1YTZT

Crystal structure of skeletal muscle troponin in the ca2+-activated state
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
90
structure length
90
Chain Sequence
SYSSYLAKADQKRGKKQTARETKKKVLAERRKPLNIDHLNEDKLRDKAKELWDWLYQLQTEKYDFAEQIKRKKYEIVTLRNRIDQAQKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Troponin T
publication title Ca2+-regulated structural changes in troponin
pubmed doi rcsb
source organism Gallus gallus
molecule tags Contractile protein
total genus 34
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2005-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.350 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ytzT00
1J1DB 1J1DC 4Y99B 1YTZT 4Y99C 1YTZI 1J1EB 1J1EC
chains in the Genus database with same CATH superfamily
1GMJA 1AQ5A 5KLVE 3TNUB 2KSEA 3EFFK 5APUA 2YO2A 3KHUA 3B71A 5AVVB 1YBKA 1VQPP 2NPSA 4L75A 2YMKA 4KT0J 1KYOI 1LTJA 2QJYC 1LJ2A 3F89A 3KYQA 3CMEP 5CJ0A 1SFCB 1PGQA 1VPCA 4IFFA 3CD6P 4HJGH 2WT7A 2K37A 2L5GB 4HYTB 4EOTA 2C0XA 1U57A 1KQLA 1OVVA 1X22A 2AEMA 1T3JA 3PJSK 4GKGA 1EZVI 4Y99C 5AW7B 1NHLA 5CBNA 2N9BA 2VRSA 1VF5D 3L71E 1MZ9A 4LGDE 1M7LA 3Q2YA 1SQXG 2FYZA 4H0LB 3MTUE 2ZT9B 1JCDA 4K3AA 3I55P 2OGUA 1RF1B 3H6PA 1L0NG 2PGDA 1T2KC 3HE4B 3FXEA 3JCUH 3M9HA 3L71J 4KHXA 2H7HA 3RL0C 5APYA 2N9YB 1K04A 2KLVA 2RKLA 1JTHA 1X9VA 3CCUP 3RK3B 1QVFO 2O01H 2P10A 1GD2E 1KILC 1VQ6P 1BE3J 3HUSA 3TGUG 1SP4A 4OVNF 2E76D 3HD7D 3L70J 1NKZB 4HB1A 3D70A 3GMAA 2WQYC 1SS1A 1AVYA 2QE7H 3Q5SA 4R4LA 3HTKA 4Z1MH 1SQPE 3M0AA 1VDFA 4YXDC 3IR9A 1P84E 1N7SA 3TK1A 3B5NB 2P58A 1YQ3C 2ZYAA 4M3LA 2E75C 3SFEC 2A45G 4L73A 2ZAEB 1KN7A 1EXIA 3H1ID 3V5BA 1FBMA 1FE6A 2J59M 1FZCC 3HRNA 3AE7C 1GDTA 2N1TC 4DT0A 5B5EH 3CX5H 2MKVA 1K8AQ 1KD1Q 2AXCA 2W83C 1KILE 1KB9H 2K88A 1SVFA 2B87B 2ZXXA 1Z56A 5CCGD 2JWDA 3P7KA 1BCCE 1GL2D 2Q7CA 3H1HD 1HF9A 3VMZA 5KJ7C 1LT1A 1FZAA 1SQQE 4PJ0H 1IC2A 3H1KD 3L75D 1JO5A 4N78E 2KOGA 2HYNA 1YI2P 3SWFA 2W90A 5TJHA 3L73E 1N73B 1OXZA 2IFNA 3L71G 3H1JD 4IFMA 1BGYD 4H44D 1BCCJ 1SQVE 4D6TJ 4N6JA 3GHGA 1M1JB 2P1JA 2A06G 1AJYA 1BE3G 1JUNA 3BATA 1S5LX 1U7JA 2HR3A 3Q3DA 3L73J 2GUVA 1PPJE 3L70G 1VQ9P 2YNYA 1IFIA 4LLHA 2OTKE 3L74E 1NJIQ 2WSFJ 4R4MA 1OVUA 3CCSP 2KS1B 3JCUE 4Y28J 1A02F 1HGZA 1FZGA 1OVRA 3USSA 3A5TA 3HD7A 2FFDA 1RE4A 1NU1D 2HLOA 4EDFA 2FYNC 4ASWA 3BRVB 4H13B 1RF1C 1ZR2A 1T6AA 2JJLA 3BCCE 1EZVD 1H8AA 2BCCD 3NXSA 1HGVA 5AVTB 1DIPA 3H25A 4GT1A 4GIFA 4TT3H 5AVXB 1SFCD 1KQSO 1GW3A 1K9MQ 1BSNA 3E1IA 2QJYB 1S72P 3MP7B 1JY2P 2FYUJ 3L37A 1AV1A 1NAYA 3AEDC 3BCCJ 3M9BA 4EIJA 3CPWO 5B66H 3LW5H 3CCRP 2KZIA 2IBZE 2Y9YA 3MGNA 1SQBJ 1S9KD 3WUVA 2JP3A 3NMDA 5CCGA 2KUBA 3ABVC 1LTGC 3PRJA 2E5TA 3CXHH 1GL2A 3AE5C 5CHXA 1BCCG 5B5EE 1LTTC 3CX5E 1EDIA 2HODB 4JYBA 1USEA 3CC4P 1LT9C 1DH3A 4H0LD 2ZT9D 1KB9E 4L74A 1FZFA 1PGJA 2W6AA 5BU8B 2CPSA 3T97A 1S1CX 4O9BA 3L73G 2B9BA 1FZEA 1OFCX 2KNCA 5APTA 2Q6QA 2WITA 4I1LA 4PJ0E 1SQVG 4XE5B 1PZQA 4NPFX 1DEBA 3RK3D 3RL0B 3SSUA 3R4YA 2IZ1A 1DD4A 3M0DC 1M56D 2D2CC 1JMBA 2SPZA 4AUWA 2FBWC 2ZFCA 2YKQA 3AE8C 3LIDA 4UB8H 4IFDK 4C7NB 1KFNA 1PPJG 1KILB 3MIWA 3TDKA 2OYHC 1IFJA 5GTIH 1JY3N 2K9JA 1KTMA 2BEQD 3CWBE 1OMIA 1SQXD 2PAJA 3LIEA 3B5ND 5AVZB 1FOSF 1Y8AA 1EDLA 1N73C 2ZVOB 1QEXA 1L0ND 4U3FE 4YTPC 2YO3A 2Y9ZA 1CSBA 4OWFA 1SLQA 3TNUA 3BCCG 4C7RA 3PP5A 3AEAC 2HPCB 1LNQA 1FZCB 3PLNA 1QL1A 1SFCA 1K05A 1SQBG 2Q1KA 2N1TB 2GA1A 1RHZB 1JB0J 1PP9E 4B86A 3QH9A 3L72E 1VQ5P 1KMIZ 2XV5A 2KK7A 1VQNP 2FKWB 1L0LJ 1L4AC 3IN6A 3G3ZA 2ITAA 2IBZG 1RF0A 1OIPA 3KXDA 2H43A 3G4SP 2WSCH 1PP9J 3TGUJ 3GF7A 2Z5IA 3L72J 4WWIA 5AW9B 1RQUA 3AE9C 5B66E 1KV4A 5AVSB 1N7LA 3P8CD 1WT6A 3AE1C 3G71P 1GTWA 3WMM0 5DJTB 1X79B 1HJ0A 1G1JA 3HE4A 3CXHE 2KLUA 1G2CB 3S1KA 1IFDA 2XDJA 3LW5J 2OYIC 1HVVA 1NWQA 1AVOA 5KLVJ 3RBZA 3P8MC 1A02J 4OGQC 1H89A 1UIXA 5KLIC 3GW6A 4I6MC 3U1CA 