1YTZT

Crystal structure of skeletal muscle troponin in the ca2+-activated state
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
90
structure length
90
Chain Sequence
SYSSYLAKADQKRGKKQTARETKKKVLAERRKPLNIDHLNEDKLRDKAKELWDWLYQLQTEKYDFAEQIKRKKYEIVTLRNRIDQAQKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Ca2+-regulated structural changes in troponin
pubmed doi rcsb
source organism Gallus gallus
molecule tags Contractile protein
molecule keywords Troponin T
total genus 34
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2005-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.350 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ytzT00
1J1EB 1J1DB 1J1DC 4Y99C 1YTZI 1J1EC 1YTZT 4Y99B
chains in the Genus database with same CATH superfamily
1PGOA 1KB9D 1GW4A 1L0NG 1OZHA 1GL2B 2G3AA 3Q5RA 5KLVJ 4EOTA 2YKOA 1VQ5P 1NOHA 2HR3A 3H1IJ 4PD4D 3CPWO 1BDCA 2XNDH 2NPSD 4H0LD 1JY3O 2Z4EA 1LWUB 1N2DC 1R5SA 1N7SD 2A45H 3L71G 3V4WA 1Q7YQ 2SPZA 2ZXXA 3HE5A 2OYIB 4Y99B 5GTIE 1HVVA 1BCCE 3WUUA 1NO4A 1UIXA 3HE5B 1NTKJ 3P8CD 1U7JA 1SQQG 4IOIH 2R5DA 1L0NK 5APTA 1YI2P 2W8ZA 2E42A 1N7SB 3LIDA 3ITKA 2L91A 5AW9B 3H1IE 1VF5B 3L73G 3M91A 4PV1B 2R44A 3TNUB 1NKZB 3V6IA 4RJTA 3O8ZA 1LTSC 1L0NE 1N8RQ 3N4XA 3L74J 1YJ9P 2E43A 2KS1B 1DD4A 1LGHB 1W2EA 1RH5B 4U3FG 5GTHH 3H1ID 1JTHA 2O01J 3MUDA 3I5CA 1Q86Q 4JYCA 3RK2D 1BE3G 3VTPC 3CCUP 1PV3A 2QIWA 1QVGO 1U57A 3H6PA 1BCCD 3HD7B 1KMIZ 3H32B 2QJPB 1SFCD 3RK3B 3CI9A 3L4FA 3V2PA 1Q2NA 3TYYA 1BDDA 5TISE 1GD2E 1IC2A 1S2EA 3TGUG 4NPFX 1LTJA 1IFPA 5KLVD 1MFZA 1LWUA 1SQXJ 1XTCC 3L72D 4OWFA 4W7ZA 3NMDA 1VQ7P 3CWBD 2KZJA 2ZT9B 1M1KQ 1OVUA 2L5GB 1NYHA 1URQB 3GMAA 4EIJA 2K1AA 1X8YA 1AFOA 1EZVG 1NGMB 3AE5C 2WSSH 2ZVNB 1OFCX 1SQQD 3BASA 5CBNA 1AA0A 3GLMA 1OVRA 1PPJG 1X22A 1SQBE 3H32A 1NAYA 2K88A 2O3JA 1GTWA 5GTHE 2AEJA 1S5LE 2Q5UA 3M0AA 1SQQE 3ABVC 5CMZA 3H1HJ 2HG5D 3U1CA 2OYHB 1S1CX 3SWFA 1SQXE 4D6TJ 2IFMA 3FWNA 4C46A 1GU5A 3H1LD 1SQQK 1M8OB 2H8PD 2IX7C 3B5NB 3RK2C 2KP8A 4ZNCA 1SQVK 1RY3A 3K5BA 1URQA 4N78E 2FXOA 4M3LA 1JY3P 3RL0g 3TNUA 2P1JA 2J58A 3FWLA 4LGDE 2OYHA 2O1KA 2XV5A 1SQBJ 3GF7A 1X79B 1RF1C 3VYIA 1A02F 1HF9A 3USSA 2WPQA 5E79H 2ITAA 2KLVA 4QMAA 1RF0A 1SQVD 2CK3H 1RQUA 5CCGD 4L74A 1RF0C 2AXCA 1FZCA 1L4AC 3H1HG 2Y0DA 1SVFA 4R4LA 1G2CA 5CHXA 3V4QA 3HE4B 2B87A 2KNCB 3AE1C 3A2AA 3KPEA 4PJ0E 4DZOA 5APUA 1N7SC 1OWAA 2Z5IA 3CMEP 1YBKA 3CWBG 3NFQA 1ZP0C 2H88C 2XDJA 4XA4A 2E74C 5DJUB 5AW3B 5BU8B 3H1KG 1N7LA 1FDIA 3BCCG 5AW4B 3TDKA 1EZVD 3TSIA 4BRYA 5AVZB 1P84H 2H7HA 4I2LC 1LNQA 1SQBG 1X0TA 2K37A 2QJPC 1Y8AA 3EWKA 5KAFH 1NTME 4IFFA 2WPVB 1RQVA 4WY4A 3MTUE 2QJYC 2A06E 3RK2B 1EXJA 3KZIE 1L0LG 2ZAEB 3P32A 2A06G 1IFMA 1E79H 3CD6P 3QH9A 1XTGB 3OJAB 2KS1A 1LT9A 1L2PA 1OW7A 2FXMA 3AE9C 4H13B 3S4RA 5KJ7C 1IK7A 2JJLA 2YIUC 3NXSA 2LR2A 1S9KE 4ZKUA 4AYCA 2O1JA 1FS0E 1FZBA 1S5LX 3HE4A 5KJ7A 1RF1A 3SSUA 5B66H 5BU5A 2RKLA 2E75C 2RN0A 2YXRB 3G3ZA 3O6QA 4H13D 3TF5A 3L37A 3AE4C 1T8ZA 4JF7A 5APSA 3BCCE 2C9NY 1PPJE 4ASVA 1K05A 1BSNA 2A45G 3CX5D 3H1JD 3S1KA 3OAKA 3KYQA 4TT3H 2FYZA 1GK4A 4LC1A 2YMKA 2KUBA 3AEGC 1SQXG 5CCHC 1Z56A 1SFCB 1VDFA 3RK3D 1HUCA 2WTYA 2OYHC 3L74D 5AVWB 1NWQA 1KB9H 3L72G 1EZVI 1GZLA 2J5UA 2I8DA 3B5NA 3L72E 1NTMK 2N1TD 4CPGA 4EYYQ 1AVOA 2KOGA 3LW5J 3CLQA 2IYPA 3RGUA 1ZOYC 1JMBA 3BCCD 1N73B 2YIUB 1YJWP 1K9MQ 2N9YB 3W68A 5B66E 1M56D 5C39A 3L70J 2I1KA 3CCRP 4H44D 4C7NA 1GDTA 1JO5A 3JCUE 3VMZA 1ZV8A 2QA4P 5AVXB 2P67A 2OYIC 4O9BA 2QM7A 3Q5SA 4WVZA 5H2FE 1EDLA 5M1BA 1KORA 3AE8C 1JY3N 1QGKB 1GW3A 2E5TA 1LP1A 3SFDC 1M1JA 1LTGC 4D6TD 1NTKE 1L4AB 2JDIH 2PP6A 3H1JG 1M1JC 4MN4C 2ZFCA 3U59A 3W67A 1HJBA 1NU1K 2IYOA 1JEKA 3GF3A 2NPSB 1QEXA 2ZYDA 2KK7A 4R4MA 3JSVC 1QL2A 3A0BE 1VQ9P 2IBZG 3HD7A 1W5CE 2E5YA 3CXHH 1NH4A 1BCCG 2OGUA 3I55P 1OMIA 4AQRD 4I7ZB 1LJ2A 4IL6E 1KILC 4OGQC 