1YTZT

Crystal structure of skeletal muscle troponin in the ca2+-activated state
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
90
structure length
90
Chain Sequence
b'SYSSYLAKADQKRGKKQTARETKKKVLAERRKPLNIDHLNEDKLRDKAKELWDWLYQLQTEKYDFAEQIKRKKYEIVTLRNRIDQAQKHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Troponin T
publication title Ca2+-regulated structural changes in troponin
pubmed doi rcsb
source organism Gallus gallus
molecule tags Contractile protein
total genus 34
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2005-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.350 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ytzT00
1J1EC 1J1EB 1J1DC 1YTZI 1J1DB 1YTZT 4Y99C 4Y99B
chains in the Genus database with same CATH superfamily
4WWIA 1MUUA 1OW6A 1VQOP 3MUDC 2N1TA 1Q81Q 5B5EE 3O6QB 1JEKA 1KQFB 3H25A 2OYHA 1MFTA 3AE6C 4H44B 3L74E 1HGVA 5GTIH 4WY4C 3I55P 4GODA 1K9MQ 5KKZB 2ZYGA 1BE3G 1ZXGA 4ZKPA 3L71J 1SQXD 5CHXA 1R5SA 1KTMA 3I5CA 3LW5J 1NTME 2ZYDA 4H0LB 1EQ7A 2B89A 1HUCA 5CCHC 3KZIH 3P8CE 1RH5B 2NPSD 2FKWB 5KJ7C 1GK6A 1SS1A 1CZQA 2AEMA 1FOSF 4H44C 1NVOA 3AE3C 1K8AQ 3RL0B 2MKVA 1LNQA 3E1IA 4Z1MH 5KKZC 1SQBD 4R4MA 1SFCA 3H1KD 2BCCG 2WZ7A 2Y0CA 1JMMA 1YTZT 2K9JB 2N1TD 4ZMDA 1JO5A 1ZP0C 4EI2A 2W6AA 3BRTB 4H0LC 4KT0J 2KNCB 2P7JA 3T97B 3EFFK 2JKVA 2IBZI 2QJYB 2GM4A 3CCQP 4WVZA 3L75G 1LTJB 3AE8C 5AVSB 2KZJA 1PL5A 1PPJG 3RL0C 1JCCA 3MHVA 1NGMB 1IC2A 1AVOA 1D7MA 1L0NE 2FYUD 1PP9J 1K05A 1N7SA 5APVA 3FWLA 4W7YA 5AVWB 1FJPA 3RK2D 2QJYC 1A02J 2H7HA 2AEFA 1JY2N 1LTJC 3SFDC 1BSHA 5AVQB 1NHLA 1S2EA 1URQB 2V7QH 1QEXA 4H13B 3WUVA 1SFCD 2FFDB 3FGAD 4HB1A 4HYTB 5C39A 2A45G 3L73G 1M1JB 3FXDA 3HD7B 4YXWH 3CPWO 2YIUB 1GD2E 1U7JA 1BCCG 3V2PA 2C0XA 3EWKA 1LP1A 1L4AA 3VMZA 1LWUB 1URQC 3CD6P 4JPZB 3GW6A 5APQA 2FFDC 1HJBA 5DJUB 1VQ5P 2SPZA 1M1JC 1T6AA 1N7SD 3H1JJ 1SQPD 1KD1Q 5AW9B 2WITA 2YKQA 5CBOA 3Q3DA 2YIUC 2JEEA 3PHLA 2W27A 1HH0A 1LT1A 2IYOA 1YIJP 1G2CB 3S9OA 3B4SA 3P32A 1ZR4A 1M90Q 3CC2P 3CCUP 2P67A 1LWUC 1BGYG 1Q82Q 5AVVB 1IFIA 3CCLP 2YO2A 1Z56A 2IYPA 2A45H 2K9YA 3AEGC 1S5LX 1H88A 2WSSH 4OH8B 1NU1J 3TDKA 1T2KC 3P8CD 3CXHI 4D6TG 1LTBC 1L4AD 1CW5A 1A02F 3W67A 1IFJA 3P8MC 2H89C 4B86A 4JQ0D 3H1HE 1FZCA 5TJHA 3U59A 1AFOA 2J5UA 1H8AA 3D6ZA 4PD4H 4PV1B 2FBWC 3L73J 4NPEA 1HWTC 5AW6B 1EZVE 4RKUJ 3MTUE 1FDOA 1PIXA 2WQYC 3M0AA 2E76D 4OGQD 5GTIE 2HPCB 5KAFH 3V5BA 1T8ZA 1RF0A 1KILA 1RE3C 3H1LJ 3RGUA 1EDLA 2WSCJ 3CWBG 3EQ2A 3L70G 3H1IG 1NTKK 1WT6A 3BCCE 1KV4A 1SQQE 1L0ND 3KZIE 1MFZA 4PV1C 1GMJA 3CLQA 2ZXXA 2H8PD 5TISH 1NTKG 4UB8E 2LKMA 4L74A 2D2CC 3KPEA 5KTBA 5APWA 1NTZJ 2KI7B 1L0LE 2O01H 2AXCA 1QLED 3CCSP 1S4XA 3V6IA 2G3AA 2FY8A 3RBZA 2WSFH 1AVYA 2LXBA 3L35A 4BWNA 3CCRP 4GIFA 4IL6E 2P1JA 1LTTC 1X0TA 1PFIA 1SQVJ 3WMM0 2B87B 3H1ID 3R2PA 2C0WA 3OW2O 2IZ1A 3TK1A 3R4YA 1KILD 4D6TJ 2PP6A 1LTGC 2OGUA 1BE3E 2XU6A 2W8ZA 3AE2C 3S1KA 1IO4A 2IX7C 3SSUA 3MP7B 2JR8A 4L76A 2Z5IA 2KS1B 1USDA 1N8RQ 1VQNP 3K5BA 1VF5D 1FZBA 2M3BA 3L71G 1LT9A 1LTSC 3BATA 2A06G 1H89A 3HE5A 1QGKB 1BDCA 2K88A 1ZRTE 1CSBA 3C1LA 2H43A 2J58A 3L72D 2BCCE 1JUNA 3TGUJ 4DOJA 3KHUA 2QA4P 2RMZA 2E75B 4JYCA 2OYOA 2PGDA 2B9BA 2Y0EA 2IBZG 3ABVC 2XV5A 1QVGO 3L75E 3A2AA 1GL2B 1NAFA 4OWFA 1PPJE 5KLVK 1N73B 3HTKB 4UB6H 3S4RA 5BU8B 3JSVC 2GA1A 1PGQA 3MUDA 2H88C 3H1HD 3L36A 2G8YA 5KLVG 3P7KA 2E75C 3CMEP 2OYIB 2QEXP 2FXPA 1CI6A 2NPSB 1KORA 1EZVD 3CCEP 1PP9G 4WY4A 1GL2C 3HE4B 3GG2A 3LW5H 1N73C 1J1EB 4C7NA 2Z5HA 4NPDA 3QWOC 3V2QA 2IDBA 3O6QA 2XDJA 2N1TB 1P84I 3BCCD 1BCCE 2UWJE 2OYIC 1SQQD 1RE4A 1S9KE 2NPSC 3USSA 3VP8A 1AJYA 5AVYB 1JB0J 2OYHB 2ZJSE 1EDJA 1GW4A 2WMMA 4GOEA 1YJ9P 1VQ6P 1FS0E 3CMAP 2N9YB 1J1EC 1YJNP 3GLMA 3WUUA 2W6BA 2ZVNB 1L0LD 4PD4E 3CX5H 2M0BA 1VQ4P 2M5AA 2N1TC 4YTPC 2HODB 4AUWA 2QM7A 2Q9IA 3B5NB 4UB8H 1OXZA 4U3FJ 2K3RA 5KAFE 