8 A;  2WT7 A;  2A45 H;  2WPS A;  1KQL A;  3FWN A;  2LXC B;  5BU5 A;  1YYC A;  1NAY A;  1N2D C;  1L0L K;  1LTJ B;  5AW5 B;  4DT0 A;  3H1H J;  1JMB A;  3AEA C;  3BCC G;  1P84 H;  3B5N A;  3CMA P;  2W6B A;  1BCC J;  1IFJ A;  1GDT A;  1KIL A;  3CXH I;  1RF0 C;  5KLI C;  3Q5S A;  4IFD K;  2YMY A;  3K5B A;  1FZC C;  1OZH A;  1PV3 A;  2ZVO B;  3KZI E;  1BSH A;  2BCC E;  2Q3E A;  1SQQ E;  4JF7 A;  3BAT A;  4OWF A;  3R4Y A;  1KTM A;  2WPR A;  1PZQ A;  3H1L D;  2NRG A;  1VQO P;  3V6I A;  3D70 A;  2V4H A;  1YJN P;  2JKV A;  2PRR A;  3HD7 D;  3RK2 B;  1SQQ J;  1KOR A;  1IFM A;  1L4A D;  1T2K C;  2Q6Q A;  1QGK B;  3GW6 A;  2N1T A;  2M3B A;  2KLU A;  1M7L A;  4WWI A;  3W67 A;  2AEJ A;  2OYI B;  4I6M C;  2IDB A;  1L0L D;  3RBZ A;  5AVZ B;  3TF5 A;  3ITK A;  3GHG A;  3CCV P;  3L71 E;  2E76 B;  3AE8 C;  4D6T E;  3H1H D;  1FOS F;  2MJZ A;  2R32 A;  3CXH D;  4CPG A;  3T97 A;  3O6Q A;  1EXJ A;  1GK4 A;  3SFD C;  4UB6 E;  3A0H E;  3CI9 A;  2KSJ A;  5E79 E;  2XV5 A;  4YXD C;  1BCC D;  3WMM 0;  1GTW A;  2CPS A;  4PD4 D;  4U3F J;  1NJI Q;  3II6 A;  1LGH B;  1GU4 A;  2H89 C;  3CCL P;  5C39 A;  1OVU A;  2E74 D;  1PPJ D;  1PGO A;  1U57 A;  3C8V A;  2FYU E;  3IN6 A;  1U7M A;  3KDP B;  2HLO A;  2IPP A;  3PLN A;  3GF7 A;  2QVA A;  2M5A B;  5KAI E;  3B5N D;  3SSU A;  1MFT A;  4UB8 H;  2WSE J;  2QM8 A;  3WUV A;  2WSC H;  1KIL D;  1E5W A;  3R2P A;  1Q7Y Q;  2O01 H;  5AW2 B;  2IYP A;  5DJT B;  3PHL A;  1SQQ D;  1NTK K;  2KNC B;  2D2C C;  2NZ2 A;  3MGN A;  1DD4 A;  2B9B A;  2IBZ G;  3P7K A;  5KLI B;  1KD1 Q;  2OAR A;  4EI2 A;  3PP5 A;  1JCC A;  1ZN5 A;  1FZC B;  1JO5 A;  1AQT A;  3L72 J;  5AW7 B;  1AV1 A;  1PP9 G;  4ZKU A;  3AEG C;  4BXL A;  1N86 A;  3OJA B;  1DIP A;  4W7Z A;  1KB9 E;  2KZJ A;  4IFM A;  2YXR B;  1CZQ A;  3CXH H;  3MZW B;  2JJL A;  1QLE D;  2XNX A;  3CCJ P;  4ZMD A;  3G9R A;  3TGU J;  1XTC C;  1FDI A;  2JO1 A;  4U3F D;  1KV4 A;  1BE3 J;  2N1T D;  2JDI H;  2R5D A;  1Q86 Q;  2E5T A;  2YKO A;  2W90 A;  4PD4 H;  1Q82 Q;  3M06 A;  2P2U A;  5EFW B;  2GM4 A;  4NPF X;  3CCQ P;  2Q3I A;  3BVH A;  2WMM A;  4N78 D;  1SP4 A;  5AVT B;  1NU1 G;  5APT A;  3HRN A;  3RL0 C;  2K9J B;  1NTM E;  2R5B A;  