1YTZT

Crystal structure of skeletal muscle troponin in the ca2+-activated state
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
90
structure length
90
Chain Sequence
SYSSYLAKADQKRGKKQTARETKKKVLAERRKPLNIDHLNEDKLRDKAKELWDWLYQLQTEKYDFAEQIKRKKYEIVTLRNRIDQAQKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Ca2+-regulated structural changes in troponin
pubmed doi rcsb
source organism Gallus gallus
molecule tags Contractile protein
molecule keywords Troponin T
total genus 34
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2005-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.350 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ytzT00
1J1DC 1YTZI 4Y99C 1J1EB 1YTZT 4Y99B 1J1EC 1J1DB
chains in the Genus database with same CATH superfamily
1H8AA 1HVVA 2YIUB 1PP9G 1X9VA 1FZFA 2OYHC 3D70A 1LT1A 1YTZI 3FX0A 2WT7A 1N73C 2C9LY 2IYPA 1KQLA 1X8YA 1VQ4P 3D6YA 3AEGC 1N7SC 1T3UA 2YNYA 2AXCA 1M90Q 1E79H 4XE5B 3WUTA 2J58A 5KTBA 2WZ7A 1VQNP 2ZYAA 2KOGA 2OYHA 3TGUJ 2WPRA 4WBAA 2V7QH 2Z5HA 1AV1A 1GL2A 1L0LJ 1LP1B 1N86A 3H1HE 1VF5D 4JYBA 4EDFA 1HJBA 2PP6A 3KZIE 1LWUB 2FYNB 5KKZC 3BRVB 2JWAA 5TJHA 2RMZA 1LTAC 2H8PD 1JY2N 2K9JA 3H1JJ 1VPCA 2YXRB 4H44D 4DCKA 3HD7C 4ZMDA 1NTKJ 2JO1A 1DEBA 3AE9C 4H0LB 3V5BA 1XTGB 3GLMA 1NTMK 4U7JA 3CXHI 3JSVC 2O1KA 4OVNF 2AXTE 4N6JA 3L71J 1VQ7P 2AEFA 3B5ND 2QRXA 1XTCC 2NPSB 1EZVE 1OW7A 1LTIC 3L71E 1RY3A 1VQOP 1Q7YQ 1HTLC 3CX5E 4PD4E 4NPDA 3U59A 1DIPA 1HF9A 2G8YA 3OAKA 4L73A 1GW3A 1USEA 2WSEH 4W80A 3SSUA 1L0LD 1R5LA 3RK3C 1YIJP 2KNCB 1FC2C 1JMMA 1JB0J 3F89A 4PV1C 2I1KA 1ZN5A 1RE3C 3Q2YA 2Y9YA 1L0NE 1S5LH 4PJ0E 3H1KD 1VF5B 1YQ3C 4Z1MH 1M7LA 5KLIB 2IBZD 3M0DA 1NTZK 1OFCX 3L72G 3TGUE 2QEXP 3RBXA 2R3CA 2LR2A 2OTLP 3KQGA 5AVSB 3II6A 1PL5A 3L74G 3CMAP 1GTWA 2W83C 2E75C 3AEDC 3BRTB 1BDDA 1NKNA 1Y9BA 3L71D 3R4YA 5AW3B 4D6TJ 3A0BE 3VP9A 2KNCA 4ASVA 3CCQP 3TYYA 1FOSE 1L2PA 1PGOA 1SQQE 2ZYDA 3PLNA 3CC2P 1RF1C 3VMZA 2R3SA 4HB1A 5B5EE 1LTBC 1M56D 1FZEA 5KAFH 2N9BA 2WSEJ 3H1JD 3WU2H 1L0ND 3S1KA 3W68A 1M1KQ 1IZNB 1IFNA 4GOFA 2W27A 5B5EH 2OGUA 5E79E 5AVUB 3MTUE 3I55P 3V6IA 1Q86Q 2SPZA 1J1DC 3TGUD 3CWBJ 2R32A 3A7OA 3PH0A 3CWBD 1EXJA 3AE1C 1M1JA 2MJZA 1P84E 3TK1A 1QL2A 1U7MA 1ZRTE 5AW2B 3CPWO 1PPJE 1GU4A 2RKLA 1NU1J 5K5GB 3RL0B 2XKMA 3L70G 2K9JB 4NPEA 4W7ZA 3E1RA 1SLQA 3H1IE 3H25A 2OYOA 1J2JB 4IFMA 5APXA 2NRGA 5CCGD 1W2BO 3GHGB 3AE2C 3H1LE 3RK2C 1URQC 2K37A 1GK4A 1JY2O 1JY2P 1KZUB 4JQ0D 3OA7A 1ZOYC 2KZJA 2QJKC 4HH2A 5AVVB 1SVFA 3KHUA 1LJ2A 1K9MQ 3MGNA 3GF7A 3RK2B 2I1JA 2FBWC 4L76A 2IX7C 3B5NA 1MZ9A 2I8DA 2HFED 1GL2D 2KI7B 2XV5A 1SQQJ 3IF4A 3VTPC 3OJAB 1NTME 4PV1D 3CWBE 1M1JC 1EDIA 2KUBA 1SQVG 5L8RJ 1URQD 2WT7B 1QEXA 1IO4A 3BASA 3BCCJ 2V7QJ 2N1TB 3P8CD 2FXPA 4H13D 1Q81Q 1H88A 3LW5J 5AW0B 3AE5C 3AEBC 1N73A 1NTZD 4L74A 4EIJA 2BEQD 3Q5RA 1JEKA 2E43A 1JCDA 3ZDMA 3TNUA 3I56P 1BDCA 2LXBA 5KLVG 2FYUG 1GL2C 2NPSD 3UIAA 2FFDA 3B5NB 2WSCH 1RE4C 3G6EP 2KZIA 4O9BA 4CPGA 1H0TA 4Y99C 3WU2E 2CPBA 3T97A 4M3LA 1YTZT 3EFGA 4GT1A 1BSNA 3JCUH 1GU5A 1DH3A 1AVYA 2YO2A 1IK9A 1NU1G 1BE3G 4H0LD 1BGYG 1EZVD 1SQQK 1FZCB 1GD2E 1M57D 4LLHA 3L72J 1MFTA 2QJKB 3BATA 1N73B 3NFQA 1YITP 2OQQA 1TU3F 2WSFH 2E74B 2GA1A 3B4SA 5CBNA 1VQ8P 1JTHB 3H1HG 1ZV8A 1NTKD 2FFDC 1RE4A 2Q3IA 1X79B 3D71A 1HWTC 3FXDA 5DJUB 1RF1B 1VL2A 3CCLP 4U3FJ 2ZXEB 1OW8A 2WMMA 2M5AA 2XZRA 3CX5D 3G9RA 1KILB 2B89A 2IYOA 2KS1A 2H43A 1LTJC 1FZCA 1U7JA 2AXTH 1FDMA 3AEEC 3CCVP 2L5GB 2YIUC 1BCCG 2W90A 3CI9A 1OVRA 1SQXG 2B87B 1RH5B 4L75A 4YPCA 1NTZG 4KHXA 1S5LX 1W2EA 2ZVNB 3A3YB 3AEAC 3GHGA 3MIWA 5AVTB 1A02F 3P32A 2O01J 1BCCD 4XFJA 1OX3A 5KJ7C 1N7SD 2E74C 4N78D 4U3FG 3T97B 1SQPD 4IFDK 1LTJB 3F5HA 3H1JE 1FZCC 4KT0J 3RK3D 1S9KD 5APWA 3CCJP 1YHQP 3CC4P 1KFNA 3AE3C 1PGQA 3VN0A 5KLIC 4MN4C 5KKZB 1IFDA 4OGQC 2HODA 1N2DC 3LIEA 3D6ZA 4EI2A 2WPQA 