1KYOH 4WY4D 3CC4P 1X79B 3N7NA 3RK2B 2E74D 1XTCC 2OYHC 5L8RJ 3H1JG 1NYHA 2Y0DA 1BGYE 3Q2YA 4GDOA 3NFQA 3L37A 4I7ZB 2K9JA 1BE3D 5CCGA 4ZNCA 2KNCA 3T97A 1ZLLA 3A0BH 4IL6H 3AE4C 2M3EA 5AW7B 2YMKA 2AEJA 1NU1K 1NKZB 5TISE 5KLVJ 3B5NC 2FXOA 4D6TE 1LTIC 3RK2C 2RH0A 2AXTH 1OIPA 2XZRA 1FZGA 2FYNB 4M3LA 1JTHB 3HUSA 2WTYA 1PGOA 3H32B 1NU1G 4ASVA 1L2PA 3GF7A 3W68A 1JMBA 1SQXJ 4H0LD 4I7ZC 2KSJA 1ZRTD 2FXMA 4XE5B 3CI9A 4RESB 2KLUA 1N7SB 2BCCD 2R3SA 5KLIB 1HVVA 2BEZF 3FWNA 3NMDA 2Q5UA 1MKMA 3GHGA 3A0HH 3RL0D 3G4SP 1URQA 5KAIH 3AE7C 3L75D 3RL0g 2FFDA 4QMAA 2FYNC 3VOPA 1SQBJ 1M57D 1FE6A 1PPJD 3CWBE 1M1JA 1FOSE 5CJ4A 3EFGA 3H1KJ 3H1IE 3L70E 5CCGD 3HD7A 2YKPA 2C9LY 5APUA 2OTJP 1KILE 2ZT9B 1KFNA 1DD3A 2WVRA 1N7SC 1M7LA 3H1LG 1PV3A 2PFXA 5KLIC 2JDIH 4U7JA 1NTKE 2QIWA 1JY2P 3ZDMA 3KYQA 1LWUA 1DIPA 3MGNA 1L4AB 2QSIA 1NTZK 1KQGB 2FYUJ 2JP3A 1JY2O 2IFNA 1ZMEC 1USEA 3G3ZA 3II6A 3L73D 2ZT9C 1NTZG 1G2CA 2CPBA 1GU5A 1SQVK 1SLQA 3AEDC 4I2LC 1BCCD 5APTA 1URQD 3L72E 4H13D 1W5CE 2HLOA 2E76B 2IPPA 1S9KD 4UB6E 4OGQB 1Y8AA 2O01N 1L4AC 2K37A 5APXA 1FZAA 1YTZI 2XNDH 2I1KA 2OQQA 2XNXA 1SQVG 3HD7D 3SFEC 3IR9A 1EXJA 2CK3H 1FJKA 3KDPB 2V4HA 1H0TA 2YMYA 1OWAA 2ZXEB 3CCJP 1VQ7P 2BEQD 4PD4D 3AE5C 4IFDK 3IN6A 4W7ZA 5AVXB 3L71E 2KZIA 1RF1B 1EC5A 2WSCH 1SP4A 2A06E 4WB4A 2WT7A 2QE7H 1RE3A 2XKMA 2E76C 4OGQC 2JWAA 1IFNA 1JCDA 1BGYD 1N2DC 1FZCB 3CCVP 2OTLP 4KHXA 1E5WA 1OFCX 2KSEA 1T2KD 2W6JH 1OW7A 2D2CB 2IBZE 3AE9C 2QRXA 3G71P 1RF1C 2LXCB 3G6EP 3TGUG 2WSEJ 4D6TD 3L74J 1M1KQ 2YKOA 1FZEA 1NH4A 2JO1A 3CX5E 1UIXA 2QVAA 1U7MA 2R5BA 2DW3A 3N4XA 2KYVA 1J2JB 1FZCC 4W80A 5KLVE 1KB9H 3LIDA 1NTMJ 1N86A 3PJSK 1KYOE 1SVFA 3PTZA 2P58A 1PP9E 3Q5RA 1M56D 3OAKA 3Q5PA 3C9IA 1RF0C 2Y9YA 1T3JA 2JJLA 1IFMA 1IFDA 4PD4I 3A0BE 3WU2H 3CWBD 5AVUB 1NO4A 2L5GB 3L70D 4K35A 1NKNA 1J1DB 2B87A 3JC22 4GT1A 2K1AA 2AXTE 3TYYA 1NJIQ 4HJGH 3M0DC 1NTKD 3VMYA 1IK9A 1DH3A 1GZLA 2IZ0A 2OTKE 1IJDB 2W90A 1R5LA 2I1JA 2KS1A 1L0NJ 5BU5A 2VRSA 1EDKA 2Z4EA 3TNUB 4ASWA 2I8DA 3VYIA 1J1DC 1PZQA 3A0HE 5KAIE 1VQ9P 1GW3A 2QJPB 3RK3B 5AVTB 1HJ0A 3H1JE 3WUTA 1OVVA 1JY3N 3C8VA 2B88A 2GUVA 3MD0A 4U3FG 2RN0A 3GF3A 5B66E 1OVRA 1S5LH 3AECC 3BRVB 5AVZB 4YPCA 4C46A 5CBNA 1P84H 1GL2A 1VQKP 1ZN5A 4RJTA 2QJPC 3RK3C 3M91A 3L71D 3HTKA 1Q90D 3G9RA 2A06D 3AEFC 1YITP 1NU1E 1S72P 4EYYQ 4BRYA 2E5TA 1X9VA 1SQXK 1KN7A 3VMAA 4PJ0H 2OYIA 2NZ2A 5EFWB 4LGDE 4GKGA 1KFMA 3AE1C 2OARA 1SQXG 5H2FH 3SWKA 2IBZD 1Q86Q 1IFPA 2E74B 3L73E 3VN0A 1PGPA 1RQVA 1GK4A 1QVFO 5CCHA 1SQBK 1FAVA 1AQ5A 1Q2NA 5KJ7A 1BDDA 2E75D 2YNYA 2E5YA 5M1BA 3CX5D 3H1LE 3F5HA 2W83C 1GL2D 1SQBG 2N9BA 1EDIA 5KLVD 3A7OA 1UIIA 4DCKA 3H1KG 1KYOD 1E79H 5GTHH 2J59M 2E42A 1PP9D 1Q7YQ 2E74C 4N6JA 5CMZA 2C9NY 4EIJA 2FYUK 2KB7P 3SWFA 2WPVB 1YQ4C 4IOIH 3PRJA 3H1HJ 2HODA 2Y9ZA 1DD4A 1NTZE 3B5NA 1JM0A 2R5DA 2M5AB 3Q1MA 2R44A 2O1JA 2FYUG 4BXLA 1RE4C 1SFCB 5CCHD 1FZFA 2QM8A 3B71A 4C7RA 5KJ7D 1SQVE 3GMAA 1EZVI 1OMIA 1S1CX 4O9BA 1KB9E 3H6PA 1LTJA 4H44D 1DEBA 1LGHB 1W2BO 3TF5A 3BCCJ 3U1AA 1QX8A 1SQQJ 1X22A 3TSIA 2Q1KA 3CL3D 1HGZA 4HKZH 3PP5A 1IZNB 3A3YB 3D6YA 5AW5B 1JTHA 4DJGA 5AW8B 3H32A 1SFCC 3I56P 2HFED 3E7KA 3H1JD 3HUSB 2Q3IA 2RKLA 5APYA 1L0LJ 3WU2E 2POHA 3CX5I 2GUSA 1SQPK 5K5GB 2KXPB 5CCGC 4YXDC 3B5ND 4JYBA 4K3AA 3PLNA 1KYOI 1KQLA 2YXQB 3OA7A 3M9HA 1QL2A 3GHGB 3VP9A 3TGUE 1W2EA 1SQPG 3CXHD 4OVNF 5B66H 1PGJA 4Y99B 3HUSC 2IFMA 1VPCA 1BE3J 1HF9A 1NU1D 3BVHA 2P10A 1OZHA 1MZ9A 3VTPC 4N78E 1NTMK 1YJWP 2BASA 3CXHH 3L74G 1FC2C 1LP1B 5DJTB 3O8ZA 3U1CA 3JCUH 1EXIA 3GHGC 1YHQP 1GTWA 2KK7A 1HBWA 3NXSA 2V7QJ 1ZR2A 1FU1A 4H13C 1WRGA 2R3CA 2LR2A 1NTMG 4Y99C 1S5LE 1OVUA 4MN4C 3HD7C 1VDFA 2WPSA 2BCCJ 1P84E 1JNMA 1KMIZ 2MJZA 5CJ0A 3AEEC 4Y28J 1TU3F 4AQRD 2KP8A 1FDIA 3H1LD 5E79H 3V4WA 1KZUB 1G1JA 3L75J 4DT0A 1AV1A 3L4FA 3IFMA 1AA0A 4HH2A 3L74D 1OW8A 1S3JA 4L73A 4EOTA 