1HH0A 1G1IA 1EDJA 2FY8A 3L71D 5CCHD 1SQXK 1KORA 4H13D 1PIXA 2R3SA 1Q86Q 2V7QJ 1QLED 3B5NA 3SWKA 4UB8E 1Q81Q 4WY4C 1L0NK 2FYNB 1LGHB 3IF4A 2A06D 4U3FG 5GTIE 1BE3D 1KC8Q 4IL6X 3A7OA 1OW8A 1N8RQ 3M06A 1IFMA 1MV8A 3L70D 1L0LG 1KYOH 3H32B 2QJKC 1ZRTE 5AVQB 4W7YA 1X8YA 2P7JA 2GUSA 1LTJB 5AVRB 4HH2A 5AVWB 3V2RA 1PP9G 3CCQP 2K9YA 5KKZC 1FZBA 4AYCA 1VL2A 3L72G 4RKUJ 4W7ZA 5KTBA 1NH4A 2Q5UA 2AEJA 2M0BA 3S9OA 2H88C 1RE3C 2O1JA 4ZKPA 3NTNA 1BSHA 3GLMA 1URQC 4A7PA 1P84D 1LT9B 3RK2C 4ZKUA 1LTAC 2IX7C 5CBOA 3B8EB 2M5AA 2QG4A 3AEBC 5APSA 4RO0A 3VMYA 3A0BH 3M9QA 1T2KD 1USDA 3KZIH 1W5CE 3VP8A 1R5LA 1M1JA 1YQ4C 1BDCA 1NTME 3RL0D 1SQPJ 2AXTH 5KLVG 3MUDA 2UWJE 1LWUC 1FOSE 2CPBA 3H1IE 3UIAA 1XTCC 1NTKE 2I8DA 2AEFA 3D6YA 2WSEH 5TISH 1KILD 2D2CB 1GU5A 1JEKA 1NVOA 2J5UA 1FS0E 1LTBC 2KS1A 1Y47A 1IFNA 1NTMJ 1MKMA 1BCCD 2WSCJ 2OYHB 4D6TD 2G3AA 3WU2H 1J1DC 2OYOA 3C8VA 1N86A 1NTKJ 3OW2O 2R3CA 1JY2O 3H1HE 5CCHA 3L73D 2E75D 2LXBA 4WBAA 3H1KE 3HTKB 2PP6A 3PHLA 2ZYDA 1TU3F 2Q3EA 3PH0A 1CI6B 1N7SB 1NAFA 1R8EA 1RH5B 1SQQJ 1IFPA 1MFZA 1XTGB 2N1TD 1W2EA 2ZJSE 1FJPA 5EFWB 5C39A 1KFMA 1PPJD 3TSIA 1H0TB 2YKOA 3H1KJ 1GU4A 1SQVJ 3NFQA 2K3RA 3E7KA 3V2PA 2A45I 2JKVA 3O6QB 1L4AB 1D7MA 2PFXA 5KJ7D 1EQ7A 4KJMA 1S2EA 1LTIC 1ZV8A 1KYOE 3N7NA 2HODA 5H2FH 5AW6B 4I7ZB 2O1KA 4XA4A 3L74J 2O3JA 2FYUD 1YITP 1SQPG 3B4SA 3BCCD 3ZDMA 5DJUB 3W68A 4N3YB 1MFTA 3C9IA 4OH8B 3K5BA 3MD0A 5AVYB 1SQBD 3PTZA 1EZVE 3Q5PA 2BCCE 2O01J 5APVA 1NKNA 1NTMG 5E79H 2NPSC 1CZQA 1LTJC 2OYIB 2JWAA 2W6BA 1WRGA 1Y9BA 3A0BE 1NTKG 2NZ2A 1KILA 3KZIE 1NTZD 3H1LE 3IFMA 1Q90D 1EXJA 1U7MA 4OGQB 2E74C 1KQFB 2QA4P 3AEEC 1YHQP 2AXTE 1PGPA 2IDBA 4YPCA 2QM8A 2WTYA 2A45H 5KLIB 3VOPA 1FDIA 1KQGB 1HJBA 3CX5D 3JC22 1S9KE 5TISE 4I2LC 1KB9D 1SQQG 3OAKA 2QIWA 1VQOP 1ZR4A 2YIUC 1ZLLA 3H1LJ 4WY4B 1NO4A 4IOIH 1NOHA 2WPRA 1OX3A 3WU2E 1AQTA 3H1KG 3L4FA 2HPCA 1FDMA 1QVGO 1FZCA 2WSEJ 1GW4A 1Q2NA 1YTZT 2XNXA 2WMMA 2N1TA 1ZN5A 1FJKA 4LC1A 2QJKB 3AE6C 5AW1B 2YXRB 2R32A 1P84I 5APQA 1CW5A 1E5WA 2QEXP 1IK9A 5KKZB 1DD3A 3L74G 3CMAP 4PD4D 2XU6A 2W27A 3HUSC 3HE5B 3ITKA 3AEFC 1T3UA 2P67A 2QJPC 5KJ7A 1NU1K 2ZVNB 1RY3A 2WWWA 1S5LH 1N2DC 1URQB 1ZP0C 3CC2P 1LTSC 2FYUK 2R5BA 2W8ZA 2QRXA 2RH0A 1N7SC 3RK2B 4ASVA 4BRYB 2YMYA 3CWBJ 1VQMP 1L0LD 2I1JA 3FWNA 4ZMDA 2DW3A 2Q3IA 1SQBK 4PV1C 4AQRD 2E43A 3CC7P 3W67A 1G2CA 5H2FE 4MN4C 3FWLA 4U3FJ 1LWUB 2D2CD 1Q7YQ 5APXA 1UIIA 1PP9D 3TGUD 2BCCG 3L72D 3AE4C 1E79H 2C9LY 2Y0DA 2JO1A 1H88A 1LP1B 2R5DA 1NTZK 3H1LG 2QM7A 3V2NA 1J1DB 5E79E 1VQ7P 4I7ZC 2LR2A 4L76A 1NGMB 3VMXA 3QWOC 1HWTC 1ZW0A 3RBXA 1RF1A 3VN0A 1VF5C 2W6JH 5KLVD 3RGUA 1JMMA 3V4WA 3P8CE 3V2QA 3IAOA 3CXHD 3JSVC 4NPEA 2GM4A 4QMAA 2WSSH 1YYCA 3GHGC 3VMAA 4GOFA 4W80A 1QL2A 2M3BA 4DZOA 3H32A 2WVRA 5M1BA 4RESB 3AE3C 1L4AD 2LXCB 1M57D 3GG2A 3F5HA 5KAIH 2KIKA 5BU5A 2HFED 2B89A 3II6A 1OW6A 5L8RJ 1K73Q 2OTLP 3Q5RA 2E5YA 1VQKP 2B88A 3CWBG 1GK4A 2E76C 2H8PD 3HD7C 2WSFH 3MZWB 1PGOA 2FFDC 2R44A 1J1EC 1LT9A 1RE4C 3KDPB 1NYHA 3CI9A 2ZYGA 1VQ4P 1S3JA 1JNMA 1OW7A 1JY3P 1PV3A 2IBZI 1L0LK 3V6IA 2IYOA 2J58A 3WUTA 2A06E 2Z5HA 1RQVA 1S5LE 1BE3E 2I1KA 1ZRTD 2NPSB 2JEEA 2YXQB 2G8YA 3M0DA 3EWKA 2KXPB 2B87A 3CX5I 2OTJP 1MUUA 3L70E 4OGQD 3AEGC 3G6EP 2WT7B 1Q82Q 1KB9I 3TF5A 2OYHA 2E74B 1AFOA 2NRGA 5CCGC 1SQPD 1PL5A 4BWNA 1ZXGA 3VYIA 1J2JB 4WY4D 4UB6H 1GL2C 4XFJA 3FXDA 1N73A 2FXOA 5KAFH 1JY2N 2YIUB 3G9RA 4DCKA 3FX0A 1CI6A 1YJWP 5KLVK 1PFIA 1IZNB 4NPDA 1NTMD 2PRRA 3MHVA 3GF3A 2LKMA 2HG5D 4WVZA 3BVHA 4H44C 2RMZA 4PD4I 2C9NY 1NTKD 1H0TA 3CL3D 4DJGA 3CCLP 4CPGA 1VQLP 4JQ0D 1JTHB 2CK3H 1YJ9P 3CCJP 4BXLA 3O6QA 1L4AA 4JYCA 1FU1A 5GTHH 3H1IJ 1SQQD 3HUSB 1URQD 4N78D 2QJPB 4D6TE 3RK2D 1FAVA 3L36A 1VQ8P 3L75E 3D71A 1SQVD 5KAIE 2E42A 3H1JE 4GODA 1HUCA 3O8ZA 2M5AB 1BGYE 1HTLC 4PV1B 4U7JA 1M8OB 3H1HJ 2WZ7A 1FC2C 4JF7A 5CJ4A 2XNDH 2OYIA 3C1LA 