1KILD

Three-dimensional structure of the complexin/snare complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
66
structure length
66
Chain Sequence
GSARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Synaptobrevin SNARE motif
publication title Three-dimensional structure of the complexin/SNARE complex.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 31
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2001-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1kilD00
1N7SA 2KOGA 1GL2D 3B5ND 2M8RA 5CCHC 3RK2D 1N7SD 3HTKB 3RK3D 2HFED 4JF7A 2N1TA 1KILC 5KJ7A 1GL2A 1L4AD 3HD7C 3HD7B 2NPSC 1URQA 4WY4C 2N1TD 4WY4B 4W7YA 5KJ7D 1JTHB 2PP6A 1URQD 3RL0D 3B5NC 1L4AA 4OH8B 5CCHA 3M0DC 4LGDE 3KYQA 4W7ZA 2XDJA 5CCGC 1KILB 1SFCC 1NHLA 1SFCB 5CCHD 4W80A 2NPSB 1HVVA 4WY4A 1T3JA 1GL2C 1GL2B 3B5NB 1KILD 3HD7D 3RK2C 3RK2B 2NPSD 4WY4D 1N7SC 2H8PD 3TSIA 1N7SB 3P8CE 3RK3C 3RK3B 3PP5A 1L4AC 1L4AB 2WZ7A 5CCGA 1KILA 3VOPA 2N1TC 1SFCA 3HD7A 2N1TB 2NPSA 1XTGB 4N78E 2HG5D 5KJ7C 5CCGD 2YMYA 1JTHA 1URQC 3RL0C 1SFCD 1URQB 3RL0B 3B5NA
chains in the Genus database with same CATH superfamily
3TK1A 2YNYA 3U1CA 2Q3EA 2ZJSE 1E79H 1JEKA 3MUDA 5H2FE 4Z1MH 1AFOA 5B5EE 1CW5A 4JF7A 1YQ4C 2JO1A 1QX8A 4D6TG 4GIFA 2W6AA 2K1AA 2FYUJ 4C7NB 1LTJC 1VL2A 1KILE 3SWYA 1FC2C 1M1JB 2KNCB 1DIPA 4O9BA 1S4XA 4L75A 2E74C 3JC22 3CCQP 3M9BA 1PIXA 1SS1A 3KYQA 4UB8H 4NPFX 3L71J 3AE2C 2W27A 3IR9A 5CCHD 1X8YA 2WTYA 5APQA 1YTZT 2ZAEB 2SPZA 2L91A 2H88C 2ZT9B 1CSBA 4C7NA 1BE3E 1NGMB 2GUSA 3B5NB 1LWUA 1DEBA 2IFMA 3PLNA 3A0BH 1M1JA 1JMBA 2KNCA 3RK2B 2E76B 4WY4D 2ZYAA 2E42A 3G9RA 3AECC 1JY2O 3V2QA 4PV1C 2HR3A 4I6MC 3IN6A 4H0LC 3MTUE 1FDOA 4GDOA 3HD7A 4H44C 3TGUJ 3USSA 1BDCA 1RF0A 3JCUH 3GHGC 3B5NA 1J1DB 3H1IE 2YIUC 5AVSB 1VQ9P 2RMZA 1ZLLA 1PFIA 1GL2D 4U3FD 2VRSA 3V6IA 3L75E 1J1EB 3H1LG 1JB0J 3KHUA 1BCCE 1Q90D 3AEEC 3HE4B 3CWBG 1M8OB 3BCCG 3L72G 2NRGA 2KS1B 2CPBA 4PD4I 4WVZA 2B89A 4AQRD 2FKWB 4R4LA 2A06G 3H25A 3JSVC 1HGVA 1RF1B 3AE6C 1EDJA 3W67A 2OYIB 1LJ2A 2R32A 2WITA 5BVZA 3HE4A 4OVNF 4Y28J 1NAYA 1KYOI 1ZOYC 2KS1A 3II6A 3G4SP 1PP9D 1JY3O 2WPSA 2NPSD 1NVOA 3H1KE 2Q1KA 3RK3C 4EOTA 1H0TB 1LT9C 3FX0A 2OYIA 1S72P 2N1TC 2C9NY 3D70A 1HJBA 2WSEJ 2FFDB 3RL0B 3MD0A 5GTHH 4I7ZC 2OTLP 2FYZA 2M8RA 1UIXA 1ZRTE 1PGPA 3E1IA 2JEEA 1VQPP 3F89A 1PPJD 3I5CA 2FFDA 4NPEA 3R2PA 1X22A 3Q1MA 3CXHH 3RBZA 4YTPC 4PJ0E 2E43A 1ZP0C 4K35A 4LGDE 2B9BA 3KQGA 3AE3C 1SQVK 3CX5H 2QVAA 5CCGC 4JYBA 5AVZB 3VMXA 2AEMA 2AXCA 2K9JB 2M5AB 2KUBA 1RQVA 5C39A 1AA0A 1YITP 1VPCA 5AVVB 1FJKA 2K3RA 2IZ1A 3HD7D 3ITKA 1DD3A 1GK6A 1NTKJ 2E5YA 2OTKE 2C0WA 2P67A 4WB4A 3V4QA 1XTCC 1OVVA 1WMKA 1GMJA 2YKOA 2FXPA 5E79H 4RESB 2K9JA 5KJ7C 1N73B 1L0LE 2PFXA 5AVRB 2G3AA 4ZNCA 2GM4A 1JCDA 2JJLA 3HRNA 3PRJA 1HBWA 1SQXE 1KB9I 2WVRA 2YO3A 3D71A 2M3EA 