3A5TA 1RHZB 2ZT9D 4PJ0E 5B5EH 1R8EA 5AW2B 1LTAC 4XFJA 1L0NK 2E43A 1H0TB 3UIAA 1Y9BA 3OJAB 2WPQA 1VQPP 2KUBA 1BSNA 1NTMD 2PAJA 2WSEH 1ZW0A 2HG5D 5H2FE 3CCMP 1RF1A 1NTZD 1LJ2A 1XTGB 3BASA 1IK7A 2WT7B 1MV8A 1L0NG 5BVZA 3ITKA 2Q3EA 1FDMA 1SQPJ 5AW0B 3M9QA 3PH0A 2Q6QA 1JOCA 4U3FE 1YQ3C 1HTLC 2HR3A 1SQVD 2ZFCA 3B8EB 3RK3E 2HPCA 4GOFA 2O3JA 3MZWB 3IAOA 2QG4A 1KB9D 2JWDA 4IFFA 1VQLP 5GTHE 1BCCJ 1YI2P 1KILB 1Y47A 1N7LA 5AVRB 2A45I 3F89A 4LC1A 2WPRA 1YBKA 3MIWA 2L91A 2R32A 1KQSO 4WBAA 3AEBC 2Q7CA 1OX3A 2PRRA 1KC8Q 1FBMA 1VL2A 3SWYA 5AW3B 1VQ8P 1VF5B 1DEEG 2KIKA 2WWWA 2YXRB 3VMXA 3RBXA 1SQXE 3M0DA 1KILC 1RY3A 1VQMP 5AW1B 2NRGA 1X8YA 4R4LA 4PV1D 4RO0A 4LLHA 4A7PA 3TGUD 4N3YB 1BGYJ 4AYCA 3E1RA 2KOGA 4TT3H 1DX7A 1M8OB 4JF7A 2D2CD 2ITAA 4TLFA 1K73Q 1VF5C 2M8RA 1SQBE 4N78D 1NOHA 3L72G 1U57A 3H1KE 2FYZA 3V4QA 3FXEA 1T3UA 3KQGA 2O01J 3IF4A 4ZKUA 3AEAC 4IL6X 2HYNA 1NWQA 2WSFJ 1QL1A 4NPFX 1KB9I 3QH9A 4IFMA 3TNUA 2CPSA 3CC7P 1LT9B 4L75A 1P84D 3HE5B 3M06A 1G1IA 2FYUE 1WMKA 3D71A 1NAYA 3M9BA 3H1HG 1RQUA 4DZOA 3Q5SA 1GDTA 2ZVOB 1EZVG 1AQTA 4I1LA 3CWBJ 5APSA 2KLVA 1YYCA 3L70J 2ZYAA 3H1IJ 2YO3A 3CXHE 4I6MC 3V2RA 4XA4A 1SQQK 1LT9C 1N73A 3V2NA 1ZOYC 3JCUE 2O1KA 3LIEA 2QJKB 3HRNA 4JBZA 1NTKJ 2P2UA 4CPGA 3BCCG 1JY3P 1GU4A 3D70A 1SQQG 4KJMA 1L0LK 3NTNA 5AW4B 4BRYB 2NPSA 4EDFA 4U3FD 1K04A 3KXDA 1CI6B 3HE4A 4WY4B 1JY3O 3RK3D 2ZAEB 1L0LG 1ZV8A 5E79E 3FX0A 2QJKC 4C7NB 1SQPE 3L72J
chains in the Genus database with same CATH topology
2GUSA 1MUUA 4W7ZA 1SQPK 2PP6A 1LTGC 5AVXB 5CCGC 1RF1B 2N1TA 2WSCH 2XU6A 1SP4A 3B5ND 4WB4A 2WT7A 4JYBA 1RE3A 1IO4A 1KQLA 2XKMA 3OA7A 3M9HA 2IX7C 2OYHA 1QL2A 2Z5IA 3GHGB 3VP9A 1IFNA 1W2EA 1JCDA 1HGVA 1N2DC 4WY4C 1FZCB 1FZBA 2M3BA 4KHXA 1E5WA 1LT9A 1LTSC 1T2KD 4Y99B 3HUSC 4ZKPA 3BATA 2IFMA 1VPCA 1H89A 3HE5A 5CHXA 3BVHA 3I5CA 1EQ7A 1MZ9A 3VTPC 4N78E 1RF1C 1CSBA 1HUCA 5CCHC 3P8CE 1NTMK 2H43A 2NPSD 2BASA 2J58A 1JUNA 2FKWB 5KJ7C 1GK6A 4DOJA 3O8ZA 4JYCA 1CZQA 2YKOA 3U1CA 1FZEA 1FOSF 1NH4A 3GHGC 1GTWA 1HBWA 3RL0B 2R5BA 3NXSA 3N4XA 1FU1A 2KYVA 1WRGA 2R3CA 1J2JB 2XV5A 1ZR2A 1FZCC 3E1IA 3A2AA 1GL2B 4W80A 1NAFA 1SFCA 4Y99C 3LIDA 1N86A 5KLVK 2WZ7A 1N73B 1SVFA 1JMMA 1YTZT 2N1TD 3HD7C 3HTKB 1JO5A 1VDFA 2WPSA 5BU8B 2W6AA 3BRTB 2P7JA 1JNMA 2MJZA 5CJ0A 3MUDA 4AQRD 3OAKA 2KP8A 2GM4A 3C9IA 1RF0C 1T3JA 1LTJB 3L36A 5AVSB 2JJLA 3P7KA 3V4WA 1KZUB 2OYIB 1IFMA 1G1JA 1IFDA 3L4FA 3IFMA 1CI6A 4HH2A 5AVUB 2NPSB 3RL0C 1JCCA 1NO4A 2L5GB 4WY4A 1GL2C 1IC2A 4EOTA 3A5TA 1NKNA 1J1DB 4GT1A 3HE4B 3LW5H 1LTAC 5AW2B 1N73C 1J1EB 1L0NK 2E43A 4C7NA 3UIAA 1N7SA 3OJAB 2WPQA 3TYYA 2Z5HA 5APVA 4W7YA 2PAJA 2WSEH 5AVWB 2HG5D 3M0DC 1RF1A 1FJPA 3VMYA 3RK2D 1IK9A 1DH3A 1A02J 3V2QA 1GZLA 2H7HA 1XTGB 2XDJA 1JY2N 2N1TB 3BASA 1LTJC 5AVQB 1IJDB 2WT7B 1MV8A 1NHLA 5BVZA 2OYIC 1URQB 2I1JA 1FDMA 5BU5A 1RE4A 1S9KE 1SFCD 2NPSC 2FFDB 2VRSA 5AW0B 3VP8A 5AVYB 3M9QA 2OYHB 4HYTB 2Z4EA 1JOCA 1GW4A 2A45G 3TNUB 3VYIA 1M1JB 1J1DC 1HTLC 3HD7B 2ZFCA 1GW3A 3B8EB 1J1EC 2HPCA 3RK3B 5AVTB 2W6BA 1GD2E 4IFFA 3V2PA 2C0XA 1JY3N 1KILB 2GUVA 1N7LA 2N1TC 5AVRB 3MD0A 1L4AA 2A45I 3VMZA 2HODB 4AUWA 4LC1A 2QM7A 1LWUB 2Q9IA 2WPRA 3B5NB 1OXZA 1URQC 4WY4D 5APQA 3MIWA 1X79B 3N7NA 3RK2B 2FFDC 2R32A 3BRVB 1XTCC 2OYHC 4WBAA 5AVZB 2Q7CA 4C46A 1HJBA 1GL2A 1M1JC 1N7SD 1FBMA 1ZN5A 5AW9B 3SWYA 5AW3B 2WITA 2YKQA 3NFQA 3L37A 3RK3C 3M91A 2JEEA 3HTKA 2W27A 1HH0A 2WWWA 5CCGA 3VMXA 1G2CB 3T97A 1ZLLA 3M0DA 3P32A 1KILC 1RY3A 1ZR4A 5AW7B 1X9VA 1SQXK 1NU1K 5AW1B 1NKZB 1X8YA 2P67A 1LWUC 4LLHA 3B5NC 4N3YB 2OYIA 1LTIC 3RK2C 5AVVB 4LGDE 4GKGA 1KFMA 2XZRA 4AYCA 1IFIA 1FZGA 2KOGA 4M3LA 2YO2A 2OARA 1DX7A 4JF7A 1JTHB 1Z56A 2A45H 3HUSA 2WTYA 3H32B 1H88A 4OH8B 2M8RA 2KSJA 2FXMA 4N78D 4XE5B 1T2KC 3VN0A 1NOHA 3CI9A 1GK4A 3P8CD 5CCHA 1SQBK 4RESB 1FAVA 1N7SB 2FYZA 1LTBC 1L4AD 1CW5A 1A02F 1AQ5A 3V4QA 5KJ7A 