1YTZT

Crystal structure of skeletal muscle troponin in the ca2+-activated state
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
90
structure length
90
Chain Sequence
SYSSYLAKADQKRGKKQTARETKKKVLAERRKPLNIDHLNEDKLRDKAKELWDWLYQLQTEKYDFAEQIKRKKYEIVTLRNRIDQAQKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Troponin T
publication title Ca2+-regulated structural changes in troponin
pubmed doi rcsb
source organism Gallus gallus
molecule tags Contractile protein
total genus 34
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2005-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.350 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ytzT00
1J1EB 1YTZT 4Y99C 1J1EC 1J1DB 1YTZI 1J1DC 4Y99B
chains in the Genus database with same CATH superfamily
2W6BA 2Q7CA 2OQQA 2AXTH 1BGYG 3H1LE 2QJKC 5CCGC 1J2JB 3BATA 5KLIB 2IFNA 3LW5J 1CI6B 1L0LK 3V6IA 3T97B 4K3AA 1OWAA 1N7SA 1PGPA 1YI2P 1FJKA 1NH4A 4H0LC 1NHLA 1HGVA 1YBKA 1GDTA 3G71P 2PAJA 1KB9H 3GHGA 4OVNF 4XA4A 3PRJA 1L0LG 4L75A 3C1LA 2WPRA 1EDLA 1N73B 1AQ5A 1KQSO 1L0ND 3HE5A 3AE4C 1UIIA 2SPZA 4M3LA 1JNMA 3CWBJ 1SQVD 1YQ4C 3EQ2A 3GG2A 5AW9B 2D2CB 1S5LH 1PPJG 4XE5B 1KYOH 2GUSA 4QMAA 2OYIA 2OGUA 5CMZA 2E42A 1R8EA 4PJ0E 2OYHC 1SQQJ 1Q7YQ 1T3JA 3CCRP 3GF7A 2QE7H 1T2KD 3D6YA 3L72G 2BCCE 1NTMD 3AEDC 4GOEA 2N1TA 3JSVC 4YXDC 2HODA 3F89A 3JCUH 3ITKA 3TNUB 1P84H 4H44D 2I8DA 4AUWA 2AXCA 1IZNB 3E1RA 1NKZB 2ZAEB 4WWIA 1DD3A 1JY2N 1DEBA 3L71G 2Q3EA 5AVRB 3HRNA 5TJHA 1PP9E 1VDFA 3H1IJ 1PIXA 2CPBA 2WWWA 1GD2E 4I2LC 3AE7C 1RQVA 2FYUJ 3V2PA 3L36A 2B9BA 5CCHC 2WSEH 3M9HA 2J58A 1NTZJ 3CCSP 1SFCD 3TYYA 1JO5A 1N7LA 3VMXA 2R44A 5KLIC 3TGUG 5KAFE 3L70E 4ZKUA 1GU5A 5APXA 1LT9B 4HKZH 3TSIA 4OGQD 2NPSD 3CLQA 3SWFA 2KLVA 2Q9IA 1BSNA 4ASVA 1N73C 1JTHA 2B87B 3G6EP 1H89A 2RN0A 5B5EE 2YO3A 2R3CA 4C46A 2P58A 1KQLA 1PZQA 3KYQA 3HE4B 4YXWH 1N8RQ 3C9IA 1SQPJ 1N7SD 1MUUA 2E75B 2D2CC 3VMYA 4I6MC 2O3JA 5KTBA 3L74J 3MZWB 5BU8B 1YHQP 3L75J 1E5WA 3PHLA 4PD4D 2GM4A 1NTKK 1FZFA 1Z56A 5BVZA 1L0LE 3TK1A 3AEGC 3VYIA 3H1KJ 1K04A 4IFFA 4ZKPA 3LIDA 3IF4A 2HG5D 3VP8A 4TLFA 3MD0A 5KAIE 2BEZF 1USEA 1GTWA 2XNXA 2ZT9D 2B88A 3V5BA 3CXHD 1WT6A 3A0BE 1N86A 4W7YA 1HUCA 1JCDA 2C9NY 3CWBD 2YKOA 1SLQA 1GK4A 2M8RA 5CCHA 2N1TD 3AE6C 1NGMB 1JCCA 2A45G 3K5BA 1YQ3C 3L37A 5GTHE 1VQ4P 1IO4A 1CI6A 3T97A 2N9BA 2FYZA 2H7HA 2WSCH 4KJMA 3H1JD 1ZRTE 1SQQD 3RGUA 2QJYB 1VQ9P 4B86A 1U7JA 1L0NJ 1LT9C 1FBMA 5AW5B 1OVRA 1SQVJ 3B5NB 2OTKE 4D6TJ 2ZYGA 4L76A 1D7MA 2JWAA 2H8PD 3OJAB 1YYCA 1ZMEC 1IFJA 3BCCE 3Q3DA 2Z5HA 4WBAA 4H0LD 3H1LJ 2J5UA 4PD4H 2FXOA 2WTYA 1W2EA 2E75C 3RL0C 3LW5H 2Q6QA 2FYUD 1RE4C 1PFIA 5B5EH 1VQ8P 2WVRA 1IFPA 1VQ5P 4PV1B 2M5AA 1NTZD 3CXHH 1NAFA 2POHA 5AVYB 2KLUA 1FJPA 4O9BA 1DEEG 2W8ZA 3CC2P 1RE3A 1RHZB 1SQXK 3IFMA 2A06G 2L91A 3MGNA 3HUSB 1NAYA 3AEAC 1HTLC 1YITP 4GOFA 4DT0A 1ZR2A 4HH2A 4RESB 2H89C 2KOGA 1SQXG 3FGAD 1H8AA 3RK2B 1NOHA 3PLNA 1SQBK 3L35A 1JY2P 1S1CX 1EZVD 5APVA 1KFMA 1SQPD 5CJ4A 2BCCJ 1SQBG 4UB8H 2YMYA 1MFZA 5B66H 4ASWA 1M1JB 3M91A 4N78D 2AEMA 4N3YB 4H13C 5KJ7A 2IX7C 1PGJA 3CCMP 3CCLP 3L75D 1NTKE 2ITAA 4XFJA 1KYOD 3PJSK 3QH9A 1LT9A 2QA4P 1BCCG 1EXJA 1LTJB 2BASA 3H32B 2QJYC 1KILC 1OW6A 3FXDA 1TU3F 2B87A 3CX5D 1PP9J 4W80A 2QG4A 1BE3E 1JOCA 3H1KD 2WT7A 5GTHH 2Q1KA 3LIEA 1BDCA 3O8ZA 3B5NC 5TISE 1KC8Q 3KZIE 4IL6E 3VOPA 1L4AC 2V7QH 1OX3A 3A0HH 1LNQA 1EDIA 1CW5A 3UIAA 2XU6A 1KZUB 5DJTB 4LGDE 4JBZA 1KB9I 4AYCA 1LWUB 4DOJA 1VL2A 3L70J 1OIPA 1VF5B 1CZQA 2BEQD 5KLVE 1QEXA 2RH0A 3FWLA 3CCUP 2K9JB 5E79H 4PV1C 2XV5A 1X9VA 4U3FG 1SVFA 2HFED 3RBXA 4BWNA 2C0WA 2XNDH 3HD7B 1PGOA 1NU1E 2HYNA 4GIFA 3FXEA 1J1EB 5DJUB 2I1KA 3NFQA 1QX8A 3HUSC 3CCJP 5CJ0A 1FZAA 2IBZE 2E76D 1YTZT 1KQGB 1M7LA 1MKMA 1OW7A 2QVAA 4D6TD 1UIXA 3RK2C 3P7KA 2JDIH 5AVQB 1SQQG 2CPSA 3H1LD 1H0TB 4C7NB 1L0LJ 2KUBA 2FYNB 2VRSA 