3V2PA 2N1TA 2O1JA 1R8EA 1DD3A 1EDJA 3VP8A 3CCEP 3HD7D 1P84D 1SQXD 1VF5C 3NTNA 3WMM0 1AQTA 5KLVJ 1KQFB 1PPJD 1KYOI 2PRRA 1P84I 1YQ4C 4GDOA 5CCHC 1PP9J 2WSSH 2M3EA 1U57A 2P58A 1JMBA 3B8EB 2IFMA 2N1TC 5TISE 2H7HA 2J59M 1HUCA 3NXSA 4Y28J 1EZVI 1L4AD 2BCCD 2KSJA 3BCCG 3M9QA 1OVVA 2E76B 2M3BA 4YXWH 3S9OA 1Y8AA 2BEZF 3P7KA 1G2CB 2KB7P 1OXZA 1SFCB 2ZT9C 1ZW0A 3IN6A 3KPEA 2OARA 1S9KE 1NU1K 3RL0g 2J5UA 1VQ5P 1Y47A 1T8ZA 2Z5IA 1FDIA 4RO0A 2OTJP 3HRNA 1PZQA 1J1DB 5APTA 2C9NY 5CCHD 2K3RA 3CX5H 2K88A 3KXDA 3OW2O 1WMKA 2IFNA 4ZKPA 1NTMD 1QLED 4WY4D 1NWQA 3M06A 4I2LC 5KLVK 1KYOH 1SQBE 1M1JB 2R44A 3HUSC 3RL0C 3CL3D 2Y0DA 3RBZA 5AVQB 1QL1A 4NPFX 1IK7A 4I7ZB 1K8AQ 1GZLA 2FY8A 3G3ZA 3L73J 2RH0A 3L70J 3G4SP 1JUNA 2QM8A 3CXHE 3L74D 3PHLA 1SQBJ 2E75D 3IR9A 1LT9A 1S1CX 1X22A 5CCGC 3V4QA 1SP4A 1SQPG 1E5WA 1NH4A 1AA0A 2WSCJ 1S72P 1HGVA 1SQVD 3QWOC 2P10A 3O8ZA 1RHZB 2QVAA 1KB9E 3C1LA 4AUWA 1HGZA 1R5SA 2YKPA 2YO3A 5AVYB 2FFDB 4W7YA 1KFMA 4DT0A 1LTGC 4IFFA 1FZGA 5AW8B 4BRYB 1LTSC 4EYYQ 1MUUA 4K3AA 2KSEA 1FZBA 1SFCA 3AE4C 2FXMA 3AECC 1KMIZ 3SWYA 3VMXA 5BU8B 1NGMB 3L75E 3FXEA 2KXPB 5GTIH 1KN7A 4C7NB 2K1AA 2FYZA 1G1JA 3A0HE 2HPCA 3V4WA 1AQ5A 1S4XA 1GW4A 1FS0E 4TLFA 4UB6H 4D6TG 1SQBK 2QJYC 1KD1Q 2D2CD 3NMDA 1SQXK 1FE6A 2A45H 4OH8B 2RN0A 1QX8A 5CMZA 3E7KA 2PGDA 5GTHH 3H1IJ 1LNQA 3A2AA 3PTZA 1YJWP 2FYUD 4TT3H 1RF1A 1LTTC 1J1EC 1NU1E 3IAOA 4I6MC 1FJKA 2VRSA 1NTKE 4YXDC 1VQMP 3EFFK 2MKVA 5AVZB 1BGYD 1EDKA 2QSIA 3VYIA 5B66E 2R5DA 3CMEP 2KS1B 1YI2P 1VQ6P 3VMAA 2Q1KA 4Y99B 2OYIA 4UB6E 3H1HJ 2JR8A 3H6PA 5KJ7A 4WVZA 5APVA 4YTPC 1G2CA 2LXCB 3W67A 5CBOA 4R4MA 1KORA 2JWDA 2CK3H 3M0DC 5AW5B 1OZHA 5AW1B 1BGYJ 1KB9I 2ZXXA 5C39A 1SQXJ 2DW3A 2PFXA 1G1IA 4PV1B 4WWIA 3Q1MA 1KILC 1LWUA 3L71G 4JYCA 5KAFE 4RKUJ 3H1ID 4OWFA 5BVZA 4C46A 1M8OB 1BCCE 3LIDA 2Q6QA 3H1LD 1KQGB 4GKGA 1CI6B 3H1KG 1SQXE 4N3YB 5H2FE 3USSA 4LGDE 1FDOA 3MUDC 3N7NA 1Q90D 5AVRB 3SWKA 2FYUK 3RK3E 2HODB 2QG4A 2E5TA 3IFMA 4DOJA 1KILE 2QE7H 3M91A 1ZP0C 4OGQB 3K5BA 3MP7B 4HJGH 1L0LG 3VOPA 5EFWB 1KYOD 1FOSF 3SWFA 1L4AA 1QGKB 3TSIA 3L37A 2BCCE 1RQVA 5KJ7D 4IL6E 3H32B 3HTKA 3L72E 1RF0A 1SQQG 3TGUG 5CCHA 1KQSO 3CD6P 1CW5A 3L75J 5AW6B 3C9IA 4H0LC 3FWLA 1NAFA 3AE6C 1SFCC 2ZT9B 3P8CE 5APYA 1BE3J 5KAIE 3CCMP 4BRYA 1Q2NA 1CI6A 2BASA 1AVOA 2B88A 2AEMA 2R5BA 1GK6A 3Q3DA 2FXOA 2OTKE 2W6BA 3MD0A 4RESB 5AW4B 2NPSA 1AJYA 2KIKA 3CXHH 4ZNCA 3CCSP 1SQBD 1WT6A 2B9BA 4U3FD 1HBWA 2FYUJ 3AEFC 1HJ0A 3WUUA 2A06E 2Q5UA 1DX7A 5APSA 4H44B 1RF0C 1S3JA 2OYHB 1K04A 4R4LA 4PJ0H 3AE7C 2Y9ZA 3BCCE 1D7MA 3L70E 3JC22 3L73E 3GG2A 4K35A 3ABVC 3TDKA 3LW5H 3L72D 5B66H 3HE4A 1EC5A 2QJYB 1NYHA 2XU6A 2ZT9D 2A45G 2E74D 2P67A 3GW6A 1PPJG 1PV3A 4GOEA 4KJMA 1H89A 1MKMA 4WY4B 5DJTB 1L0LK 1T2KC 5M1BA 3KZIH 3KDPB 1N7SA 1K05A 3CCRP 1T3JA 2E75B 1EDLA 1LT9C 1BE3D 3H1LG 5CCGA 2NZ2A 2Q9IA 3PRJA 4GODA 1VQLP 1CSBA 2IBZE 4OGQD 5GTHE 1N7LA 1VDFA 3L75D 5GTIE 1SQVE 1NO4A 3B5NC 1KB9D 1NOHA 2FKWB 3L74J 4PD4H 3N4XA 3L70D 2C0WA 2JJLA 4XA4A 5E79H 4DJGA 2ZFCA 1IFJA 1PFIA 1NJIQ 1PP9E 1NTMG 4WY4A 2JP3A 3HD7A 3CWBG 3L4FA 1EXIA 5KLVE 2FYUE 3MZWB 1T6AA 2N1TD 2GUSA 3R2PA 4HKZH 4N78E 3FWNA 1P84H 3H1LJ 1L4AC 1OVUA 2YKOA 3M9BA 2YXQB 3V2NA 3KYQA 2B87A 3GHGC 1ZR4A 2E42A 2WTYA 3Q5SA 5APQA 4DZOA 1JCCA 1L4AB 3FGAD 1Q82Q 2QIWA 1BE3E 2ZJSE 3SFDC 3V2RA 3H32A 3HUSA 3CLQA 3L75G 1BCCJ 2AEJA 2P2UA 1FZAA 5CJ0A 4H44C 3Q5PA 2Y0EA 2HG5D 4UB8E 3RK3B 4WB4A 4D6TE 3MHVA 4WY4C 2BCCJ 4JF7A 3WUVA 4AQRD 1ZRTD 4EOTA 1JY3N 2H89C 3HD7B 1FAVA 3A0BH 4JBZA 3TF5A 2O01H 2WQYC 1BGYE 1OIPA 1USDA 2M0BA 1OMIA 3EWKA 3H1HD 2D2CC 1PP9D 3B71A 1FBMA 2A45I 4UB8H 5AVWB 2QA4P 1BSHA 1KTMA 1YJ9P 4AYCA 1J1EB 3RL0D 1NTKG 4I1LA 1CZQA 1IFMA 2IBZI 2D2CB 2N9YB 2L91A 2W6AA 3P8MC 1EZVG 1NTKK 4BWNA 3A5TA 3BVHA 2JDIH 2XNDH 1A02J 2WITA 2WPSA 1L0NJ 1LTJA 2QJPB 1YBKA 3PJSK 4ASWA 3EQ2A 1RQUA 