5APWA 3FX0A 3IAOA 2HLOA 2P10A 1NU1D 1WMKA 4DJGA 3CCQP 1HTLC 2KSJA 2H43A 3T97B 3SWKA 1RE3A 3BRTB 4H0LC 3RBZA 1URQC 2ZT9D 2WT7A 2D2CB 3H25A 2FBWC 2K3RA 2W6JH 1USDA 4PD4E 5TISH 4Y28J 1KFMA 1NVOA 3C1LA 5H2FH 2LKMA 3HD7D 3H1KD 1NJIQ 1JM0A 1SP4A 2O01N 2W27A 4ASWA 2GM4A 1ZRTE 5CCHA 2B9BA 2IZ1A 1EC5A 2Y0CA 2A45I 3Q1MA 1AJYA 3WUVA 2WSFJ 1NTMD 4JQ0D 1DX7A 1J1EB 3V2NA 2Z5HA 1ZRTD 4D6TG 3CX5I 5AVRB 3B5NC 3V2QA 5KKZC 2QM8A 2FFDC 1RE4C 2BCCE 3MUDC 1YTZT 2DW3A 2WPSA 1FZCC 3PTZA 4DOJA 2BCCG 2N1TB 2V7QH 3M9QA 1KYOE 1T2KD 1NKNA 1UIIA 1EDIA 3S9OA 2E76B 3A5TA 3CC7P 1GL2A 2M3EA 2YNYA 5B5EH 1IZNB 1KFNA 1S4XA 1JB0J 3KHUA 2V4HA 1GL2C 4GT1A 1YHQP 1YQ3C 2GUSA 3F89A 3L75D 5TJHA 3CCSP 2E76D 2W6AA 2Y0EA 2KZIA 1KILB 1FJKA 3L75G 2I1JA 2JEEA 4OGQB 4U3FD 5DJTB 2M0BA 3AEEC 3L70G 4WY4C 5AW5B 3VOPA 3A0HH 3L75E 3PH0A 4EI2A 2FYNB 1SQQJ 2BCCJ 4Z1MH 5KAIH 2XKMA 2N9BA 2QEXP 3E1RA 1BE3D 3BATA 3HTKA 4Y99C 4D6TE 3L35A 3TGUE 4W7YA 4U7JA 4UB8E 1VQOP 5APQA 3RK3E 3IF4A 1FJPA 2ZYAA 1PL5A 1JMMA 3E1IA 3P8MC 1EQ7A 4H44B 4HH2A 4RKUJ 5AVYB 4KJMA 5AW2B 3CC4P 1EXIA 2P2UA 1JY2N 5AVQB 3M06A 4RESB 3PRJA 5KTBA 4AUWA 4IL6X 1H0TA 1KD1Q 3RL0D 2WSCJ 1LTAC 1URQD 2ZT9C 5KLVG 3VMYA 2M5AA 1P84E 4PV1D 3L75J 5KLIB 4KT0J 1YIJP 1VQ4P 2C9LY 4PJ0H 1QX8A 5KKZB 4WBAA 2PAJA 2P58A 4JYBA 5AW6B 1VF5C 2QE7H 1P84I 2MKVA 2R3CA 3BRVB 4C7NB 3L73E 2OTKE 2D2CD 2WQYC 4KHXA 3H1LG 1NTKG 1NTZE 1PGJA 1ZN5A 2GUVA 2JR8A 2M3BA 3A0HE 1YTZI 1GK6A 3H1IG 3G6EP 1FDOA 3Q2YA 1JNMA 1IJDB 1VQKP 2IDBA 2FFDA 2D2CC 3HUSB 3N7NA 4N78D 4XE5B 2QG4A 3WU2E 1KQSO 2YXQB 1PFIA 1KV4A 2Q1KA 2FYNC 1HWTC 3CL3D 2B88A 3L71E 4K3AA 1VQNP 3CCMP 5AVVB 1SFCA 1LT1A 3CXHI 3KXDA 4I1LA 1FC2C 1H88A 1FZAA 4HKZH 4NPDA 1CSBA 4HB1A 3P7KA 2R5BA 5AVUB 3R4YA 1NTZJ 2KB7P 3H1HD 1CI6A 1LTJC 1MV8A 1VPCA 3B8EB 3RL0C 2WITA 2XU6A 2HODB 3P8CE 2KSEA 1MFTA 3H1LJ 1JCDA 4RO0A 1Q82Q 4BXLA 3O6QB 2Q6QA 3CC2P 2ZXEB 1LWUC 4I6MC 2WZ7A 1K8AQ 2Q9IA 1J1EC 2ZYGA 2ZVOB 1JY2O 1OW6A 1LT9C 1SS1A 2BEZF 2WSEH 1KZUB 3OW2O 3D6YA 2K9JA 2WSCH 1EZVE 1OX3A 3FGAD 1LTBC 1L0LK 1E5WA 4ZKPA 3VMAA 2AXTH 1HH0A 1YQ4C 2E76C 3V5BA 1PGQA 3JC22 2HPCA 1X9VA 2FKWB 3PJSK 2YMYA 1EDKA 1SQPG 3G71P 1KILA 3AE2C 4L75A 1W2BO 1DEEG 3CXHD 5CBOA 2O01H 1KQFB 2QVAA 4YPCA 4BRYB 1ZR2A 3BVHA 1ZLLA 2NPSA 3M0DC 1VQ6P 3F5HA 2E75D 2PFXA 3L72J 4H13C 4YTPC 2J59M 3EFFK 1ZMEC 1VQMP 1Q90D 1PP9J 2C0WA 2CPSA 1Y9BA 3AE6C 3B5ND 3FXEA 1NTZG 2N1TA 1TU3F 3EQ2A 3A0BH 2VRSA 4LLHA 1AVYA 1G1IA 2HODA 2H89C 5BVZA 2Y9ZA 4WWIA 1VL2A 1OIPA 4TLFA 5AW0B 1ZXGA 1DH3A 1SQBK 4H0LB 3V2RA 2M5AB 2JP3A 3PLNA 5AVTB 5AW7B 1N73C 4BWNA 1L0LJ 2FXPA 1RHZB 3CXHE 1RE4A 2AXTE 5AW8B 1PP9E 1FE6A 1HGVA 1FBMA 1T3JA 2K9YA 2P7JA 1QLED 3CWBE 1L0NJ 3NTNA 2QRXA 3L74E 1IFJA 1PP9G 4IL6H 1PPJD 3HUSA 5GTIH 4NPEA 1H89A 3EFGA 3MZWB 2WT7B 3L74G 1CI6B 3HUSC 1SQBD 1D7MA 3GHGB 1DIPA 4ZMDA 2OARA 1PZQA 5AVSB 1VQLP 2NZ2A 3GG2A 3AEBC 1HGZA 4PD4H 1ZW0A 1WRGA 3KQGA 2BEQD 4DT0A 1N86A 2R32A 3CMAP 1L0LE 1J1DB 3VP8A 2OTLP 2HFED 1LTTC 1NTMG 4OVNF 3GHGA 1T3UA 2KYVA 1R5LA 3CWBJ 4WY4D 1KYOH 2Y9YA 4L73A 5EFWB 1L0LD 1SQPJ 5APXA 2RH0A 1HBWA 2AEMA 1OVVA 2BASA 4L76A 3MP7B 3VN0A 3MHVA 1M1JB 1OXZA 1M90Q 1IO4A 3QWOC 3C8VA 4PD4I 1P84D 3B71A 4HYTB 4GIFA 1LT9B 4JPZB 1T2KC 5KAFE 1S3JA 3CCEP 1FZFA 1KQLA 1G1JA 3H1KJ 1K73Q 2POHA 1QVFO 2KLUA 3L70D 1MUUA 4A7PA 4B86A 2PRRA 1SQVE 2FYUJ 4UB6E 4DCKA 4GKGA 4N6JA 4W80A 4EDFA 3JCUH 3AEFC 1SQPE 4UB8H 2KI7B 3H1HE 1FDMA 2C0XA 3IR9A 1H0TB 2JO1A 4YXWH 1NTZD 1DD3A 3U1AA 3VMXA 2Q7CA 1U7MA 2FFDB 1NU1E 2WVRA 3A7OA 1R8EA 2Q3EA 1KQGB 1HJ0A 4N3YB 4XFJA 2FYUK 1NAFA 2YO2A 1AQTA 1BGYG 5K5GB 3HTKB 2M8RA 3H1KE 5APYA 3L71D 2XNXA 1DEBA 1NTKK 1T6AA 3IN6A 3MGNA 1YJNP 1SQVJ 1OW8A 2FYUE 3H1JJ 1GU4A 2HPCB 1N7SA 2A06D 2OYOA 2WWWA 1Q81Q 2YKQA 3TK1A 4YXDC 3D71A 1FZCB 1SFCC 3SWYA 2E74B 1KILD 2QJKB 3II6A 4OGQD 5CJ0A 2ZJSE 2K9JB 2W6BA 1S5LH 1EDJA 