1HVVA 3NMDA 1T3UA 2YNYA 3KQGA 1IFJA 2Q5UA 3P8MC 3GHGA 4ZKUA 4B86A 3RL0D 1URQA 1GL2D 2HYNA 1FZCA 2N9BA 2FFDA 3U59A 1NWQA 1QL1A 3A7OA 1AFOA 3VOPA 1H8AA 4IFMA 3TNUA 2CPSA 1M1JA 1HWTC 1LT9B 1FOSE 2J59M 5AW6B 5CJ4A 3MTUE 3EFGA 5CCGD 3HD7A 2E42A 2YKPA 3M0AA 2C9LY 5APUA 3HE5B 3M06A 1G1IA 4N6JA 1KFNA 5CMZA 2C9NY 4EIJA 2HPCB 1N7SC 1M7LA 2FYUK 2KB7P 3SWFA 1T8ZA 3V5BA 3M9BA 1RF0A 1KILA 1RE3C 4DZOA 1JY2P 2HODA 3KYQA 1LWUA 1GDTA 3B5NA 3EQ2A 2R5DA 1NTKK 3MGNA 4I1LA 1L4AB 1WT6A 2O1JA 5APSA 1NTZK 2KLVA 1YYCA 2YO3A 4I6MC 1RE4C 1MFZA 3V2RA 4XA4A 1SQQK 1LT9C 1SFCB 1N73A 3CLQA 3V2NA 1JY2O 2H8PD 2IFNA 5CCHD 1FZFA 2O1KA 2QM8A 3G3ZA 3II6A 3LIEA 4C7RA 3HRNA 5KJ7D 2LKMA 3KPEA 1G2CA 2CPBA 5KTBA 2P2UA 4O9BA 1GU5A 5APWA 1SQVK 1SLQA 4I2LC 1JY3P 2O01H 1LTJA 3H6PA 1GU4A 5APTA 1URQD 1DEBA 1LGHB 1L0LK 3U1AA 3NTNA 5AW4B 2HLOA 1S9KD 2IPPA 2NPSA 2WSFH 3TSIA 3CL3D 1HGZA 1L4AC 3PP5A 3A3YB 5APXA 1FZAA 1YTZI 2I1KA 1CI6B 2XNXA 5AW5B 3L35A 3HD7D 3HE4A 1JTHA 3IR9A 4GIFA 1JY3O 4WY4B 2P1JA 5AW8B 3H32A 1LTTC 1SFCC 3RK3D 1FJKA 3KDPB 1PFIA 2HFED 3WMM0 2YMYA 1OWAA 1ZV8A 3R2PA 2ZXEB 3HUSB 2Q3IA 5APYA 2C0WA 4C7NB 4IFDK 2POHA 3TK1A 1KILD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J1E C;  1J1E B;  1J1D C;  1YTZ I;  1J1D B;  1YTZ T;  4Y99 C;  4Y99 B; 
#chains in the Genus database with same CATH topology
 4WWI A;  1MUU A;  1OW6 A;  1VQO P;  3MUD C;  2N1T A;  1Q81 Q;  5B5E E;  3O6Q B;  1JEK A;  1KQF B;  3H25 A;  2OYH A;  1MFT A;  3AE6 C;  4H44 B;  3L74 E;  1HGV A;  5GTI H;  4WY4 C;  3I55 P;  4GOD A;  1K9M Q;  5KKZ B;  2ZYG A;  1BE3 G;  1ZXG A;  4ZKP A;  3L71 J;  1SQX D;  5CHX A;  1R5S A;  1KTM A;  3I5C A;  3LW5 J;  1NTM E;  2ZYD A;  4H0L B;  1EQ7 A;  2B89 A;  1HUC A;  5CCH C;  3KZI H;  3P8C E;  1RH5 B;  2NPS D;  2FKW B;  5KJ7 C;  1GK6 A;  1SS1 A;  1CZQ A;  2AEM A;  1FOS F;  4H44 C;  1NVO A;  3AE3 C;  1K8A Q;  3RL0 B;  2MKV A;  1LNQ A;  3E1I A;  4Z1M H;  5KKZ C;  1SQB D;  4R4M A;  1SFC A;  3H1K D;  2BCC G;  2WZ7 A;  2Y0C A;  1JMM A;  1YTZ T;  2K9J B;  2N1T D;  4ZMD A;  1JO5 A;  1ZP0 C;  4EI2 A;  2W6A A;  3BRT B;  4H0L C;  4KT0 J;  2KNC B;  2P7J A;  3T97 B;  3EFF K;  2JKV A;  2IBZ I;  2QJY B;  2GM4 A;  3CCQ P;  4WVZ A;  3L75 G;  1LTJ B;  3AE8 C;  5AVS B;  2KZJ A;  1PL5 A;  1PPJ G;  3RL0 C;  1JCC A;  3MHV A;  1NGM B;  1IC2 A;  1AVO A;  1D7M A;  1L0N E;  2FYU D;  1PP9 J;  1K05 A;  1N7S A;  5APV A;  3FWL A;  4W7Y A;  5AVW B;  1FJP A;  3RK2 D;  2QJY C;  1A02 J;  2H7H A;  2AEF A;  1JY2 N;  1LTJ C;  3SFD C;  1BSH A;  5AVQ B;  1NHL A;  1S2E A;  1URQ B;  2V7Q H;  1QEX A;  4H13 B;  3WUV A;  1SFC D;  2FFD B;  3FGA D;  4HB1 A;  4HYT B;  5C39 A;  2A45 G;  3L73 G;  1M1J B;  3FXD A;  3HD7 B;  4YXW H;  3CPW O;  2YIU B;  1GD2 E;  1U7J A;  1BCC G;  3V2P A;  2C0X A;  3EWK A;  1LP1 A;  1L4A A;  3VMZ A;  1LWU B;  1URQ C;  3CD6 P;  4JPZ B;  3GW6 A;  5APQ A;  2FFD C;  1HJB A;  5DJU B;  1VQ5 P;  2SPZ A;  1M1J C;  1T6A A;  1N7S D;  3H1J J;  1SQP D;  1KD1 Q;  5AW9 B;  2WIT A;  2YKQ A;  5CBO A;  3Q3D A;  2YIU C;  2JEE A;  3PHL A;  2W27 A;  1HH0 A;  1LT1 A;  2IYO A;  1YIJ P;  1G2C B;  3S9O A;  3B4S A;  3P32 A;  1ZR4 A;  1M90 Q;  3CC2 P;  3CCU P;  2P67 A;  1LWU C;  1BGY G;  1Q82 Q;  5AVV B;  1IFI A;  3CCL P;  2YO2 A;  1Z56 A;  2IYP A;  2A45 H;  2K9Y A;  3AEG C;  1S5L X;  1H88 A;  2WSS H;  4OH8 B;  1NU1 J;  3TDK A;  1T2K C;  3P8C D;  3CXH I;  4D6T G;  1LTB C;  1L4A D;  1CW5 A;  1A02 F;  3W67 A;  1IFJ A;  3P8M C;  2H89 C;  4B86 A;  4JQ0 D;  3H1H E;  1FZC A;  5TJH A;  3U59 A;  1AFO A;  2J5U A;  1H8A A;  3D6Z A;  4PD4 H;  4PV1 B;  2FBW C;  3L73 J;  4NPE A;  1HWT C;  5AW6 B;  1EZV E;  4RKU J;  3MTU E;  1FDO A;  1PIX A;  2WQY C;  3M0A A;  2E76 D;  4OGQ D;  5GTI E;  2HPC B;  5KAF H;  3V5B A;  1T8Z A;  1RF0 A;  1KIL A;  1RE3 C;  3H1L J;  3RGU A;  1EDL