5AVXB 2OYIB 5KAIH 1S2EA 5AW7B 2ZAEB 3M9HA 1IFPA 4PD4D 3I5CA 1S5LE 5BU5A 1L0NG 4IL6H 3L36A 4C7RA 3TNUB 5TISH 1MFZA 2CPSA 1JTHA 3CC7P 1YYCA 2PAJA 5CHXA 3S4RA 1VQKP 3JCUE 1SQPK 4HYTB 2W6JH 2WSFJ 4IOIH 1JO5A 1UIXA 2K9YA 3VMYA 1JNMA 5CJ4A 1DEEG 1NTZE 1KILD 1X0TA 2KP8A 2P1JA 3HTKB 1KC8Q 2JKVA 2OYIC 4PD4I 3H1KE 1KYOE 3SFEC 2M5AB 3CXHD 3L74E 4A7PA 3H1KJ 4U3FE 2V4HA 1PGJA 1ZR2A 2P7JA 1QVGO 1SQVJ 1N8RQ 2HPCB 2O3JA 3H1JG 2A06D 3A0HH 1NTZJ 1AFOA 1L0LE 1IJDB 1OWAA 2M8RA 2E76C 3PP5A 5AW9B 4BXLA 4RJTA 1YJNP 1FJPA 2BCCG 3BCCD 2KK7A 2HR3A 2ITAA 3L73D 4H13C 2QM7A 2XDJA 4QMAA 2Q7CA 1LP1A 4LC1A 2ZVOB 3CCUP 1SQQD 2YKQA 2IPPA 1URQA 1GMJA 2WWWA 1ZXGA 2QJPC 3ITKA 1KB9H 2H88C 2IZ0A 3O6QB 4H13B 1KILA 2C0XA 2HYNA 2POHA 1ZLLA 1K73Q 1NHLA 1NTMJ 1SFCD 2KLUA 1H0TB 1PIXA 3HE4B 2E76D 3HUSB 4ZKUA 1Z56A 1MV8A 4GIFA 1DD4A 1EQ7A 1JOCA 5APUA 1SQVK 3U1AA 3MUDA 4B86A 2A06G 3V2QA 1LT9B 2LKMA 1HH0A 3RK2D 1SS1A 1WRGA 3H1IG 1IFIA 4JPZB 1SQBG 2GM4A 1PGPA 2KYVA 1NU1D 2W8ZA 1URQB 2JEEA 2HLOA 3GF3A 3HE5B 3L35A 3L73G 3QH9A 1JY3O 1JY3P 1FU1A 1LGHB 2XNXA 3O6QA 5H2FH 1KV4A 1GL2B 2YMYA 2Z4EA 2IZ1A 2KLVA 5KLVD 2UWJE 2Q3EA 1SQPE 2GUVA 3U1CA 1L0NK 3M0AA 1RE3A 2E5YA 2ZYGA 3RGUA 1VQPP 2YMKA 1VQ9P 1NVOA 1QVFO 2IDBA 4C7NA 2WVRA 1JM0A 3C8VA 2WPVB 3E1IA 1N7SB 1NAYA 1NKZB 2IBZG 3G71P 4IL6X 1T2KD 2O01N 1LWUC 2FYNC 1OW6A 1ZMEC 1W5CE 3HE5A 1UIIA 3CX5I 3GMAA 1GDTA 1IC2A 2NPSC 4D6TD 3AE8C 4I7ZC 1SQPJ 2G3AA 2Y0CA
chains in the Genus database with same CATH topology
1H8AA 1HVVA 1FZFA 1X9VA 2OYHC 1YTZI 2WT7A 2C9LY 1N73C 1KQLA 1X8YA 1N7SC 1T3UA 2YNYA 4XE5B 2J58A 5KTBA 2WZ7A 2KOGA 2OYHA 2WPRA 4WBAA 2Z5HA 1GL2A 1N86A 4JYBA 1HJBA 2PP6A 1LWUB 2H43A 3BRVB 1LTAC 2H8PD 1JY2N 1VPCA 3HD7C 1DEBA 3V5BA 1XTGB 1NTMK 2O1KA 4N6JA 3B5ND 1XTCC 2NPSB 1LTIC 1RY3A 1HTLC 3U59A 3OAKA 1GW3A 2WSEH 4W80A 3RK3C 1JMMA 2I1KA 1ZN5A 1RE3C 1M7LA 3M0DA 1NTZK 2R3CA 3KQGA 5AVSB 3II6A 1GTWA 1JO5A 3BRTB 1NKNA 5AW3B 3VP9A 1FOSE 3TYYA 1RF1C 3VMZA 1LTBC 1FZEA 2N9BA 1IFNA 2W27A 5AVUB 3MTUE 1J1DC 2R32A 3A7OA 1M1JA 2MJZA 3TK1A 1QL2A 5AW2B 1GU4A 3RL0B 2XKMA 4W7ZA 1SLQA 4IFMA 1J2JB 5APXA 5CCGD 3GHGB 3RK2C 1URQC 1GK4A 1JY2O 1JY2P 1KZUB 3OA7A 4HH2A 5AVVB 1SVFA 3MGNA 3RK2B 2I1JA 2IX7C 3B5NA 1MZ9A 2HFED 1GL2D 2XV5A 3OJAB 1M1JC 2WT7B 1URQD 1IO4A 3BASA 2N1TB 3P8CD 1H88A 5AW0B 1N73A 4EIJA 2E43A 1JCDA 3TNUA 1GL2C 2NPSD 3UIAA 2FFDA 3B5NB 2WSCH 1RE4C 4O9BA 4Y99C 2CPBA 3T97A 4M3LA 1YTZT 3EFGA 4GT1A 1GU5A 1DH3A 2YO2A 1FZCB 1IK9A 1SQQK 1GD2E 4LLHA 3BATA 1N73B 3NFQA 2WSFH 1JTHB 1ZV8A 2FFDC 1RE4A 2Q3IA 1X79B 1HWTC 1RF1B 2ZXEB 2XZRA 1FZCA 1KILB 1LTJC 1FDMA 2L5GB 3CI9A 4KHXA 1W2EA 3GHGA 3A3YB 5AVTB 3MIWA 1A02F 3P32A 5KJ7C 1N7SD 4N78D 4IFDK 1LTJB 1FZCC 3RK3D 1S9KD 5APWA 1KFNA 3VN0A 1IFDA 2HODA 1N2DC 3LIEA 2WPQA 3V2PA 2N1TA 2O1JA 3VP8A 3HD7D 3NTNA 3WMM0 5CCHC 3B8EB 2IFMA 2N1TC 2H7HA 2J59M 1HUCA 3NXSA 1L4AD 3M9QA 2KSJA 2M3BA 3P7KA 1G2CB 2KB7P 1OXZA 1SFCB 3KPEA 1S9KE 2OARA 1NU1K 1T8ZA 2Z5IA 3HRNA 5APTA 1J1DB 2C9NY 5CCHD 2IFNA 4ZKPA 1NWQA 4WY4D 3M06A 4I2LC 5KLVK 1M1JB 3RL0C 3HUSC 3CL3D 5AVQB 1QL1A 1GZLA 3G3ZA 1JUNA 2QM8A 3V4QA 3IR9A 1LT9A 5CCGC 1SP4A 1E5WA 1NH4A 1HGVA 3O8ZA 4AUWA 1HGZA 2YKPA 2YO3A 5AVYB 2FFDB 4W7YA 1KFMA 1LTGC 4IFFA 1FZGA 5AW8B 1LTSC 1MUUA 1FZBA 1SFCA 2FXMA 3SWYA 3VMXA 5BU8B 4C7NB 1AQ5A 2FYZA 1G1JA 2HPCA 3V4WA 1GW4A 1SQBK 3NMDA 1SQXK 4OH8B 2A45H 5CMZA 3A2AA 1RF1A 1LTTC 1J1EC 4I6MC 1FJKA 2VRSA 5AVZB 3VYIA 2R5DA 2OYIA 4Y99B 3H6PA 5KJ7A 5APVA 1G2CA 5AW5B 5AW1B 1G1IA 1KILC 1LWUA 4JYCA 5BVZA 4C46A 3LIDA 4N3YB 4GKGA 1CI6B 4LGDE 5AVRB 3N7NA 2FYUK 2HODB 3IFMA 4DOJA 3M91A 3VOPA 1FOSF 3SWFA 1L4AA 3TSIA 3L37A 5KJ7D 3H32B 3HTKA 5CCHA 1RF0A 1CW5A 5AW6B 3C9IA 1NAFA 1SFCC 5APYA 3P8CE 1CI6A 2BASA 2R5BA 1GK6A 4RESB 5AW4B 2W6BA 3MD0A 2NPSA 1WT6A 1HBWA 1DX7A 2Q5UA 5APSA 1RF0C 2OYHB 3LW5H 3HE4A 2XU6A 2A45G 2P67A 