2FYUD 3TGUJ 1SQPD 5APVA 1S9KD 1NU1J 2OYIA 1JOCA 2BCCD 2WSFH 3SFEC 3AE7C 3G4SP 1A02J 1AV1A 1VQ8P 3ZDMA 1KYOI 4UB6H 2B87B 2KNCA 3M9HA 2QJYB 2YO3A 3PP5A 4K35A 1JCCA 1G2CB 3WU2H 1YITP 3VP9A 2R3SA 3GHGC 1RF1B 1WT6A 1KYOD 1YYCA 2GA1A 1SQXK 3CX5E 3H1JE 2QSIA 2V7QJ 3AEDC 1IK9A 2NRGA 2WPRA 5AW1B 1SQPK 2W90A 3C9IA 4U3FJ 3MIWA 3D6ZA 1AQ5A 2CPBA 1VF5D 2HYNA 2KXPB 5E79E 3CCLP 1MKMA 1SQVG 1NTMJ 2JWAA 1BE3J 1KILE 1M7LA 3PHLA 2FY8A 3L73J 4WY4B 2E74D 1SLQA 4PV1C 2PGDA 4H44C 3RBXA 1KC8Q 3OA7A 1RE3C 1NHLA 1SQXD 2JKVA 4GOEA 3TGUD 1VQPP 1KTMA 3LW5H 1BGYD 4GODA 2RMZA 1NU1G 5KLIC 1J2JB 1LTIC 1PP9D 1IFNA 1IFDA 2NPSC 3M0DA 3MD0A 3T97A 3HRNA 1ZR4A 1FZGA 1BSHA 1L4AD 2N1TC 5B5EE 4U3FE 4IFDK 3A3YB 1BGYE 3IFMA 1KB9I 1L0ND 2WMMA 3L71J 5CCGC 1JY2P 2W83C 2XZRA 4HJGH 1NTZK 3CCVP 3R2PA 3LIEA 3I56P 1H8AA 2FYUG 5CCGA 1BE3E 3BCCJ 4I7ZC 3UIAA 1FU1A 3RK3C 1FAVA 2YKPA 5CCHD 3CX5H 1FOSE 2G8YA 3GW6A 3G9RA 1GMJA 5KAIE 1S72P 2LXCB 3L73D 2OTJP 1NTKD 1PGPA 1M57D 3H1LE 3KZIH 2JWDA 1GL2D 1N73A 1L4AA 1CW5A 3L36A 2IBZI 4IFMA 3WMM0 3E7KA 2WSEJ 3AEAC 1JUNA 1LP1B 1BGYJ 2LXBA 3D70A 1FOSF 3KDPB 4GDOA 4WB4A 2OQQA 1JTHB 1K04A 1LTJB 1QL1A 3RL0B 2IBZD 3WUTA 5CJ4A 1KN7A 5KLVE 2IFNA 3FXDA 1J1DC 2Q3IA 3AE3C 5KJ7D 2AEFA 4OH8B 2E75B 2KIKA 2IBZE 2QJKC 4JBZA 5KLVK 1USEA 1FZEA 4C7RA 1KB9E 3L70E 1IFIA 2IZ0A 3M9BA 4GOFA 3CCJP 2IPPA 5L8RJ 2MJZA 1BCCJ 1CZQA 2UWJE 3AECC 1PIXA 1MZ9A 2B89A 3B4SA 3Q3DA 1Y47A 3Q5PA 3HD7C
chains in the Genus database with same CATH topology
1GW4A 1GL2B 1RF1C 4EOTA 2YKOA 1NOHA 2NPSD 1JY3O 2Z4EA 1LWUB 1N2DC 3V4WA 1N7SD 2A45H 3HE5A 2OYIB 4Y99B 1HVVA 1NO4A 3HE5B 3P8CD 2R5DA 1L0NK 5APTA 1N7SB 3LIDA 5AW9B 3M91A 3TNUB 1NKZB 3O8ZA 1LTSC 3N4XA 2E43A 1LGHB 1W2EA 1JTHA 3MUDA 3I5CA 4JYCA 3RK2D 3VTPC 3H6PA 3HD7B 3H32B 1SFCD 3RK3B 3CI9A 3L4FA 3V2PA 3TYYA 1GD2E 1IC2A 1LTJA 1MFZA 1LWUA 1XTCC 4W7ZA 3NMDA 2L5GB 4EIJA 1URQB 1X8YA 1AFOA 3BASA 3H32A 1GTWA 2Q5UA 3M0AA 5CMZA 2HG5D 3U1CA 2OYHB 3SWFA 2IFMA 4C46A 1GU5A 1SQQK 2H8PD 3B5NB 2IX7C 3RK2C 2KP8A 1SQVK 1RY3A 1URQA 4N78E 4M3LA 1JY3P 3TNUA 2P1JA 2J58A 4LGDE 2OYHA 2O1KA 2XV5A 1X79B 3VYIA 1A02F 2WPQA 2KLVA 1RF0A 5CCGD 1RF0C 1FZCA 1L4AC 1SVFA 1G2CA 3V4QA 3HE4B 3KPEA 3A2AA 4DZOA 5APUA 1N7SC 1OWAA 2Z5IA 3NFQA 2XDJA 4XA4A 5AW3B 5BU8B 1N7LA 5AW4B 3TSIA 5AVZB 2H7HA 4I2LC 4IFFA 4WY4A 3MTUE 3RK2B 3P32A 1IFMA 1XTGB 3OJAB 1LT9A 2FXMA 5KJ7C 1S9KE 2JJLA 3NXSA 4ZKUA 4AYCA 2O1JA 1FZBA 3HE4A 5KJ7A 1RF1A 5BU5A 3G3ZA 3L37A 1T8ZA 4JF7A 2C9NY 2A45G 3OAKA 3KYQA 2FYZA 1GK4A 4LC1A 5CCHC 1Z56A 1SFCB 1VDFA 3RK3D 1HUCA 2WTYA 2OYHC 5AVWB 1NWQA 1GZLA 3B5NA 1NTMK 2N1TD 2KOGA 3CLQA 1N73B 2I1KA 4C7NA 1GDTA 1JO5A 3VMZA 1ZV8A 5AVXB 2P67A 2OYIC 4O9BA 2QM7A 1JY3N 1GW3A 1M1JA 1LTGC 1L4AB 2PP6A 1M1JC 3U59A 2ZFCA 1HJBA 1NU1K 2NPSB 1QL2A 3HD7A 1NH4A 4AQRD 1KILC 5APWA 2HLOA 1HTLC 2KSJA 2H43A 1RE3A 3BRTB 1URQC 2WT7A 1KFMA 3HD7D 2LKMA 1SP4A 2W27A 2GM4A 5CCHA 2A45I 1DX7A 1J1EB 3V2NA 2Z5HA 2FFDC 5AVRB 3B5NC 3V2QA 2QM8A 1RE4C 1YTZT 2WPSA 1FZCC 4DOJA 2N1TB 3M9QA 1T2KD 1NKNA 3A5TA 1GL2A 2YNYA 1KFNA 1FZFA 1GL2C 4GT1A 2GUSA 2W6AA 1KILB 1FJKA 2I1JA 2JEEA 5AW5B 4WY4C 3VOPA 2XKMA 2N9BA 3BATA 3HTKA 4Y99C 3L35A 4W7YA 5APQA 1FJPA 2FFDB 3P8MC 1JMMA 3E1IA 4HH2A 1EQ7A 5AVYB 5AW2B 2P2UA 1JY2N 5AVQB 3M06A 4RESB 5KTBA 4AUWA 3RL0D 1LTAC 1URQD 3VMYA 2C9LY 4WBAA 2PAJA 4JYBA 5AW6B 2R3CA 3BRVB 4C7NB 4KHXA 2GUVA 1ZN5A 2M3BA 1YTZI 1GK6A 1JNMA 1IJDB 2FFDA 3HUSB 3N7NA 4N78D 4XE5B 1PFIA 1HWTC 3CL3D 5AVVB 1SFCA 4I1LA 1H88A 1FZAA 1CSBA 3P7KA 2R5BA 5AVUB 2KB7P 1CI6A 1LTJC 1MV8A 1VPCA 3B8EB 3RL0C 2WITA 2XU6A 2HODB 3P8CE 1JCDA 2ZXEB 1LWUC 4I6MC 2WZ7A 2Q9IA 1J1EC 1JY2O 1LT9C 2WSEH 1KZUB 2WSCH 1LTBC 1L0LK 1E5WA 4ZKPA 1HH0A 3V5BA 2HPCA 1X9VA 2FKWB 2YMYA 1KILA 2O01H 1ZR2A 3BVHA 1ZLLA 2NPSA 3M0DC 2J59M 2C0WA 2CPSA 3B5ND 2N1TA 3EQ2A 4LLHA 2VRSA 1G1IA 2HODA 5BVZA 5AW0B 