1KC8Q 1R8EA 1NO4A 2NZ2A 2XU6A 4H13C 1USEA 2O01H 3SFDC 1HWTC 1KILC 1N73A 1GW3A 5TISE 1LTJB 1SQVD 5KAIE 3FXEA 2R5BA 3H1HE 1SQPE 1SQQJ 2E74B 4CPGA 3RL0g 3WUTA 1U57A 1MZ9A 4JQ0D 1NYHA 1SFCC 1PGOA 1FOSF 2JDIH 3CMAP 1GTWA 1KV4A 1EZVE 2KLUA 3GF3A 4EDFA 5DJTB 1DX7A 1KQLA 3GF7A 3GMAA 1PPJG 1N7SC 2E5TA 3L75D 4OGQD 3L73J 4U3FE 4PV1B 3KDPB 5M1BA 1BCCD 3TDKA 4H0LB 5CBNA 1JUNA 5APTA 5EFWB 5AVYB 4H44B 3RBXA 3JCUE 1URQC 1SQBD 3GHGB 2HPCB 2YIUB 3V2NA 2FY8A 3WUUA 1NH4A 3M9QA 2N9BA 3NFQA 3LW5J 3L74J 4GOFA 4PD4H 1KQFB 3F5HA 3WMM0 3V2RA 1VQOP 5APSA 1P84D 1VDFA 2FBWC 1Y47A 3H1KD 1JTHB 3OA7A 4ASWA 1PP9E 5DJUB 3VP9A 1RQUA 1KZUB 2Q9IA 2H7HA 3S4RA 3L70D 3V4WA 1JOCA 4XFJA 1H89A 4DOJA 2LXBA 5APXA 3OJAB 4JPZB 4I1LA 3TNUB 1L0LK 3H6PA 3Q5RA 1VQMP 1ZRTD 3CL3D 1BE3G 4R4MA 1AQTA 3TSIA 1BGYJ 3RK3B 2O01J 1SQXK 2C9LY 2XNXA 3H32B 1FZCB 1LT9B 1BSNA 1Y9BA 2KZJA 1KMIZ 2N1TB 3Q3DA 2ITAA 4WBAA 5KAFE 1IFMA 2OYOA 4ZKUA 3TNUA 2IFNA 1CZQA 3CCUP 1LP1B 2BCCJ 1NU1E 3H1JJ 1Q7YQ 2KIKA 2PGDA 3H1IG 2FXOA 2K37A 1Q81Q 1SQPK 4EIJA 3H32A 1FZCA 1GU4A 1LT9A 4IL6X 5AW7B 3A0HE 2N1TA 3L75G 3U59A 1BCCG 3SSUA 1L0NK 2YXQB 1NTMK 4ZKPA 3L37A 2O1KA 2Z5HA 4K3AA 3OAKA 1L4AA 5KLVE 4GT1A 3G71P 2YMKA 3Q5SA 2M3BA 1L0LD 4HKZH 1JY2N 1NTZE 1R5SA 2E75C 4D6TJ 2WT7B 2D2CC 2WSEH 5CJ4A 3HUSB 1RE3A 1SQXD 2JWDA 1NOHA 3E1RA 1NWQA 1MUUA 2P7JA 1KTMA 3CI9A 3H1KG 3CCLP 5CCGA 3Q5PA 2A45G 2QSIA 2W6BA 4LLHA 4L73A 2ZYGA 3MHVA 1Q82Q 3SWFA 5KKZB 3HUSA 3L70G 1LTGC 3H1HD 1KB9H 3L35A 1OW8A 1IFIA 1SQPD 3AEGC 1SQVE 1M57D 3N7NA 2IZ0A 3TF5A 1JM0A 2YKPA 5CCHC 1L0ND 1QLED 1NTMD 2W6JH 4H13B 3BVHA 1FE6A 1FZBA 1FU1A 1EZVD 4BXLA 2H43A 1VQLP 5KJ7A 3GW6A 1W2EA 2ZFCA 1HJ0A 1EDIA 4WY4C 3AEDC 1LTBC 4YXWH 3T97B 2HODB 1YQ3C 3WU2H 1LNQA 2WSFJ 4NPDA 3Q2YA 3B71A 5KLIC 1KQGB 1VQNP 3CC2P 4TLFA 3H1LJ 3I55P 3CCEP 1NHLA 4U7JA 1SFCB 3HE5B 1S3JA 3QH9A 1P84I 3CWBJ 3BCCJ 1IFPA 5CHXA 3L72J 1JO5A 3ABVC 1GL2C 1SQBE 4ZMDA 2A45I 2Y0EA 2HODA 3P8MC 1QEXA 1N7SB 2G8YA 1NU1K 3SWKA 1FZFA 4AYCA 1S5LE 2K9YA 1E5WA 2YXRB 1SFCA 3HE5A 5APWA 1FDIA 2YMYA 2FYUE 5L8RJ 1URQB 1P84E 3C8VA 1L0LG 4KJMA 1X9VA 1N7SA 1RF1A 1KORA 1SQXG 2I1JA 3L71E 3L70E 4BWNA 4TT3H 5KLVK 1IJDB 3O6QB 1Y8AA 3B8EB 1H88A 3K5BA 1L4AD 1NTZK 2NPSC 1URQA 2WQYC 1USDA 3WUVA 1VF5D 2POHA 3CMEP 4IL6H 2PP6A 1HTLC 1H0TA 3H1HG 1SVFA 1OMIA 2QM8A 1X79B 1SQPG 3ZDMA 2R44A 3TGUE 3MUDC 2IBZE 3O6QA 1RH5B 2UWJE 4IOIH 5APVA 1H8AA 1NU1D 1L0NG 2CPSA 2KI7B 2PAJA 5BU8B 1EZVG 3FWNA 3AE5C 1LGHB 4ASVA 1MFZA 3O8ZA 5AVQB 3CLQA 3EQ2A 5APUA 4U3FG 3VOPA 3LW5H 1LTIC 3CXHD 1M1KQ 3VTPC 1HGZA 5H2FH 5B5EH 1MV8A 3IF4A 5KLVD 2Y9ZA 1YJNP 2ZT9D 3CX5D 1LWUC 1VQ5P 5GTIH 3B5ND 1M1JC 1G1IA 3CC4P 1NTZD 2JP3A 3RK2D 2E76D 3L74D 3HTKB 2M5AA 1VQKP 1JMMA 1N7LA 2HFED 2QM7A 5B66E 5AW2B 1K73Q 2IYOA 3HD7C 2C0XA 1AV1A 1MKMA 1FBMA 4N6JA 2OGUA 3FXDA 2P2UA 3B5NC 4IFDK 