1H89A 4WY4B 1L0LK 1T2KC 3KDPB 1N7SA 1T3JA 1LT9C 5CCGA 2Q9IA 1CSBA 1N7LA 1VDFA 1NO4A 3B5NC 1NOHA 2FKWB 3N4XA 4XA4A 2C0WA 2JJLA 1PFIA 2ZFCA 1IFJA 4WY4A 3HD7A 3L4FA 2N1TD 2GUSA 3R2PA 4N78E 3VTPC 3V2NA 4AYCA 1L4AC 3M9BA 2YKOA 1ZR4A 3KYQA 3GHGC 2E42A 2WTYA 5APQA 4DZOA 1JCCA 1L4AB 3V2RA 3H32A 3HUSA 3CLQA 5CJ0A 2P2UA 1FZAA 2HG5D 3RK3B 4WB4A 4WY4C 4JF7A 4AQRD 4EOTA 1JY3N 3HD7B 1FAVA 2O01H 3M0DC 5AVWB 1FBMA 2A45I 1J1EB 3RL0D 4I1LA 1CZQA 1IFMA 2W6AA 3P8MC 3BVHA 1A02J 1NTKK 3A5TA 2WITA 2WPSA 1LTJA 3EQ2A 5AVXB 2OYIB 5AW7B 3M9HA 3I5CA 5BU5A 3L36A 4C7RA 3TNUB 1MFZA 2CPSA 1JTHA 1YYCA 2PAJA 5CHXA 1SQPK 4HYTB 3VMYA 1JNMA 5CJ4A 1KILD 2KP8A 2P1JA 3HTKB 2OYIC 1ZR2A 2P7JA 2HPCB 1AFOA 1IJDB 1OWAA 2M8RA 3PP5A 5AW9B 1FJPA 2Q7CA 2QM7A 2XDJA 4LC1A 2YKQA 2IPPA 1URQA 2WWWA 1KILA 2C0XA 2HYNA 2POHA 1ZLLA 1NHLA 1SFCD 3HE4B 3HUSB 4ZKUA 1Z56A 1MV8A 4GIFA 1EQ7A 1JOCA 5APUA 1SQVK 3U1AA 3MUDA 4B86A 3V2QA 1LT9B 2LKMA 1HH0A 3RK2D 1WRGA 1IFIA 2GM4A 2KYVA 1URQB 2JEEA 2HLOA 3HE5B 3L35A 1JY3O 1JY3P 1FU1A 1LGHB 2XNXA 1GL2B 2YMYA 2Z4EA 2KLVA 2GUVA 3U1CA 1L0NK 3M0AA 1RE3A 4C7NA 3E1IA 1N7SB 1T2KD 1NKZB 1LWUC 3HE5A 1GDTA 1IC2A 2NPSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J1D C;  1YTZ I;  4Y99 C;  1J1E B;  1YTZ T;  4Y99 B;  1J1E C;  1J1D B; 
#chains in the Genus database with same CATH topology
 1H8A A;  1HVV A;  2YIU B;  1PP9 G;  1X9V A;  1FZF A;  2OYH C;  3D70 A;  1LT1 A;  1YTZ I;  3FX0 A;  2WT7 A;  1N73 C;  2C9L Y;  2IYP A;  1KQL A;  1X8Y A;  1VQ4 P;  3D6Y A;  3AEG C;  1N7S C;  1T3U A;  2YNY A;  2AXC A;  1M90 Q;  1E79 H;  4XE5 B;  3WUT A;  2J58 A;  5KTB A;  2WZ7 A;  1VQN P;  2ZYA A;  2KOG A;  2OYH A;  3TGU J;  2WPR A;  4WBA A;  2V7Q H;  2Z5H A;  1AV1 A;  1GL2 A;  1L0L J;  1LP1 B;  1N86 A;  3H1H E;  1VF5 D;  4JYB A;  4EDF A;  1HJB A;  2PP6 A;  3KZI E;  1LWU B;  2FYN B;  5KKZ C;  3BRV B;  2JWA A;  5TJH A;  2RMZ A;  1LTA C;  2H8P D;  1JY2 N;  2K9J A;  3H1J J;  1VPC A;  2YXR B;  4H44 D;  4DCK A;  3HD7 C;  4ZMD A;  1NTK J;  2JO1 A;  1DEB A;  3AE9 C;  4H0L B;  3V5B A;  1XTG B;  3GLM A;  1NTM K;  4U7J A;  3CXH I;  3JSV C;  2O1K A;  4OVN F;  2AXT E;  4N6J A;  3L71 J;  1VQ7 P;  2AEF A;  3B5N D;  2QRX A;  1XTC C;  2NPS B;  1EZV E;  1OW7 A;  1LTI C;  3L71 E;  1RY3 A;  1VQO P;  1Q7Y Q;  1HTL C;  3CX5 E;  4PD4 E;  4NPD A;  3U59 A;  1DIP A;  1HF9 A;  2G8Y A;  3OAK A;  4L73 A;  1GW3 A;  1USE A;  2WSE H;  4W80 A;  3SSU A;  1L0L D;  1R5L A;  3RK3 C;  1YIJ P;  2KNC B;  1FC2 C;  1JMM A;  1JB0 J;  3F89 A;  4PV1 C;  2I1K A;  1ZN5 A;  1RE3 C;  3Q2Y A;  2Y9Y A;  1L0N E;  1S5L H;  4PJ0 E;  3H1K D;  1VF5 B;  1YQ3 C;  4Z1M H;  1M7L A;  5KLI B;  2IBZ D;  3M0D A;  1NTZ K;  1OFC X;  3L72 G;  3TGU E;  2QEX P;  3RBX A;  2R3C A;  2LR2 A;  2OTL P;  3KQG A;  5AVS B;  3II6 A;  1PL5 A;  3L74 G;  3CMA P;  1GTW A;  2W83 C;  2E75 C;  3AED C;  3BRT B;  1BDD A;  1NKN A;  1Y9B A;  3L71 D;  3R4Y A;  5AW3 B;  4D6T J;  3A0B E;  3VP9 A;  2KNC A;  4ASV A;  3CCQ P;  3TYY A;  1FOS E;  1L2P A;  1PGO A;  1SQQ E;  2ZYD A;  3PLN A;  3CC2 P;  1RF1 C;  3VMZ A;  2R3S A;  4HB1 A;  5B5E E;  1LTB C;  1M56 D;  1FZE A;  5KAF H;  2N9B A;  2WSE J;  3H1J D;  3WU2 H;  1L0N D;  3S1K A;  3W68 A;  1M1K Q;  1IZN B;  1IFN A;  4GOF A;  2W27 A;  5B5E H;  2OGU A;  5E79 E;  5AVU B;  3MTU E;  3I55 P;  3V6I A;  1Q86 Q;  2SPZ A;  1J1D C;  3TGU D;  3CWB J;  2R32 A;  3A7O A;  3PH0 A;  3CWB D;  1EXJ A;  3AE1 C;  1M1J A;  2MJZ A;  1P84 E;  3TK1 A;  1QL2 A;  1U7M A;  1ZRT E;  5AW2 B;  3CPW O;  1PPJ E;  1GU4 A;  2RKL A;  1NU1 J;  5K5G B;  3RL0 B;  2XKM A;  3L70 G;  2K9J B;  4NPE A;  4W7Z A;  3E1R A;  1SLQ A;  3H1I E;  3H25 A;  2OYO A;  1J2J B;  4IFM A;  5APX A;  2NRG A;  5CCG D;  1W2B O;  3GHG B;  3AE2 C;  3H1L E;  3RK2 C;  1URQ C;  2K37 A;  1GK4 A;  1JY2 O;  1JY2 P;  1KZU B;  4JQ0 D;  