1DH3A 1SQBK 3V2RA 5AVTB 5AW7B 1N73C 1RE4A 5AW8B 2P7JA 1HGVA 1FBMA 1T3JA 3NTNA 5APSA 1IFJA 3HUSA 1H89A 3EFGA 2WT7B 1CI6B 3HUSC 3GHGB 2OARA 5AVSB 1HGZA 3KQGA 1WRGA 1N86A 2R32A 1J1DB 3VP8A 2HFED 1LTTC 3GHGA 1T3UA 2KYVA 4WY4D 5APXA 1HBWA 2BASA 3VN0A 1M1JB 1OXZA 1IO4A 4HYTB 4GIFA 1LT9B 1T2KC 1KQLA 1G1JA 2POHA 1MUUA 4B86A 2E42A 4GKGA 4N6JA 4W80A 1FDMA 2C0XA 3IR9A 3U1AA 3VMXA 2Q7CA 3A7OA 4N3YB 2FYUK 1NAFA 2YO2A 3HTKB 2M8RA 5APYA 2XNXA 1DEBA 1NTKK 3MGNA 1GU4A 2HPCB 1N7SA 2WWWA 2YKQA 3TK1A 1FZCB 1SFCC 3SWYA 5CJ0A 1KILD 3II6A 2W6BA 5APVA 1S9KD 2OYIA 1JOCA 2WSFH 1A02J 3PP5A 3M9HA 2YO3A 1JCCA 1G2CB 3VP9A 3GHGC 1RF1B 1WT6A 1YYCA 1SQXK 1IK9A 2WPRA 5AW1B 1SQPK 3C9IA 3MIWA 1AQ5A 2CPBA 2HYNA 4WY4B 1M7LA 1SLQA 3OA7A 1RE3C 1NHLA 3LW5H 1J2JB 1LTIC 1IFNA 1IFDA 2NPSC 3M0DA 3MD0A 3T97A 3HRNA 1ZR4A 1FZGA 1CW5A 1L4AD 2N1TC 4IFDK 3A3YB 3IFMA 5CCGC 1JY2P 2XZRA 1NTZK 1H8AA 3R2PA 3LIEA 5CCGA 3UIAA 1FU1A 3RK3C 1FAVA 2YKPA 5CCHD 1FOSE 1GL2D 1N73A 1L4AA 3L36A 3WMM0 4IFMA 1JUNA 1FOSF 3KDPB 4WB4A 1JTHB 1LTJB 1QL1A 3RL0B 5CJ4A 2IFNA 1J1DC 2Q3IA 5KJ7D 4OH8B 5KLVK 1FZEA 4C7RA 1IFIA 3M9BA 2IPPA 2MJZA 1CZQA 1MZ9A 5CHXA 3HD7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J1E B;  1J1D B;  1J1D C;  4Y99 C;  1YTZ I;  1J1E C;  1YTZ T;  4Y99 B; 
#chains in the Genus database with same CATH topology
 1PGO A;  1KB9 D;  1GW4 A;  1L0N G;  1OZH A;  1GL2 B;  2G3A A;  3Q5R A;  5KLV J;  4EOT A;  2YKO A;  1VQ5 P;  1NOH A;  2HR3 A;  3H1I J;  4PD4 D;  3CPW O;  1BDC A;  2XND H;  2NPS D;  4H0L D;  1JY3 O;  2Z4E A;  1LWU B;  1N2D C;  1R5S A;  1N7S D;  2A45 H;  3L71 G;  3V4W A;  1Q7Y Q;  2SPZ A;  2ZXX A;  3HE5 A;  2OYI B;  4Y99 B;  5GTI E;  1HVV A;  1BCC E;  3WUU A;  1NO4 A;  1UIX A;  3HE5 B;  1NTK J;  3P8C D;  1U7J A;  1SQQ G;  4IOI H;  2R5D A;  1L0N K;  5APT A;  1YI2 P;  2W8Z A;  2E42 A;  1N7S B;  3LID A;  3ITK A;  2L91 A;  5AW9 B;  3H1I E;  1VF5 B;  3L73 G;  3M91 A;  4PV1 B;  2R44 A;  3TNU B;  1NKZ B;  3V6I A;  4RJT A;  3O8Z A;  1LTS C;  1L0N E;  1N8R Q;  3N4X A;  3L74 J;  1YJ9 P;  2E43 A;  2KS1 B;  1DD4 A;  1LGH B;  1W2E A;  1RH5 B;  4U3F G;  5GTH H;  3H1I D;  1JTH A;  2O01 J;  3MUD A;  3I5C A;  1Q86 Q;  4JYC A;  3RK2 D;  1BE3 G;  3VTP C;  3CCU P;  1PV3 A;  2QIW A;  1QVG O;  1U57 A;  3H6P A;  1BCC D;  3HD7 B;  1KMI Z;  3H32 B;  2QJP B;  1SFC D;  3RK3 B;  3CI9 A;  3L4F A;  3V2P A;  1Q2N A;  3TYY A;  1BDD A;  5TIS E;  1GD2 E;  1IC2 A;  1S2E A;  3TGU G;  4NPF X;  1LTJ A;  1IFP A;  5KLV D;  1MFZ A;  1LWU A;  1SQX J;  1XTC C;  3L72 D;  4OWF A;  4W7Z A;  3NMD A;  1VQ7 P;  3CWB D;  2KZJ A;  2ZT9 B;  1M1K Q;  1OVU A;  2L5G B;  1NYH A;  1URQ B;  3GMA A;  4EIJ A;  2K1A A;  1X8Y A;  1AFO A;  1EZV G;  1NGM B;  3AE5 C;  2WSS H;  2ZVN B;  1OFC X;  1SQQ D;  3BAS A;  5CBN A;  1AA0 A;  3GLM A;  1OVR A;  1PPJ G;  1X22 A;  1SQB E;  3H32 A;  1NAY A;  2K88 A;  2O3J A;  1GTW A;  5GTH E;  2AEJ A;  1S5L E;  2Q5U A;  3M0A A;  1SQQ E;  3ABV C;  5CMZ A;  3H1H J;  2HG5 D;  3U1C A;  2OYH B;  1S1C X;  3SWF A;  1SQX E;  4D6T J;  2IFM A;  3FWN A;  4C46 A;  1GU5 A;  3H1L D;  1SQQ K;  1M8O B;  2H8P D;  2IX7 C;  3B5N B;  3RK2 C;  2KP8 A;  4ZNC A;  1SQV K;  1RY3 A;  3K5B A;  1URQ A;  4N78 E;  2FXO A;  4M3L A;  1JY3 P;  3RL0 g;  3TNU A;  2P1J A;  2J58 A;  3FWL A;  4LGD E;  2OYH A;  2O1K A;  2XV5 A;  1SQB J;  3GF7 A;  1X79 B;  1RF1 C;  3VYI A;  1A02 F;  1HF9 A;  3USS A;  2WPQ A;  5E79 H;  2ITA A;  2KLV A;  4QMA A;  1RF0 A;  1SQV D;  2CK3 H;  1RQU A;  5CCG D;  4L74 A;  1RF0 C;  2AXC A;  1FZC A;  1L4A C;  3H1H G;  2Y0D A;  1SVF A;  4R4L A;  1G2C A;  5CHX A;  3V4Q A;  3HE4 B;  2B87 A;  2KNC B;  3AE1 C;  3A2A A;  3KPE A;  4PJ0 E;  4DZO A;  5APU A;  1N7S C;  1OWA A;  2Z5I A;  3CME P;  1YBK A;  3CWB G;  3NFQ A;  1ZP0 C;  2H88 C;  2XDJ A;  4XA4 A;  2E74 C;  5DJU B;  