3LIEA 1SQBK 1PP9G 1BDDA 1EZVI 1LT1A 3RGUA 2E75B 2D2CB 1R5LA 1RE4C 1M56D 1QL2A 1U7MA 1FAVA 2FYUK 3MZWB 1BGYD 4UB8E 4I2LC 1EXIA 1ZR4A 1G2CB 1YHQP 2WWWA 1S2EA 4MN4C 3C1LA 1N86A 1SLQA 3BASA 4Y99C 1YIJP 1L0NE 1NTME 5CMZA 1LTTC 1RHZB 2IX7C 3A0BE 3AE9C 1LTJA 1GD2E 4B86A 5TJHA 3H1JD 2ZVOB 3CCMP 1G2CA 1N8RQ 5KTBA 3SFEC 1NU1G 3KPEA 1FJPA 2H89C 2KSJA 2AXTH 2KP8A 2I8DA 1VQ8P 1JNMA 5APYA 1OXZA 1KFNA 4WY4B 1DD4A 3LIDA 1NTKE 4OGQC 4RKUJ 4EI2A 3RL0D 1KD1Q 2BEQD 3BRVB 5KLIB 4RO0A 2FYNC 5CCHA 3AE4C 4UB6H 1ZMEC 4M3LA 5KLVG 2FYUD 1K05A 1S1CX 1VQ7P 2A45H 4GODA 1NTZG 1HVVA 3RK3E 3GHGA 2HPCA 2KLVA 1FZEA 4WY4A 1GL2B 4DZOA 1CI6B 2Y0DA 1AVOA 2OQQA 3BATA 3L71D 3NXSA 2DW3A 4PD4D 3AEAC 1KYOH 1YBKA 1U7JA 2ZYDA 4QMAA 2WZ7A 1NAFA 3A2AA 2V4HA 1Z56A 1EC5A 3M0AA 1JTHA 2BEZF 1CI6A 1SQQE 5AVUB 1KFMA 1BE3J 1EXJA 1T2KD 2WSFH 3N4XA 1FS0E 1SQVG 3TGUD 2OARA 3AEFC 2IBZD 3FGAD 1IZNB 3PJSK 5GTHE 2Z4EA 3A3YB 4PJ0H 4HB1A 2AEJA 3V5BA 2LKMA 2WSCJ 4I7ZB 2OTJP 5AW0B 2WPRA 2V7QH 2JWAA 3L4FA 1EQ7A 3L73E 1NKNA 3H1IJ 4DJGA 2QJYC 1VQ6P 3P7KA 3M0DC 4DCKA 1JY2P 3CWBD 2Q7CA 2Q5UA 3L75J 3CXHE 5CBOA 4GOEA 4YXDC 3VYIA 1LP1A 1BCCJ 1N73C 2HLOA 1DH3A 2O1JA 2P10A 1ZW0A 4IFFA 1X0TA 3A7OA 3CX5E 1SQBG 1K8AQ 2N9YB 3CPWO 1OX3A 2E74D 3L74E 1PZQA 2QJKC 5AVTB 2QJPC 3PTZA 1W2BO 3R4YA 2FYUG 2KK7A 5GTIE 4XE5B 2KOGA 1LWUB 5E79E 1NTKK 5TISH 1LTSC 2RH0A 3H1KJ 2PRRA 5KAIH 2WT7A 1G1JA 1GW4A 1GDTA 3L71G 4PV1D 2J59M 3L70J 4H0LD 3HD7B 1L2PA 4H44D 2QRXA 4W7YA 4EYYQ 3FWLA 1BGYE 3VN0A 1K04A 1A02J 2B88A 3VMYA 2O01N 4OH8B 1JY3P 4IFMA 2QE7H 4W7ZA 1KB9D 2MJZA 3EFFK 1KILB 3PH0A 1YTZI 1QGKB 2Y0CA 3TGUG 1M90Q 2IBZG 2BCCE 1MFTA 2IYPA 3S9OA 5AW3B 1T3JA 1IK9A 4JYCA 3H1JE 1YI2P 1IFNA 2H8PD 2JR8A 1JY3N 3P8CE 1SQQK 2KXPB 3GG2A 1RY3A 2YO2A 3PP5A 2XV5A 2KSEA 1T3UA 4Y99B 5CJ0A 3KZIH 1KILA 1YJWP 1IO4A 2V7QJ 4N78E 2JKVA 1RE4A 3T97A 1NTKD 2J5UA 2Q6QA 2LR2A 2WMMA 2ZXXA 3BRTB 4L74A 1IK7A 4D6TE 1HF9A 3RK3D 2AXTE 2RN0A 2WPQA 5K5GB 3CC7P 1A02F 2N1TD 1L0LJ 4GKGA 1PV3A 2OYHC 2Y9YA 4OGQB 1NKZB 3AE1C 3PHLA 3G3ZA 2R3CA 2IBZI 1JCCA 1SQXJ 1EDKA 4PD4E 4UB6E 1S5LX 2FYNB 3CCRP 1J2JB 1FZGA 2KZIA 1FZCC 3W68A 1AQ5A 1QL1A 1SQQD 4C46A 3GLMA 2Q3IA 2GA1A 1IFDA 5KAFH 3I56P 2BASA 1KYOE 2CK3H 3H1HJ 1SQPJ 2XKMA 1HUCA 1D7MA 1L4AC 3L36A 2QEXP 1VF5C 2LXCB 1XTGB 1NTMG 3IAOA 5CCGD 1L0NJ 1NTMJ 3VMAA 4XA4A 3L73D 1RE3C 3A0HH 1GK4A 1OFCX 1YJ9P 3CCJP 2P58A 1SP4A 3H1LE 1S9KD 4U3FJ 1PL5A 3CCSP 1T8ZA 3CWBE 3BCCE 2IPPA 3L72E 1KN7A 4JBZA 1FZAA 3NTNA 2QA4P 3MGNA 1OZHA 1ZV8A 3HUSC 5KJ7D 3VP8A 2FXMA 2A06E 2WPVB 1ZR2A 1NTKG 1QVFO 2QJYB 5AVWB 4L76A 1VQ4P 2B87B 3MIWA 4HJGH 4RJTA 3B4SA 2QG4A 3D6ZA 1RF0C 4H13D 2ZT9C 2R3SA 5KKZC 4DT0A 1AVYA 1KILD 1OW6A 3RK2C 2E76C 4N3YB 1PP9J 3CD6P 3EWKA 4BRYB 4LC1A 3HTKA 2WSSH 1TU3F 3M0DA 2B87A 2W83C 5AW9B 2QJKB 1PGQA 2WSCH 1SFCD 3AEBC 4HYTB 4YPCA 5AW8B 