2Z5I A;  3A7O A;  3MD0 A;  1NH4 A;  1N73 C;  1QEX A;  2LR2 A;  1N7S A;  4WVZ A;  1SQX E;  5TIS H;  3A3Y B;  3G6E P;  2KS1 A;  1H0T A;  1RF1 C;  2WPV B;  3RGU A;  2K9Y A;  4U7J A;  2O1K A;  2IX7 C;  4H0L C;  3H25 A;  3CC2 P;  2W83 C;  1RF0 A;  1RQV A;  2FXO A;  5APV A;  3L72 D;  1G2C A;  1K9M Q;  2GA1 A;  1KZU B;  3HUS A;  3FGA D;  2AXT H;  3U59 A;  3L75 G;  1CW5 A;  1ZRT E;  3AE3 C;  3GF3 A;  1OW6 A;  3L35 A;  1URQ A;  2R44 A;  1NTK G;  1S9K E;  3TGU D;  1NO4 A;  1BE3 D;  3H1I J;  3AE5 C;  1ZP0 C;  3V2P A;  2D2C B;  1L0N G;  2ZYD A;  3U1C A;  2K3R A;  1KMI Z;  3BRT B;  5B66 H;  3N7N A;  1VQ4 P;  3NTN A;  1M1J C;  5CCH A;  1OX3 A;  2R3S A;  2WWW A;  4KHX A;  1MV8 A;  1KC8 Q;  5GTI E;  2KB7 P;  1JY2 P;  1NGM B;  2PFX A;  3VTP C;  1OWA A;  1S2E A;  2K9J A;  5GTH E;  1VQ7 P;  2V7Q H;  1M57 D;  4DJG A;  2C0W A;  3NMD A;  2JR8 A;  4R4M A;  2RH0 A;  1HJB A;  4BRY B;  1VQ6 P;  4TT3 H;  3L74 G;  3I56 P;  1T3U A;  4OGQ C;  5CHX A;  1JY2 N;  3V2R A;  2W27 A;  1EDK A;  3QH9 A;  3GMA A;  1PGQ A;  3P8M C;  1K73 Q;  3HTK B;  4HKZ H;  2P10 A;  3V4W A;  2ZXE B;  1VF5 D;  2YNY A;  1RQU A;  4LC1 A;  1JMM A;  1SQV J;  3H1K G;  1VQM P;  1SQV K;  3RL0 B;  2MKV A;  5AVU B;  1JTH A;  3L73 G;  1N7S D;  1SQP G;  1EZV G;  2P7J A;  5KJ7 A;  2W8Z A;  2BEZ F;  4IL6 E;  4N3Y B;  3CWB G;  2A45 G;  1R5L A;  5CCG C;  2OGU A;  3H1I D;  4JYB A;  1N73 B;  3IF4 A;  4DZO A;  4QMA A;  2C0X A;  3M0A A;  1KYO E;  3Q5P A;  2RN0 A;  1S5L E;  3HE4 A;  2WQY C;  5AW8 B;  4C7N A;  1BDC A;  3V2Q A;  5APW A;  2KK7 A;  3IAO A;  4PJ0 H;  1W2E A;  4N6J A;  1M1K Q;  1FDO A;  2ZYG A;  1X0T A;  1URQ D;  4EYY Q;  1ZR4 A;  3CLQ A;  2YXQ B;  5CJ4 A;  1HJ0 A;  1LWU A;  3TK1 A;  3AED C;  3WU2 E;  3CD6 P;  3KXD A;  1KYO I;  1LP1 A;  2C9L Y;  1NTZ J;  2E5Y A;  3RL0 g;  3H1J G;  2H43 A;  4LGD E;  1NTZ K;  5CCH D;  3G4S P;  1DX7 A;  4I1L A;  1IO4 A;  1BGY J;  3L70 J;  5KLV G;  1M1J B;  2E75 D;  3TYY A;  1SQV D;  2KIK A;  1J2J B;  3RBX A;  1HTL C;  1SQB E;  4H13 D;  1SS1 A;  3O8Z A;  1QL2 A;  5KAF H;  1G1I A;  1USE A;  1VQL P;  1JY2 O;  2PGD A;  2KYV A;  1M90 Q;  2OYH C;  1SFC C;  1AQ5 A;  3A0B E;  1GW4 A;  5K5G B;  3AE1 C;  3CX5 