1JY3N 1P84I 2P2UA 2W90A 3CX5H 4JYCA 2XDJA 4DJGA 1M1JC 3I55P 3H1JJ 3RBZA 1JEKA 2K88A 3OAKA 1GK6A 4DZOA 3I5CA 1VQ6P 1LTJC 1G1JA 1JY2O 2FYUK 3CMAP 2A06E 4BXLA 3U1AA 4WY4D 1FDMA 5AVVB 1EDJA 3H1IG 2HPCB 4GODA 3M0AA 1SQXE 2FYUG 2A45I 1NTZK 4L74A 3H1HE 2R5BA 2FFDC 4LLHA 3AEFC 5CBOA 2I1JA 5KJ7D 3BVHA 1S72P 1HVVA 3VP9A 2Y0EA 1NTZG 3P32A 1SQBE 3JC22 1S3JA 2V7QJ 3RK3C 1GU4A 2KNCB 2Q3IA 1LWUC 4ZNCA 5CCGA 1ZOYC 2YIUB 2R3SA 1VF5C 5H2FH 1S5LX 1NVOA 2QJPB 2BCCD 1BCCE 4IL6H 3CCEP 4HB1A 3L73E 1KN7A 3M0DC 4H44B 4WB4A 5KKZB 3D71A 1VQNP 1SQPK 2JO1A 1ZLLA 3HD7C 1Q90D 2KYVA 3BCCJ 1X8YA 1T3UA 1EZVG 1J1EC 2IBZI 3HUSA 4CPGA 1NJIQ 1SQPG 1BDDA 2H43A 5AVSB 2IPPA 1QL1A 3IAOA 2C0XA 1PP9D 1JMBA 3AEEC 2P1JA 2MJZA 3L74G 4GKGA 3NMDA 3H6PA 1IFNA 3CC7P 3RL0B 1BGYE 1SFCB 1PL5A 4R4MA 1ZP0C 2QM8A 4BRYB 1KILE 1M1JA 1H88A 2FYNC 2OYHA 4IFMA 3H1KG 1J1DC 1S4XA 4U3FE 1RF0C 3V2RA 2R5DA 3P8MC 3L70D 1S9KE 4OGQB 2NPSB 1R5LA 3VTPC 4EYYQ 3PP5A 3HTKB 1MV8A 3WUUA 1LTJA 2YXRB 3P8CE 4UB6E 2Q5UA 1K8AQ 1LTGC 3Q5RA 2QEXP 1CSBA 2UWJE 1A02F 4I1LA 2YKQA 1AQTA 3S9OA 2YMKA 1WRGA 3OA7A 3WU2E 3O6QA 1HJBA 4NPEA 2HLOA 2RMZA 2KB7P 3GW6A 3R4YA 3B4SA 3C8VA 3I56P 4PJ0H 5L8RJ 3U1CA 2V4HA 1PPJE 2W27A 2WPSA 3G4SP 2LKMA 3V4WA 1L0NK 3HE5B 1FZGA 1FZCB 3W67A 1NTKJ 3FWNA 2O01J 1ZW0A 1Q86Q 2KI7B 2KS1B 3TDKA 2YIUC 1AA0A 1SQVK 1T2KC 3L72E 2WZ7A 1L0LD 1L0NG 2K9JA 2P10A 2QIWA 4H13B 2QJPC 1BE3J 5AW3B 1SQVG 4RO0A 3RL0g 4H44C 2AEJA 4D6TG 5KKZC 2ZT9B 1KILB 2CK3H 2OYIB 1N73A 2Z5IA 1Y9BA 2HR3A 2YXQB 3ABVC 2WPQA 5GTIE 3L71E 3USSA 5CCGD 1AVOA 2O1JA 3W68A 3KDPB 2JWDA 1NTMK 1L4AB 1M56D 1MFTA 1IFIA 2NRGA 1M57D 4GT1A 5KAFH 3KXDA 2AXTE 2C9LY 3IR9A 5KLVJ 3CXHI 2FBWC 4RKUJ 5M1BA 1NTMG 4C7NA 5AVTB 1SFCC 1RF1B 3MHVA 1KORA 1DH3A 2FXMA 5AVUB 4Y99B 1HGZA 2IDBA 2K3RA 3TGUE 2LR2A 1IFMA 2KP8A 1GL2B 1OXZA 4OWFA 1NU1J 1NWQA 1KB9E 2JEEA 1GW4A 1VPCA 4R4LA 3G9RA 3PH0A 1ZRTD 1M90Q 1JMMA 2NZ2A 4N6JA 4OGQC 2NPSC 3RK2D 3OW2O 1QGKB 3TNUA 1DD4A 1VQ7P 2HPCA 4EDFA 2QSIA 1USDA 3RK3E 2WSFJ 5AW7B 1KV4A 3BCCD 5BU5A 3CL3D 4K35A 3CD6P 1NKNA 2WSSH 1Y8AA 1QL2A 2E5YA 1AFOA 4JQ0D 2IZ1A 2KNCA 3A2AA 3SSUA 2AEFA 5APWA 2YO2A 2GA1A 4Y28J 1FZCC 3N7NA 5KAIH 1EXIA 3WU2H 1OFCX 3TF5A 4KT0J 3A0BH 1PP9G 3JCUE 2R32A 5C39A 1P84E 4NPFX 1SQXJ 3H1HJ 1AVYA 2ZT9C 2ZVOB 2OYIC 1W2BO 5CCHD 5AW4B 3SFDC 1VF5D 2E74B 1FS0E 1SQBJ 3HE4A 4A7PA 5APYA 2FFDB 1FZBA 2ZYDA 2N1TC 1EQ7A 1M1KQ 1FDIA 1URQB 2MKVA 1BCCJ 3RK3B 1RE4A 3L73J 3SWYA 1PV3A 3G3ZA 1L0NE 1OZHA 1RF1C 1VQLP 1NO4A 4IOIH 4Y99C 1NTKD 1EZVI 1FE6A 3M9QA 1GL2C 3HTKA 3EWKA 1RY3A 1E79H 2WPVB 3WMM0 1HBWA 1LT1A 4ZMDA 2ZXEB 4WVZA 3CWBG 2D2CD 2KZJA 2Y0CA 1BE3D 2JKVA 5AVZB 3GF3A 3H25A 1BSHA 1KYOI 4C7RA 3SWKA 3A3YB 1LGHB 1BGYJ 1KMIZ 2M3BA 3CX5I 2W6JH 1ZXGA 1NTME 1SQQK 3SFEC 5AW8B 1FAVA 2ZYAA 1K73Q 1JY3O 1RH5B 2K37A 4U3FJ 1FZCA 3H1JG 2QRXA 2KS1A 1GMJA 5KLVD 1J1DB 1HF9A 2JP3A 1VQMP 5APQA 1G2CB 2PP6A 1JUNA 3B71A 3R2PA 1IJDB 2FXPA 1FDOA 3S1KA 2QM7A 1NU1D 3Q1MA 5AVWB 1KILA 3QWOC 1ZN5A 5APTA 3AE3C 1X79B 1ZV8A 2E76B 1GZLA 2KSEA 3B5NA 1Y47A 1RQUA 2M5AB 3CMEP 2IBZD 1L4AA 2E74C 2OYOA 3B8EB 4MN4C 1YJWP 3GMAA 3AEBC 2M0BA 3EFFK 1OMIA 2O01H 3L72J 5APUA 3FX0A 1URQC 3V4QA 2IYOA 1RF1A 2M3EA 3MUDC 1GL2A 3WUVA 2JJLA 2PGDA 1LP1B 1U7MA 2K9YA 2WQYC 5TISH 3BCCG 3KZIH 2ZJSE 2ZVNB 2N9YB 4WY4B 1KTMA 1N2DC 3AECC 1JM0A 3L71J 5APSA 2A06D 3MIWA 2XKMA 2A45H 4IFDK 2PRRA 3RL0D 2E75D 3V2QA 3AE2C 2KK7A 3GLMA 1SQXD 3IN6A 2YNYA 1K05A 3H1HD 1L2PA 4PD4E 3M9BA 5EFWB 3PTZA 3Q5SA 2KIKA 4EOTA 1DIPA 1SQBD 4OH8B 2Y9YA 3TGUJ 2OTJP 3L75G 2OTLP 2B89A 1SP4A 2WT7B 3AE5C 4LC1A 1FOSE 1QVFO 5K5GB 1LJ2A 1LTTC 1BCCD 3CXHE 2KXPB 3L73D 4GDOA 3AE8C 2Y9ZA 4W7ZA 3CPWO 3CWBE 1FC2C 3E1IA 1LTBC 3A7OA 1NYHA 3KQGA 3H32A 3L4FA 4YPCA 2WSFH 3VN0A 4IL6X 1X0TA 3A5TA 2KSJA 3KPEA 1LTAC 1MZ9A 2E76C 1KQFB 3BRVB 4HYTB 2FFDA 1N7SB 1U57A 1YIJP 4H13D 3NTNA 