1BE3D 2QJPB 1J1DC 2O3JA 4BRYA 1SQQG 1OIPA 4WWIA 1N7SD 1KB9E 5AW1B 1J1EC 1GZLA 2BCCD 1Q2NA 3AE8C 2RKLA 4HH2A 2W90A 3OW2O 3P8CD 3H1ID 1URQD 3M9HA 1NU1J 2HYNA 1RF1C 3UIAA 3L73G 2OYIC 4N78D 1YYCA 1NJIQ 2W8ZA 1PGJA 1IFJA 3M06A 1FOSE 2KB7P 3WU2E 3VMZA 3U1AA 1S5LH 2YKQA 3G6EP 2QIWA 2Z5IA 1AJYA 1FDMA 2KYVA 4D6TD 1P84H 3NMDA 3IFMA 3V2PA 3C9IA 3KZIE 5KLVJ 3MP7B 4A7PA 1NTZJ 3L74G 2HG5D 2FFDC 2R5DA 3RL0C 2GUVA 3P32A 2AEFA 3TYYA 1HH0A 2XZRA 1K9MQ 1EDLA 3A5TA 1ZN5A 1Q86Q 3AE7C 1T6AA 1GL2A 3D6YA 1UIIA 1IC2A 1KYOD 1W5CE 2K88A 1OWAA 2OYHB 1WT6A 4C7RA 1SQVJ 1DEEG 3CXHI 1QVGO 1OVRA 1BGYG 1OVUA 2M0BA 2XDJA 4OWFA 3EFGA 5AVXB 5AW6B 1ZXGA 3QWOC 1M7LA 2P1JA 4IL6E 2ZXEB 4W80A 2NPSB 3CX5I 1T2KC 2I1KA 1PPJE 2L5GB 2OYHA 2BCCG 3H1LD 3H1JG 3BCCD 3L72D 5AW4B 5AW5B 1S9KE 4KHXA 1N2DC 1L4AB 2XNDH 3KXDA 2IDBA 2ZVNB 4AUWA 1VF5B 1GU5A 2NPSA 3E7KA 5BU5A 1KQSO 3S1KA 1WRGA 2A06D 1BSHA 2E75D 2J58A 2D2CD 1LTAC 2MKVA 3CCVP 5B66H 4KT0J 1SQBJ 3M91A 1OW7A
chains in the Genus database with same CATH topology
3TK1A 2YNYA 1LWUC 3V2NA 3U1CA 3B5ND 1M1JC 1G1IA 3BRTB 3MUDA 3RK2D 1NH4A 1AFOA 3HTKB 3M9QA 2N9BA 3NFQA 3RK3D 1JMMA 1N7LA 1CW5A 2HFED 4JF7A 2QM7A 2WPQA 5AW2B 3WMM0 3HD7C 3V2RA 4GIFA 2C0XA 1A02F 2W6AA 5APSA 1VDFA 2N1TD 4GKGA 4C7NB 1LTJC 1JTHB 3SWYA 1FBMA 3OA7A 2OYHC 1M1JB 4N6JA 1NKZB 4O9BA 2P2UA 3G3ZA 2R3CA 3B5NC 4IFDK 3LIEA 1JCCA 1SQBK 3VP9A 3M9BA 1KZUB 2Q9IA 2H7HA 3V4WA 3KYQA 1JOCA 1J2JB 1FZGA 2W27A 3IR9A 1FZCC 1H89A 4DOJA 5CCHD 5APXA 1RE4C 1X8YA 3OJAB 2WTYA 1AQ5A 5APQA 1YTZT 1QL1A 4C46A 1QL2A 4I1LA 1CSBA 3TNUB 1FAVA 2Q3IA 4C7NA 2GUSA 3B5NB 1IFDA 3H6PA 1L0LK 1LWUA 1DEBA 2IFMA 2FYUK 1M1JA 3CL3D 3RK2B 4I2LC 4WY4D 2E42A 2BASA 3TSIA 1ZR4A 1G2CB 1JY2O 3RK3B 2WWWA 3V2QA 2XKMA 1SQXK 1HUCA 2C9LY 4I6MC 2XNXA 3H32B 1N86A 1SLQA 3BASA 4Y99C 1FZCB 1L4AC 1LT9B 5CMZA 3MTUE 3L36A 1LTTC 3HD7A 2N1TB 4WBAA 2IX7C 1XTGB 1IFMA 1RF0A 5CCGD 1LTJA 4ZKUA 3TNUA 2IFNA 1CZQA 4XA4A 1GD2E 3GHGC 4B86A 1RE3C 3B5NA 1GK4A 1J1DB 5AVSB 1ZLLA 1PFIA 1G2CA 1GL2D 5KTBA 3KPEA 1SP4A 1SQPK 4EIJA 1S9KD 1FJPA 3H32A 2VRSA 1FZCA 1GU4A 1LT9A 1T8ZA 5AW7B 1J1EB 2IPPA 2KSJA 2N1TA 3HE4B 2KP8A 1JNMA 5APYA 3U59A 1FZAA 3NTNA 3MGNA 1OXZA 1KFNA 2CPBA 4WY4B 1L0NK 1NTMK 1ZV8A 3HUSC 3LIDA 4ZKPA 5KJ7D 3L37A 3VP8A 2O1KA 2FXMA 2Z5HA 3RL0D 4AQRD 1ZR2A 2FKWB 3OAKA 3BRVB 1L4AA 1HGVA 5AVWB 5CCHA 4GT1A 1RF1B 2OYIB 3MIWA 4M3LA 2M3BA 2R32A 1JY2N 2WITA 2WT7B 5BVZA 3HE4A 1RF0C 2A45H 2WSEH 5CJ4A 1HVVA 3HUSB 3GHGA 1RE3A 2HPCA 2KLVA 1FZEA 4WY4A 3II6A 1NOHA 1GL2B 4DZOA 1KILD 1CI6B 3RK2C 1JY3O 3BATA 2WPSA 2NPSD 4N3YB 1NWQA 4LC1A 3RK3C 1MUUA 3NXSA 3HTKA 2P7JA 4EOTA 3CI9A 1LT9C 3M0DA 2OYIA 2WZ7A 1NAFA 5CCGA 3A2AA 2N1TC 2A45G 5AW9B 2W6BA 4LLHA 2C9NY 1Z56A 3SWFA 1HJBA 2WSCH 3M0AA 2FFDB 3HUSA 1JTHA 1LTGC 1SFCD 3L35A 3RL0B 3MD0A 4HYTB 1IFIA 5AW8B 1CI6A 1J1DC 5AVUB 