E;  3KHU A;  3SWF A;  1SQB J;  4OGQ B;  2IBZ E;  3LIE A;  3L36 A;  3EFF K;  1RF1 A;  1YIJ P;  4KJM A;  3RK3 C;  4MN4 C;  4KT0 J;  4H44 D;  4DCK A;  1PP9 E;  3N4X A;  1N7L A;  4TLF A;  1T6A A;  2J59 M;  2H8P D;  2WVR A;  1N8R Q;  1DEE G;  3TDK A;  5KJ7 D;  1W2B O;  5KKZ C;  4RJT A;  3HE5 B;  3CX5 I;  2HPC A;  2BCC J;  3AE2 C;  2FYZ A;  1FU1 A;  2PP6 A;  3E7K A;  1NTZ D;  3KPE A;  3MIW A;  2GUS A;  2IBZ I;  1Q90 D;  2H88 C;  2YIU C;  2N9Y B;  1SQQ K;  1LT9 A;  1BGY D;  3L70 D;  1GMJ A;  2NPS C;  3H32 B;  3MUD C;  5H2F H;  1H89 A;  2FXM A;  1IFP A;  1NU1 E;  1TU3 F;  2A06 D;  1LTJ A;  2JWA A;  4EDF A;  2WTY A;  3H1L G;  1CI6 B;  1HH0 A;  3IR9 A;  2FFD C;  3BAS A;  3B71 A;  3LW5 H;  3FXD A;  1NVO A;  2C9N Y;  1R8E A;  1FE6 A;  2XZR A;  1VPC A;  3L71 J;  1NU1 J;  2QE7 H;  4D6T J;  1SQB D;  4WB4 A;  4EOT A;  1IZN B;  5AW1 B;  4AUW A;  1L0L G;  2ZXX A;  2GUV A;  2FYN C;  1YJ9 P;  3JCU H;  3G71 P;  4GOD A;  1FC2 C;  5APU A;  1JY3 P;  2XU6 A;  5AVV B;  3H1H G;  3L75 E;  1OIP A;  1FJK A;  2IZ1 A;  4WY4 C;  4I2L C;  2AEM A;  2FYU J;  1SLQ A;  2ZT9 D;  3Q2Y A;  4ZKP A;  2QIW A;  3M0D A;  4NPD A;  2FYU K;  1BCC G;  1RE4 C;  1DH3 A;  1GU5 A;  3C1L A;  2IZ0 A;  1FS0 E;  1IFN A;  1JY3 N;  2K1A A;  2BCC D;  2W6A A;  2OYH B;  4W7Y A;  1SFC B;  2ZAE B;  4GT1 A;  2Y0D A;  1ZOY C;  1PPJ G;  2FXP A;  1L0N E;  1NOH A;  4H0L D;  4RKU J;  1RE3 A;  3RK3 B;  3HD7 C;  2OYI A;  5B5E E;  1S72 P;  1L4A C;  3NFQ A;  2YO2 A;  4OVN F;  3WUU A;  2CK3 H;  3V2N A;  1L0N J;  1M56 D;  1USD A;  1Y47 A;  2G8Y A;  5KKZ B;  2DW3 A;  1X79 B;  4AQR D;  1JM0 A;  2N9B A;  3OAK A;  4PV1 D;  3TNU B;  1SQQ G;  3L74 E;  1KQS O;  3L71 D;  4D6T D;  2Y9Y A;  2B87 B;  2W6J H;  3AEE C;  1GD2 E;  2Q5U A;  2YIU B;  2YKQ A;  2Y9Z A;  1X9V A;  1AVY A;  1GL2 C;  2NPS B;  2FY8 A;  1KB9 I;  3H1K E;  1JEK A;  4ASV A;  1K05 A;  2M5A A;  1LTA C;  2FYU D;  3L73 E;  1SQP E;  1PL5 A;  3CPW O;  1EZV E;  2OTJ P;  4B86 A;  4O9B A;  4U3F G;  2FFD B;  3B5N C;  1KFN A;  3GLM A;  3KZI H;  5L8R J;  4OGQ D;  3BRV B;  1NTM J;  2KNC A;  1KIL C;  2KOG A;  3ZDM A;  1DD3 A;  5KTB A;  1NTM K;  2QSI A;  1OXZ A;  2FYN B;  3VOP A;  1P84 E;  1FZC A;  