1NTKG 3H1JE 2IYPA 3GHGB 1BGYD 1SQQE 5AW2B 1URQA 2P7JA 2OARA 2DW3A 4UB8E 3MUDA 5B66E 1LWUA 1KILD 1RE3C 2W83C 1BE3G 3U59A 4U3FD 3II6A 1S9KD 2H88C 1YTZI 3E7KA 3B5ND 1A02J 1L4AD 3M0DA 3P8CD 3S4RA 4WY4C 1OW8A 1VQOP 3HD7A 1WMKA 4U7JA 4JF7A 3H1IE 5KLVK 4PD4I 1QLED 4I7ZB 2FYUE 2L5GB 4KHXA 3H1LG 3A0HE 1IK7A 1KFNA 3N4XA 2WSEJ 5KLVG 5KJ7C 1OVVA 1PPJD 1GL2D 1NU1K 3F5HA 1NTZE 3CI9A 2N1TB 4PV1D 1LTIC 1VQKP 1X22A 2HODB 1IFDA 1VQPP 2LXBA 2IZ0A 1NU1G 1IK9A 1H0TA 5CBNA 1EDKA 3L72D 5E79E 3Q5PA 1K9MQ 1RF0A 2JR8A 3KHUA 1G2CA 3EFGA 3ZDMA 1IC2A 4RJTA 4HJGH 2IBZG 3D6ZA 3M06A 3VMZA 3H1ID 1XTCC 1HWTC 2ZFCA 1JY3P 4NPDA 1W5CE 2ZXXA 1EZVE 2QJKB 2XZRA 4AQRD 1GW3A 1SQPE 3BRTB 1YJNP 3L71D 1NTMJ 1EC5A 1HJ0A 5AW0B 3WUTA 1QVGO 2O01N 3MTUE 4H0LB 1KD1Q 1SS1A 3L74E 2G8YA 3AE1C 4N78E 2Y0DA 1T8ZA 3MP7B 2W6AA 1N7SC 3L75E 5AW6B 1S5LE 1AJYA 1KYOE 4L73A 2Z4EA 4EIJA 2KZIA 2BCCG 2IFMA 4Z1MH 3D70A 3GHGC 4UB6H 1PGQA 2J59M 3CX5E 1JTHB 2YKPA 3TGUD 3H1KE 2K1AA 5AW1B 1R5SA 1KB9D 1LP1A 1YJ9P 1AV1A 2FKWB 2E74D 3H1HG 4JPZB 4WY4A 3V2NA 5CHXA 2E43A 1LTSC 4DCKA 2E5TA 3VMAA 1XTGB 1Q81Q 1URQD 1OVUA 1G1IA 3RK3D 4I7ZC 2OYHB 3L74D 4JYBA 4EI2A 2GUVA 1JB0J 3CC4P 1DX7A 2P67A 1HH0A 3Q2YA 2RKLA 2WITA 3L73G 2PFXA 2WSCJ 2LXCB 3L70G 3AE9C 1SFCA 2FY8A 1S2EA 5H2FE 3HD7D 2O1KA 1T6AA 4BRYA 4TT3H 3O6QB 1Q2NA 1FU1A 1M8OB 1FOSF 3BASA 1ZR4A 2WMMA 5AVXB 5GTIH 3CCQP 1SQVE 3CCVP 4YTPC 3NXSA 1Q82Q 2NPSA 1P84D 1FZEA 2G3AA 4D6TE
chains in the Genus database with same CATH topology
1URQC 2W6BA 3V4QA 1WRGA 3OA7A 1RF1A 2Q7CA 1NAFA 2POHA 1HJBA 2HLOA 2KB7P 5AVYB 1FJPA 4O9BA 3U1CA 1GL2A 5CCGC 1J2JB 3BATA 2JJLA 2IFNA 2W27A 2WPSA 1RE3A 1CI6B 1SQXK 1L0LK 3IFMA 1OWAA 1N7SA 2LKMA 3MGNA 3HUSB 1N2DC 4WY4B 1FJKA 1NH4A 3V4WA 1L0NK 1HTLC 3HE5B 1FZGA 1FZCB 1NHLA 5APSA 3MIWA 1HGVA 1ZR2A 4HH2A 2XKMA 2A45H 1GDTA 4RESB 2PAJA 3GHGA 4IFDK 2KOGA 4XA4A 3RL0D 1SQVK 1T2KC 3V2QA 1H8AA 2WPRA 2WZ7A 3RK2B 1NOHA 1N73B 1AQ5A 1SQBK 3L35A 1JY2P 2YNYA 3HE5A 5AW3B 5APVA 4M3LA 1JNMA 3M9BA 1KFMA 5CJ4A 4EOTA 1KILB 2YMYA 2OYIB 1MFZA 1N73A 2Z5IA 1M1JB 3M91A 4OH8B 4N78D 2WPQA 3EQ2A 4N3YB 5AW9B 5KJ7A 2IX7C 4XE5B 1SP4A 5CCGD 2WT7B 4LC1A 2O1JA 1FOSE 1LT9A 3KDPB 2GUSA 1LTJB 1NTMK 2BASA 1L4AB 2OYIA 1IFIA 1LTTC 3H32B 5CMZA 4GT1A 1KILC 2C9LY 2E42A 3IR9A 2OYHC 4W80A 1JOCA 1T3JA 2WT7A 4W7ZA 1T2KD 3E1IA 4C7NA 3LIEA 5AVTB 1LTBC 1SFCC 3O8ZA 3B5NC 3A7OA 1RF1B 3KQGA 3H32A 3L4FA 2N1TA 1DH3A 3VOPA 2WSFH 2FXMA 1L4AC 5AVUB 4Y99B 1HGZA 3VN0A 2HODA 1IFMA 2KP8A 3A5TA 1GL2B 1OXZA 2KSJA 3TNUB 1NWQA 2JEEA 1GW4A 1VPCA 3KPEA 1LTAC 4AUWA 1CW5A 3UIAA 1MZ9A 2XU6A 1NKZB 1KZUB 1JMMA 4LGDE 4N6JA 2NPSC 1JY2N 4AYCA 3BRVB 1LWUB 4HYTB 4DOJA 3RK2D 2FFDA 1N7SB 1DEBA 3NTNA 5AVRB 3HRNA 3GHGB 1CZQA 1VDFA 5AW2B 3TNUA 1URQA 2CPBA 2WWWA 2HPCA 4I2LC 1GD2E 2P7JA 2OARA 5AW7B 3MUDA 1LWUA 1KILD 1RE3C 3L36A 3V2PA 5BU5A 2XV5A 3CL3D 1X9VA 1SVFA 2HFED 3U59A 5CCHC 2C0WA 2WSEH 3HD7B 3II6A 1NKNA 3M9HA 2J58A 1QL2A 1S9KD 1YTZI 1AFOA 1SFCD 2HYNA 3B5ND 4GIFA 3TYYA 1JO5A 1N7LA 1J1EB 3VMXA 1A02J 2I1KA 1L4AD 3M0DA 3P8CD 3A2AA 3NFQA 4WY4C 3HUSC 5APWA 2YO2A 4ZKUA 1FZCC 1GU5A 3HD7A 5CJ0A 5APXA 3N7NA 1FZAA 4JF7A 1LT9B 5KLVK 1YTZT 3TSIA 1M7LA 2NPSD 3CLQA 2L5GB 3SWFA 3RK2C 2KLVA 2Q9IA 1N73C 3P7KA 4KHXA 1JTHA 1H89A 5AVQB 1KFNA 3N4XA 2YO3A 2R32A 5KJ7C 2CPSA 2R3CA 4C46A 1KQLA 4C7NB 1GL2D 3KYQA 1NU1K 3HE4B 2VRSA 3CI9A 1JY3N 2N1TB 1LTIC 2P2UA 4JYCA 2OYIC 2XDJA 1M1JC 2HODB 3C9IA 1IFDA 1N7SD 5CCHD 5AW4B 1MUUA 3OAKA 1IK9A 1GK6A 3VMYA 4DZOA 4I6MC 3I5CA 5KTBA 3HE4A 5BU8B 5APYA 2FFDB 1LTJC 1FZBA 1G1JA 1JY2O 2FYUK 1RF0A 2N1TC 1E5WA 1EQ7A 3U1AA 4WY4D 1G2CA 3EFGA 1FDMA 1IC2A 5AVVB 2GM4A 1URQB 1NTKK 1FZFA 2HPCB 1Z56A 3M06A 3VMZA 5BVZA 3M0AA 1XTCC 3RK3B 3TK1A 1RE4A 2A45I 3SWYA 1HWTC 1NTZK 2ZFCA 1JY3P 3G3ZA 3VYIA 1RF1C 2R5BA 1NO4A 2XZRA 2FFDC 4AQRD 1GW3A 4LLHA 4IFFA 4Y99C 4ZKPA 2I1JA 