1KFMA 3N7NA 1T2KD 2FYZA 2WSFH 3N4XA 2M8RA 2OARA 2YKPA 5CCHC 3E1IA 2JEEA 1N7SD 5AW1B 3BVHA 2Z4EA 1J1EC 1FZBA 3A3YB 1FU1A 1GZLA 2H43A 3V5BA 3I5CA 2LKMA 5KJ7A 4HH2A 2FFDA 1W2EA 3R2PA 5AW0B 2ZFCA 2WPRA 4WY4C 1LTBC 3P8CD 2HODB 1URQD 3L4FA 1EQ7A 3M9HA 1NKNA 2E43A 2HYNA 3P7KA 3UIAA 1RF1C 3M0DC 4LGDE 3KQGA 2OYIC 1JY2P 4N78D 1SQVK 5CCGC 1YYCA 4JYBA 2Q7CA 1NHLA 5AVZB 3VMXA 1SFCB 3HE5B 2Q5UA 1IFJA 3M06A 1FOSE 5CHXA 1JO5A 2KB7P 3VYIA 3VMZA 3U1AA 2YKQA 1N73C 1VPCA 1GL2C 2HLOA 2A45I 1DH3A 2O1JA 2Z5IA 5AVVB 1FJKA 2HODA 4IFFA 3HD7D 3A7OA 1GK6A 1FDMA 3P8MC 1N7SB 2KYVA 3NMDA 2C0WA 3IFMA 2P67A 4WB4A 1NU1K 3V4QA 3V2PA 1FZFA 3C9IA 1XTCC 4AYCA 2YKOA 1E5WA 1SFCA 3HE5A 5APWA 4RESB 5KJ7C 2HG5D 5AVTB 1N73B 2FFDC 2R5DA 2YMYA 5AVRB 3RL0C 2GUVA 1URQB 3P32A 2GM4A 1JCDA 2JJLA 3HRNA 3TYYA 1HBWA 1X9VA 1HH0A 2XZRA 2YO3A 4XE5B 1N7SA 2KOGA 1LWUB 1RF1A 1NTKK 1LTSC 2I1JA 1NO4A 3A5TA 2XU6A 2WT7A 1ZN5A 1G1JA 1GW4A 1GDTA 2O01H 5KLVK 1IJDB 2J59M 3B8EB 1H88A 1KILC 1HWTC 1N73A 1GW3A 1L4AD 1GL2A 1NTZK 3HD7B 2NPSC 1URQA 1IC2A 2POHA 4W7YA 1LTJB 2PP6A 1OWAA 2OYHB 2R5BA 3VN0A 1HTLC 1WT6A 1A02J 4C7RA 3VMYA 1SVFA 4OH8B 2QM8A 1JY3P 1X79B 4IFMA 1MZ9A 4W7ZA 2XDJA 2MJZA 3EFGA 5AVXB 1KILB 5AW6B 1YTZI 1SFCC 1M7LA 2P1JA 2ZXEB 4W80A 2NPSB 1FOSF 1GTWA 5APVA 1T2KC 1H8AA 2I1KA 5AW3B 1T3JA 2CPSA 1DX7A 1KQLA 1IK9A 4JYCA 2L5GB 2PAJA 5BU8B 2OYHA 1IFNA 1N7SC 1LGHB 2H8PD 1JY3N 1MFZA 3P8CE 3O8ZA 1SQQK 5AVQB 1RY3A 2YO2A 3PP5A 2XV5A 3KDPB 3CLQA 5AW4B 5AW5B 1S9KE 4KHXA 1N2DC 3EQ2A 1T3UA 4Y99B 5CJ0A 5APUA 1L4AB 1KILA 1JUNA 5APTA 3VOPA 3LW5H 1IO4A 4AUWA 1LTIC 5AVYB 1GU5A 2NPSA 4N78E 3VTPC 3T97A 1RE4A 5BU5A 1HGZA 1URQC 1WRGA 2J58A 1LTAC 1MV8A 3GHGB 2HPCB 3M91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N7S A;  2KOG A;  1GL2 D;  3B5N D;  2M8R A;  5CCH C;  3RK2 D;  1N7S D;  3HTK B;  3RK3 D;  2HFE D;  4JF7 A;  2N1T A;  1KIL C;  5KJ7 A;  1GL2 A;  1L4A D;  3HD7 C;  3HD7 B;  2NPS C;  1URQ A;  4WY4 C;  2N1T D;  4WY4 B;  4W7Y A;  5KJ7 D;  1JTH B;  2PP6 A;  1URQ D;  3RL0 D;  3B5N C;  1L4A A;  4OH8 B;  5CCH A;  3M0D C;  4LGD E;  3KYQ A;  4W7Z A;  2XDJ A;  5CCG C;  1KIL B;  1SFC C;  1NHL A;  1SFC B;  5CCH D;  4W80 A;  2NPS B;  1HVV A;  4WY4 A;  1T3J A;  1GL2 C;  1GL2 B;  3B5N B;  1KIL D;  3HD7 D;  3RK2 C;  3RK2 B;  2NPS D;  4WY4 D;  1N7S C;  2H8P D;  3TSI A;  1N7S B;  3P8C E;  3RK3 C;  3RK3 B;  3PP5 A;  1L4A C;  1L4A B;  2WZ7 A;  5CCG A;  1KIL A;  3VOP A;  2N1T C;  1SFC A;  3HD7 A;  2N1T B;  2NPS A;  1XTG B;  4N78 E;  2HG5 D;  5KJ7 C;  5CCG D;  2YMY A;  1JTH A;  1URQ C;  3RL0 C;  1SFC D;  1URQ B;  3RL0 B;  3B5N A; 
#chains in the Genus database with same CATH topology