1AFO A;  1SQX J;  4XA4 A;  1SQX K;  1FJP A;  1EQ7 A;  4WY4 B;  1EZV I;  5AVS B;  3WUT A;  4LLH A;  1VQK P;  2A45 I;  3RK3 E;  2ZFC A;  4GOF A;  1ZLL A;  4L74 A;  1NWQ A;  3RK2 D;  5APX A;  1IC2 A;  1KB9 D;  3H1J E;  5DJU B;  1JUN A;  2QRX A;  3L72 G;  3CCM P;  3Q5R A;  5KLV E;  1P84 I;  2N1T C;  1HGZ A;  4UB6 H;  3HD7 B;  3P8C E;  2QA4 P;  3A0H H;  2E76 D;  5E79 H;  5AVY B;  4W80 A;  1L4A B;  1JB0 J;  1GW3 A;  2UWJ E;  4EIJ A;  2O1J A;  2WPQ A;  3H1J J;  2O3J A;  2B89 A;  3BCC E;  3GHG C;  3MUD A;  2POH A;  2WSE H;  4JQ0 D;  3TGU G;  2J58 A;  3AEF C;  1BE3 G;  1EDJ A;  1J1D C;  2QJP C;  3TSI A;  1NTM D;  3SFE C;  3IFM A;  4YTP C;  3EFG A;  5KAI H;  3BCC J;  3D71 A;  3Q1M A;  1JNM A;  3C9I A;  5M1B A;  1Q2N A;  1SQX D;  2WSS H;  1GL2 B;  1FZB A;  3EQ2 A;  3S9O A;  2YO3 A;  5AW4 B;  3VN0 A;  3M9H A;  2WSF J;  4AYC A;  1QL1 A;  1Q81 Q;  2YMK A;  4Y28 J;  4WY4 A;  2M3E A;  2KZI A;  1HBW A;  1LTI C;  2G3A A;  3B5N B;  1U7J A;  1DEB A;  1ZRT D;  2Z5H A;  2KUB A;  3CCS P;  2ZJS E;  3I5C A;  1KB9 H;  1KIL B;  1J1E C;  4UB8 E;  1S9K D;  2KSE A;  1MZ9 A;  1YQ3 C;  1XTG B;  1FAV A;  1LTB C;  1YJW P;  2J5U A;  1OW7 A;  3OW2 O;  4RO0 A;  1S3J A;  3KYQ A;  3H1L E;  1L4A A;  1QVG O;  3H1I G;  3M91 A;  2WSC J; 
#chains in the Genus database with same CATH homology
 3H32 B;  1CZQ A;  1H89 A;  2JJL A;  2XNX A;  2FXM A;  1T2K D;  1XTC C;  4Y99 B;  2HG5 D;  3M9B A;  2N1T D;  1LTJ C;  4HYT B;  1LTJ A;  2WTY A;  2R5D A;  1NKZ B;  3MTU E;  3OA7 A;  1WT6 A;  1CI6 B;  3U1A A;  2YKO A;  3VYI A;  1HH0 A;  3IR9 A;  5KLV K;  2FFD C;  3BAS A;  3HTK A;  2N1T B;  2FFD A;  5AVQ B;  3LW5 H;  3M06 A;  1LWU B;  2C9N Y;  1MFZ A;  2P2U A;  4M3L A;  2XZR A;  1VPC A;  3CL3 D;  5AW0 B;  2GM4 A;  1YTZ I;  3BVH A;  1GL2 A;  2Q3I A;  4WB4 A;  4EOT A;  1GK6 A;  4N78 D;  1SP4 A;  1FOS E;  5AVT B;  3GHG B;  4WBA A;  5APT A;  5AW1 B;  3HRN A;  3RL0 C;  2WT7 B;  4AUW A;  2L5G B;  2R5B A;  2Z4E A;  1FBM A;  2GUV A;  2Z5I A;  3A7O A;  1IJD B;  3MD0 A;  1NH4 A;  5APU A;  1JY3 P;  2XU6 A;  5AW3 B;  5AVV B;  1N73 C;  1J1D B;  1X8Y A;  1A02 J;  1N73 A;  1N7S C;  3VP8 A;  1N7S A;  1FJK A;  4WY4 C;  3A3Y B;  1SQB K;  4I2L