3BRTB 3LIDA 5KJ7D 3BVHA 2HG5D 3VP8A 3M9QA 1HVVA 3MD0A 1GL2C 5AW0B 3VP9A 3HTKA 1RY3A 3MTUE 1GTWA 3P32A 3WMM0 1HBWA 2XNXA 4N78E 3RK3C 1T8ZA 3V5BA 1GU4A 2Q3IA 2W6AA 1LWUC 5CCGA 1WT6A 1N7SC 2ZXEB 5AW6B 1N86A 4W7YA 1HUCA 2Z4EA 4EIJA 5AVZB 2IFMA 1JCDA 2C9NY 3GHGC 2YKOA 1SLQA 4C7RA 1GK4A 2M8RA 2J59M 3A3YB 5CCHA 2N1TD 1JTHB 1LGHB 1JCCA 2YKPA 3M0DC 2A45G 4WB4A 5AW1B 2M3BA 3L37A 1SQPK 1SQQK 2FKWB 1ZLLA 3HD7C 5AW8B 2KYVA 1FAVA 1X8YA 1IO4A 1CI6A 1T3UA 3T97A 1JY3O 1J1EC 4WY4A 2N9BA 3HUSA 3V2NA 2FYZA 2H7HA 5CHXA 1FZCA 2E43A 1LTSC 2WSCH 2H43A 5AVSB 2IPPA 1QL1A 2C0XA 1XTGB 1URQD 2P1JA 2MJZA 4B86A 1LT9C 1FBMA 1G1IA 4GKGA 1J1DB 3RK3D 3NMDA 2OYHB 4JYBA 5AW5B 3H6PA 5APQA 1G2CB 1IFNA 2PP6A 1JUNA 3RL0B 3R2PA 1SFCB 3B5NB 1IJDB 1DX7A 2P67A 1HH0A 2QM7A 2QM8A 5AVWB 1KILA 2H8PD 2WITA 3OJAB 1YYCA 1IFJA 1M1JA 2Z5HA 1H88A 1ZN5A 5APTA 1X79B 2OYHA 1ZV8A 4IFMA 4WBAA 1J1DC 1RF0C 3V2RA 2R5DA 3P8MC 1SFCA 2WTYA 1GZLA 3B5NA 1S9KE 1W2EA 2NPSB 3RL0C 3VTPC 3HD7D 2O1KA 3HTKB 1MV8A 3PP5A 1LTJA 3LW5H 1L4AA 3B8EB 3P8CE 2Q5UA 1FU1A 1RE4C 1FOSF 3BASA 1LTGC 1ZR4A 5AVXB 1PFIA 1CSBA 2O01H 1A02F 3NXSA 4I1LA 2NPSA 2YKQA 1FZEA 5APUA 2GUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J1E B;  1YTZ T;  4Y99 C;  1J1E C;  1J1D B;  1YTZ I;  1J1D C;  4Y99 B; 
#chains in the Genus database with same CATH topology
 2W6B A;  2Q7C A;  2OQQ A;  2AXT H;  1BGY G;  3H1L E;  2QJK C;  5CCG C;  1J2J B;  3BAT A;  5KLI B;  2IFN A;  3LW5 J;  1CI6 B;  1L0L K;  3V6I A;  3T97 B;  4K3A A;  1OWA A;  1N7S A;  1PGP A;  1YI2 P;  1FJK A;  1NH4 A;  4H0L C;  1NHL A;  1HGV A;  1YBK A;  1GDT A;  3G71 P;  2PAJ A;  1KB9 H;  3GHG A;  4OVN F;  4XA4 A;  3PRJ A;  1L0L G;  4L75 A;  3C1L A;  2WPR A;  1EDL A;  1N73 B;  1AQ5 A;  1KQS O;  1L0N D;  3HE5 A;  3AE4 C;  1UII A;  2SPZ A;  4M3L A;  1JNM A;  3CWB J;  1SQV D;  1YQ4 C;  3EQ2 A;  3GG2 A;  5AW9 B;  2D2C B;  1S5L H;  1PPJ G;  4XE5 B;  1KYO H;  2GUS A;  4QMA A;  2OYI A;  2OGU A;  5CMZ A;  2E42 A;  1R8E A;  4PJ0 E;  2OYH C;  1SQQ J;  1Q7Y Q;  1T3J A;  3CCR P;  3GF7 A;  2QE7 H;  1T2K D;  3D6Y A;  3L72 G;  2BCC E;  1NTM D;  3AED C;  4GOE A;  2N1T A;  3JSV C;  4YXD C;  2HOD A;  3F89 A;  3JCU H;  3ITK A;  3TNU B;  1P84 H;  4H44 D;  2I8D A;  4AUW A;  2AXC A;  1IZN B;  3E1R A;  1NKZ B;  2ZAE B;  4WWI A;  1DD3 A;  1JY2 N;  1DEB A;  3L71 G;  2Q3E A;  5AVR B;  3HRN A;  5TJH A;  1PP9 E;  1VDF A;  3H1I J;  1PIX A;  2CPB A;  2WWW A;  1GD2 E;  4I2L C;  3AE7 C;  1RQV A;  2FYU J;  3V2P A;  3L36 A;  2B9B A;  5CCH C;  2WSE H;  3M9H A;  2J58 A;  1NTZ J;  3CCS P;  1SFC D;  3TYY A;  1JO5 A;  1N7L A;  3VMX A;  2R44 A;  5KLI C;  3TGU G;  5KAF E;  3L70 E;  4ZKU A;  1GU5 A;  5APX A;  1LT9 B;  4HKZ H;  3TSI A;  4OGQ D;  2NPS D;  3CLQ A;  3SWF A;  2KLV A;  2Q9I A;  1BSN A;  4ASV A;  1N73 C;  1JTH A;  2B87 B;  3G6E P;  1H89 A;  2RN0 A;  5B5E E;  2YO3 A;  2R3C A;  4C46 A;  2P58 A;  1KQL A;  1PZQ A;  3KYQ A;  3HE4 B;  4YXW H;  1N8R Q;  3C9I A;  1SQP J;  1N7S D;  1MUU A;  2E75 B;  2D2C C;  3VMY A;  4I6M C;  2O3J A;  5KTB A;  3L74 J;  3MZW B;  5BU8 B;  1YHQ P;  3L75 J;  1E5W A;  3PHL A;  4PD4 D;  2GM4 A;  1NTK K;  1FZF A;  1Z56 A;  5BVZ A;  1L0L E;  3TK1 A;  3AEG C;  3VYI A;  3H1K J;  1K04 A;  4IFF A;  4ZKP A;  3LID A;  3IF4 A;  2HG5 D;  3VP8 A;  4TLF A;  3MD0 A;  5KAI E;  2BEZ F;  1USE A;  1GTW A;  2XNX A;  2ZT9 D;  2B88 A;  3V5B A;  3CXH D;  1WT6 A;  3A0B E;  1N86 A;  4W7Y A;  1HUC A;  1JCD A;  2C9N Y;  3CWB D;  2YKO A;  1SLQ A;  1GK4 A;  2M8R A;  5CCH A;  2N1T D;  3AE6 C;  1NGM B;  1JCC A;  2A45 G;  3K5B A;  1YQ3 C;  3L37 A;  5GTH E;  1VQ4 P;  1IO4 A;  1CI6 A;  3T97 A;  2N9B A;  2FYZ A;  2H7H A;  2WSC H;  4KJM A;  3H1J D;  1ZRT E;  1SQQ D;  3RGU A;  2QJY B;  1VQ9 P;  4B86 A;  1U7J A;  1L0N J;  1LT9 C;  1FBM A;  5AW5 B;  1OVR A;  1SQV J;  