5AW3 B;  5BU8 B;  3H1K G;  1N7L A;  1FDI A;  3BCC G;  5AW4 B;  3TDK A;  1EZV D;  3TSI A;  4BRY A;  5AVZ B;  1P84 H;  2H7H A;  4I2L C;  1LNQ A;  1SQB G;  1X0T A;  2K37 A;  2QJP C;  1Y8A A;  3EWK A;  5KAF H;  1NTM E;  4IFF A;  2WPV B;  1RQV A;  4WY4 A;  3MTU E;  2QJY C;  2A06 E;  3RK2 B;  1EXJ A;  3KZI E;  1L0L G;  2ZAE B;  3P32 A;  2A06 G;  1IFM A;  1E79 H;  3CD6 P;  3QH9 A;  1XTG B;  3OJA B;  2KS1 A;  1LT9 A;  1L2P A;  1OW7 A;  2FXM A;  3AE9 C;  4H13 B;  3S4R A;  5KJ7 C;  1IK7 A;  2JJL A;  2YIU C;  3NXS A;  2LR2 A;  1S9K E;  4ZKU A;  4AYC A;  2O1J A;  1FS0 E;  1FZB A;  1S5L X;  3HE4 A;  5KJ7 A;  1RF1 A;  3SSU A;  5B66 H;  5BU5 A;  2RKL A;  2E75 C;  2RN0 A;  2YXR B;  3G3Z A;  3O6Q A;  4H13 D;  3TF5 A;  3L37 A;  3AE4 C;  1T8Z A;  4JF7 A;  5APS A;  3BCC E;  2C9N Y;  1PPJ E;  4ASV A;  1K05 A;  1BSN A;  2A45 G;  3CX5 D;  3H1J D;  3S1K A;  3OAK A;  3KYQ A;  4TT3 H;  2FYZ A;  1GK4 A;  4LC1 A;  2YMK A;  2KUB A;  3AEG C;  1SQX G;  5CCH C;  1Z56 A;  1SFC B;  1VDF A;  3RK3 D;  1HUC A;  2WTY A;  2OYH C;  3L74 D;  5AVW B;  1NWQ A;  1KB9 H;  3L72 G;  1EZV I;  1GZL A;  2J5U A;  2I8D A;  3B5N A;  3L72 E;  1NTM K;  2N1T D;  4CPG A;  4EYY Q;  1AVO A;  2KOG A;  3LW5 J;  3CLQ A;  2IYP A;  3RGU A;  1ZOY C;  1JMB A;  3BCC D;  1N73 B;  2YIU B;  1YJW P;  1K9M Q;  2N9Y B;  3W68 A;  5B66 E;  1M56 D;  5C39 A;  3L70 J;  2I1K A;  3CCR P;  4H44 D;  4C7N A;  1GDT A;  1JO5 A;  3JCU E;  3VMZ A;  1ZV8 A;  2QA4 P;  5AVX B;  2P67 A;  2OYI C;  4O9B A;  2QM7 A;  3Q5S A;  4WVZ A;  5H2F E;  1EDL A;  5M1B A;  1KOR A;  3AE8 C;  1JY3 N;  1QGK B;  1GW3 A;  2E5T A;  1LP1 A;  3SFD C;  1M1J A;  1LTG C;  4D6T D;  1NTK E;  1L4A B;  2JDI H;  2PP6 A;  3H1J G;  1M1J C;  4MN4 C;  2ZFC A;  3U59 A;  3W67 A;  1HJB A;  1NU1 K;  2IYO A;  1JEK A;  3GF3 A;  2NPS B;  1QEX A;  2ZYD A;  2KK7 A;  4R4M A;  3JSV C;  1QL2 A;  3A0B E;  1VQ9 P;  2IBZ G;  3HD7 A;  1W5C E;  2E5Y A;  3CXH H;  1NH4 A;  1BCC G;  2OGU A;  3I55 P;  1OMI A;  4AQR D;  4I7Z B;  1LJ2 A;  4IL6 E;  1KIL C;  4OGQ C;  5APW A;  3FX0 A;  3IAO A;  2HLO A;  2P10 A;  1NU1 D;  1WMK A;  4DJG A;  3CCQ P;  1HTL C;  2KSJ A;  2H43 A;  3T97 B;  3SWK A;  1RE3 A;  3BRT B;  4H0L C;  3RBZ A;  1URQ C;  2ZT9 D;  2WT7 A;  2D2C B;  3H25 A;  2FBW C;  2K3R A;  2W6J H;  1USD A;  4PD4 E;  5TIS H;  4Y28 J;  1KFM A;  1NVO A;  3C1L A;  5H2F H;  2LKM A;  3HD7 D;  3H1K D;  1NJI Q;  1JM0 A;  1SP4 A;  2O01 N;  2W27 A;  4ASW A;  2GM4 A;  1ZRT E;  5CCH A;  2B9B A;  2IZ1 A;  1EC5 A;  2Y0C A;  2A45 I;  3Q1M A;  1AJY A;  3WUV A;  2WSF J;  1NTM D;  4JQ0 D;  1DX7 A;  1J1E B;  3V2N A;  2Z5H A;  1ZRT D;  4D6T G;  3CX5 I;  5AVR B;  3B5N C;  3V2Q A;  5KKZ C;  2QM8 A;  2FFD C;  1RE4 C;  2BCC E;  3MUD C;  1YTZ T;  2DW3 A;  2WPS A;  1FZC C;  3PTZ A;  4DOJ A;  2BCC G;  2N1T B;  2V7Q H;  3M9Q A;  1KYO E;  1T2K D;  1NKN A;  1UII A;  1EDI A;  3S9O A;  2E76 B;  3A5T A;  3CC7 P;  1GL2 A;  2M3E A;  2YNY A;  5B5E H;  1IZN B;  1KFN A;  1S4X A;  1JB0 J;  3KHU A;  2V4H A;  1GL2 C;  4GT1 A;  1YHQ P;  1YQ3 C;  2GUS A;  3F89 A;  3L75 D;  5TJH A;  3CCS P;  2E76 D;  2W6A A;  2Y0E A;  2KZI A;  1KIL B;  1FJK A;  3L75 G;  2I1J A;  2JEE A;  4OGQ B;  4U3F D;  5DJT B;  2M0B A;  3AEE C;  3L70 G;  4WY4 C;  5AW5 B;  3VOP A;  3A0H H;  3L75 E;  3PH0 A;  4EI2 A;  2FYN B;  1SQQ J;  2BCC J;  4Z1M H;  5KAI H;  2XKM A;  2N9B A;  2QEX P;  3E1R A;  1BE3 D;  3BAT A;  3HTK A;  4Y99 C;  4D6T E;  3L35 A;  3TGU E;  4W7Y A;  4U7J A;  4UB8 E;  1VQO P;  5APQ A;  3RK3 E;  3IF4 A;  1FJP A;  2ZYA A;  1PL5 A;  1JMM A;  3E1I A;  3P8M C;  1EQ7 A;  4H44 B;  4HH2 A;  4RKU J;  5AVY B;  4KJM A;  5AW2 B;  3CC4 P;  1EXI A;  2P2U A;  1JY2 N;  5AVQ B;  3M06 A;  4RES B;  3PRJ A;  5KTB A;  4AUW A;  4IL6 X;  1H0T A;  1KD1 Q;  3RL0 D;  2WSC J;  1LTA C;  1URQ D;  2ZT9 C;  