 3TK1 A;  2YNY A;  3U1C A;  2Q3E A;  2ZJS E;  1E79 H;  1JEK A;  3MUD A;  5H2F E;  4Z1M H;  1AFO A;  5B5E E;  1CW5 A;  4JF7 A;  1YQ4 C;  2JO1 A;  1QX8 A;  4D6T G;  4GIF A;  2W6A A;  2K1A A;  2FYU J;  4C7N B;  1LTJ C;  1VL2 A;  1KIL E;  3SWY A;  1FC2 C;  1M1J B;  2KNC B;  1DIP A;  4O9B A;  1S4X A;  4L75 A;  2E74 C;  3JC2 2;  3CCQ P;  3M9B A;  1PIX A;  1SS1 A;  3KYQ A;  4UB8 H;  4NPF X;  3L71 J;  3AE2 C;  2W27 A;  3IR9 A;  5CCH D;  1X8Y A;  2WTY A;  5APQ A;  1YTZ T;  2ZAE B;  2SPZ A;  2L91 A;  2H88 C;  2ZT9 B;  1CSB A;  4C7N A;  1BE3 E;  1NGM B;  2GUS A;  3B5N B;  1LWU A;  1DEB A;  2IFM A;  3PLN A;  3A0B H;  1M1J A;  1JMB A;  2KNC A;  3RK2 B;  2E76 B;  4WY4 D;  2ZYA A;  2E42 A;  3G9R A;  3AEC C;  1JY2 O;  3V2Q A;  4PV1 C;  2HR3 A;  4I6M C;  3IN6 A;  4H0L C;  3MTU E;  1FDO A;  4GDO A;  3HD7 A;  4H44 C;  3TGU J;  3USS A;  1BDC A;  1RF0 A;  3JCU H;  3GHG C;  3B5N A;  1J1D B;  3H1I E;  2YIU C;  5AVS B;  1VQ9 P;  2RMZ A;  1ZLL A;  1PFI A;  1GL2 D;  4U3F D;  2VRS A;  3V6I A;  3L75 E;  1J1E B;  3H1L G;  1JB0 J;  3KHU A;  1BCC E;  1Q90 D;  3AEE C;  3HE4 B;  3CWB G;  1M8O B;  3BCC G;  3L72 G;  2NRG A;  2KS1 B;  2CPB A;  4PD4 I;  4WVZ A;  2B89 A;  4AQR D;  2FKW B;  4R4L A;  2A06 G;  3H25 A;  3JSV C;  1HGV A;  1RF1 B;  3AE6 C;  1EDJ A;  3W67 A;  2OYI B;  1LJ2 A;  2R32 A;  2WIT A;  5BVZ A;  3HE4 A;  4OVN F;  4Y28 J;  1NAY A;  1KYO I;  1ZOY C;  2KS1 A;  3II6 A;  3G4S P;  1PP9 D;  1JY3 O;  2WPS A;  2NPS D;  1NVO A;  3H1K E;  2Q1K A;  3RK3 C;  4EOT A;  1H0T B;  1LT9 C;  3FX0 A;  2OYI A;  1S72 P;  2N1T C;  2C9N Y;  3D70 A;  1HJB A;  2WSE J;  2FFD B;  3RL0 B;  3MD0 A;  5GTH H;  4I7Z C;  2OTL P;  2FYZ A;  2M8R A;  1UIX A;  1ZRT E;  1PGP A;  3E1I A;  2JEE A;  1VQP P;  3F89 A;  1PPJ D;  3I5C A;  2FFD A;  4NPE A;  3R2P A;  1X22 A;  3Q1M A;  3CXH H;  3RBZ A;  4YTP C;  4PJ0 E;  2E43 A;  1ZP0 C;  4K35 A;  4LGD E;  2B9B A;  3KQG A;  3AE3 C;  1SQV K;  3CX5 H;  2QVA A;  5CCG C;  4JYB A;  5AVZ B;  3VMX A;  2AEM A;  2AXC A;  2K9J B;  2M5A B;  2KUB A;  1RQV A;  5C39 A;  1AA0 A;  1YIT P;  1VPC A;  5AVV B;  1FJK A;  2K3R A;  2IZ1 A;  3HD7 D;  3ITK A;  1DD3 A;  1GK6 A;  1NTK J;  2E5Y A;  2OTK E;  2C0W A;  2P67 A;  4WB4 A;  3V4Q A;  1XTC C;  1OVV A;  1WMK A;  1GMJ A;  2YKO A;  2FXP A;  5E79 H;  4RES B;  2K9J A;  5KJ7 C;  1N73 B;  1L0L E;  2PFX A;  5AVR B;  2G3A A;  4ZNC A;  2GM4 A;  1JCD A;  2JJL A;  3HRN A;  3PRJ A;  1HBW A;  1SQX E;  1KB9 I;  2WVR A;  2YO3 A;  3D71 A;  2M3E A;  1KC8 Q;  1R8E A;  1NO4 A;  2NZ2 A;  2XU6 A;  4H13 C;  1USE A;  2O01 H;  3SFD C;  1HWT C;  1KIL C;  1N73 A;  1GW3 A;  5TIS E;  1LTJ B;  1SQV D;  5KAI E;  3FXE A;  2R5B A;  3H1H E;  1SQP E;  1SQQ J;  2E74 B;  4CPG A;  3RL0 g;  3WUT A;  1U57 A;  1MZ9 A;  4JQ0 D;  1NYH A;  1SFC C;  1PGO A;  1FOS F;  2JDI H;  3CMA P;  1GTW A;  1KV4 A;  1EZV E;  2KLU A;  3GF3 A;  4EDF A;  5DJT B;  1DX7 A;  1KQL A;  3GF7 A;  3GMA A;  1PPJ G;  1N7S C;  2E5T A;  