3B5N B;  2OTK E;  4D6T J;  2ZYG A;  4L76 A;  1D7M A;  2JWA A;  2H8P D;  3OJA B;  1YYC A;  1ZME C;  1IFJ A;  3BCC E;  3Q3D A;  2Z5H A;  4WBA A;  4H0L D;  3H1L J;  2J5U A;  4PD4 H;  2FXO A;  2WTY A;  1W2E A;  2E75 C;  3RL0 C;  3LW5 H;  2Q6Q A;  2FYU D;  1RE4 C;  1PFI A;  5B5E H;  1VQ8 P;  2WVR A;  1IFP A;  1VQ5 P;  4PV1 B;  2M5A A;  1NTZ D;  3CXH H;  1NAF A;  2POH A;  5AVY B;  2KLU A;  1FJP A;  4O9B A;  1DEE G;  2W8Z A;  3CC2 P;  1RE3 A;  1RHZ B;  1SQX K;  3IFM A;  2A06 G;  2L91 A;  3MGN A;  3HUS B;  1NAY A;  3AEA C;  1HTL C;  1YIT P;  4GOF A;  4DT0 A;  1ZR2 A;  4HH2 A;  4RES B;  2H89 C;  2KOG A;  1SQX G;  3FGA D;  1H8A A;  3RK2 B;  1NOH A;  3PLN A;  1SQB K;  3L35 A;  1JY2 P;  1S1C X;  1EZV D;  5APV A;  1KFM A;  1SQP D;  5CJ4 A;  2BCC J;  1SQB G;  4UB8 H;  2YMY A;  1MFZ A;  5B66 H;  4ASW A;  1M1J B;  3M91 A;  4N78 D;  2AEM A;  4N3Y B;  4H13 C;  5KJ7 A;  2IX7 C;  1PGJ A;  3CCM P;  3CCL P;  3L75 D;  1NTK E;  2ITA A;  4XFJ A;  1KYO D;  3PJS K;  3QH9 A;  1LT9 A;  2QA4 P;  1BCC G;  1EXJ A;  1LTJ B;  2BAS A;  3H32 B;  2QJY C;  1KIL C;  1OW6 A;  3FXD A;  1TU3 F;  2B87 A;  3CX5 D;  1PP9 J;  4W80 A;  2QG4 A;  1BE3 E;  1JOC A;  3H1K D;  2WT7 A;  5GTH H;  2Q1K A;  3LIE A;  1BDC A;  3O8Z A;  3B5N C;  5TIS E;  1KC8 Q;  3KZI E;  4IL6 E;  3VOP A;  1L4A C;  2V7Q H;  1OX3 A;  3A0H H;  1LNQ A;  1EDI A;  1CW5 A;  3UIA A;  2XU6 A;  1KZU B;  5DJT B;  4LGD E;  4JBZ A;  1KB9 I;  4AYC A;  1LWU B;  4DOJ A;  1VL2 A;  3L70 J;  1OIP A;  1VF5 B;  1CZQ A;  2BEQ D;  5KLV E;  1QEX A;  2RH0 A;  3FWL A;  3CCU P;  2K9J B;  5E79 H;  4PV1 C;  2XV5 A;  1X9V A;  4U3F G;  1SVF A;  2HFE D;  3RBX A;  4BWN A;  2C0W A;  2XND H;  3HD7 B;  1PGO A;  1NU1 E;  2HYN A;  4GIF A;  3FXE A;  1J1E B;  5DJU B;  2I1K A;  3NFQ A;  1QX8 A;  3HUS C;  3CCJ P;  5CJ0 A;  1FZA A;  2IBZ E;  2E76 D;  1YTZ T;  1KQG B;  1M7L A;  1MKM A;  1OW7 A;  2QVA A;  4D6T D;  1UIX A;  3RK2 C;  3P7K A;  2JDI H;  5AVQ B;  1SQQ G;  2CPS A;  3H1L D;  1H0T B;  4C7N B;  1L0L J;  2KUB A;  2FYN B;  2VRS A;  1JY3 N;  1P84 I;  2P2U A;  2W90 A;  3CX5 H;  4JYC A;  2XDJ A;  4DJG A;  1M1J C;  3I55 P;  3H1J J;  3RBZ A;  1JEK A;  2K88 A;  3OAK A;  1GK6 A;  4DZO A;  3I5C A;  1VQ6 P;  1LTJ C;  1G1J A;  1JY2 O;  2FYU K;  3CMA P;  2A06 E;  4BXL A;  3U1A A;  4WY4 D;  1FDM A;  5AVV B;  1EDJ A;  3H1I G;  2HPC B;  4GOD A;  3M0A A;  1SQX E;  2FYU G;  2A45 I;  1NTZ K;  4L74 A;  3H1H E;  2R5B A;  2FFD C;  4LLH A;  3AEF C;  5CBO A;  2I1J A;  5KJ7 D;  3BVH A;  1S72 P;  1HVV A;  3VP9 A;  2Y0E A;  1NTZ G;  3P32 A;  1SQB E;  3JC2 2;  1S3J A;  2V7Q J;  3RK3 C;  1GU4 A;  2KNC B;  2Q3I A;  1LWU C;  4ZNC A;  5CCG A;  1ZOY C;  2YIU B;  2R3S A;  1VF5 C;  5H2F H;  1S5L X;  1NVO A;  2QJP B;  2BCC D;  1BCC E;  4IL6 H;  3CCE P;  4HB1 A;  3L73 E;  1KN7 A;  3M0D C;  4H44 B;  4WB4 A;  5KKZ B;  3D71 A;  1VQN P;  1SQP K;  2JO1 A;  1ZLL A;  3HD7 C;  1Q90 D;  2KYV A;  3BCC J;  1X8Y A;  1T3U A;  1EZV G;  1J1E C;  2IBZ I;  3HUS A;  4CPG A;  1NJI Q;  1SQP G;  1BDD A;  2H43 A;  5AVS B;  2IPP A;  1QL1 A;  3IAO A;  2C0X A;  1PP9 D;  1JMB A;  3AEE C;  2P1J A;  2MJZ A;  3L74 G;  4GKG A;  3NMD A;  3H6P A;  1IFN A;  3CC7 P;  3RL0 B;  1BGY E;  1SFC B;  1PL5 A;  4R4M A;  1ZP0 C;  2QM8 A;  4BRY B;  1KIL E;  1M1J A;  1H88 A;  2FYN C;  2OYH A;  4IFM A;  3H1K G;  1J1D C;  1S4X A;  4U3F E;  1RF0 C;  3V2R A;  2R5D A;  3P8M C;  3L70 D;  1S9K E;  4OGQ B;  2NPS B;  1R5L A;  3VTP C;  4EYY Q;  3PP5 A;  3HTK B;  1MV8 A;  3WUU A;  1LTJ A;  2YXR B;  3P8C E;  4UB6 E;  2Q5U A;  1K8A Q;  1LTG C;  3Q5R A;  2QEX P;  1CSB A;  2UWJ E;  1A02 F;  4I1L A;  2YKQ A;  1AQT A;  3S9O A;  2YMK A;  1WRG A;  3OA7 A;  3WU2 E;  3O6Q A;  1HJB A;  4NPE A;  2HLO A;  2RMZ A;  2KB7 P;  3GW6 A;  3R4Y A;  3B4S A;  3C8V A;  3I56 P;  4PJ0 H;  5L8R J;  