3OA7 A;  1ZOY C;  2KZJ A;  2QJK C;  4HH2 A;  5AVV B;  1SVF A;  3KHU A;  1LJ2 A;  1K9M Q;  3MGN A;  3GF7 A;  3RK2 B;  2I1J A;  2FBW C;  4L76 A;  2IX7 C;  3B5N A;  1MZ9 A;  2I8D A;  2HFE D;  1GL2 D;  2KI7 B;  2XV5 A;  1SQQ J;  3IF4 A;  3VTP C;  3OJA B;  1NTM E;  4PV1 D;  3CWB E;  1M1J C;  1EDI A;  2KUB A;  1SQV G;  5L8R J;  1URQ D;  2WT7 B;  1QEX A;  1IO4 A;  3BAS A;  3BCC J;  2V7Q J;  2N1T B;  3P8C D;  2FXP A;  4H13 D;  1Q81 Q;  1H88 A;  3LW5 J;  5AW0 B;  3AE5 C;  3AEB C;  1N73 A;  1NTZ D;  4L74 A;  4EIJ A;  2BEQ D;  3Q5R A;  1JEK A;  2E43 A;  1JCD A;  3ZDM A;  3TNU A;  3I56 P;  1BDC A;  2LXB A;  5KLV G;  2FYU G;  1GL2 C;  2NPS D;  3UIA A;  2FFD A;  3B5N B;  2WSC H;  1RE4 C;  3G6E P;  2KZI A;  4O9B A;  4CPG A;  1H0T A;  4Y99 C;  3WU2 E;  2CPB A;  3T97 A;  4M3L A;  1YTZ T;  3EFG A;  4GT1 A;  1BSN A;  3JCU H;  1GU5 A;  1DH3 A;  1AVY A;  2YO2 A;  1IK9 A;  1NU1 G;  1BE3 G;  4H0L D;  1BGY G;  1EZV D;  1SQQ K;  1FZC B;  1GD2 E;  1M57 D;  4LLH A;  3L72 J;  1MFT A;  2QJK B;  3BAT A;  1N73 B;  3NFQ A;  1YIT P;  2OQQ A;  1TU3 F;  2WSF H;  2E74 B;  2GA1 A;  3B4S A;  5CBN A;  1VQ8 P;  1JTH B;  3H1H G;  1ZV8 A;  1NTK D;  2FFD C;  1RE4 A;  2Q3I A;  1X79 B;  3D71 A;  1HWT C;  3FXD A;  5DJU B;  1RF1 B;  1VL2 A;  3CCL P;  4U3F J;  2ZXE B;  1OW8 A;  2WMM A;  2M5A A;  2XZR A;  3CX5 D;  3G9R A;  1KIL B;  2B89 A;  2IYO A;  2KS1 A;  2H43 A;  1LTJ C;  1FZC A;  1U7J A;  2AXT H;  1FDM A;  3AEE C;  3CCV P;  2L5G B;  2YIU C;  1BCC G;  2W90 A;  3CI9 A;  1OVR A;  1SQX G;  2B87 B;  1RH5 B;  4L75 A;  4YPC A;  1NTZ G;  4KHX A;  1S5L X;  1W2E A;  2ZVN B;  3A3Y B;  3AEA C;  3GHG A;  3MIW A;  5AVT B;  1A02 F;  3P32 A;  2O01 J;  1BCC D;  4XFJ A;  1OX3 A;  5KJ7 C;  1N7S D;  2E74 C;  4N78 D;  4U3F G;  3T97 B;  1SQP D;  4IFD K;  1LTJ B;  3F5H A;  3H1J E;  1FZC C;  4KT0 J;  3RK3 D;  1S9K D;  5APW A;  3CCJ P;  1YHQ P;  3CC4 P;  1KFN A;  3AE3 C;  1PGQ A;  3VN0 A;  5KLI C;  4MN4 C;  5KKZ B;  1IFD A;  4OGQ C;  2HOD A;  1N2D C;  3LIE A;  3D6Z A;  4EI2 A;  2WPQ A;  3V2P A;  2N1T A;  2O1J A;  1R8E A;  1DD3 A;  1EDJ A;  3VP8 A;  3CCE P;  3HD7 D;  1P84 D;  1SQX D;  1VF5 C;  3NTN A;  3WMM 0;  1AQT A;  5KLV J;  1KQF B;  1PPJ D;  1KYO I;  2PRR A;  1P84 I;  1YQ4 C;  4GDO A;  5CCH C;  1PP9 J;  2WSS H;  2M3E A;  1U57 A;  2P58 A;  1JMB A;  3B8E B;  2IFM A;  2N1T C;  5TIS E;  2H7H A;  2J59 M;  1HUC A;  3NXS A;  4Y28 J;  1EZV I;  1L4A D;  2BCC D;  2KSJ A;  3BCC G;  3M9Q A;  1OVV A;  2E76 B;  2M3B A;  4YXW H;  3S9O A;  1Y8A A;  2BEZ F;  3P7K A;  1G2C B;  2KB7 P;  1OXZ A;  1SFC B;  2ZT9 C;  1ZW0 A;  3IN6 A;  3KPE A;  2OAR A;  1S9K E;  1NU1 K;  3RL0 g;  2J5U A;  1VQ5 P;  1Y47 A;  1T8Z A;  2Z5I A;  1FDI A;  4RO0 A;  2OTJ P;  3HRN A;  1PZQ A;  1J1D B;  5APT A;  2C9N Y;  5CCH D;  2K3R A;  3CX5 H;  2K88 A;  3KXD A;  3OW2 O;  1WMK A;  2IFN A;  4ZKP A;  1NTM D;  1QLE D;  4WY4 D;  1NWQ A;  3M06 A;  4I2L C;  5KLV K;  1KYO H;  1SQB E;  1M1J B;  2R44 A;  3HUS C;  3RL0 C;  3CL3 D;  2Y0D A;  3RBZ A;  5AVQ B;  1QL1 A;  4NPF X;  1IK7 A;  4I7Z B;  1K8A Q;  1GZL A;  2FY8 A;  3G3Z A;  3L73 J;  2RH0 A;  3L70 J;  3G4S P;  1JUN A;  2QM8 A;  3CXH E;  3L74 D;  3PHL A;  1SQB J;  2E75 D;  3IR9 A;  1LT9 A;  1S1C X;  1X22 A;  5CCG C;  3V4Q A;  1SP4 A;  1SQP G;  1E5W A;  1NH4 A;  1AA0 A;  2WSC J;  1S72 P;  1HGV A;  1SQV D;  3QWO C;  2P10 A;  3O8Z A;  1RHZ B;  2QVA A;  1KB9 E;  3C1L A;  4AUW A;  1HGZ A;  1R5S A;  2YKP A;  2YO3 A;  5AVY B;  2FFD B;  4W7Y A;  1KFM A;  4DT0 A;  1LTG C;  4IFF A;  1FZG A;  5AW8 B;  4BRY B;  1LTS C;  4EYY Q;  1MUU A;  4K3A A;  2KSE A;  1FZB A;  1SFC A;  3AE4 C;  2FXM A;  3AEC C;  1KMI Z;  3SWY A;  3VMX A;  5BU8 B;  1NGM B;  3L75 E;  3FXE A;  2KXP B;  5GTI H;  1KN7 A;  4C7N B;  2K1A A;  2FYZ A;  1G1J A;  3A0H E;  2HPC A;  3V4W A;  