3L75J 3SWYA 4PD4H 2ZXEB 1SFCC 1YTZI 3L74D 3A2AA 3EQ2A 1AA0A 3H1JJ 1EDKA 1JCCA 1BGYJ 3A0HH 3CCVP 4IL6H 4C46A 2O01N 3E1RA 1KYOD 4K35A 1RF0C 3V4QA 2L91A 1SQPK 4EI2A 3I5CA 3CXHI 2WPQA 3KQGA 2Y0EA 1ZMEC 1NU1E 4WY4A 2WPVB 4ZNCA 1VF5B 4H0LC 2FYUE 2ZT9C 3BRTB 3CCMP 2POHA 1IK7A 1NTMK 5AW0B 1W2BO 4EYYQ 2H89C 2BEZF 3GHGB 4UB6E 1WMKA 4HKZH 1SQBE 1NTKK 1NU1J 1IO4A 2M8RA 5KAFE 2XKMA 3H1IG 2OARA 2IBZD 4C7NA 2QVAA 2IZ0A 3N4XA 5K5GB 3RK3C 3H1LD 1M90Q 2BCCJ 1OWAA 3CCEP 2IFMA 3HE5A 2KB7P 3OA7A 1NTZE 1SQQK 5AW2B 2KSJA 3L35A 4JBZA 2RN0A 1RE3A 3BASA 2YKPA 1URQA 2E76B 1ZOYC 3HD7B 2FFDB 3OJAB 1J1EB 1JM0A 5CMZA 2Z4EA 4Y99B 3FGAD 2IPPA 3H1HG 4D6TG 3B5NC 3VP9A 4BRYA 1SQVK 3EFGA 2WPSA 3L75G 1JOCA 2C0WA 5GTHE 1QGKB 3VTPC 1NTZJ 2P2UA 2V7QH 3R2PA 3D6ZA 2KP8A 3U1AA 2NPSD 3H1JG 1LWUA 4TLFA 1BGYG 1DEEG 2FXPA 1EC5A 3RK3E 5AW8B 2E74D 1LP1A 1DX7A 2K1AA 1YJNP 3CWBD 1BDDA 3WUUA 1IJDB 2QSIA 3KPEA 3Q1MA 4WB4A 2BASA 1GK6A 5AW5B 4PD4E 4DOJA 4U3FD 1X0TA 1OZHA 1FDOA 1GL2B 5APWA 1SQXE 4GOEA 5BVZA 2IYPA 1KZUB 2KYVA 4YXWH 3A3YB 1L0NE 3A0HE 5AVUB 2JR8A 1GZLA 1NU1G 4IL6E 2KI7B 1M1KQ 3T97B 3S4RA 2E75B 2FYUG 2KNCB 1M1JC 4H44B 3U59A 1EZVG 1L0LE 3MUDC 1SQXJ 3AECC 5AW4B 1T8ZA 3CLQA 1L0NJ 2M3EA 2V4HA 1S4XA 1HBWA 2XZRA 3TGUE 1R5SA 1P84H 2MJZA 2FXMA 1JY3O 4RJTA 5AW3B 3P32A 2Q9IA 4JPZB 3I56P 2K9JB 1YIJP 2JDIH 3AE2C 1NTZG 3RL0g 1N7SD 3TYYA 1L2PA 2Y0CA 3M91A 2KZJA 5CCHC 4GDOA 4H13C 1QX8A 3SFDC 4PV1D 2OQQA
chains in the Genus database with same CATH topology
1N73A 1AQ5A 1L4AB 3M0DC 5KJ7D 1EQ7A 3TNUB 1JY2N 1LTIC 1ZV8A 5APUA 2YO2A 4AUWA 3N7NA 2ZFCA 2YKQA 5AVVB 3LIDA 2HODA 4IFDK 1CI6A 4C7NB 5KLVK 2NPSA 1PFIA 1KFNA 1LTJA 1KILB 5AW6B 2O1KA 3MIWA 4XA4A 3KYQA 2OYHC 5CJ0A 1SFCB 1VPCA 4IFFA 2LKMA 1IFJA 2WT7A 2HG5D 2L5GB 1JY3N 4HYTB 4EOTA 3BVHA 2C0XA 1KQLA 2C9NY 2PAJA 3LIEA 3B5ND 4N3YB 3C9IA 4OH8B 5AVZB 1T3JA 3CL3D 1FOSF 3MD0A 5AVYB 1N73C 1JTHB 4GKGA 2YO3A 1CSBA 5APVA 4Y99C 5AW7B 1NKNA 1NHLA 1L4AA 2NPSC 4JYCA 1CZQA 1FU1A 1SLQA 1LTJC 2N9BA 2VRSA 2OYIB 3TNUA 2W6BA 1MZ9A 1WRGA 4C7RA 3HUSB 3PP5A 1URQD 4LGDE 2HPCB 1M7LA 2FYZA 4N78D 1KILA 1FZCB 3IFMA 3MTUE 1JCDA 3RK2D 1QL1A 1SFCA 1FAVA 1RF1B 3H6PA 2N1TB 3L36A 2QM8A 4B86A 2A45H 2WTYA 3VOPA 1HJBA 1T2KC 3HE4B 2XV5A 3M9HA 4KHXA 2E42A 1S9KE 2H7HA 3RL0C 2FKWB 4I2LC 1L4AC 1HUCA 5APYA 3G3ZA 3O8ZA 3OAKA 2KLVA 1JTHA 1ZR4A 1X9VA 1HTLC 1RF0A 1ZLLA 2H43A 4WY4B 3RK3B 2WZ7A 1NO4A 2WSCH 2O01H 1GD2E 1KILC 4JF7A 5CJ4A 2OYIA 1NOHA 3SWYA 2WPRA 2Z5IA 2ZXEB 1SFCC 1YTZI 5AW9B 3HUSA 3L4FA 2HPCA 1SP4A 1FDMA 3HD7D 5AVSB 1N7LA 3P8CD 1FZCA 3EQ2A 1WT6A 1GW4A 3A2AA 1NKZB 1GTWA 3WMM0 1YTZT 1JCCA 2XNXA 1X79B 2N1TA 1ZN5A 1FJKA 3HTKA 4LC1A 3M0AA 4C46A 1VDFA 3IR9A 1G1JA 3HE4A 5AW1B 1N7SA 3TK1A 2R32A 3B5NB 1RF0C 3V4QA 1SQPK 5APQA 1G2CB 3I5CA 1CW5A 1E5WA 2WPQA 4M3LA 1IFDA 2XDJA 1IK9A 3KQGA 2OYIC 1HVVA 2A45G 2XU6A 2W27A 4WY4A 3HUSC 1NWQA 3HE5B 1T3UA 3V5BA 1FBMA 2J59M 2P67A 1FZCC 5KJ7A 1NU1K 3HRNA 3P8MC 1A02J 1RY3A 2WWWA 1H89A 3BRTB 1GDTA 1N2DC 1URQB 2N1TC 2POHA 1NTMK 1LTSC 5AW0B 2FYUK 2R5BA 4I6MC 1N7SC 3GHGB 3RK2B 3U1CA 1HH0A 1G1IA 1SVFA 2YMYA 1Z56A 5CCHD 1NTKK 1SQXK 5CCGD 1IO4A 2M8RA 2I1JA 2XKMA 2OARA 4C7NA 3P7KA 2Q3IA 3B5NA 1SQBK 4AQRD 1GL2D 3N4XA 4WY4C 2E43A 1L0NK 2Q7CA 1LGHB 1G2CA 3RK3C 3VMZA 5KJ7C 1LWUB 5APXA 1FZAA 1IC2A 1OWAA 2IFMA 1JO5A 3HE5A 2KB7P 4N78E 2KOGA 2HYNA 3OA7A 2C9LY 1SQQK 3A7OA 3SWFA 5AW2B 2KSJA 3L35A 1RE3A 3BASA 3M06A 1N73B 1OXZA 2IFNA 1IFMA 1MV8A 2YKPA 1H88A 4IFMA 2R5DA 1URQA 1NTZK 3H32B 3HD7B 2FFDB 3OJAB 1J1EB 5CMZA 5AVQB 4N6JA 4W7YA 2Z4EA 4Y99B 1X8YA 2P7JA 2GUSA 2IPPA 2QM7A 3GHGA 3B5NC 1LTJB 1M1JB 3V2NA 1J1DB 2P1JA 5AVRB 3VP9A 1SQVK 4HH2A 5AVWB 3EFGA 2WPSA 3V2RA 1JOCA 2C0WA 3VMXA 1FZBA 1JUNA 4AYCA 3VTPC 4W7ZA 5KTBA 1NH4A 2P2UA 3BATA 3R2PA 2GUVA 1HWTC 2Q5UA 2KP8A 3U1AA 2NPSD 1RF1A 2YNYA 3VN0A 1LWUA 1IFIA 1RE3C 2O1JA 