3U1C A;  2V4H A;  1PPJ E;  2W27 A;  2WPS A;  3G4S P;  2LKM A;  3V4W A;  1L0N K;  3HE5 B;  1FZG A;  1FZC B;  3W67 A;  1NTK J;  3FWN A;  2O01 J;  1ZW0 A;  1Q86 Q;  2KI7 B;  2KS1 B;  3TDK A;  2YIU C;  1AA0 A;  1SQV K;  1T2K C;  3L72 E;  2WZ7 A;  1L0L D;  1L0N G;  2K9J A;  2P10 A;  2QIW A;  4H13 B;  2QJP C;  1BE3 J;  5AW3 B;  1SQV G;  4RO0 A;  3RL0 g;  4H44 C;  2AEJ A;  4D6T G;  5KKZ C;  2ZT9 B;  1KIL B;  2CK3 H;  2OYI B;  1N73 A;  2Z5I A;  1Y9B A;  2HR3 A;  2YXQ B;  3ABV C;  2WPQ A;  5GTI E;  3L71 E;  3USS A;  5CCG D;  1AVO A;  2O1J A;  3W68 A;  3KDP B;  2JWD A;  1NTM K;  1L4A B;  1M56 D;  1MFT A;  1IFI A;  2NRG A;  1M57 D;  4GT1 A;  5KAF H;  3KXD A;  2AXT E;  2C9L Y;  3IR9 A;  5KLV J;  3CXH I;  2FBW C;  4RKU J;  5M1B A;  1NTM G;  4C7N A;  5AVT B;  1SFC C;  1RF1 B;  3MHV A;  1KOR A;  1DH3 A;  2FXM A;  5AVU B;  4Y99 B;  1HGZ A;  2IDB A;  2K3R A;  3TGU E;  2LR2 A;  1IFM A;  2KP8 A;  1GL2 B;  1OXZ A;  4OWF A;  1NU1 J;  1NWQ A;  1KB9 E;  2JEE A;  1GW4 A;  1VPC A;  4R4L A;  3G9R A;  3PH0 A;  1ZRT D;  1M90 Q;  1JMM A;  2NZ2 A;  4N6J A;  4OGQ C;  2NPS C;  3RK2 D;  3OW2 O;  1QGK B;  3TNU A;  1DD4 A;  1VQ7 P;  2HPC A;  4EDF A;  2QSI A;  1USD A;  3RK3 E;  2WSF J;  5AW7 B;  1KV4 A;  3BCC D;  5BU5 A;  3CL3 D;  4K35 A;  3CD6 P;  1NKN A;  2WSS H;  1Y8A A;  1QL2 A;  2E5Y A;  1AFO A;  4JQ0 D;  2IZ1 A;  2KNC A;  3A2A A;  3SSU A;  2AEF A;  5APW A;  2YO2 A;  2GA1 A;  4Y28 J;  1FZC C;  3N7N A;  5KAI H;  1EXI A;  3WU2 H;  1OFC X;  3TF5 A;  4KT0 J;  3A0B H;  1PP9 G;  3JCU E;  2R32 A;  5C39 A;  1P84 E;  4NPF X;  1SQX J;  3H1H J;  1AVY A;  2ZT9 C;  2ZVO B;  2OYI C;  1W2B O;  5CCH D;  5AW4 B;  3SFD C;  1VF5 D;  2E74 B;  1FS0 E;  1SQB J;  3HE4 A;  4A7P A;  5APY A;  2FFD B;  1FZB A;  2ZYD A;  2N1T C;  1EQ7 A;  1M1K Q;  1FDI A;  1URQ B;  2MKV A;  1BCC J;  3RK3 B;  1RE4 A;  3L73 J;  3SWY A;  1PV3 A;  3G3Z A;  1L0N E;  1OZH A;  1RF1 C;  1VQL P;  1NO4 A;  4IOI H;  4Y99 C;  1NTK D;  1EZV I;  1FE6 A;  3M9Q A;  1GL2 C;  3HTK A;  3EWK A;  1RY3 A;  1E79 H;  2WPV B;  3WMM 0;  1HBW A;  1LT1 A;  4ZMD A;  2ZXE B;  4WVZ A;  3CWB G;  2D2C D;  2KZJ A;  2Y0C A;  1BE3 D;  2JKV A;  5AVZ B;  3GF3 A;  3H25 A;  1BSH A;  1KYO I;  4C7R A;  3SWK A;  3A3Y B;  1LGH B;  1BGY J;  1KMI Z;  2M3B A;  3CX5 I;  2W6J H;  1ZXG A;  1NTM E;  1SQQ K;  3SFE C;  5AW8 B;  1FAV A;  2ZYA A;  1K73 Q;  1JY3 O;  1RH5 B;  2K37 A;  4U3F J;  1FZC A;  3H1J G;  2QRX A;  2KS1 A;  1GMJ A;  5KLV D;  1J1D B;  1HF9 A;  2JP3 A;  1VQM P;  5APQ A;  1G2C B;  2PP6 A;  1JUN A;  3B71 A;  3R2P A;  1IJD B;  2FXP A;  1FDO A;  3S1K A;  2QM7 A;  1NU1 D;  3Q1M A;  5AVW B;  1KIL A;  3QWO C;  1ZN5 A;  5APT A;  3AE3 C;  1X79 B;  1ZV8 A;  2E76 B;  1GZL A;  2KSE A;  3B5N A;  1Y47 A;  1RQU A;  2M5A B;  3CME P;  2IBZ D;  1L4A A;  2E74 C;  2OYO A;  3B8E B;  4MN4 C;  1YJW P;  3GMA A;  3AEB C;  2M0B A;  3EFF K;  1OMI A;  2O01 H;  3L72 J;  5APU A;  3FX0 A;  1URQ C;  3V4Q A;  2IYO A;  1RF1 A;  2M3E A;  3MUD C;  1GL2 A;  3WUV A;  2JJL A;  2PGD A;  1LP1 B;  1U7M A;  2K9Y A;  2WQY C;  5TIS H;  3BCC G;  3KZI H;  2ZJS E;  2ZVN B;  2N9Y B;  4WY4 B;  1KTM A;  1N2D C;  3AEC C;  1JM0 A;  3L71 J;  5APS A;  2A06 D;  3MIW A;  2XKM A;  2A45 H;  4IFD K;  2PRR A;  3RL0 D;  2E75 D;  3V2Q A;  3AE2 C;  2KK7 A;  3GLM A;  1SQX D;  3IN6 A;  2YNY A;  1K05 A;  3H1H D;  1L2P A;  4PD4 E;  3M9B A;  5EFW B;  3PTZ A;  3Q5S A;  2KIK A;  4EOT A;  1DIP A;  1SQB D;  4OH8 B;  2Y9Y A;  3TGU J;  2OTJ P;  3L75 G;  2OTL P;  2B89 A;  1SP4 A;  2WT7 B;  3AE5 C;  4LC1 A;  1FOS E;  1QVF O;  5K5G B;  1LJ2 A;  1LTT C;  1BCC D;  3CXH E;  2KXP B;  3L73 D;  4GDO A;  3AE8 C;  2Y9Z A;  4W7Z A;  3CPW O;  3CWB E;  1FC2 C;  3E1I A;  1LTB C;  3A7O A;  1NYH A;  3KQG A;  3H32 A;  3L4F A;  4YPC A;  2WSF H;  3VN0 A;  4IL6 X;  1X0T A;  