5KLV G;  3VMY A;  2M5A A;  1P84 E;  4PV1 D;  3L75 J;  5KLI B;  4KT0 J;  1YIJ P;  1VQ4 P;  2C9L Y;  4PJ0 H;  1QX8 A;  5KKZ B;  4WBA A;  2PAJ A;  2P58 A;  4JYB A;  5AW6 B;  1VF5 C;  2QE7 H;  1P84 I;  2MKV A;  2R3C A;  3BRV B;  4C7N B;  3L73 E;  2OTK E;  2D2C D;  2WQY C;  4KHX A;  3H1L G;  1NTK G;  1NTZ E;  1PGJ A;  1ZN5 A;  2GUV A;  2JR8 A;  2M3B A;  3A0H E;  1YTZ I;  1GK6 A;  3H1I G;  3G6E P;  1FDO A;  3Q2Y A;  1JNM A;  1IJD B;  1VQK P;  2IDB A;  2FFD A;  2D2C C;  3HUS B;  3N7N A;  4N78 D;  4XE5 B;  2QG4 A;  3WU2 E;  1KQS O;  2YXQ B;  1PFI A;  1KV4 A;  2Q1K A;  2FYN C;  1HWT C;  3CL3 D;  2B88 A;  3L71 E;  4K3A A;  1VQN P;  3CCM P;  5AVV B;  1SFC A;  1LT1 A;  3CXH I;  3KXD A;  4I1L A;  1FC2 C;  1H88 A;  1FZA A;  4HKZ H;  4NPD A;  1CSB A;  4HB1 A;  3P7K A;  2R5B A;  5AVU B;  3R4Y A;  1NTZ J;  2KB7 P;  3H1H D;  1CI6 A;  1LTJ C;  1MV8 A;  1VPC A;  3B8E B;  3RL0 C;  2WIT A;  2XU6 A;  2HOD B;  3P8C E;  2KSE A;  1MFT A;  3H1L J;  1JCD A;  4RO0 A;  1Q82 Q;  4BXL A;  3O6Q B;  2Q6Q A;  3CC2 P;  2ZXE B;  1LWU C;  4I6M C;  2WZ7 A;  1K8A Q;  2Q9I A;  1J1E C;  2ZYG A;  2ZVO B;  1JY2 O;  1OW6 A;  1LT9 C;  1SS1 A;  2BEZ F;  2WSE H;  1KZU B;  3OW2 O;  3D6Y A;  2K9J A;  2WSC H;  1EZV E;  1OX3 A;  3FGA D;  1LTB C;  1L0L K;  1E5W A;  4ZKP A;  3VMA A;  2AXT H;  1HH0 A;  1YQ4 C;  2E76 C;  3V5B A;  1PGQ A;  3JC2 2;  2HPC A;  1X9V A;  2FKW B;  3PJS K;  2YMY A;  1EDK A;  1SQP G;  3G71 P;  1KIL A;  3AE2 C;  4L75 A;  1W2B O;  1DEE G;  3CXH D;  5CBO A;  2O01 H;  1KQF B;  2QVA A;  4YPC A;  4BRY B;  1ZR2 A;  3BVH A;  1ZLL A;  2NPS A;  3M0D C;  1VQ6 P;  3F5H A;  2E75 D;  2PFX A;  3L72 J;  4H13 C;  4YTP C;  2J59 M;  3EFF K;  1ZME C;  1VQM P;  1Q90 D;  1PP9 J;  2C0W A;  2CPS A;  1Y9B A;  3AE6 C;  3B5N D;  3FXE A;  1NTZ G;  2N1T A;  1TU3 F;  3EQ2 A;  3A0B H;  2VRS A;  4LLH A;  1AVY A;  1G1I A;  2HOD A;  2H89 C;  5BVZ A;  2Y9Z A;  4WWI A;  1VL2 A;  1OIP A;  4TLF A;  5AW0 B;  1ZXG A;  1DH3 A;  1SQB K;  4H0L B;  3V2R A;  2M5A B;  2JP3 A;  3PLN A;  5AVT B;  5AW7 B;  1N73 C;  4BWN A;  1L0L J;  2FXP A;  1RHZ B;  3CXH E;  1RE4 A;  2AXT E;  5AW8 B;  1PP9 E;  1FE6 A;  1HGV A;  1FBM A;  1T3J A;  2K9Y A;  2P7J A;  1QLE D;  3CWB E;  1L0N J;  3NTN A;  2QRX A;  3L74 E;  1IFJ A;  1PP9 G;  4IL6 H;  1PPJ D;  3HUS A;  5GTI H;  4NPE A;  1H89 A;  3EFG A;  3MZW B;  2WT7 B;  3L74 G;  1CI6 B;  3HUS C;  1SQB D;  1D7M A;  3GHG B;  1DIP A;  4ZMD A;  2OAR A;  1PZQ A;  5AVS B;  1VQL P;  2NZ2 A;  3GG2 A;  3AEB C;  1HGZ A;  4PD4 H;  1ZW0 A;  1WRG A;  3KQG A;  2BEQ D;  4DT0 A;  1N86 A;  2R32 A;  3CMA P;  1L0L E;  1J1D B;  3VP8 A;  2OTL P;  2HFE D;  1LTT C;  1NTM G;  4OVN F;  3GHG A;  1T3U A;  2KYV A;  1R5L A;  3CWB J;  4WY4 D;  1KYO H;  2Y9Y A;  4L73 A;  5EFW B;  1L0L D;  1SQP J;  5APX A;  2RH0 A;  1HBW A;  2AEM A;  1OVV A;  2BAS A;  4L76 A;  3MP7 B;  3VN0 A;  3MHV A;  1M1J B;  1OXZ A;  1M90 Q;  1IO4 A;  3QWO C;  3C8V A;  4PD4 I;  1P84 D;  3B71 A;  4HYT B;  4GIF A;  1LT9 B;  4JPZ B;  1T2K C;  5KAF E;  1S3J A;  3CCE P;  1FZF A;  1KQL A;  1G1J A;  3H1K J;  1K73 Q;  2POH A;  1QVF O;  2KLU A;  3L70 D;  1MUU A;  4A7P A;  4B86 A;  2PRR A;  1SQV E;  2FYU J;  4UB6 E;  4DCK A;  4GKG A;  4N6J A;  4W80 A;  4EDF A;  3JCU H;  3AEF C;  1SQP E;  4UB8 H;  2KI7 B;  3H1H E;  1FDM A;  2C0X A;  3IR9 A;  1H0T B;  2JO1 A;  4YXW H;  1NTZ D;  1DD3 A;  3U1A A;  3VMX A;  2Q7C A;  1U7M A;  2FFD B;  1NU1 E;  2WVR A;  3A7O A;  1R8E A;  2Q3E A;  1KQG B;  1HJ0 A;  4N3Y B;  4XFJ A;  2FYU K;  1NAF A;  2YO2 A;  1AQT A;  1BGY G;  5K5G B;  3HTK B;  2M8R A;  3H1K E;  5APY A;  3L71 D;  2XNX A;  1DEB A;  1NTK K;  1T6A A;  3IN6 A;  3MGN A;  1YJN P;  1SQV J;  1OW8 A;  2FYU E;  3H1J J;  1GU4 A;  2HPC B;  1N7S A;  2A06 D;  2OYO A;  2WWW A;  1Q81 Q;  2YKQ A;  3TK1 A;  4YXD C;  3D71 