1AQ5 A;  1S4X A;  1GW4 A;  1FS0 E;  4TLF A;  4UB6 H;  4D6T G;  1SQB K;  2QJY C;  1KD1 Q;  2D2C D;  3NMD A;  1SQX K;  1FE6 A;  2A45 H;  4OH8 B;  2RN0 A;  1QX8 A;  5CMZ A;  3E7K A;  2PGD A;  5GTH H;  3H1I J;  1LNQ A;  3A2A A;  3PTZ A;  1YJW P;  2FYU D;  4TT3 H;  1RF1 A;  1LTT C;  1J1E C;  1NU1 E;  3IAO A;  4I6M C;  1FJK A;  2VRS A;  1NTK E;  4YXD C;  1VQM P;  3EFF K;  2MKV A;  5AVZ B;  1BGY D;  1EDK A;  2QSI A;  3VYI A;  5B66 E;  2R5D A;  3CME P;  2KS1 B;  1YI2 P;  1VQ6 P;  3VMA A;  2Q1K A;  4Y99 B;  2OYI A;  4UB6 E;  3H1H J;  2JR8 A;  3H6P A;  5KJ7 A;  4WVZ A;  5APV A;  4YTP C;  1G2C A;  2LXC B;  3W67 A;  5CBO A;  4R4M A;  1KOR A;  2JWD A;  2CK3 H;  3M0D C;  5AW5 B;  1OZH A;  5AW1 B;  1BGY J;  1KB9 I;  2ZXX A;  5C39 A;  1SQX J;  2DW3 A;  2PFX A;  1G1I A;  4PV1 B;  4WWI A;  3Q1M A;  1KIL C;  1LWU A;  3L71 G;  4JYC A;  5KAF E;  4RKU J;  3H1I D;  4OWF A;  5BVZ A;  4C46 A;  1M8O B;  1BCC E;  3LID A;  2Q6Q A;  3H1L D;  1KQG B;  4GKG A;  1CI6 B;  3H1K G;  1SQX E;  4N3Y B;  5H2F E;  3USS A;  4LGD E;  1FDO A;  3MUD C;  3N7N A;  1Q90 D;  5AVR B;  3SWK A;  2FYU K;  3RK3 E;  2HOD B;  2QG4 A;  2E5T A;  3IFM A;  4DOJ A;  1KIL E;  2QE7 H;  3M91 A;  1ZP0 C;  4OGQ B;  3K5B A;  3MP7 B;  4HJG H;  1L0L G;  3VOP A;  5EFW B;  1KYO D;  1FOS F;  3SWF A;  1L4A A;  1QGK B;  3TSI A;  3L37 A;  2BCC E;  1RQV A;  5KJ7 D;  4IL6 E;  3H32 B;  3HTK A;  3L72 E;  1RF0 A;  1SQQ G;  3TGU G;  5CCH A;  1KQS O;  3CD6 P;  1CW5 A;  3L75 J;  5AW6 B;  3C9I A;  4H0L C;  3FWL A;  1NAF A;  3AE6 C;  1SFC C;  2ZT9 B;  3P8C E;  5APY A;  1BE3 J;  5KAI E;  3CCM P;  4BRY A;  1Q2N A;  1CI6 A;  2BAS A;  1AVO A;  2B88 A;  2AEM A;  2R5B A;  1GK6 A;  3Q3D A;  2FXO A;  2OTK E;  2W6B A;  3MD0 A;  4RES B;  5AW4 B;  2NPS A;  1AJY A;  2KIK A;  3CXH H;  4ZNC A;  3CCS P;  1SQB D;  1WT6 A;  2B9B A;  4U3F D;  1HBW A;  2FYU J;  3AEF C;  1HJ0 A;  3WUU A;  2A06 E;  2Q5U A;  1DX7 A;  5APS A;  4H44 B;  1RF0 C;  1S3J A;  2OYH B;  1K04 A;  4R4L A;  4PJ0 H;  3AE7 C;  2Y9Z A;  3BCC E;  1D7M A;  3L70 E;  3JC2 2;  3L73 E;  3GG2 A;  4K35 A;  3ABV C;  3TDK A;  3LW5 H;  3L72 D;  5B66 H;  3HE4 A;  1EC5 A;  2QJY B;  1NYH A;  2XU6 A;  2ZT9 D;  2A45 G;  2E74 D;  2P67 A;  3GW6 A;  1PPJ G;  1PV3 A;  4GOE A;  4KJM A;  1H89 A;  1MKM A;  4WY4 B;  5DJT B;  1L0L K;  1T2K C;  5M1B A;  3KZI H;  3KDP B;  1N7S A;  1K05 A;  3CCR P;  1T3J A;  2E75 B;  1EDL A;  1LT9 C;  1BE3 D;  3H1L G;  5CCG A;  2NZ2 A;  2Q9I A;  3PRJ A;  4GOD A;  1VQL P;  1CSB A;  2IBZ E;  4OGQ D;  5GTH E;  1N7L A;  1VDF A;  3L75 D;  5GTI E;  1SQV E;  1NO4 A;  3B5N C;  1KB9 D;  1NOH A;  2FKW B;  3L74 J;  4PD4 H;  3N4X A;  3L70 D;  2C0W A;  2JJL A;  4XA4 A;  5E79 H;  4DJG A;  2ZFC A;  1IFJ A;  1PFI A;  1NJI Q;  1PP9 E;  1NTM G;  4WY4 A;  2JP3 A;  3HD7 A;  3CWB G;  3L4F A;  1EXI A;  5KLV E;  2FYU E;  3MZW B;  1T6A A;  2N1T D;  2GUS A;  3R2P A;  4HKZ H;  4N78 E;  3FWN A;  1P84 H;  3H1L J;  1L4A C;  1OVU A;  2YKO A;  3M9B A;  2YXQ B;  3V2N A;  3KYQ A;  2B87 A;  3GHG C;  1ZR4 A;  2E42 A;  2WTY A;  3Q5S A;  5APQ A;  4DZO A;  1JCC A;  1L4A B;  3FGA D;  1Q82 Q;  2QIW A;  1BE3 E;  2ZJS E;  3SFD C;  3V2R A;  3H32 A;  3HUS A;  3CLQ A;  3L75 G;  1BCC J;  2AEJ A;  2P2U A;  1FZA A;  5CJ0 A;  4H44 C;  3Q5P A;  2Y0E A;  2HG5 D;  4UB8 E;  3RK3 B;  4WB4 A;  4D6T E;  3MHV A;  4WY4 C;  2BCC J;  4JF7 A;  3WUV A;  4AQR D;  1ZRT D;  4EOT A;  1JY3 N;  2H89 C;  3HD7 B;  1FAV A;  3A0B H;  4JBZ A;  3TF5 A;  2O01 H;  2WQY C;  1BGY E;  1OIP A;  1USD A;  2M0B A;  1OMI A;  3EWK A;  3H1H D;  2D2C C;  1PP9 D;  3B71 A;  1FBM A;  2A45 I;  4UB8 H;  5AVW B;  2QA4 P;  1BSH A;  1KTM A;  1YJ9 P;  4AYC A;  1J1E B;  3RL0 D;  1NTK G;  4I1L A;  1CZQ A;  1IFM A;  2IBZ I;  2D2C B;  2N9Y B;  2L91 A;  2W6A A;  3P8M C;  1EZV G;  1NTK K;  4BWN A;  3A5T