3A5T A;  2KSJ A;  3KPE A;  1LTA C;  1MZ9 A;  2E76 C;  1KQF B;  3BRV B;  4HYT B;  2FFD A;  1N7S B;  1U57 A;  1YIJ P;  4H13 D;  3NTN A;  1NTK G;  3H1J E;  2IYP A;  3GHG B;  1BGY D;  1SQQ E;  5AW2 B;  1URQ A;  2P7J A;  2OAR A;  2DW3 A;  4UB8 E;  3MUD A;  5B66 E;  1LWU A;  1KIL D;  1RE3 C;  2W83 C;  1BE3 G;  3U59 A;  4U3F D;  3II6 A;  1S9K D;  2H88 C;  1YTZ I;  3E7K A;  3B5N D;  1A02 J;  1L4A D;  3M0D A;  3P8C D;  3S4R A;  4WY4 C;  1OW8 A;  1VQO P;  3HD7 A;  1WMK A;  4U7J A;  4JF7 A;  3H1I E;  5KLV K;  4PD4 I;  1QLE D;  4I7Z B;  2FYU E;  2L5G B;  4KHX A;  3H1L G;  3A0H E;  1IK7 A;  1KFN A;  3N4X A;  2WSE J;  5KLV G;  5KJ7 C;  1OVV A;  1PPJ D;  1GL2 D;  1NU1 K;  3F5H A;  1NTZ E;  3CI9 A;  2N1T B;  4PV1 D;  1LTI C;  1VQK P;  1X22 A;  2HOD B;  1IFD A;  1VQP P;  2LXB A;  2IZ0 A;  1NU1 G;  1IK9 A;  1H0T A;  5CBN A;  1EDK A;  3L72 D;  5E79 E;  3Q5P A;  1K9M Q;  1RF0 A;  2JR8 A;  3KHU A;  1G2C A;  3EFG A;  3ZDM A;  1IC2 A;  4RJT A;  4HJG H;  2IBZ G;  3D6Z A;  3M06 A;  3VMZ A;  3H1I D;  1XTC C;  1HWT C;  2ZFC A;  1JY3 P;  4NPD A;  1W5C E;  2ZXX A;  1EZV E;  2QJK B;  2XZR A;  4AQR D;  1GW3 A;  1SQP E;  3BRT B;  1YJN P;  3L71 D;  1NTM J;  1EC5 A;  1HJ0 A;  5AW0 B;  3WUT A;  1QVG O;  2O01 N;  3MTU E;  4H0L B;  1KD1 Q;  1SS1 A;  3L74 E;  2G8Y A;  3AE1 C;  4N78 E;  2Y0D A;  1T8Z A;  3MP7 B;  2W6A A;  1N7S C;  3L75 E;  5AW6 B;  1S5L E;  1AJY A;  1KYO E;  4L73 A;  2Z4E A;  4EIJ A;  2KZI A;  2BCC G;  2IFM A;  4Z1M H;  3D70 A;  3GHG C;  4UB6 H;  1PGQ A;  2J59 M;  3CX5 E;  1JTH B;  2YKP A;  3TGU D;  3H1K E;  2K1A A;  5AW1 B;  1R5S A;  1KB9 D;  1LP1 A;  1YJ9 P;  1AV1 A;  2FKW B;  2E74 D;  3H1H G;  4JPZ B;  4WY4 A;  3V2N A;  5CHX A;  2E43 A;  1LTS C;  4DCK A;  2E5T A;  3VMA A;  1XTG B;  1Q81 Q;  1URQ D;  1OVU A;  1G1I A;  3RK3 D;  4I7Z C;  2OYH B;  3L74 D;  4JYB A;  4EI2 A;  2GUV A;  1JB0 J;  3CC4 P;  1DX7 A;  2P67 A;  1HH0 A;  3Q2Y A;  2RKL A;  2WIT A;  3L73 G;  2PFX A;  2WSC J;  2LXC B;  3L70 G;  3AE9 C;  1SFC A;  2FY8 A;  1S2E A;  5H2F E;  3HD7 D;  2O1K A;  1T6A A;  4BRY A;  4TT3 H;  3O6Q B;  1Q2N A;  1FU1 A;  1M8O B;  1FOS F;  3BAS A;  1ZR4 A;  2WMM A;  5AVX B;  5GTI H;  3CCQ P;  1SQV E;  3CCV P;  4YTP C;  3NXS A;  1Q82 Q;  2NPS A;  1P84 D;  1FZE A;  2G3A A;  4D6T E; 
#chains in the Genus database with same CATH homology
 1URQ C;  2W6B A;  3V4Q A;  1WRG A;  3OA7 A;  1RF1 A;  2Q7C A;  1NAF A;  2POH A;  1HJB A;  2HLO A;  2KB7 P;  5AVY B;  1FJP A;  4O9B A;  3U1C A;  1GL2 A;  5CCG C;  1J2J B;  3BAT A;  2JJL A;  2IFN A;  2W27 A;  2WPS A;  1RE3 A;  1CI6 B;  1SQX K;  1L0L K;  3IFM A;  1OWA A;  1N7S A;  2LKM A;  3MGN A;  3HUS B;  1N2D C;  4WY4 B;  1FJK A;  1NH4 A;  3V4W A;  1L0N K;  1HTL C;  3HE5 B;  1FZG A;  1FZC B;  1NHL A;  5APS A;  3MIW A;  1HGV A;  1ZR2 A;  4HH2 A;  2XKM A;  2A45 H;  1GDT A;  4RES B;  2PAJ A;  3GHG A;  4IFD K;  2KOG A;  4XA4 A;  3RL0 D;  1SQV K;  1T2K C;  3V2Q A;  1H8A A;  2WPR A;  2WZ7 A;  3RK2 B;  1NOH A;  1N73 B;  1AQ5 A;  1SQB K;  3L35 A;  1JY2 P;  2YNY A;  3HE5 A;  5AW3 B;  5APV A;  4M3L A;  1JNM A;  3M9B A;  1KFM A;  5CJ4 A;  4EOT A;  1KIL B;  2YMY A;  2OYI B;  1MFZ A;  1N73 A;  2Z5I A;  1M1J B;  3M91 A;  4OH8 B;  4N78 D;  2WPQ A;  3EQ2 A;  4N3Y B;  5AW9 B;  5KJ7 A;  2IX7 C;  4XE5 B;  1SP4 A;  5CCG D;  2WT7 B;  4LC1 A;  2O1J A;  1FOS E;  1LT9 A;  3KDP B;  2GUS A;  1LTJ B;  1NTM K;  2BAS A;  1L4A B;  2OYI A;  1IFI A;  1LTT C;  3H32 B;  5CMZ A;  4GT1 A;  1KIL C;  2C9L Y;  2E42 A;  3IR9 A;  2OYH C;  4W80 A;  1JOC A;  1T3J A;  2WT7 A;  4W7Z A;  1T2K D;  3E1I A;  4C7N A;  3LIE A;  5AVT B;  1LTB C;  1SFC C;  3O8Z A;  3B5N C;  3A7O A;  1RF1 B;  3KQG A;  3H32 A;  3L4F A;  2N1T A;  1DH3 A;  3VOP A;  2WSF H;  2FXM A;  1L4A C;  5AVU B;  4Y99 B;  1HGZ A;  3VN0 A;  2HOD A;  1IFM A;  2KP8 