4LLHA 4ZKPA 3NTNA 1JMMA 3V4WA 1URQC 3P8CE 3V2QA 5AW8B 1LT9B 2GM4A 1YYCA 1A02F 1HGZA 3RK2C 3GHGC 4ZKUA 1FZGA 1LTAC 2IX7C 3B8EB 1DX7A 5APSA 4W80A 1QL2A 2M3BA 4DZOA 3VMYA 3A5TA 3H32A 3HD7A 2FFDA 1RE4A 3M9QA 1T2KD 2HLOA 1IJDB 3KPEA 3VP8A 4WB4A 1M1JA 4RESB 3RL0D 1L4AD 3MUDA 2BASA 3BRVB 1GK6A 1RF1C 1ZR2A 2JJLA 5AW5B 1LWUC 4DOJA 1FOSE 2CPBA 1H8AA 3UIAA 1XTCC 1GL2B 5APWA 5BU5A 2HFED 3NXSA 1HGVA 5BVZA 1KZUB 2WSEH 5AVTB 3II6A 4GT1A 2KYVA 1KILD 4GIFA 3A3YB 1GU5A 5AVXB 1SFCD 5AVUB 1GW3A 1LTBC 1GZLA 1GK4A 2H8PD 3HD7C 1IFNA 2WSFH 3E1IA 2FFDC 1LT9A 1J1EC 1JY2P 1RE4C 3KDPB 3L37A 3CI9A 2OYHB 1M1JC 3M9BA 1J1DC 4EIJA 3LW5H 3U59A 1N86A 1JNMA 5AW4B 2R3CA 1JY3P 1JY2O 1T8ZA 3CLQA 1L0LK 3MGNA 1S9KD 5CCHA 5CCGA 2J58A 3NMDA 1LTGC 2Z5HA 4WBAA 1HBWA 2XZRA 3HTKB 2PP6A 2MJZA 1GL2A 2I1KA 5CHXA 1LTTC 2FXMA 2HODB 1CI6B 1N7SB 2NPSB 1NAFA 2JEEA 1JY3O 4JYBA 3M0DA 1LT9C 5AW3B 3P32A 2Q9IA 1DH3A 1MUUA 1MFZA 1FZFA 1XTGB 2N1TD 2WT7B 1W2EA 2W6AA 5BU8B 2CPSA 3T97A 1FJPA 1N7SD 4O9BA 2OYHA 3TYYA 1KFMA 1FZEA 3TSIA 5APTA 2YKOA 1AFOA 3M91A 1GU4A 5CCHC 5CCGC 2WITA 3NFQA 4I1LA 4XE5B 3VYIA 1J2JB 3V2PA 4WY4D 1DEBA 1GL2C 2A45I 3RK3D 3RL0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J1D B;  1J1D C;  4Y99 B;  1YTZ T;  4Y99 C;  1YTZ I;  1J1E B;  1J1E C; 
#chains in the Genus database with same CATH topology
 1GMJ A;  1AQ5 A;  5KLV E;  3TNU B;  2KSE A;  3EFF K;  5APU A;  2YO2 A;  3KHU A;  3B71 A;  5AVV B;  1YBK A;  1VQP P;  2NPS A;  4L75 A;  2YMK A;  4KT0 J;  1KYO I;  1LTJ A;  2QJY C;  1LJ2 A;  3F89 A;  3KYQ A;  3CME P;  5CJ0 A;  1SFC B;  1PGQ A;  1VPC A;  4IFF A;  3CD6 P;  4HJG H;  2WT7 A;  2K37 A;  2L5G B;  4HYT B;  4EOT A;  2C0X A;  1U57 A;  1KQL A;  1OVV A;  1X22 A;  2AEM A;  1T3J A;  3PJS K;  4GKG A;  1EZV I;  4Y99 C;  5AW7 B;  1NHL A;  5CBN A;  2N9B A;  2VRS A;  1VF5 D;  3L71 E;  1MZ9 A;  4LGD E;  1M7L A;  3Q2Y A;  1SQX G;  2FYZ A;  4H0L B;  3MTU E;  2ZT9 B;  1JCD A;  4K3A A;  3I55 P;  2OGU A;  1RF1 B;  3H6P A;  1L0N G;  2PGD A;  1T2K C;  3HE4 B;  3FXE A;  3JCU H;  3M9H A;  3L71 J;  4KHX A;  2H7H A;  3RL0 C;  5APY A;  2N9Y B;  1K04 A;  2KLV A;  2RKL A;  1JTH A;  1X9V A;  3CCU P;  3RK3 B;  1QVF O;  2O01 H;  2P10 A;  1GD2 E;  1KIL C;  1VQ6 P;  1BE3 J;  3HUS A;  3TGU G;  1SP4 A;  4OVN F;  2E76 D;  3HD7 D;  3L70 J;  1NKZ B;  4HB1 A;  3D70 A;  3GMA A;  2WQY C;  1SS1 A;  1AVY A;  2QE7 H;  3Q5S A;  4R4L A;  3HTK A;  4Z1M H;  1SQP E;  3M0A A;  1VDF A;  4YXD C;  3IR9 A;  1P84 E;  1N7S A;  3TK1 A;  3B5N B;  2P58 A;  1YQ3 C;  2ZYA A;  4M3L A;  2E75 C;  3SFE C;  2A45 G;  4L73 A;  2ZAE B;  1KN7 A;  1EXI A;  3H1I D;  3V5B A;  1FBM A;  1FE6 A;  2J59 M;  1FZC C;  3HRN A;  3AE7 C;  1GDT A;  2N1T C;  4DT0 A;  5B5E H;  3CX5 H;  2MKV A;  1K8A Q;  1KD1 Q;  2AXC A;  2W83 C;  1KIL E;  1KB9 H;  2K88 A;  1SVF A;  2B87 B;  2ZXX A;  1Z56 A;  5CCG D;  2JWD A;  3P7K A;  1BCC E;  1GL2 D;  2Q7C A;  3H1H D;  1HF9 A;  3VMZ A;  5KJ7 C;  1LT1 A;  1FZA A;  1SQQ E;  4PJ0 H;  1IC2 A;  3H1K D;  3L75 D;  1JO5 A;  4N78 E;  2KOG A;  2HYN A;  1YI2 P;  3SWF A;  2W90 A;  5TJH A;  3L73 E;  1N73 B;  1OXZ A;  2IFN A;  3L71 G;  3H1J D;  4IFM A;  1BGY D;  4H44 D;  1BCC J;  1SQV E;  4D6T J;  4N6J A;  3GHG A;  1M1J B;  2P1J A;  2A06 G;  1AJY A;  1BE3 G;  1JUN A;  3BAT A;  1S5L X;  1U7J A;  2HR3 A;  3Q3D A;  3L73 J;  2GUV A;  1PPJ E;  3L70 G;  1VQ9 P;  2YNY A;  1IFI A;  4LLH A;  2OTK E;  3L74 E;  1NJI Q;  2WSF J;  4R4M A;  1OVU A;  3CCS P;  2KS1 B;  3JCU E;  4Y28 J;  1A02 F;  1HGZ A;  1FZG A;  1OVR A;  3USS A;  3A5T A;  3HD7 A;  2FFD A;  1RE4 A;  1NU1 D;  2HLO A;  4EDF A;  2FYN C;  4ASW A;  3BRV B;  4H13 B;  1RF1 C;  1ZR2 A;  1T6A A;  2JJL A;  3BCC E;  1EZV D;  1H8A A;  2BCC D;  3NXS A;  1HGV A;  5AVT B;  1DIP A;  3H25 A;  4GT1 A;  4GIF A;  4TT3 H;  5AVX B;  1SFC D;  