A;  1FZC B;  1SFC C;  3SWY A;  2E74 B;  1KIL D;  2QJK B;  3II6 A;  4OGQ D;  5CJ0 A;  2ZJS E;  2K9J B;  2W6B A;  1S5L H;  1EDJ A;  2FYU D;  3TGU J;  1SQP D;  5APV A;  1S9K D;  1NU1 J;  2OYI A;  1JOC A;  2BCC D;  2WSF H;  3SFE C;  3AE7 C;  3G4S P;  1A02 J;  1AV1 A;  1VQ8 P;  3ZDM A;  1KYO I;  4UB6 H;  2B87 B;  2KNC A;  3M9H A;  2QJY B;  2YO3 A;  3PP5 A;  4K35 A;  1JCC A;  1G2C B;  3WU2 H;  1YIT P;  3VP9 A;  2R3S A;  3GHG C;  1RF1 B;  1WT6 A;  1KYO D;  1YYC A;  2GA1 A;  1SQX K;  3CX5 E;  3H1J E;  2QSI A;  2V7Q J;  3AED C;  1IK9 A;  2NRG A;  2WPR A;  5AW1 B;  1SQP K;  2W90 A;  3C9I A;  4U3F J;  3MIW A;  3D6Z A;  1AQ5 A;  2CPB A;  1VF5 D;  2HYN A;  2KXP B;  5E79 E;  3CCL P;  1MKM A;  1SQV G;  1NTM J;  2JWA A;  1BE3 J;  1KIL E;  1M7L A;  3PHL A;  2FY8 A;  3L73 J;  4WY4 B;  2E74 D;  1SLQ A;  4PV1 C;  2PGD A;  4H44 C;  3RBX A;  1KC8 Q;  3OA7 A;  1RE3 C;  1NHL A;  1SQX D;  2JKV A;  4GOE A;  3TGU D;  1VQP P;  1KTM A;  3LW5 H;  1BGY D;  4GOD A;  2RMZ A;  1NU1 G;  5KLI C;  1J2J B;  1LTI C;  1PP9 D;  1IFN A;  1IFD A;  2NPS C;  3M0D A;  3MD0 A;  3T97 A;  3HRN A;  1ZR4 A;  1FZG A;  1BSH A;  1L4A D;  2N1T C;  5B5E E;  4U3F E;  4IFD K;  3A3Y B;  1BGY E;  3IFM A;  1KB9 I;  1L0N D;  2WMM A;  3L71 J;  5CCG C;  1JY2 P;  2W83 C;  2XZR A;  4HJG H;  1NTZ K;  3CCV P;  3R2P A;  3LIE A;  3I56 P;  1H8A A;  2FYU G;  5CCG A;  1BE3 E;  3BCC J;  4I7Z C;  3UIA A;  1FU1 A;  3RK3 C;  1FAV A;  2YKP A;  5CCH D;  3CX5 H;  1FOS E;  2G8Y A;  3GW6 A;  3G9R A;  1GMJ A;  5KAI E;  1S72 P;  2LXC B;  3L73 D;  2OTJ P;  1NTK D;  1PGP A;  1M57 D;  3H1L E;  3KZI H;  2JWD A;  1GL2 D;  1N73 A;  1L4A A;  1CW5 A;  3L36 A;  2IBZ I;  4IFM A;  3WMM 0;  3E7K A;  2WSE J;  3AEA C;  1JUN A;  1LP1 B;  1BGY J;  2LXB A;  3D70 A;  1FOS F;  3KDP B;  4GDO A;  4WB4 A;  2OQQ A;  1JTH B;  1K04 A;  1LTJ B;  1QL1 A;  3RL0 B;  2IBZ D;  3WUT A;  5CJ4 A;  1KN7 A;  5KLV E;  2IFN A;  3FXD A;  1J1D C;  2Q3I A;  3AE3 C;  5KJ7 D;  2AEF A;  4OH8 B;  2E75 B;  2KIK A;  2IBZ E;  2QJK C;  4JBZ A;  5KLV K;  1USE A;  1FZE A;  4C7R A;  1KB9 E;  3L70 E;  1IFI A;  2IZ0 A;  3M9B A;  4GOF A;  3CCJ P;  2IPP A;  5L8R J;  2MJZ A;  1BCC J;  1CZQ A;  2UWJ E;  3AEC C;  1PIX A;  1MZ9 A;  2B89 A;  3B4S A;  3Q3D A;  1Y47 A;  3Q5P A;  3HD7 C; 
#chains in the Genus database with same CATH homology
 1GW4 A;  1GL2 B;  1RF1 C;  4EOT A;  2YKO A;  1NOH A;  2NPS D;  1JY3 O;  2Z4E A;  1LWU B;  1N2D C;  3V4W A;  1N7S D;  2A45 H;  3HE5 A;  2OYI B;  4Y99 B;  1HVV A;  1NO4 A;  3HE5 B;  3P8C D;  2R5D A;  1L0N K;  5APT A;  1N7S B;  3LID A;  5AW9 B;  3M91 A;  3TNU B;  1NKZ B;  3O8Z A;  1LTS C;  3N4X A;  2E43 A;  1LGH B;  1W2E A;  1JTH A;  3MUD A;  3I5C A;  4JYC A;  3RK2 D;  3VTP C;  3H6P A;  3HD7 B;  3H32 B;  1SFC D;  3RK3 B;  3CI9 A;  3L4F A;  3V2P A;  3TYY A;  1GD2 E;  1IC2 A;  1LTJ A;  1MFZ A;  1LWU A;  1XTC C;  4W7Z A;  3NMD A;  2L5G B;  4EIJ A;  1URQ B;  1X8Y A;  1AFO A;  3BAS A;  3H32 A;  1GTW A;  2Q5U A;  3M0A A;  5CMZ A;  2HG5 D;  3U1C A;  2OYH B;  3SWF A;  2IFM A;  4C46 A;  1GU5 A;  1SQQ K;  2H8P D;  3B5N B;  2IX7 C;  3RK2 C;  2KP8 A;  1SQV K;  1RY3 A;  1URQ A;  4N78 E;  4M3L A;  1JY3 P;  3TNU A;  2P1J A;  2J58 A;  4LGD E;  2OYH A;  2O1K A;  2XV5 A;  1X79 B;  3VYI A;  1A02 F;  2WPQ A;  2KLV A;  1RF0 A;  5CCG D;  1RF0 C;  1FZC A;  1L4A C;  1SVF A;  1G2C A;  3V4Q A;  3HE4 B;  3KPE A;  3A2A A;  4DZO A;  5APU A;  1N7S C;  1OWA A;  2Z5I A;  3NFQ A;  2XDJ A;  4XA4 A;  5AW3 B;  5BU8 B;  1N7L A;  5AW4 B;  3TSI A;  5AVZ B;  2H7H A;  4I2L C;  4IFF A;  4WY4 A;  3MTU E;  3RK2 B;  3P32 A;  1IFM A;  1XTG B;  3OJA B;  1LT9 A;  2FXM A;  5KJ7 C;  1S9K E;  2JJL A;  3NXS A;  4ZKU A;  4AYC A;  2O1J A;  1FZB A;  3HE4 A;  5KJ7 A;  1RF1 A;  5BU5 A;  3G3Z A;  3L37 A;  1T8Z A;  4JF7 A;  2C9N Y;  2A45 