A;  2WSC J;  3CWB G;  3EQ2 A;  3L70 G;  3H1I G;  1NTK K;  1WT6 A;  3BCC E;  1KV4 A;  1SQQ E;  1L0N D;  3KZI E;  1MFZ A;  4PV1 C;  1GMJ A;  3CLQ A;  2ZXX A;  2H8P D;  5TIS H;  1NTK G;  4UB8 E;  2LKM A;  4L74 A;  2D2C C;  3KPE A;  5KTB A;  5APW A;  1NTZ J;  2KI7 B;  1L0L E;  2O01 H;  2AXC A;  1QLE D;  3CCS P;  1S4X A;  3V6I A;  2G3A A;  2FY8 A;  3RBZ A;  2WSF H;  1AVY A;  2LXB A;  3L35 A;  4BWN A;  3CCR P;  4GIF A;  4IL6 E;  2P1J A;  1LTT C;  1X0T A;  1PFI A;  1SQV J;  3WMM 0;  2B87 B;  3H1I D;  3R2P A;  2C0W A;  3OW2 O;  2IZ1 A;  3TK1 A;  3R4Y A;  1KIL D;  4D6T J;  2PP6 A;  1LTG C;  2OGU A;  1BE3 E;  2XU6 A;  2W8Z A;  3AE2 C;  3S1K A;  1IO4 A;  2IX7 C;  3SSU A;  3MP7 B;  2JR8 A;  4L76 A;  2Z5I A;  2KS1 B;  1USD A;  1N8R Q;  1VQN P;  3K5B A;  1VF5 D;  1FZB A;  2M3B A;  3L71 G;  1LT9 A;  1LTS C;  3BAT A;  2A06 G;  1H89 A;  3HE5 A;  1QGK B;  1BDC A;  2K88 A;  1ZRT E;  1CSB A;  3C1L A;  2H43 A;  2J58 A;  3L72 D;  2BCC E;  1JUN A;  3TGU J;  4DOJ A;  3KHU A;  2QA4 P;  2RMZ A;  2E75 B;  4JYC A;  2OYO A;  2PGD A;  2B9B A;  2Y0E A;  2IBZ G;  3ABV C;  2XV5 A;  1QVG O;  3L75 E;  3A2A A;  1GL2 B;  1NAF A;  4OWF A;  1PPJ E;  5KLV K;  1N73 B;  3HTK B;  4UB6 H;  3S4R A;  5BU8 B;  3JSV C;  2GA1 A;  1PGQ A;  3MUD A;  2H88 C;  3H1H D;  3L36 A;  2G8Y A;  5KLV G;  3P7K A;  2E75 C;  3CME P;  2OYI B;  2QEX P;  2FXP A;  1CI6 A;  2NPS B;  1KOR A;  1EZV D;  3CCE P;  1PP9 G;  4WY4 A;  1GL2 C;  3HE4 B;  3GG2 A;  3LW5 H;  1N73 C;  1J1E B;  4C7N A;  2Z5H A;  4NPD A;  3QWO C;  3V2Q A;  2IDB A;  3O6Q A;  2XDJ A;  2N1T B;  1P84 I;  3BCC D;  1BCC E;  2UWJ E;  2OYI C;  1SQQ D;  1RE4 A;  1S9K E;  2NPS C;  3USS A;  3VP8 A;  1AJY A;  5AVY B;  1JB0 J;  2OYH B;  2ZJS E;  1EDJ A;  1GW4 A;  2WMM A;  4GOE A;  1YJ9 P;  1VQ6 P;  1FS0 E;  3CMA P;  2N9Y B;  1J1E C;  1YJN P;  3GLM A;  3WUU A;  2W6B A;  2ZVN B;  1L0L D;  4PD4 E;  3CX5 H;  2M0B A;  1VQ4 P;  2M5A A;  2N1T C;  4YTP C;  2HOD B;  4AUW A;  2QM7 A;  2Q9I A;  3B5N B;  4UB8 H;  1OXZ A;  4U3F J;  2K3R A;  5KAF E;  1KYO H;  4WY4 D;  3CC4 P;  1X79 B;  3N7N A;  3RK2 B;  2E74 D;  1XTC C;  2OYH C;  5L8R J;  3H1J G;  1NYH A;  2Y0D A;  1BGY E;  3Q2Y A;  4GDO A;  3NFQ A;  3L37 A;  4I7Z B;  2K9J A;  1BE3 D;  5CCG A;  4ZNC A;  2KNC A;  3T97 A;  1ZLL A;  3A0B H;  4IL6 H;  3AE4 C;  2M3E A;  5AW7 B;  2YMK A;  2AEJ A;  1NU1 K;  1NKZ B;  5TIS E;  5KLV J;  3B5N C;  2FXO A;  4D6T E;  1LTI C;  3RK2 C;  2RH0 A;  2AXT H;  1OIP A;  2XZR A;  1FZG A;  2FYN B;  4M3L A;  1JTH B;  3HUS A;  2WTY A;  1PGO A;  3H32 B;  1NU1 G;  4ASV A;  1L2P A;  3GF7 A;  3W68 A;  1JMB A;  1SQX J;  4H0L D;  4I7Z C;  2KSJ A;  1ZRT D;  2FXM A;  4XE5 B;  3CI9 A;  4RES B;  2KLU A;  1N7S B;  2BCC D;  2R3S A;  5KLI B;  1HVV A;  2BEZ F;  3FWN A;  3NMD A;  2Q5U A;  1MKM A;  3GHG A;  3A0H H;  3RL0 D;  3G4S P;  1URQ A;  5KAI H;  3AE7 C;  3L75 D;  3RL0 g;  2FFD A;  4QMA A;  2FYN C;  3VOP A;  1SQB J;  1M57 D;  1FE6 A;  1PPJ D;  3CWB E;  1M1J A;  1FOS E;  5CJ4 A;  3EFG A;  3H1K J;  3H1I E;  3L70 E;  5CCG D;  3HD7 A;  2YKP A;  2C9L Y;  5APU A;  2OTJ P;  1KIL E;  2ZT9 B;  1KFN A;  1DD3 A;  2WVR A;  1N7S C;  1M7L A;  3H1L G;  1PV3 A;  2PFX A;  5KLI C;  2JDI H;  4U7J A;  1NTK E;  2QIW A;  1JY2 P;  3ZDM A;  3KYQ A;  1LWU A;  1DIP A;  3MGN A;  1L4A B;  2QSI A;  1NTZ K;  1KQG B;  2FYU J;  2JP3 A;  1JY2 O;  2IFN A;  1ZME C;  1USE A;  3G3Z A;  3II6 A;  3L73 D;  2ZT9 C;  1NTZ G;  1G2C A;  2CPB A;  1GU5 A;  1SQV K;  1SLQ A;  3AED C;  4I2L C;  1BCC D;  5APT A;  1URQ D;  3L72 E;  4H13 D;  1W5C E;  2HLO A;  2E76 B;  2IPP A;  1S9K D;  4UB6 E;  4OGQ B;  1Y8A A;  2O01 N;  1L4A C;  2K37 A;  5APX A;  1FZA A;  1YTZ I;  2XND H;  2I1K A;  2OQQ A;  2XNX A;  1SQV G;  3HD7 D;  3SFE C;  3IR9 A;  1EXJ A;  2CK3 H;  1FJK A;  3KDP B;  2V4H A;  1H0T A;  