C;  1IK9 A;  1RF1 C;  2HOD A;  1G1J A;  4XE5 B;  1SLQ A;  1JCD A;  1IFI A;  1PFI A;  2LKM A;  1SFC D;  3M0D C;  3M0D A;  4ZKP A;  2FYU K;  2O1K A;  2IX7 C;  1RE4 C;  1DH3 A;  1GU5 A;  1MUU A;  1RE4 A;  1IFN A;  1RF0 A;  5AVW B;  1JY3 N;  5BU8 B;  5APV A;  4JYC A;  2W6A A;  2OYH B;  4W7Y A;  1T8Z A;  4WY4 D;  2YKP A;  1SFC B;  1G2C A;  3L37 A;  3HUS C;  1KZU B;  2Q7C A;  3HUS A;  4GT1 A;  2WZ7 A;  5CMZ A;  3RK3 D;  3U59 A;  3RK2 C;  2CPB A;  2KLV A;  1CW5 A;  4IFF A;  1NOH A;  2KP8 A;  2WIT A;  1LTT C;  4C46 A;  2P1J A;  1RF1 B;  1RE3 C;  2IFN A;  4OH8 B;  1RE3 A;  3RK3 B;  2XDJ A;  1URQ C;  3HD7 C;  3L35 A;  1URQ A;  3HD7 A;  2OYI C;  2OYI A;  1L4A C;  1S9K E;  4HH2 A;  3NFQ A;  2JEE A;  1NO4 A;  2YO2 A;  2E42 A;  2FKW B;  1NHL A;  3V2N A;  3SWY A;  3V2P A;  1HVV A;  1GZL A;  1LTG C;  3P8C D;  3VP9 A;  1J1E B;  3U1C A;  1X79 B;  2VRS A;  4AQR D;  2N9B A;  3BRT B;  2IFM A;  1KFM A;  3OAK A;  5APS A;  3VMZ A;  3TNU B;  3N7N A;  3NTN A;  1M1J C;  5AW6 B;  1M1J A;  5CCH C;  2HPC B;  5CCH A;  3M9Q A;  2P67 A;  4C7R A;  2WWW A;  1GD2 E;  4KHX A;  2NPS D;  2Q5U A;  2WSF H;  1ZR2 A;  1MV8 A;  1A02 F;  2YKQ A;  2KB7 P;  1JY2 P;  1HUC A;  1LT9 B;  1X9V A;  3VTP C;  1OWA A;  1ZV8 A;  2WT7 A;  2A45 H;  2WPS A;  2C0W A;  3NMD A;  1GL2 C;  1KQL A;  2NPS B;  1HJB A;  2M8R A;  2PAJ A;  2H7H A;  5BU5 A;  1YYC A;  1NU1 K;  1N2D C;  1LTA C;  1T3U A;  1L0L K;  1LTJ B;  5CHX A;  5AW5 B;  1JY2 N;  3V2R A;  2W27 A;  4B86 A;  4N78 E;  5APY A;  3B8E B;  1GL2 D;  3P8M C;  4O9B A;  3HTK B;  2FFD B;  3B5N C;  3V4W A;  3UIA A;  2ZXE B;  1KFN A;  3B5N A;  3VMX A;  3RL0 D;  2YNY A;  4LC1 A;  1JMM A;  2W6B A;  3BRV B;  1IFJ A;  1GDT A;  1KIL C;  2KOG A;  1KIL A;  2BAS A;  1SQV K;  5KTB A;  3RL0 B;  1NTM K;  1RF0 C;  5AVU B;  1JTH A;  1N7S D;  3LID A;  3A2A A;  1OXZ A;  3G3Z A;  3HE5 A;  3VOP A;  4IFD K;  5KJ7 C;  2P7J A;  2YMY A;  2XKM A;  3V4Q A;  5KJ7 A;  1FZC C;  1FZC A;  1AFO A;  5APQ A;  4N3Y B;  2A45 G;  2HFE D;  5CCG C;  4XA4 A;  5CCG A;  4JYB A;  1N73 B;  1N7S B;  4DZO A;  1SQX K;  1FJP A;  1EQ7 A;  2C0X A;  4WY4 B;  3M0A A;  5AVS B;  2I1J A;  4LLH A;  3A5T A;  4JF7 A;  3BAT A;  2A45 I;  