3L75 D;  4OGQ D;  3L73 J;  4U3F E;  4PV1 B;  3KDP B;  5M1B A;  1BCC D;  3TDK A;  4H0L B;  5CBN A;  1JUN A;  5APT A;  5EFW B;  5AVY B;  4H44 B;  3RBX A;  3JCU E;  1URQ C;  1SQB D;  3GHG B;  2HPC B;  2YIU B;  3V2N A;  2FY8 A;  3WUU A;  1NH4 A;  3M9Q A;  2N9B A;  3NFQ A;  3LW5 J;  3L74 J;  4GOF A;  4PD4 H;  1KQF B;  3F5H A;  3WMM 0;  3V2R A;  1VQO P;  5APS A;  1P84 D;  1VDF A;  2FBW C;  1Y47 A;  3H1K D;  1JTH B;  3OA7 A;  4ASW A;  1PP9 E;  5DJU B;  3VP9 A;  1RQU A;  1KZU B;  2Q9I A;  2H7H A;  3S4R A;  3L70 D;  3V4W A;  1JOC A;  4XFJ A;  1H89 A;  4DOJ A;  2LXB A;  5APX A;  3OJA B;  4JPZ B;  4I1L A;  3TNU B;  1L0L K;  3H6P A;  3Q5R A;  1VQM P;  1ZRT D;  3CL3 D;  1BE3 G;  4R4M A;  1AQT A;  3TSI A;  1BGY J;  3RK3 B;  2O01 J;  1SQX K;  2C9L Y;  2XNX A;  3H32 B;  1FZC B;  1LT9 B;  1BSN A;  1Y9B A;  2KZJ A;  1KMI Z;  2N1T B;  3Q3D A;  2ITA A;  4WBA A;  5KAF E;  1IFM A;  2OYO A;  4ZKU A;  3TNU A;  2IFN A;  1CZQ A;  3CCU P;  1LP1 B;  2BCC J;  1NU1 E;  3H1J J;  1Q7Y Q;  2KIK A;  2PGD A;  3H1I G;  2FXO A;  2K37 A;  1Q81 Q;  1SQP K;  4EIJ A;  3H32 A;  1FZC A;  1GU4 A;  1LT9 A;  4IL6 X;  5AW7 B;  3A0H E;  2N1T A;  3L75 G;  3U59 A;  1BCC G;  3SSU A;  1L0N K;  2YXQ B;  1NTM K;  4ZKP A;  3L37 A;  2O1K A;  2Z5H A;  4K3A A;  3OAK A;  1L4A A;  5KLV E;  4GT1 A;  3G71 P;  2YMK A;  3Q5S A;  2M3B A;  1L0L D;  4HKZ H;  1JY2 N;  1NTZ E;  1R5S A;  2E75 C;  4D6T J;  2WT7 B;  2D2C C;  2WSE H;  5CJ4 A;  3HUS B;  1RE3 A;  1SQX D;  2JWD A;  1NOH A;  3E1R A;  1NWQ A;  1MUU A;  2P7J A;  1KTM A;  3CI9 A;  3H1K G;  3CCL P;  5CCG A;  3Q5P A;  2A45 G;  2QSI A;  2W6B A;  4LLH A;  4L73 A;  2ZYG A;  3MHV A;  1Q82 Q;  3SWF A;  5KKZ B;  3HUS A;  3L70 G;  1LTG C;  3H1H D;  1KB9 H;  3L35 A;  1OW8 A;  1IFI A;  1SQP D;  3AEG C;  1SQV E;  1M57 D;  3N7N A;  2IZ0 A;  3TF5 A;  1JM0 A;  2YKP A;  5CCH C;  1L0N D;  1QLE D;  1NTM D;  2W6J H;  4H13 B;  3BVH A;  1FE6 A;  1FZB A;  1FU1 A;  1EZV D;  4BXL A;  2H43 A;  1VQL P;  5KJ7 A;  3GW6 A;  1W2E A;  2ZFC A;  1HJ0 A;  1EDI A;  4WY4 C;  3AED C;  1LTB C;  4YXW H;  3T97 B;  2HOD B;  1YQ3 C;  3WU2 H;  1LNQ A;  2WSF J;  4NPD A;  3Q2Y A;  3B71 A;  5KLI C;  1KQG B;  1VQN P;  3CC2 P;  4TLF A;  3H1L J;  3I55 P;  3CCE P;  1NHL A;  4U7J A;  1SFC B;  3HE5 B;  1S3J A;  3QH9 A;  1P84 I;  3CWB J;  3BCC J;  1IFP A;  5CHX A;  3L72 J;  1JO5 A;  3ABV C;  1GL2 C;  1SQB E;  4ZMD A;  2A45 I;  2Y0E A;  2HOD A;  3P8M C;  1QEX A;  1N7S B;  2G8Y A;  1NU1 K;  3SWK A;  1FZF A;  4AYC A;  1S5L E;  2K9Y A;  1E5W A;  2YXR B;  1SFC A;  3HE5 A;  5APW A;  1FDI A;  2YMY A;  2FYU E;  5L8R J;  1URQ B;  1P84 E;  3C8V A;  1L0L G;  4KJM A;  1X9V A;  1N7S A;  1RF1 A;  1KOR A;  1SQX G;  2I1J A;  3L71 E;  3L70 E;  4BWN A;  4TT3 H;  5KLV K;  1IJD B;  3O6Q B;  1Y8A A;  3B8E B;  1H88 A;  