2YMY A;  1OWA A;  2ZXE B;  3CCJ P;  1VQ7 P;  2BEQ D;  4PD4 D;  3AE5 C;  4IFD K;  3IN6 A;  4W7Z A;  5AVX B;  3L71 E;  2KZI A;  1RF1 B;  1EC5 A;  2WSC H;  1SP4 A;  2A06 E;  4WB4 A;  2WT7 A;  2QE7 H;  1RE3 A;  2XKM A;  2E76 C;  4OGQ C;  2JWA A;  1IFN A;  1JCD A;  1BGY D;  1N2D C;  1FZC B;  3CCV P;  2OTL P;  4KHX A;  1E5W A;  1OFC X;  2KSE A;  1T2K D;  2W6J H;  1OW7 A;  2D2C B;  2IBZ E;  3AE9 C;  2QRX A;  3G71 P;  1RF1 C;  2LXC B;  3G6E P;  3TGU G;  2WSE J;  4D6T D;  3L74 J;  1M1K Q;  2YKO A;  1FZE A;  1NH4 A;  2JO1 A;  3CX5 E;  1UIX A;  2QVA A;  1U7M A;  2R5B A;  2DW3 A;  3N4X A;  2KYV A;  1J2J B;  1FZC C;  4W80 A;  5KLV E;  1KB9 H;  3LID A;  1NTM J;  1N86 A;  3PJS K;  1KYO E;  1SVF A;  3PTZ A;  2P58 A;  1PP9 E;  3Q5R A;  1M56 D;  3OAK A;  3Q5P A;  3C9I A;  1RF0 C;  2Y9Y A;  1T3J A;  2JJL A;  1IFM A;  1IFD A;  4PD4 I;  3A0B E;  3WU2 H;  3CWB D;  5AVU B;  1NO4 A;  2L5G B;  3L70 D;  4K35 A;  1NKN A;  1J1D B;  2B87 A;  3JC2 2;  4GT1 A;  2K1A A;  2AXT E;  3TYY A;  1NJI Q;  4HJG H;  3M0D C;  1NTK D;  3VMY A;  1IK9 A;  1DH3 A;  1GZL A;  2IZ0 A;  2OTK E;  1IJD B;  2W90 A;  1R5L A;  2I1J A;  2KS1 A;  1L0N J;  5BU5 A;  2VRS A;  1EDK A;  2Z4E A;  3TNU B;  4ASW A;  2I8D A;  3VYI A;  1J1D C;  1PZQ A;  3A0H E;  5KAI E;  1VQ9 P;  1GW3 A;  2QJP B;  3RK3 B;  5AVT B;  1HJ0 A;  3H1J E;  3WUT A;  1OVV A;  1JY3 N;  3C8V A;  2B88 A;  2GUV A;  3MD0 A;  4U3F G;  2RN0 A;  3GF3 A;  5B66 E;  1OVR A;  1S5L H;  3AEC C;  3BRV B;  5AVZ B;  4YPC A;  4C46 A;  5CBN A;  1P84 H;  1GL2 A;  1VQK P;  1ZN5 A;  4RJT A;  2QJP C;  3RK3 C;  3M91 A;  3L71 D;  3HTK A;  1Q90 D;  3G9R A;  2A06 D;  3AEF C;  1YIT P;  1NU1 E;  1S72 P;  4EYY Q;  4BRY A;  2E5T A;  1X9V A;  1SQX K;  1KN7 A;  3VMA A;  4PJ0 H;  2OYI A;  2NZ2 A;  5EFW B;  4LGD E;  4GKG A;  1KFM A;  3AE1 C;  2OAR A;  1SQX G;  5H2F H;  3SWK A;  2IBZ D;  1Q86 Q;  1IFP A;  2E74 B;  3L73 E;  3VN0 A;  1PGP A;  1RQV A;  1GK4 A;  1QVF O;  5CCH A;  1SQB K;  1FAV A;  1AQ5 A;  1Q2N A;  5KJ7 A;  1BDD A;  2E75 D;  2YNY A;  2E5Y A;  5M1B A;  3CX5 D;  3H1L E;  3F5H A;  2W83 C;  1GL2 D;  1SQB G;  2N9B A;  1EDI A;  5KLV D;  3A7O A;  1UII A;  4DCK A;  3H1K G;  1KYO D;  1E79 H;  5GTH H;  2J59 M;  2E42 A;  1PP9 D;  1Q7Y Q;  2E74 C;  4N6J A;  5CMZ A;  2C9N Y;  4EIJ A;  2FYU K;  2KB7 P;  3SWF A;  2WPV B;  1YQ4 C;  4IOI H;  3PRJ A;  3H1H J;  2HOD A;  2Y9Z A;  1DD4 A;  1NTZ E;  3B5N A;  1JM0 A;  2R5D A;  2M5A B;  3Q1M A;  2R44 A;  2O1J A;  2FYU G;  4BXL A;  1RE4 C;  1SFC B;  5CCH D;  1FZF A;  2QM8 A;  3B71 A;  4C7R A;  5KJ7 D;  1SQV E;  3GMA A;  1EZV I;  1OMI A;  1S1C X;  4O9B A;  1KB9 E;  3H6P A;  1LTJ A;  4H44 D;  1DEB A;  1LGH B;  1W2B O;  3TF5 A;  3BCC J;  3U1A A;  1QX8 A;  1SQQ J;  1X22 A;  3TSI A;  2Q1K A;  3CL3 D;  1HGZ A;  4HKZ H;  3PP5 A;  1IZN B;  3A3Y B;  3D6Y A;  5AW5 B;  1JTH A;  4DJG A;  5AW8 B;  3H32 A;  1SFC C;  3I56 P;  2HFE D;  3E7K A;  3H1J D;  3HUS B;  2Q3I A;  2RKL A;  5APY A;  1L0L J;  3WU2 E;  2POH A;  3CX5 I;  2GUS A;  1SQP K;  5K5G B;  2KXP B;  5CCG C;  4YXD C;  3B5N D;  4JYB A;  4K3A A;  3PLN A;  1KYO I;  1KQL A;  2YXQ B;  3OA7 A;  3M9H A;  1QL2 A;  3GHG B;  3VP9 A;  3TGU E;  1W2E A;  1SQP G;  3CXH D;  4OVN F;  5B66 H;  1PGJ A;  4Y99 B;  3HUS C;  2IFM A;  1VPC A;  1BE3 J;  1HF9 A;  1NU1 D;  3BVH A;  2P10 A;  1OZH A;  1MZ9 A;  3VTP C;  4N78 E;  1NTM K;  1YJW P;  2BAS A;  3CXH H;  3L74 G;  1FC2 C;  1LP1 B;  5DJT B;  3O8Z A;  3U1C A;  3JCU H;  1EXI A;  3GHG C;  1YHQ P;  1GTW A;  2KK7 A;  1HBW A;  3NXS A;  2V7Q J;  1ZR2 A;  1FU1 A;  4H13 C;  1WRG A;  2R3C A;  2LR2 A;  1NTM G;  4Y99 C;  1S5L E;  1OVU A;  4MN4 C;  3HD7 C;  1VDF A;  2WPS A;  2BCC J;  1P84 E;  1JNM A;  1KMI Z;  2MJZ A;  5CJ0 A;  3AEE C;  4Y28 J;  1TU3 F;  4AQR D;  2KP8 A;  1FDI A;  3H1L D;  5E79 H;  3V4W