A;  3BVH A;  2JDI H;  2XND H;  1A02 J;  2WIT A;  2WPS A;  1L0N J;  1LTJ A;  2QJP B;  1YBK A;  3PJS K;  4ASW A;  3EQ2 A;  1RQU A;  5AVX B;  2OYI B;  5KAI H;  1S2E A;  5AW7 B;  2ZAE B;  3M9H A;  1IFP A;  4PD4 D;  3I5C A;  1S5L E;  5BU5 A;  1L0N G;  4IL6 H;  3L36 A;  4C7R A;  3TNU B;  5TIS H;  1MFZ A;  2CPS A;  1JTH A;  3CC7 P;  1YYC A;  2PAJ A;  5CHX A;  3S4R A;  1VQK P;  3JCU E;  1SQP K;  4HYT B;  2W6J H;  2WSF J;  4IOI H;  1JO5 A;  1UIX A;  2K9Y A;  3VMY A;  1JNM A;  5CJ4 A;  1DEE G;  1NTZ E;  1KIL D;  1X0T A;  2KP8 A;  2P1J A;  3HTK B;  1KC8 Q;  2JKV A;  2OYI C;  4PD4 I;  3H1K E;  1KYO E;  3SFE C;  2M5A B;  3CXH D;  3L74 E;  4A7P A;  3H1K J;  4U3F E;  2V4H A;  1PGJ A;  1ZR2 A;  2P7J A;  1QVG O;  1SQV J;  1N8R Q;  2HPC B;  2O3J A;  3H1J G;  2A06 D;  3A0H H;  1NTZ J;  1AFO A;  1L0L E;  1IJD B;  1OWA A;  2M8R A;  2E76 C;  3PP5 A;  5AW9 B;  4BXL A;  4RJT A;  1YJN P;  1FJP A;  2BCC G;  3BCC D;  2KK7 A;  2HR3 A;  2ITA A;  3L73 D;  4H13 C;  2QM7 A;  2XDJ A;  4QMA A;  2Q7C A;  1LP1 A;  4LC1 A;  2ZVO B;  3CCU P;  1SQQ D;  2YKQ A;  2IPP A;  1URQ A;  1GMJ A;  2WWW A;  1ZXG A;  2QJP C;  3ITK A;  1KB9 H;  2H88 C;  2IZ0 A;  3O6Q B;  4H13 B;  1KIL A;  2C0X A;  2HYN A;  2POH A;  1ZLL A;  1K73 Q;  1NHL A;  1NTM J;  1SFC D;  2KLU A;  1H0T B;  1PIX A;  3HE4 B;  2E76 D;  3HUS B;  4ZKU A;  1Z56 A;  1MV8 A;  4GIF A;  1DD4 A;  1EQ7 A;  1JOC A;  5APU A;  1SQV K;  3U1A A;  3MUD A;  4B86 A;  2A06 G;  3V2Q A;  1LT9 B;  2LKM A;  1HH0 A;  3RK2 D;  1SS1 A;  1WRG A;  3H1I G;  1IFI A;  4JPZ B;  1SQB G;  2GM4 A;  1PGP A;  2KYV A;  1NU1 D;  2W8Z A;  1URQ B;  2JEE A;  2HLO A;  3GF3 A;  3HE5 B;  3L35 A;  3L73 G;  3QH9 A;  1JY3 O;  1JY3 P;  1FU1 A;  1LGH B;  2XNX A;  3O6Q A;  5H2F H;  1KV4 A;  1GL2 B;  2YMY A;  2Z4E A;  2IZ1 A;  2KLV A;  5KLV D;  2UWJ E;  2Q3E A;  1SQP E;  2GUV A;  3U1C A;  1L0N K;  3M0A A;  1RE3 A;  2E5Y A;  2ZYG A;  3RGU A;  1VQP P;  2YMK A;  1VQ9 P;  1NVO A;  1QVF O;  2IDB A;  4C7N A;  2WVR A;  1JM0 A;  3C8V A;  2WPV B;  3E1I A;  1N7S B;  1NAY A;  1NKZ B;  2IBZ G;  3G71 P;  4IL6 X;  1T2K D;  2O01 N;  1LWU C;  2FYN C;  1OW6 A;  1ZME C;  1W5C E;  3HE5 A;  1UII A;  3CX5 I;  3GMA A;  1GDT A;  1IC2 A;  2NPS C;  4D6T D;  3AE8 C;  4I7Z C;  1SQP J;  2G3A A;  2Y0C A; 
#chains in the Genus database with same CATH homology
 1H8A A;  1HVV A;  1FZF A;  1X9V A;  2OYH C;  1YTZ I;  2WT7 A;  2C9L Y;  1N73 C;  1KQL A;  1X8Y A;  1N7S C;  1T3U A;  2YNY A;  4XE5 B;  2J58 A;  5KTB A;  2WZ7 A;  2KOG A;  2OYH A;  2WPR A;  4WBA A;  2Z5H A;  1GL2 A;  1N86 A;  4JYB A;  1HJB A;  2PP6 A;  1LWU B;  2H43 A;  3BRV B;  1LTA C;  2H8P D;  1JY2 N;  1VPC A;  3HD7 C;  1DEB A;  3V5B A;  1XTG B;  1NTM K;  2O1K A;  4N6J A;  3B5N D;  1XTC C;  2NPS B;  1LTI C;  1RY3 A;  1HTL C;  3U59 A;  3OAK A;  1GW3 A;  2WSE H;  4W80 A;  3RK3 C;  1JMM A;  2I1K A;  1ZN5 A;  1RE3 C;  1M7L A;  3M0D A;  1NTZ K;  2R3C A;  3KQG A;  5AVS B;  3II6 A;  1GTW A;  1JO5 A;  3BRT B;  1NKN A;  5AW3 B;  3VP9 A;  1FOS E;  3TYY A;  1RF1 C;  3VMZ A;  1LTB C;  1FZE A;  2N9B A;  1IFN A;  2W27 A;  5AVU B;  3MTU E;  1J1D C;  2R32 A;  3A7O A;  1M1J A;  2MJZ A;  3TK1 A;  1QL2 A;  5AW2 B;  1GU4 A;  3RL0 B;  2XKM A;  4W7Z A;  1SLQ A;  4IFM A;  1J2J B;  5APX A;  5CCG D;  3GHG B;  3RK2 C;  1URQ C;  1GK4 A;  1JY2 O;  1JY2 P;  1KZU B;  3OA7 A;  4HH2 A;  5AVV B;  1SVF A;  3MGN A;  3RK2 B;  2I1J A;  2IX7 C;  3B5N A;  1MZ9 A;  2HFE D;  1GL2 D;  2XV5 A;  3OJA B;  1M1J C;  2WT7 B;  1URQ D;  1IO4 A;  3BAS A;  2N1T B;  3P8C D;  1H88 A;  5AW0 B;  1N73 A;  4EIJ A;  2E43 A;  1JCD A;  3TNU A;  1GL2 C;  2NPS D;  3UIA A;  2FFD A;  3B5N B;  2WSC H;  1RE4 C;  4O9B A;  4Y99 C;  2CPB A;  3T97 A;  4M3L A;  1YTZ T;  3EFG A;  4GT1 A;  1GU5 A;  1DH3 A;  2YO2 A;  1FZC B;  1IK9 A;  1SQQ K;  1GD2 