1KQS O;  1GW3 A;  1K9M Q;  1BSN A;  3E1I A;  2QJY B;  1S72 P;  3MP7 B;  1JY2 P;  2FYU J;  3L37 A;  1AV1 A;  1NAY A;  3AED C;  3BCC J;  3M9B A;  4EIJ A;  3CPW O;  5B66 H;  3LW5 H;  3CCR P;  2KZI A;  2IBZ E;  2Y9Y A;  3MGN A;  1SQB J;  1S9K D;  3WUV A;  2JP3 A;  3NMD A;  5CCG A;  2KUB A;  3ABV C;  1LTG C;  3PRJ A;  2E5T A;  3CXH H;  1GL2 A;  3AE5 C;  5CHX A;  1BCC G;  5B5E E;  1LTT C;  3CX5 E;  1EDI A;  2HOD B;  4JYB A;  1USE A;  3CC4 P;  1LT9 C;  1DH3 A;  4H0L D;  2ZT9 D;  1KB9 E;  4L74 A;  1FZF A;  1PGJ A;  2W6A A;  5BU8 B;  2CPS A;  3T97 A;  1S1C X;  4O9B A;  3L73 G;  2B9B A;  1FZE A;  1OFC X;  2KNC A;  5APT A;  2Q6Q A;  2WIT A;  4I1L A;  4PJ0 E;  1SQV G;  4XE5 B;  1PZQ A;  4NPF X;  1DEB A;  3RK3 D;  3RL0 B;  3SSU A;  3R4Y A;  2IZ1 A;  1DD4 A;  3M0D C;  1M56 D;  2D2C C;  1JMB A;  2SPZ A;  4AUW A;  2FBW C;  2ZFC A;  2YKQ A;  3AE8 C;  3LID A;  4UB8 H;  4IFD K;  4C7N B;  1KFN A;  1PPJ G;  1KIL B;  3MIW A;  3TDK A;  2OYH C;  1IFJ A;  5GTI H;  1JY3 N;  2K9J A;  1KTM A;  2BEQ D;  3CWB E;  1OMI A;  1SQX D;  2PAJ A;  3LIE A;  3B5N D;  5AVZ B;  1FOS F;  1Y8A A;  1EDL A;  1N73 C;  2ZVO B;  1QEX A;  1L0N D;  4U3F E;  4YTP C;  2YO3 A;  2Y9Z A;  1CSB A;  4OWF A;  1SLQ A;  3TNU A;  3BCC G;  4C7R A;  3PP5 A;  3AEA C;  2HPC B;  1LNQ A;  1FZC B;  3PLN A;  1QL1 A;  1SFC A;  1K05 A;  1SQB G;  2Q1K A;  2N1T B;  2GA1 A;  1RHZ B;  1JB0 J;  1PP9 E;  4B86 A;  3QH9 A;  3L72 E;  1VQ5 P;  1KMI Z;  2XV5 A;  2KK7 A;  1VQN P;  2FKW B;  1L0L J;  1L4A C;  3IN6 A;  3G3Z A;  2ITA A;  2IBZ G;  1RF0 A;  1OIP A;  3KXD A;  2H43 A;  3G4S P;  2WSC H;  1PP9 J;  3TGU J;  3GF7 A;  2Z5I A;  3L72 J;  4WWI A;  5AW9 B;  1RQU A;  3AE9 C;  5B66 E;  1KV4 A;  5AVS B;  1N7L A;  3P8C D;  1WT6 A;  3AE1 C;  3G71 P;  1GTW A;  3WMM 0;  5DJT B;  1X79 B;  1HJ0 A;  1G1J A;  3HE4 A;  3CXH E;  2KLU A;  1G2C B;  3S1K A;  1IFD A;  2XDJ A;  3LW5 J;  2OYI C;  1HVV A;  1NWQ A;  1AVO A;  5KLV J;  3RBZ A;  3P8M C;  1A02 J;  4OGQ C;  1H89 A;  1UIX A;  5KLI C;  3GW6 A;  4I6M C;  3U1C A;  1HH0 A;  1G1I A;  1EDJ A;  2FY8 A;  3L71 D;  5CCH D;  1SQX K;  1KOR A;  4H13 D;  1PIX A;  2R3S A;  1Q86 Q;  2V7Q J;  1QLE D;  3B5N A;  3SWK A;  4UB8 E;  1Q81 Q;  4WY4 C;  1L0N K;  2FYN B;  1LGH B;  3IF4 A;  2A06 D;  4U3F G;  5GTI E;  1BE3 D;  1KC8 Q;  4IL6 X;  3A7O A;  1OW8 A;  1N8R Q;  3M06 A;  1IFM A;  1MV8 A;  3L70 D;  1L0L G;  1KYO H;  3H32 B;  2QJK C;  1ZRT E;  5AVQ B;  4W7Y A;  1X8Y A;  2P7J A;  2GUS A;  1LTJ B;  5AVR B;  4HH2 A;  5AVW B;  3V2R A;  1PP9 G;  3CCQ P;  2K9Y A;  5KKZ C;  1FZB A;  4AYC A;  1VL2 A;  3L72 G;  4RKU J;  4W7Z A;  5KTB A;  1NH4 A;  2Q5U A;  2AEJ A;  2M0B A;  3S9O A;  2H88 C;  1RE3 C;  2O1J A;  4ZKP A;  3NTN A;  1BSH A;  3GLM A;  1URQ C;  4A7P A;  1P84 D;  1LT9 B;  3RK2 C;  4ZKU A;  1LTA C;  2IX7 C;  5CBO A;  3B8E B;  2M5A A;  2QG4 A;  3AEB C;  5APS A;  4RO0 A;  3VMY A;  3A0B H;  3M9Q A;  1T2K D;  1USD A;  3KZI H;  1W5C E;  3VP8 A;  1R5L A;  1M1J A;  1YQ4 C;  1BDC A;  1NTM E;  3RL0 D;  1SQP J;  2AXT H;  5KLV G;  3MUD A;  2UWJ E;  1LWU C;  1FOS E;  2CPB A;  3H1I E;  3UIA A;  1XTC C;  1NTK E;  2I8D A;  2AEF A;  3D6Y A;  2WSE H;  5TIS H;  1KIL D;  2D2C B;  1GU5 A;  1JEK A;  1NVO A;  2J5U A;  1FS0 E;  1LTB C;  2KS1 A;  1Y47 A;  1IFN A;  1NTM J;  1MKM A;  1BCC D;  2WSC J;  2OYH B;  4D6T D;  2G3A A;  3WU2 H;  1J1D C;  2OYO A;  3C8V A;  1N86 A;  1NTK J;  3OW2 O;  2R3C A;  1JY2 O;  3H1H E;  5CCH A;  3L73 D;  2E75 D;  2LXB A;  4WBA A;  3H1K E;  3HTK B;  2PP6 A;  3PHL A;  2ZYD A;  1TU3 F;  2Q3E A;  3PH0 A;  1CI6 B;  1N7S B;  1NAF A;  1R8E A;  1RH5 B;  1SQQ J;  1IFP A;  1MFZ A;  1XTG B;  2N1T D;  1W2E A;  2ZJS E;  1FJP A;  5EFW B;  5C39 A;  1KFM A;  1PPJ D;  3TSI A;  1H0T B;  2YKO A;  3H1K J;  1GU4 A;  1SQV J;  3NFQ A;  2K3R A;  3E7K A;  