A;  3A5T A;  1GL2 B;  1OXZ A;  2KSJ A;  3TNU B;  1NWQ A;  2JEE A;  1GW4 A;  1VPC A;  3KPE A;  1LTA C;  4AUW A;  1CW5 A;  3UIA A;  1MZ9 A;  2XU6 A;  1NKZ B;  1KZU B;  1JMM A;  4LGD E;  4N6J A;  2NPS C;  1JY2 N;  4AYC A;  3BRV B;  1LWU B;  4HYT B;  4DOJ A;  3RK2 D;  2FFD A;  1N7S B;  1DEB A;  3NTN A;  5AVR B;  3HRN A;  3GHG B;  1CZQ A;  1VDF A;  5AW2 B;  3TNU A;  1URQ A;  2CPB A;  2WWW A;  2HPC A;  4I2L C;  1GD2 E;  2P7J A;  2OAR A;  5AW7 B;  3MUD A;  1LWU A;  1KIL D;  1RE3 C;  3L36 A;  3V2P A;  5BU5 A;  2XV5 A;  3CL3 D;  1X9V A;  1SVF A;  2HFE D;  3U59 A;  5CCH C;  2C0W A;  2WSE H;  3HD7 B;  3II6 A;  1NKN A;  3M9H A;  2J58 A;  1QL2 A;  1S9K D;  1YTZ I;  1AFO A;  1SFC D;  2HYN A;  3B5N D;  4GIF A;  3TYY A;  1JO5 A;  1N7L A;  1J1E B;  3VMX A;  1A02 J;  2I1K A;  1L4A D;  3M0D A;  3P8C D;  3A2A A;  3NFQ A;  4WY4 C;  3HUS C;  5APW A;  2YO2 A;  4ZKU A;  1FZC C;  1GU5 A;  3HD7 A;  5CJ0 A;  5APX A;  3N7N A;  1FZA A;  4JF7 A;  1LT9 B;  5KLV K;  1YTZ T;  3TSI A;  1M7L A;  2NPS D;  3CLQ A;  2L5G B;  3SWF A;  3RK2 C;  2KLV A;  2Q9I A;  1N73 C;  3P7K A;  4KHX A;  1JTH A;  1H89 A;  5AVQ B;  1KFN A;  3N4X A;  2YO3 A;  2R32 A;  5KJ7 C;  2CPS A;  2R3C A;  4C46 A;  1KQL A;  4C7N B;  1GL2 D;  3KYQ A;  1NU1 K;  3HE4 B;  2VRS A;  3CI9 A;  1JY3 N;  2N1T B;  1LTI C;  2P2U A;  4JYC A;  2OYI C;  2XDJ A;  1M1J C;  2HOD B;  3C9I A;  1IFD A;  1N7S D;  5CCH D;  5AW4 B;  1MUU A;  3OAK A;  1IK9 A;  1GK6 A;  3VMY A;  4DZO A;  4I6M C;  3I5C A;  5KTB A;  3HE4 A;  5BU8 B;  5APY A;  2FFD B;  1LTJ C;  1FZB A;  1G1J A;  1JY2 O;  2FYU K;  1RF0 A;  2N1T C;  1E5W A;  1EQ7 A;  3U1A A;  4WY4 D;  1G2C A;  3EFG A;  1FDM A;  1IC2 A;  5AVV B;  2GM4 A;  1URQ B;  1NTK K;  1FZF A;  2HPC B;  1Z56 A;  3M06 A;  3VMZ A;  5BVZ A;  3M0A A;  1XTC C;  3RK3 B;  3TK1 A;  1RE4 A;  2A45 I;  3SWY A;  1HWT C;  1NTZ K;  2ZFC A;  1JY3 P;  3G3Z A;  3VYI A;  1RF1 C;  2R5B A;  1NO4 A;  2XZR A;  2FFD C;  4AQR D;  1GW3 A;  4LLH A;  4IFF A;  4Y99 C;  4ZKP A;  2I1J A;  3BRT B;  3LID A;  5KJ7 D;  3BVH A;  2HG5 D;  3VP8 A;  3M9Q A;  1HVV A;  3MD0 A;  1GL2 C;  5AW0 B;  3VP9 A;  3HTK A;  1RY3 A;  3MTU E;  1GTW A;  3P32 A;  3WMM 0;  1HBW A;  2XNX A;  4N78 E;  3RK3 C;  1T8Z A;  3V5B A;  1GU4 A;  2Q3I A;  2W6A A;  1LWU C;  5CCG A;  1WT6 A;  1N7S C;  2ZXE B;  5AW6 B;  1N86 A;  4W7Y A;  1HUC A;  2Z4E A;  4EIJ A;  5AVZ B;  2IFM A;  1JCD A;  2C9N Y;  3GHG C;  2YKO A;  1SLQ A;  4C7R A;  1GK4 A;  2M8R A;  2J59 M;  3A3Y B;  5CCH A;  2N1T D;  1JTH B;  1LGH B;  1JCC A;  2YKP A;  3M0D C;  2A45 G;  4WB4 A;  5AW1 B;  2M3B A;  3L37 A;  1SQP K;  1SQQ K;  2FKW B;  1ZLL A;  3HD7 C;  5AW8 B;  2KYV A;  1FAV A;  1X8Y A;  1IO4 A;  1CI6 A;  1T3U A;  3T97 A;  1JY3 O;  1J1E C;  4WY4 A;  2N9B A;  3HUS A;  3V2N A;  2FYZ A;  2H7H A;  5CHX A;  1FZC A;  2E43 A;  1LTS C;  2WSC H;  2H43 A;  5AVS B;  2IPP A;  1QL1 A;  2C0X A;  1XTG B;  1URQ D;  2P1J A;  2MJZ A;  4B86 A;  1LT9 C;  1FBM A;  1G1I A;  4GKG A;  1J1D B;  3RK3 D;  3NMD A;  2OYH B;  4JYB A;  5AW5 B;  3H6P A;  5APQ A;  1G2C B;  1IFN A;  2PP6 A;  1JUN A;  3RL0 B;  3R2P A;  1SFC B;  3B5N B;  1IJD B;  1DX7 A;  2P67 A;  1HH0 A;  2QM7 A;  2QM8 A;  5AVW B;  1KIL A;  2H8P D;  2WIT A;  3OJA B;  1YYC A;  1IFJ A;  1M1J A;  2Z5H A;  1H88 A;  1ZN5 A;  5APT A;  1X79 B;  2OYH A;  1ZV8 A;  4IFM A;  4WBA A;  1J1D C;  1RF0 C;  3V2R A;  2R5D A;  3P8M C;  1SFC A;  2WTY A;  1GZL A;  3B5N A;  1S9K E;  1W2E A;  2NPS B;  3RL0 C;  3VTP C;  3HD7 D;  2O1K A;  3HTK B;  1MV8 A;  3PP5 A;  1LTJ A;  3LW5 H;  1L4A A;  3B8E B;  3P8C E;  2Q5U A;  1FU1 A;  1RE4 C;  1FOS F;  3BAS A;  1LTG C;  1ZR4 A;  5AVX B;  1PFI A;  1CSB A;  2O01 H;  1A02 F;  3NXS A;  4I1L A;  2NPS A;  2YKQ A;  1FZE A;  5APU A;  2GUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...