A;  1KZU B;  1G1J A;  3L75 J;  4DT0 A;  1AV1 A;  3L4F A;  3IFM A;  1AA0 A;  4HH2 A;  3L74 D;  1OW8 A;  1S3J A;  4L73 A;  4EOT A;  3A5T A;  1RHZ B;  2ZT9 D;  4PJ0 E;  5B5E H;  1R8E A;  5AW2 B;  1LTA C;  4XFJ A;  1L0N K;  2E43 A;  1H0T B;  3UIA A;  1Y9B A;  3OJA B;  2WPQ A;  1VQP P;  2KUB A;  1BSN A;  1NTM D;  2PAJ A;  2WSE H;  1ZW0 A;  2HG5 D;  5H2F E;  3CCM P;  1RF1 A;  1NTZ D;  1LJ2 A;  1XTG B;  3BAS A;  1IK7 A;  2WT7 B;  1MV8 A;  1L0N G;  5BVZ A;  3ITK A;  2Q3E A;  1FDM A;  1SQP J;  5AW0 B;  3M9Q A;  3PH0 A;  2Q6Q A;  1JOC A;  4U3F E;  1YQ3 C;  1HTL C;  2HR3 A;  1SQV D;  2ZFC A;  3B8E B;  3RK3 E;  2HPC A;  4GOF A;  2O3J A;  3MZW B;  3IAO A;  2QG4 A;  1KB9 D;  2JWD A;  4IFF A;  1VQL P;  5GTH E;  1BCC J;  1YI2 P;  1KIL B;  1Y47 A;  1N7L A;  5AVR B;  2A45 I;  3F89 A;  4LC1 A;  2WPR A;  1YBK A;  3MIW A;  2L91 A;  2R32 A;  1KQS O;  4WBA A;  3AEB C;  2Q7C A;  1OX3 A;  2PRR A;  1KC8 Q;  1FBM A;  1VL2 A;  3SWY A;  5AW3 B;  1VQ8 P;  1VF5 B;  1DEE G;  2KIK A;  2WWW A;  2YXR B;  3VMX A;  3RBX A;  1SQX E;  3M0D A;  1KIL C;  1RY3 A;  1VQM P;  5AW1 B;  2NRG A;  1X8Y A;  4R4L A;  4PV1 D;  4RO0 A;  4LLH A;  4A7P A;  3TGU D;  4N3Y B;  1BGY J;  4AYC A;  3E1R A;  2KOG A;  4TT3 H;  1DX7 A;  1M8O B;  4JF7 A;  2D2C D;  2ITA A;  4TLF A;  1K73 Q;  1VF5 C;  2M8R A;  1SQB E;  4N78 D;  1NOH A;  3L72 G;  1U57 A;  3H1K E;  2FYZ A;  3V4Q A;  3FXE A;  1T3U A;  3KQG A;  2O01 J;  3IF4 A;  4ZKU A;  3AEA C;  4IL6 X;  2HYN A;  1NWQ A;  2WSF J;  1QL1 A;  4NPF X;  1KB9 I;  3QH9 A;  4IFM A;  3TNU A;  2CPS A;  3CC7 P;  1LT9 B;  4L75 A;  1P84 D;  3HE5 B;  3M06 A;  1G1I A;  2FYU E;  1WMK A;  3D71 A;  1NAY A;  3M9B A;  3H1H G;  1RQU A;  4DZO A;  3Q5S A;  1GDT A;  2ZVO B;  1EZV G;  1AQT A;  4I1L A;  3CWB J;  5APS A;  2KLV A;  1YYC A;  3L70 J;  2ZYA A;  3H1I J;  2YO3 A;  3CXH E;  4I6M C;  3V2R A;  4XA4 A;  1SQQ K;  1LT9 C;  1N73 A;  3V2N A;  1ZOY C;  3JCU E;  2O1K A;  3LIE A;  2QJK B;  3HRN A;  4JBZ A;  1NTK J;  2P2U A;  4CPG A;  3BCC G;  1JY3 P;  1GU4 A;  3D70 A;  1SQQ G;  4KJM A;  1L0L K;  3NTN A;  5AW4 B;  4BRY B;  2NPS A;  4EDF A;  4U3F D;  1K04 A;  3KXD A;  1CI6 B;  3HE4 A;  4WY4 B;  1JY3 O;  3RK3 D;  2ZAE B;  1L0L G;  1ZV8 A;  5E79 E;  3FX0 A;  2QJK C;  4C7N B;  1SQP E;  3L72 J; 
#chains in the Genus database with same CATH homology
 2GUS A;  1MUU A;  4W7Z A;  1SQP K;  2PP6 A;  1LTG C;  5AVX B;  5CCG C;  1RF1 B;  2N1T A;  2WSC H;  2XU6 A;  1SP4 A;  3B5N D;  4WB4 A;  2WT7 A;  4JYB A;  1RE3 A;  1IO4 A;  1KQL A;  2XKM A;  3OA7 A;  3M9H A;  2IX7 C;  2OYH A;  1QL2 A;  2Z5I A;  3GHG B;  3VP9 A;  1IFN A;  1W2E A;  1JCD A;  1HGV A;  1N2D C;  4WY4 C;  1FZC B;  1FZB A;  2M3B A;  4KHX A;  1E5W A;  1LT9 A;  1LTS C;  1T2K D;  4Y99 B;  3HUS C;  4ZKP A;  3BAT A;  2IFM A;  1VPC A;  1H89 A;  3HE5 A;  5CHX A;  3BVH A;  3I5C A;  1EQ7 A;  1MZ9 A;  3VTP C;  4N78 E;  1RF1 C;  1CSB A;  1HUC A;  5CCH C;  3P8C E;  1NTM K;  2H43 A;  2NPS D;  2BAS A;  2J58 A;  1JUN A;  2FKW B;  5KJ7 C;  1GK6 A;  4DOJ A;  3O8Z A;  4JYC A;  1CZQ A;  2YKO A;  3U1C A;  1FZE A;  1FOS F;  1NH4 A;  3GHG C;  1GTW A;  1HBW A;  3RL0 B;  2R5B A;  3NXS A;  3N4X A;  1FU1 A;  2KYV A;  1WRG A;  2R3C A;  1J2J B;  2XV5 A;  1ZR2 A;  1FZC C;  3E1I A;  3A2A A;  1GL2 B;  4W80 A;  1NAF A;  1SFC A;  4Y99 C;  3LID A;  1N86 A;  5KLV K;  2WZ7 A;  1N73 B;  1SVF A;  1JMM A;  1YTZ T;  2N1T D;  3HD7 C;  3HTK B;  1JO5 A;  1VDF A;  2WPS A;  5BU8 B;  2W6A A;  3BRT B;  2P7J A;  1JNM A;  2MJZ A;  5CJ0 A;  3MUD A;  4AQR D;  3OAK A;  2KP8 A;  2GM4 A;  3C9I A;  1RF0 C;  1T3J A;  1LTJ B;  3L36 A;  5AVS B;  2JJL A;  3P7K A;  3V4W A;  1KZU B;  2OYI B;  1IFM A;  1G1J A;  1IFD A;  3L4F A;  3IFM A;  1CI6 A;  4HH2 A;  5AVU B;  2NPS B;  3RL0 C;  1JCC A;  1NO4 A;  2L5G B;  4WY4 A;  1GL2 C;  1IC2 