E;  4LLH A;  3BAT A;  1N73 B;  3NFQ A;  2WSF H;  1JTH B;  1ZV8 A;  2FFD C;  1RE4 A;  2Q3I A;  1X79 B;  1HWT C;  1RF1 B;  2ZXE B;  2XZR A;  1FZC A;  1KIL B;  1LTJ C;  1FDM A;  2L5G B;  3CI9 A;  4KHX A;  1W2E A;  3GHG A;  3A3Y B;  5AVT B;  3MIW A;  1A02 F;  3P32 A;  5KJ7 C;  1N7S D;  4N78 D;  4IFD K;  1LTJ B;  1FZC C;  3RK3 D;  1S9K D;  5APW A;  1KFN A;  3VN0 A;  1IFD A;  2HOD A;  1N2D C;  3LIE A;  2WPQ A;  3V2P A;  2N1T A;  2O1J A;  3VP8 A;  3HD7 D;  3NTN A;  3WMM 0;  5CCH C;  3B8E B;  2IFM A;  2N1T C;  2H7H A;  2J59 M;  1HUC A;  3NXS A;  1L4A D;  3M9Q A;  2KSJ A;  2M3B A;  3P7K A;  1G2C B;  2KB7 P;  1OXZ A;  1SFC B;  3KPE A;  1S9K E;  2OAR A;  1NU1 K;  1T8Z A;  2Z5I A;  3HRN A;  5APT A;  1J1D B;  2C9N Y;  5CCH D;  2IFN A;  4ZKP A;  1NWQ A;  4WY4 D;  3M06 A;  4I2L C;  5KLV K;  1M1J B;  3RL0 C;  3HUS C;  3CL3 D;  5AVQ B;  1QL1 A;  1GZL A;  3G3Z A;  1JUN A;  2QM8 A;  3V4Q A;  3IR9 A;  1LT9 A;  5CCG C;  1SP4 A;  1E5W A;  1NH4 A;  1HGV A;  3O8Z A;  4AUW A;  1HGZ A;  2YKP A;  2YO3 A;  5AVY B;  2FFD B;  4W7Y A;  1KFM A;  1LTG C;  4IFF A;  1FZG A;  5AW8 B;  1LTS C;  1MUU A;  1FZB A;  1SFC A;  2FXM A;  3SWY A;  3VMX A;  5BU8 B;  4C7N B;  1AQ5 A;  2FYZ A;  1G1J A;  2HPC A;  3V4W A;  1GW4 A;  1SQB K;  3NMD A;  1SQX K;  4OH8 B;  2A45 H;  5CMZ A;  3A2A A;  1RF1 A;  1LTT C;  1J1E C;  4I6M C;  1FJK A;  2VRS A;  5AVZ B;  3VYI A;  2R5D A;  2OYI A;  4Y99 B;  3H6P A;  5KJ7 A;  5APV A;  1G2C A;  5AW5 B;  5AW1 B;  1G1I A;  1KIL C;  1LWU A;  4JYC A;  5BVZ A;  4C46 A;  3LID A;  4N3Y B;  4GKG A;  1CI6 B;  4LGD E;  5AVR B;  3N7N A;  2FYU K;  2HOD B;  3IFM A;  4DOJ A;  3M91 A;  3VOP A;  1FOS F;  3SWF A;  1L4A A;  3TSI A;  3L37 A;  5KJ7 D;  3H32 B;  3HTK A;  5CCH A;  1RF0 A;  1CW5 A;  5AW6 B;  3C9I A;  1NAF A;  1SFC C;  5APY A;  3P8C E;  1CI6 A;  2BAS A;  2R5B A;  1GK6 A;  4RES B;  5AW4 B;  2W6B A;  3MD0 A;  2NPS A;  1WT6 A;  1HBW A;  1DX7 A;  2Q5U A;  5APS A;  1RF0 C;  2OYH B;  3LW5 H;  3HE4 A;  2XU6 A;  2A45 G;  2P67 A;  1H89 A;  4WY4 B;  1L0L K;  1T2K C;  3KDP B;  1N7S A;  1T3J A;  1LT9 C;  5CCG A;  2Q9I A;  1CSB A;  1N7L A;  1VDF A;  1NO4 A;  3B5N C;  1NOH A;  2FKW B;  3N4X A;  4XA4 A;  2C0W A;  2JJL A;  1PFI A;  2ZFC A;  1IFJ A;  4WY4 A;  3HD7 A;  3L4F A;  2N1T D;  2GUS A;  3R2P A;  4N78 E;  3VTP C;  3V2N A;  4AYC A;  1L4A C;  3M9B A;  2YKO A;  1ZR4 A;  3KYQ A;  3GHG C;  2E42 A;  2WTY A;  5APQ A;  4DZO A;  1JCC A;  1L4A B;  3V2R A;  3H32 A;  3HUS A;  3CLQ A;  5CJ0 A;  2P2U A;  1FZA A;  2HG5 D;  3RK3 B;  4WB4 A;  4WY4 C;  4JF7 A;  4AQR D;  4EOT A;  1JY3 N;  3HD7 B;  1FAV A;  2O01 H;  3M0D C;  5AVW B;  1FBM A;  2A45 I;  1J1E B;  3RL0 D;  4I1L A;  1CZQ A;  1IFM A;  2W6A A;  3P8M C;  3BVH A;  1A02 J;  1NTK K;  3A5T A;  2WIT A;  2WPS A;  1LTJ A;  3EQ2 A;  5AVX B;  2OYI B;  5AW7 B;  3M9H A;  3I5C A;  5BU5 A;  3L36 A;  4C7R A;  3TNU B;  1MFZ A;  2CPS A;  1JTH A;  1YYC A;  2PAJ A;  5CHX A;  1SQP K;  4HYT B;  3VMY A;  1JNM A;  5CJ4 A;  1KIL D;  2KP8 A;  2P1J A;  3HTK B;  2OYI C;  1ZR2 A;  2P7J A;  2HPC B;  1AFO A;  1IJD B;  1OWA A;  2M8R A;  3PP5 A;  5AW9 B;  1FJP A;  2Q7C A;  2QM7 A;  2XDJ A;  4LC1 A;  2YKQ A;  2IPP A;  1URQ A;  2WWW A;  1KIL A;  2C0X A;  2HYN A;  2POH A;  1ZLL A;  1NHL A;  1SFC D;  3HE4 B;  3HUS B;  4ZKU A;  1Z56 A;  1MV8 A;  4GIF A;  1EQ7 A;  1JOC A;  5APU A;  1SQV K;  3U1A A;  3MUD A;  4B86 A;  3V2Q A;  1LT9 B;  2LKM A;  1HH0 A;  3RK2 D;  1WRG A;  1IFI A;  2GM4 A;  2KYV A;  1URQ B;  2JEE A;  2HLO A;  3HE5 B;  3L35 A;  1JY3 O;  1JY3 P;  1FU1 A;  1LGH B;  2XNX A;  1GL2 B;  2YMY A;  2Z4E A;  2KLV A;  2GUV A;  3U1C A;  1L0N K;  3M0A A;  1RE3 A;  4C7N A;  3E1I A;  1N7S B;  1T2K D;  1NKZ B;  1LWU C;  3HE5 A;  1GDT A;  1IC2 A;  2NPS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...