3V2P A;  2A45 I;  2JKV A;  3O6Q B;  1L4A B;  1D7M A;  2PFX A;  5KJ7 D;  1EQ7 A;  4KJM A;  1S2E A;  1LTI C;  1ZV8 A;  1KYO E;  3N7N A;  2HOD A;  5H2F H;  5AW6 B;  4I7Z B;  2O1K A;  4XA4 A;  3L74 J;  2O3J A;  2FYU D;  1YIT P;  1SQP G;  3B4S A;  3BCC D;  3ZDM A;  5DJU B;  3W68 A;  4N3Y B;  1MFT A;  3C9I A;  4OH8 B;  3K5B A;  3MD0 A;  5AVY B;  1SQB D;  3PTZ A;  1EZV E;  3Q5P A;  2BCC E;  2O01 J;  5APV A;  1NKN A;  1NTM G;  5E79 H;  2NPS C;  1CZQ A;  1LTJ C;  2OYI B;  2JWA A;  2W6B A;  1WRG A;  1Y9B A;  3A0B E;  1NTK G;  2NZ2 A;  1KIL A;  3KZI E;  1NTZ D;  3H1L E;  3IFM A;  1Q90 D;  1EXJ A;  1U7M A;  4OGQ B;  2E74 C;  1KQF B;  2QA4 P;  3AEE C;  1YHQ P;  2AXT E;  1PGP A;  2IDB A;  4YPC A;  2QM8 A;  2WTY A;  2A45 H;  5KLI B;  3VOP A;  1FDI A;  1KQG B;  1HJB A;  3CX5 D;  3JC2 2;  1S9K E;  5TIS E;  4I2L C;  1KB9 D;  1SQQ G;  3OAK A;  2QIW A;  1VQO P;  1ZR4 A;  2YIU C;  1ZLL A;  3H1L J;  4WY4 B;  1NO4 A;  4IOI H;  1NOH A;  2WPR A;  1OX3 A;  3WU2 E;  1AQT A;  3H1K G;  3L4F A;  2HPC A;  1FDM A;  1QVG O;  1FZC A;  2WSE J;  1GW4 A;  1Q2N A;  1YTZ T;  2XNX A;  2WMM A;  2N1T A;  1ZN5 A;  1FJK A;  4LC1 A;  2QJK B;  3AE6 C;  5AW1 B;  2YXR B;  2R32 A;  1P84 I;  5APQ A;  1CW5 A;  1E5W A;  2QEX P;  1IK9 A;  5KKZ B;  1DD3 A;  3L74 G;  3CMA P;  4PD4 D;  2XU6 A;  2W27 A;  3HUS C;  3HE5 B;  3ITK A;  3AEF C;  1T3U A;  2P67 A;  2QJP C;  5KJ7 A;  1NU1 K;  2ZVN B;  1RY3 A;  2WWW A;  1S5L H;  1N2D C;  1URQ B;  1ZP0 C;  3CC2 P;  1LTS C;  2FYU K;  2R5B A;  2W8Z A;  2QRX A;  2RH0 A;  1N7S C;  3RK2 B;  4ASV A;  4BRY B;  2YMY A;  3CWB J;  1VQM P;  1L0L D;  2I1J A;  3FWN A;  4ZMD A;  2DW3 A;  2Q3I A;  1SQB K;  4PV1 C;  4AQR D;  2E43 A;  3CC7 P;  3W67 A;  1G2C A;  5H2F E;  4MN4 C;  3FWL A;  4U3F J;  1LWU B;  2D2C D;  1Q7Y Q;  5APX A;  1UII A;  1PP9 D;  3TGU D;  2BCC G;  3L72 D;  3AE4 C;  1E79 H;  2C9L Y;  2Y0D A;  2JO1 A;  1H88 A;  1LP1 B;  2R5D A;  1NTZ K;  3H1L G;  2QM7 A;  3V2N A;  1J1D B;  5E79 E;  1VQ7 P;  4I7Z C;  2LR2 A;  4L76 A;  1NGM B;  3VMX A;  3QWO C;  1HWT C;  1ZW0 A;  3RBX A;  1RF1 A;  3VN0 A;  1VF5 C;  2W6J H;  5KLV D;  3RGU A;  1JMM A;  3V4W A;  3P8C E;  3V2Q A;  3IAO A;  3CXH D;  3JSV C;  4NPE A;  2GM4 A;  4QMA A;  2WSS H;  1YYC A;  3GHG C;  3VMA A;  4GOF A;  4W80 A;  1QL2 A;  2M3B A;  4DZO A;  3H32 A;  2WVR A;  5M1B A;  4RES B;  3AE3 C;  1L4A D;  2LXC B;  1M57 D;  3GG2 A;  3F5H A;  5KAI H;  2KIK A;  5BU5 A;  2HFE D;  2B89 A;  3II6 A;  1OW6 A;  5L8R J;  1K73 Q;  2OTL P;  3Q5R A;  2E5Y A;  1VQK P;  2B88 A;  3CWB G;  1GK4 A;  2E76 C;  2H8P D;  3HD7 C;  2WSF H;  3MZW B;  1PGO A;  2FFD C;  2R44 A;  1J1E C;  1LT9 A;  1RE4 C;  3KDP B;  1NYH A;  3CI9 A;  2ZYG A;  1VQ4 P;  1S3J A;  1JNM A;  1OW7 A;  1JY3 P;  1PV3 A;  2IBZ I;  1L0L K;  3V6I A;  2IYO A;  2J58 A;  3WUT A;  2A06 E;  2Z5H A;  1RQV A;  1S5L E;  1BE3 E;  2I1K A;  1ZRT D;  2NPS B;  2JEE A;  2YXQ B;  2G8Y A;  3M0D A;  3EWK A;  2KXP B;  2B87 A;  3CX5 I;  2OTJ P;  1MUU A;  3L70 E;  4OGQ D;  3AEG C;  3G6E P;  2WT7 B;  1Q82 Q;  1KB9 I;  3TF5 A;  2OYH A;  2E74 B;  1AFO A;  2NRG A;  5CCG C;  1SQP D;  1PL5 A;  4BWN A;  1ZXG A;  3VYI A;  1J2J B;  4WY4 D;  4UB6 H;  1GL2 C;  4XFJ A;  3FXD A;  1N73 A;  2FXO A;  5KAF H;  1JY2 N;  2YIU B;  3G9R A;  4DCK A;  3FX0 A;  1CI6 A;  1YJW P;  5KLV K;  1PFI A;  1IZN B;  4NPD A;  1NTM D;  2PRR A;  3MHV A;  3GF3 A;  2LKM A;  2HG5 D;  4WVZ A;  3BVH A;  4H44 C;  2RMZ A;  4PD4 I;  2C9N Y;  1NTK D;  1H0T A;  3CL3 D;  4DJG A;  3CCL P;  4CPG A;  1VQL P;  4JQ0 D;  1JTH B;  2CK3 H;  1YJ9 P;  3CCJ P;  4BXL A;  3O6Q A;  1L4A A;  4JYC A;  1FU1 A;  5GTH H;  3H1I J;  1SQQ D;  3HUS B;  1URQ D;  4N78 D;  2QJP B;  4D6T E;  3RK2 D;  1FAV A;  3L36 A;  1VQ8 P;  3L75 E;  3D71 A;  1SQV D;  5KAI E;  2E42 A;  3H1J E;  4GOD A;  1HUC A;  3O8Z