3HE4 A;  2WPR A;  2ZFC A;  1H88 A;  5AW8 B;  3VMY A;  4C7N A;  1ZLL A;  1FZE A;  4GKG A;  1NWQ A;  3RK2 D;  3V2Q A;  3H32 A;  1NKN A;  5APW A;  5APX A;  5CJ0 A;  4Y99 C;  1IC2 A;  1G2C B;  1W2E A;  4N6J A;  3HUS B;  1CSB A;  3KQG A;  1L0N K;  1JUN A;  1URQ D;  3HD7 D;  1SVF A;  3RK2 B;  1ZR4 A;  1CI6 A;  1L4A D;  1IFM A;  1T2K C;  2Q9I A;  3CLQ A;  2N1T C;  2QM7 A;  1HGZ A;  2N1T A;  2M3B A;  3P32 A;  1M7L A;  1URQ B;  3HD7 B;  5AVR B;  1LWU C;  3P8C E;  2OYI B;  5CJ4 A;  1LWU A;  3TK1 A;  4I6M C;  5AVY B;  1NAF A;  4W80 A;  1L4A B;  1Z56 A;  1GW3 A;  4EIJ A;  2O1J A;  2WPQ A;  3NXS A;  4DOJ A;  5AVZ B;  1T3J A;  2C9L Y;  3GHG C;  3MUD A;  3GHG A;  5AVX B;  2H43 A;  2POH A;  4LGD E;  1NTZ K;  2WSE H;  1FOS F;  5CCH D;  2MJZ A;  1DX7 A;  2R32 A;  2J58 A;  4I1L A;  1IO4 A;  3T97 A;  5AW9 B;  1GK4 A;  1J1D C;  3CI9 A;  2KSJ A;  1M1J B;  3TYY A;  2XV5 A;  3WMM 0;  3TSI A;  1J2J B;  3IFM A;  1GTW A;  2CPS A;  1IFD A;  3EFG A;  1HTL C;  3II6 A;  1LGH B;  1HWT C;  1FZF A;  1JNM A;  1GU4 A;  1HGV A;  3C9I A;  3O8Z A;  1QL2 A;  1G1I A;  1WRG A;  1LTS C;  1JY2 O;  2KYV A;  2I1K A;  3KDP B;  2OYH C;  1GL2 B;  2HLO A;  2OYH A;  2IPP A;  1FZB A;  3EQ2 A;  1SFC C;  1AQ5 A;  1SFC A;  2YO3 A;  4GIF A;  1GW4 A;  5AW4 B;  3VN0 A;  3M9H A;  4AYC A;  3SWF A;  1QL1 A;  3B5N D;  1SQP K;  3LIE A;  4WY4 A;  3L36 A;  5BVZ A;  1RF1 A;  2QM8 A;  3RK3 C;  1HBW A;  2WSC H;  1LTI C;  2E43 A;  1JY3 O;  3B5N B;  2R3C A;  1KIL D;  1DEB A;  4RES B;  1E5W A;  3N4X A;  1N7L A;  3R2P A;  2O01 H;  2HOD B;  5AW2 B;  2J59 M;  2Z5H A;  2H8P D;  1NTK K;  3I5C A;  5KJ7 D;  3E1I A;  1KIL B;  3MGN A;  1FZA A;  1J1E C;  1S9K D;  5CCG D;  1MZ9 A;  1JTH B;  3P7K A;  1XTG B;  1FAV A;  1FZG A;  3HE5 B;  1LTB C;  2OAR A;  3TNU A;  3PP5 A;  1JCC A;  3L4F A;  1ZN5 A;  1FZC B;  3V5B A;  2HPC A;  1JO5 A;  1JOC A;  3KYQ A;  5AW7 B;  2FYZ A;  1FU1 A;  2PP6 A;  3KPE A;  3MIW A;  4ZKU A;  1RY3 A;  2GUS A;  1L4A A;  3H6P A;  1FDM A;  1VDF A;  1N86 A;  3OJA B;  1SQQ K;  4W7Z A;  1H8A A;  1LT9 C;  1LT9 A;  3HE4 B;  4IFM A;  3M91 A;  4C7N B;  2NPS C;  1YTZ T;  2NPS A;  2HYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...