A;  4EOT A;  3A5T A;  1NKN A;  1J1D B;  4GT1 A;  3HE4 B;  3LW5 H;  1LTA C;  5AW2 B;  1N73 C;  1J1E B;  1L0N K;  2E43 A;  4C7N A;  3UIA A;  1N7S A;  3OJA B;  2WPQ A;  3TYY A;  2Z5H A;  5APV A;  4W7Y A;  2PAJ A;  2WSE H;  5AVW B;  2HG5 D;  3M0D C;  1RF1 A;  1FJP A;  3VMY A;  3RK2 D;  1IK9 A;  1DH3 A;  1A02 J;  3V2Q A;  1GZL A;  2H7H A;  1XTG B;  2XDJ A;  1JY2 N;  2N1T B;  3BAS A;  1LTJ C;  5AVQ B;  1IJD B;  2WT7 B;  1MV8 A;  1NHL A;  5BVZ A;  2OYI C;  1URQ B;  2I1J A;  1FDM A;  5BU5 A;  1RE4 A;  1S9K E;  1SFC D;  2NPS C;  2FFD B;  2VRS A;  5AW0 B;  3VP8 A;  5AVY B;  3M9Q A;  2OYH B;  4HYT B;  2Z4E A;  1JOC A;  1GW4 A;  2A45 G;  3TNU B;  3VYI A;  1M1J B;  1J1D C;  1HTL C;  3HD7 B;  2ZFC A;  1GW3 A;  3B8E B;  1J1E C;  2HPC A;  3RK3 B;  5AVT B;  2W6B A;  1GD2 E;  4IFF A;  3V2P A;  2C0X A;  1JY3 N;  1KIL B;  2GUV A;  1N7L A;  2N1T C;  5AVR B;  3MD0 A;  1L4A A;  2A45 I;  3VMZ A;  2HOD B;  4AUW A;  4LC1 A;  2QM7 A;  1LWU B;  2Q9I A;  2WPR A;  3B5N B;  1OXZ A;  1URQ C;  4WY4 D;  5APQ A;  3MIW A;  1X79 B;  3N7N A;  3RK2 B;  2FFD C;  2R32 A;  3BRV B;  1XTC C;  2OYH C;  4WBA A;  5AVZ B;  2Q7C A;  4C46 A;  1HJB A;  1GL2 A;  1M1J C;  1N7S D;  1FBM A;  1ZN5 A;  5AW9 B;  3SWY A;  5AW3 B;  2WIT A;  2YKQ A;  3NFQ A;  3L37 A;  3RK3 C;  3M91 A;  2JEE A;  3HTK A;  2W27 A;  1HH0 A;  2WWW A;  5CCG A;  3VMX A;  1G2C B;  3T97 A;  1ZLL A;  3M0D A;  3P32 A;  1KIL C;  1RY3 A;  1ZR4 A;  5AW7 B;  1X9V A;  1SQX K;  1NU1 K;  5AW1 B;  1NKZ B;  1X8Y A;  2P67 A;  1LWU C;  4LLH A;  3B5N C;  4N3Y B;  2OYI A;  1LTI C;  3RK2 C;  5AVV B;  4LGD E;  4GKG A;  1KFM A;  2XZR A;  4AYC A;  1IFI A;  1FZG A;  2KOG A;  4M3L A;  2YO2 A;  2OAR A;  1DX7 A;  4JF7 A;  1JTH B;  1Z56 A;  2A45 H;  3HUS A;  2WTY A;  3H32 B;  1H88 A;  4OH8 B;  2M8R A;  2KSJ A;  2FXM A;  4N78 D;  4XE5 B;  1T2K C;  3VN0 A;  1NOH A;  3CI9 A;  1GK4 A;  3P8C D;  5CCH A;  1SQB K;  4RES B;  1FAV A;  1N7S B;  2FYZ A;  1LTB C;  1L4A D;  1CW5 A;  1A02 F;  1AQ5 A;  3V4Q A;  5KJ7 A;  1HVV A;  3NMD A;  1T3U A;  2YNY A;  3KQG A;  1IFJ A;  2Q5U A;  3P8M C;  3GHG A;  4ZKU A;  4B86 A;  3RL0 D;  1URQ A;  1GL2 D;  2HYN A;  1FZC A;  2N9B A;  2FFD A;  3U59 A;  1NWQ A;  1QL1 A;  3A7O A;  1AFO A;  3VOP A;  1H8A A;  4IFM A;  3TNU A;  2CPS A;  1M1J A;  1HWT C;  1LT9 B;  1FOS E;  2J59 M;  5AW6 B;  5CJ4 A;  3MTU E;  3EFG A;  5CCG D;  3HD7 A;  2E42 A;  2YKP A;  3M0A A;  2C9L Y;  5APU A;  3HE5 B;  3M06 A;  1G1I A;  4N6J A;  1KFN A;  5CMZ A;  2C9N Y;  4EIJ A;  2HPC B;  1N7S C;  1M7L A;  2FYU K;  2KB7 P;  3SWF A;  1T8Z A;  3V5B A;  3M9B A;  1RF0 A;  1KIL A;  1RE3 C;  4DZO A;  1JY2 P;  2HOD A;  3KYQ A;  1LWU A;  1GDT A;  3B5N A;  3EQ2 A;  2R5D A;  1NTK K;  3MGN A;  4I1L A;  1L4A B;  1WT6 A;  2O1J A;  5APS A;  1NTZ K;  2KLV A;  1YYC A;  2YO3 A;  4I6M C;  1RE4 C;  1MFZ A;  3V2R A;  4XA4 A;  1SQQ K;  1LT9 C;  1SFC B;  1N73 A;  3CLQ A;  3V2N A;  1JY2 O;  2H8P D;  2IFN A;  5CCH D;  1FZF A;  2O1K A;  2QM8 A;  3G3Z A;  3II6 A;  3LIE A;  4C7R A;  3HRN A;  5KJ7 D;  2LKM A;  3KPE A;  1G2C A;  2CPB A;  5KTB A;  2P2U A;  4O9B A;  1GU5 A;  5APW A;  1SQV K;  1SLQ A;  4I2L C;  1JY3 P;  2O01 H;  1LTJ A;  3H6P A;  1GU4 A;  5APT A;  1URQ D;  1DEB A;  1LGH B;  1L0L K;  3U1A A;  3NTN A;  5AW4 B;  2HLO A;  1S9K D;  2IPP A;  2NPS A;  2WSF H;  3TSI A;  3CL3 D;  1HGZ A;  1L4A C;  3PP5 A;  3A3Y B;  5APX A;  1FZA A;  1YTZ I;  2I1K A;  1CI6 B;  2XNX A;  5AW5 B;  3L35 A;  3HD7 D;  3HE4 A;  1JTH A;  3IR9 A;  4GIF A;  1JY3 O;  4WY4 B;  2P1J A;  5AW8 B;  3H32 A;  1LTT C;  1SFC C;  3RK3 D;  1FJK A;  3KDP B;  1PFI A;  2HFE D;  3WMM 0;  2YMY A;  1OWA A;  1ZV8 A;  3R2P A;  2ZXE B;  3HUS B;  2Q3I A;  5APY A;  2C0W A;  4C7N B;  4IFD K;  2POH A;  3TK1 A;  1KIL D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...