A;  2M5A B;  1BGY E;  1HTL C;  4PV1 B;  4U7J A;  1M8O B;  3H1H J;  2WZ7 A;  1FC2 C;  4JF7 A;  5CJ4 A;  2XND H;  2OYI A;  3C1L A;  3L75 J;  3SWY A;  4PD4 H;  2ZXE B;  1SFC C;  1YTZ I;  3L74 D;  3A2A A;  3EQ2 A;  1AA0 A;  3H1J J;  1EDK A;  1JCC A;  1BGY J;  3A0H H;  3CCV P;  4IL6 H;  4C46 A;  2O01 N;  3E1R A;  1KYO D;  4K35 A;  1RF0 C;  3V4Q A;  2L91 A;  1SQP K;  4EI2 A;  3I5C A;  3CXH I;  2WPQ A;  3KQG A;  2Y0E A;  1ZME C;  1NU1 E;  4WY4 A;  2WPV B;  4ZNC A;  1VF5 B;  4H0L C;  2FYU E;  2ZT9 C;  3BRT B;  3CCM P;  2POH A;  1IK7 A;  1NTM K;  5AW0 B;  1W2B O;  4EYY Q;  2H89 C;  2BEZ F;  3GHG B;  4UB6 E;  1WMK A;  4HKZ H;  1SQB E;  1NTK K;  1NU1 J;  1IO4 A;  2M8R A;  5KAF E;  2XKM A;  3H1I G;  2OAR A;  2IBZ D;  4C7N A;  2QVA A;  2IZ0 A;  3N4X A;  5K5G B;  3RK3 C;  3H1L D;  1M90 Q;  2BCC J;  1OWA A;  3CCE P;  2IFM A;  3HE5 A;  2KB7 P;  3OA7 A;  1NTZ E;  1SQQ K;  5AW2 B;  2KSJ A;  3L35 A;  4JBZ A;  2RN0 A;  1RE3 A;  3BAS A;  2YKP A;  1URQ A;  2E76 B;  1ZOY C;  3HD7 B;  2FFD B;  3OJA B;  1J1E B;  1JM0 A;  5CMZ A;  2Z4E A;  4Y99 B;  3FGA D;  2IPP A;  3H1H G;  4D6T G;  3B5N C;  3VP9 A;  4BRY A;  1SQV K;  3EFG A;  2WPS A;  3L75 G;  1JOC A;  2C0W A;  5GTH E;  1QGK B;  3VTP C;  1NTZ J;  2P2U A;  2V7Q H;  3R2P A;  3D6Z A;  2KP8 A;  3U1A A;  2NPS D;  3H1J G;  1LWU A;  4TLF A;  1BGY G;  1DEE G;  2FXP A;  1EC5 A;  3RK3 E;  5AW8 B;  2E74 D;  1LP1 A;  1DX7 A;  2K1A A;  1YJN P;  3CWB D;  1BDD A;  3WUU A;  1IJD B;  2QSI A;  3KPE A;  3Q1M A;  4WB4 A;  2BAS A;  1GK6 A;  5AW5 B;  4PD4 E;  4DOJ A;  4U3F D;  1X0T A;  1OZH A;  1FDO A;  1GL2 B;  5APW A;  1SQX E;  4GOE A;  5BVZ A;  2IYP A;  1KZU B;  2KYV A;  4YXW H;  3A3Y B;  1L0N E;  3A0H E;  5AVU B;  2JR8 A;  1GZL A;  1NU1 G;  4IL6 E;  2KI7 B;  1M1K Q;  3T97 B;  3S4R A;  2E75 B;  2FYU G;  2KNC B;  1M1J C;  4H44 B;  3U59 A;  1EZV G;  1L0L E;  3MUD C;  1SQX J;  3AEC C;  5AW4 B;  1T8Z A;  3CLQ A;  1L0N J;  2M3E A;  2V4H A;  1S4X A;  1HBW A;  2XZR A;  3TGU E;  1R5S A;  1P84 H;  2MJZ A;  2FXM A;  1JY3 O;  4RJT A;  5AW3 B;  3P32 A;  2Q9I A;  4JPZ B;  3I56 P;  2K9J B;  1YIJ P;  2JDI H;  3AE2 C;  1NTZ G;  3RL0 g;  1N7S D;  3TYY A;  1L2P A;  2Y0C A;  3M91 A;  2KZJ A;  5CCH C;  4GDO A;  4H13 C;  1QX8 A;  3SFD C;  4PV1 D;  2OQQ A; 
#chains in the Genus database with same CATH homology
 1N73 A;  1AQ5 A;  1L4A B;  3M0D C;  5KJ7 D;  1EQ7 A;  3TNU B;  1JY2 N;  1LTI C;  1ZV8 A;  5APU A;  2YO2 A;  4AUW A;  3N7N A;  2ZFC A;  2YKQ A;  5AVV B;  3LID A;  2HOD A;  4IFD K;  1CI6 A;  4C7N B;  5KLV K;  2NPS A;  1PFI A;  1KFN A;  1LTJ A;  1KIL B;  5AW6 B;  2O1K A;  3MIW A;  4XA4 A;  3KYQ A;  2OYH C;  5CJ0 A;  1SFC B;  1VPC A;  4IFF A;  2LKM A;  1IFJ A;  2WT7 A;  2HG5 D;  2L5G B;  1JY3 N;  4HYT B;  4EOT A;  3BVH A;  2C0X A;  1KQL A;  2C9N Y;  2PAJ A;  3LIE A;  3B5N D;  4N3Y B;  3C9I A;  4OH8 B;  5AVZ B;  1T3J A;  3CL3 D;  1FOS F;  3MD0 A;  5AVY B;  1N73 C;  1JTH B;  4GKG A;  2YO3 A;  1CSB A;  5APV A;  4Y99 C;  5AW7 B;  1NKN A;  1NHL A;  1L4A A;  2NPS C;  4JYC A;  1CZQ A;  1FU1 A;  1SLQ A;  1LTJ C;  2N9B A;  2VRS A;  2OYI B;  3TNU A;  2W6B A;  1MZ9 A;  1WRG A;  4C7R A;  3HUS B;  3PP5 A;  1URQ D;  4LGD E;  2HPC B;  1M7L A;  2FYZ A;  4N78 D;  1KIL A;  1FZC B;  3IFM A;  3MTU E;  1JCD A;  3RK2 D;  1QL1 A;  1SFC A;  1FAV A;  1RF1 B;  3H6P A;  2N1T B;  3L36 A;  2QM8 A;  4B86 A;  2A45 H;  2WTY A;  3VOP A;  1HJB A;  1T2K C;  3HE4 B;  2XV5 A;  3M9H A;  4KHX A;  2E42 A;  1S9K E;  2H7H A;  3RL0 C;  2FKW B;  4I2L C;  1L4A C;  1HUC A;  5APY A;  3G3Z A;  3O8Z A;  3OAK A;  2KLV A;  1JTH A;  1ZR4 A;  1X9V A;  1HTL C;  1RF0 A;  1ZLL A;  2H43 A;  4WY4 B;  3RK3 B;  2WZ7 A;  1NO4 A;  2WSC H;  2O01 H;  1GD2 E;  1KIL C;  4JF7 A;  5CJ4 A;  2OYI A;  1NOH A;  3SWY A;  2WPR A;  2Z5I A;  2ZXE B;  1SFC