G;  3OAK A;  3KYQ A;  2FYZ A;  1GK4 A;  4LC1 A;  5CCH C;  1Z56 A;  1SFC B;  1VDF A;  3RK3 D;  1HUC A;  2WTY A;  2OYH C;  5AVW B;  1NWQ A;  1GZL A;  3B5N A;  1NTM K;  2N1T D;  2KOG A;  3CLQ A;  1N73 B;  2I1K A;  4C7N A;  1GDT A;  1JO5 A;  3VMZ A;  1ZV8 A;  5AVX B;  2P67 A;  2OYI C;  4O9B A;  2QM7 A;  1JY3 N;  1GW3 A;  1M1J A;  1LTG C;  1L4A B;  2PP6 A;  1M1J C;  3U59 A;  2ZFC A;  1HJB A;  1NU1 K;  2NPS B;  1QL2 A;  3HD7 A;  1NH4 A;  4AQR D;  1KIL C;  5APW A;  2HLO A;  1HTL C;  2KSJ A;  2H43 A;  1RE3 A;  3BRT B;  1URQ C;  2WT7 A;  1KFM A;  3HD7 D;  2LKM A;  1SP4 A;  2W27 A;  2GM4 A;  5CCH A;  2A45 I;  1DX7 A;  1J1E B;  3V2N A;  2Z5H A;  2FFD C;  5AVR B;  3B5N C;  3V2Q A;  2QM8 A;  1RE4 C;  1YTZ T;  2WPS A;  1FZC C;  4DOJ A;  2N1T B;  3M9Q A;  1T2K D;  1NKN A;  3A5T A;  1GL2 A;  2YNY A;  1KFN A;  1FZF A;  1GL2 C;  4GT1 A;  2GUS A;  2W6A A;  1KIL B;  1FJK A;  2I1J A;  2JEE A;  5AW5 B;  4WY4 C;  3VOP A;  2XKM A;  2N9B A;  3BAT A;  3HTK A;  4Y99 C;  3L35 A;  4W7Y A;  5APQ A;  1FJP A;  2FFD B;  3P8M C;  1JMM A;  3E1I A;  4HH2 A;  1EQ7 A;  5AVY B;  5AW2 B;  2P2U A;  1JY2 N;  5AVQ B;  3M06 A;  4RES B;  5KTB A;  4AUW A;  3RL0 D;  1LTA C;  1URQ D;  3VMY A;  2C9L Y;  4WBA A;  2PAJ A;  4JYB A;  5AW6 B;  2R3C A;  3BRV B;  4C7N B;  4KHX A;  2GUV A;  1ZN5 A;  2M3B A;  1YTZ I;  1GK6 A;  1JNM A;  1IJD B;  2FFD A;  3HUS B;  3N7N A;  4N78 D;  4XE5 B;  1PFI A;  1HWT C;  3CL3 D;  5AVV B;  1SFC A;  4I1L A;  1H88 A;  1FZA A;  1CSB A;  3P7K A;  2R5B A;  5AVU B;  2KB7 P;  1CI6 A;  1LTJ C;  1MV8 A;  1VPC A;  3B8E B;  3RL0 C;  2WIT A;  2XU6 A;  2HOD B;  3P8C E;  1JCD A;  2ZXE B;  1LWU C;  4I6M C;  2WZ7 A;  2Q9I A;  1J1E C;  1JY2 O;  1LT9 C;  2WSE H;  1KZU B;  2WSC H;  1LTB C;  1L0L K;  1E5W A;  4ZKP A;  1HH0 A;  3V5B A;  2HPC A;  1X9V A;  2FKW B;  2YMY A;  1KIL A;  2O01 H;  1ZR2 A;  3BVH A;  1ZLL A;  2NPS A;  3M0D C;  2J59 M;  2C0W A;  2CPS A;  3B5N D;  2N1T A;  3EQ2 A;  4LLH A;  2VRS A;  1G1I A;  2HOD A;  5BVZ A;  5AW0 B;  1DH3 A;  1SQB K;  3V2R A;  5AVT B;  5AW7 B;  1N73 C;  1RE4 A;  5AW8 B;  2P7J A;  1HGV A;  1FBM A;  1T3J A;  3NTN A;  5APS A;  1IFJ A;  3HUS A;  1H89 A;  3EFG A;  2WT7 B;  1CI6 B;  3HUS C;  3GHG B;  2OAR A;  5AVS B;  1HGZ A;  3KQG A;  1WRG A;  1N86 A;  2R32 A;  1J1D B;  3VP8 A;  2HFE D;  1LTT C;  3GHG A;  1T3U A;  2KYV A;  4WY4 D;  5APX A;  1HBW A;  2BAS A;  3VN0 A;  1M1J B;  1OXZ A;  1IO4 A;  4HYT B;  4GIF A;  1LT9 B;  1T2K C;  1KQL A;  1G1J A;  2POH A;  1MUU A;  4B86 A;  2E42 A;  4GKG A;  4N6J A;  4W80 A;  1FDM A;  2C0X A;  3IR9 A;  3U1A A;  3VMX A;  2Q7C A;  3A7O A;  4N3Y B;  2FYU K;  1NAF A;  2YO2 A;  3HTK B;  2M8R A;  5APY A;  2XNX A;  1DEB A;  1NTK K;  3MGN A;  1GU4 A;  2HPC B;  1N7S A;  2WWW A;  2YKQ A;  3TK1 A;  1FZC B;  1SFC C;  3SWY A;  5CJ0 A;  1KIL D;  3II6 A;  2W6B A;  5APV A;  1S9K D;  2OYI A;  1JOC A;  2WSF H;  1A02 J;  3PP5 A;  3M9H A;  2YO3 A;  1JCC A;  1G2C B;  3VP9 A;  3GHG C;  1RF1 B;  1WT6 A;  1YYC A;  1SQX K;  1IK9 A;  2WPR A;  5AW1 B;  1SQP K;  3C9I A;  3MIW A;  1AQ5 A;  2CPB A;  2HYN A;  4WY4 B;  1M7L A;  1SLQ A;  3OA7 A;  1RE3 C;  1NHL A;  3LW5 H;  1J2J B;  1LTI C;  1IFN A;  1IFD A;  2NPS C;  3M0D A;  3MD0 A;  3T97 A;  3HRN A;  1ZR4 A;  1FZG A;  1CW5 A;  1L4A D;  2N1T C;  4IFD K;  3A3Y B;  3IFM A;  5CCG C;  1JY2 P;  2XZR A;  1NTZ K;  1H8A A;  3R2P A;  3LIE A;  5CCG A;  3UIA A;  1FU1 A;  3RK3 C;  1FAV A;  2YKP A;  5CCH D;  1FOS E;  1GL2 D;  1N73 A;  1L4A A;  3L36 A;  3WMM 0;  4IFM A;  1JUN A;  1FOS F;  3KDP B;  4WB4 A;  1JTH B;  1LTJ B;  1QL1 A;  3RL0 B;  5CJ4 A;  2IFN A;  1J1D C;  2Q3I A;  5KJ7 D;  4OH8 B;  5KLV K;  1FZE A;  4C7R A;  1IFI A;  3M9B A;  2IPP A;  2MJZ A;  1CZQ A;  1MZ9 A;  5CHX A;  3HD7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...