C;  1YTZ I;  5AW9 B;  3HUS A;  3L4F A;  2HPC A;  1SP4 A;  1FDM A;  3HD7 D;  5AVS B;  1N7L A;  3P8C D;  1FZC A;  3EQ2 A;  1WT6 A;  1GW4 A;  3A2A A;  1NKZ B;  1GTW A;  3WMM 0;  1YTZ T;  1JCC A;  2XNX A;  1X79 B;  2N1T A;  1ZN5 A;  1FJK A;  3HTK A;  4LC1 A;  3M0A A;  4C46 A;  1VDF A;  3IR9 A;  1G1J A;  3HE4 A;  5AW1 B;  1N7S A;  3TK1 A;  2R32 A;  3B5N B;  1RF0 C;  3V4Q A;  1SQP K;  5APQ A;  1G2C B;  3I5C A;  1CW5 A;  1E5W A;  2WPQ A;  4M3L A;  1IFD A;  2XDJ A;  1IK9 A;  3KQG A;  2OYI C;  1HVV A;  2A45 G;  2XU6 A;  2W27 A;  4WY4 A;  3HUS C;  1NWQ A;  3HE5 B;  1T3U A;  3V5B A;  1FBM A;  2J59 M;  2P67 A;  1FZC C;  5KJ7 A;  1NU1 K;  3HRN A;  3P8M C;  1A02 J;  1RY3 A;  2WWW A;  1H89 A;  3BRT B;  1GDT A;  1N2D C;  1URQ B;  2N1T C;  2POH A;  1NTM K;  1LTS C;  5AW0 B;  2FYU K;  2R5B A;  4I6M C;  1N7S C;  3GHG B;  3RK2 B;  3U1C A;  1HH0 A;  1G1I A;  1SVF A;  2YMY A;  1Z56 A;  5CCH D;  1NTK K;  1SQX K;  5CCG D;  1IO4 A;  2M8R A;  2I1J A;  2XKM A;  2OAR A;  4C7N A;  3P7K A;  2Q3I A;  3B5N A;  1SQB K;  4AQR D;  1GL2 D;  3N4X A;  4WY4 C;  2E43 A;  1L0N K;  2Q7C A;  1LGH B;  1G2C A;  3RK3 C;  3VMZ A;  5KJ7 C;  1LWU B;  5APX A;  1FZA A;  1IC2 A;  1OWA A;  2IFM A;  1JO5 A;  3HE5 A;  2KB7 P;  4N78 E;  2KOG A;  2HYN A;  3OA7 A;  2C9L Y;  1SQQ K;  3A7O A;  3SWF A;  5AW2 B;  2KSJ A;  3L35 A;  1RE3 A;  3BAS A;  3M06 A;  1N73 B;  1OXZ A;  2IFN A;  1IFM A;  1MV8 A;  2YKP A;  1H88 A;  4IFM A;  2R5D A;  1URQ A;  1NTZ K;  3H32 B;  3HD7 B;  2FFD B;  3OJA B;  1J1E B;  5CMZ A;  5AVQ B;  4N6J A;  4W7Y A;  2Z4E A;  4Y99 B;  1X8Y A;  2P7J A;  2GUS A;  2IPP A;  2QM7 A;  3GHG A;  3B5N C;  1LTJ B;  1M1J B;  3V2N A;  1J1D B;  2P1J A;  5AVR B;  3VP9 A;  1SQV K;  4HH2 A;  5AVW B;  3EFG A;  2WPS A;  3V2R A;  1JOC A;  2C0W A;  3VMX A;  1FZB A;  1JUN A;  4AYC A;  3VTP C;  4W7Z A;  5KTB A;  1NH4 A;  2P2U A;  3BAT A;  3R2P A;  2GUV A;  1HWT C;  2Q5U A;  2KP8 A;  3U1A A;  2NPS D;  1RF1 A;  2YNY A;  3VN0 A;  1LWU A;  1IFI A;  1RE3 C;  2O1J A;  4LLH A;  4ZKP A;  3NTN A;  1JMM A;  3V4W A;  1URQ C;  3P8C E;  3V2Q A;  5AW8 B;  1LT9 B;  2GM4 A;  1YYC A;  1A02 F;  1HGZ A;  3RK2 C;  3GHG C;  4ZKU A;  1FZG A;  1LTA C;  2IX7 C;  3B8E B;  1DX7 A;  5APS A;  4W80 A;  1QL2 A;  2M3B A;  4DZO A;  3VMY A;  3A5T A;  3H32 A;  3HD7 A;  2FFD A;  1RE4 A;  3M9Q A;  1T2K D;  2HLO A;  1IJD B;  3KPE A;  3VP8 A;  4WB4 A;  1M1J A;  4RES B;  3RL0 D;  1L4A D;  3MUD A;  2BAS A;  3BRV B;  1GK6 A;  1RF1 C;  1ZR2 A;  2JJL A;  5AW5 B;  1LWU C;  4DOJ A;  1FOS E;  2CPB A;  1H8A A;  3UIA A;  1XTC C;  1GL2 B;  5APW A;  5BU5 A;  2HFE D;  3NXS A;  1HGV A;  5BVZ A;  1KZU B;  2WSE H;  5AVT B;  3II6 A;  4GT1 A;  2KYV A;  1KIL D;  4GIF A;  3A3Y B;  1GU5 A;  5AVX B;  1SFC D;  5AVU B;  1GW3 A;  1LTB C;  1GZL A;  1GK4 A;  2H8P D;  3HD7 C;  1IFN A;  2WSF H;  3E1I A;  2FFD C;  1LT9 A;  1J1E C;  1JY2 P;  1RE4 C;  3KDP B;  3L37 A;  3CI9 A;  2OYH B;  1M1J C;  3M9B A;  1J1D C;  4EIJ A;  3LW5 H;  3U59 A;  1N86 A;  1JNM A;  5AW4 B;  2R3C A;  1JY3 P;  1JY2 O;  1T8Z A;  3CLQ A;  1L0L K;  3MGN A;  1S9K D;  5CCH A;  5CCG A;  2J58 A;  3NMD A;  1LTG C;  2Z5H A;  4WBA A;  1HBW A;  2XZR A;  3HTK B;  2PP6 A;  2MJZ A;  1GL2 A;  2I1K A;  5CHX A;  1LTT C;  2FXM A;  2HOD B;  1CI6 B;  1N7S B;  2NPS B;  1NAF A;  2JEE A;  1JY3 O;  4JYB A;  3M0D A;  1LT9 C;  5AW3 B;  3P32 A;  2Q9I A;  1DH3 A;  1MUU A;  1MFZ A;  1FZF A;  1XTG B;  2N1T D;  2WT7 B;  1W2E A;  2W6A A;  5BU8 B;  2CPS A;  3T97 A;  1FJP A;  1N7S D;  4O9B A;  2OYH A;  3TYY A;  1KFM A;  1FZE A;  3TSI A;  5APT A;  2YKO A;  1AFO A;  3M91 A;  1GU4 A;  5CCH C;  5CCG C;  2WIT A;  3NFQ A;  4I1L A;  4XE5 B;  3VYI A;  1J2J B;  3V2P A;  4WY4 D;  1DEB A;  1GL2 C;  2A45 I;  3RK3 D;  3RL0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...