3K5B A;  1L4A D;  1NTZ K;  2NPS C;  1URQ A;  2WQY C;  1USD A;  3WUV A;  1VF5 D;  2POH A;  3CME P;  4IL6 H;  2PP6 A;  1HTL C;  1H0T A;  3H1H G;  1SVF A;  1OMI A;  2QM8 A;  1X79 B;  1SQP G;  3ZDM A;  2R44 A;  3TGU E;  3MUD C;  2IBZ E;  3O6Q A;  1RH5 B;  2UWJ E;  4IOI H;  5APV A;  1H8A A;  1NU1 D;  1L0N G;  2CPS A;  2KI7 B;  2PAJ A;  5BU8 B;  1EZV G;  3FWN A;  3AE5 C;  1LGH B;  4ASV A;  1MFZ A;  3O8Z A;  5AVQ B;  3CLQ A;  3EQ2 A;  5APU A;  4U3F G;  3VOP A;  3LW5 H;  1LTI C;  3CXH D;  1M1K Q;  3VTP C;  1HGZ A;  5H2F H;  5B5E H;  1MV8 A;  3IF4 A;  5KLV D;  2Y9Z A;  1YJN P;  2ZT9 D;  3CX5 D;  1LWU C;  1VQ5 P;  5GTI H;  3B5N D;  1M1J C;  1G1I A;  3CC4 P;  1NTZ D;  2JP3 A;  3RK2 D;  2E76 D;  3L74 D;  3HTK B;  2M5A A;  1VQK P;  1JMM A;  1N7L A;  2HFE D;  2QM7 A;  5B66 E;  5AW2 B;  1K73 Q;  2IYO A;  3HD7 C;  2C0X A;  1AV1 A;  1MKM A;  1FBM A;  4N6J A;  2OGU A;  3FXD A;  2P2U A;  3B5N C;  4IFD K;  3LIE A;  1SQB K;  1PP9 G;  1BDD A;  1EZV I;  1LT1 A;  3RGU A;  2E75 B;  2D2C B;  1R5L A;  1RE4 C;  1M56 D;  1QL2 A;  1U7M A;  1FAV A;  2FYU K;  3MZW B;  1BGY D;  4UB8 E;  4I2L C;  1EXI A;  1ZR4 A;  1G2C B;  1YHQ P;  2WWW A;  1S2E A;  4MN4 C;  3C1L A;  1N86 A;  1SLQ A;  3BAS A;  4Y99 C;  1YIJ P;  1L0N E;  1NTM E;  5CMZ A;  1LTT C;  1RHZ B;  2IX7 C;  3A0B E;  3AE9 C;  1LTJ A;  1GD2 E;  4B86 A;  5TJH A;  3H1J D;  2ZVO B;  3CCM P;  1G2C A;  1N8R Q;  5KTB A;  3SFE C;  1NU1 G;  3KPE A;  1FJP A;  2H89 C;  2KSJ A;  2AXT H;  2KP8 A;  2I8D A;  1VQ8 P;  1JNM A;  5APY A;  1OXZ A;  1KFN A;  4WY4 B;  1DD4 A;  3LID A;  1NTK E;  4OGQ C;  4RKU J;  4EI2 A;  3RL0 D;  1KD1 Q;  2BEQ D;  3BRV B;  5KLI B;  4RO0 A;  2FYN C;  5CCH A;  3AE4 C;  4UB6 H;  1ZME C;  4M3L A;  5KLV G;  2FYU D;  1K05 A;  1S1C X;  1VQ7 P;  2A45 H;  4GOD A;  1NTZ G;  1HVV A;  3RK3 E;  3GHG A;  2HPC A;  2KLV A;  1FZE A;  4WY4 A;  1GL2 B;  4DZO A;  1CI6 B;  2Y0D A;  1AVO A;  2OQQ A;  3BAT A;  3L71 D;  3NXS A;  2DW3 A;  4PD4 D;  3AEA C;  1KYO H;  1YBK A;  1U7J A;  2ZYD A;  4QMA A;  2WZ7 A;  1NAF A;  3A2A A;  2V4H A;  1Z56 A;  1EC5 A;  3M0A A;  1JTH A;  2BEZ F;  1CI6 A;  1SQQ E;  5AVU B;  1KFM A;  1BE3 J;  1EXJ A;  1T2K D;  2WSF H;  3N4X A;  1FS0 E;  1SQV G;  3TGU D;  2OAR A;  3AEF C;  2IBZ D;  3FGA D;  1IZN B;  3PJS K;  5GTH E;  2Z4E A;  3A3Y B;  4PJ0 H;  4HB1 A;  2AEJ A;  3V5B A;  2LKM A;  2WSC J;  4I7Z B;  2OTJ P;  5AW0 B;  2WPR A;  2V7Q H;  2JWA A;  3L4F A;  1EQ7 A;  3L73 E;  1NKN A;  3H1I J;  4DJG A;  2QJY C;  1VQ6 P;  3P7K A;  3M0D C;  4DCK A;  1JY2 P;  3CWB D;  2Q7C A;  2Q5U A;  3L75 J;  3CXH E;  5CBO A;  4GOE A;  4YXD C;  3VYI A;  1LP1 A;  1BCC J;  1N73 C;  2HLO A;  1DH3 A;  2O1J A;  2P10 A;  1ZW0 A;  4IFF A;  1X0T A;  3A7O A;  3CX5 E;  1SQB G;  1K8A Q;  2N9Y B;  3CPW O;  1OX3 A;  2E74 D;  3L74 E;  1PZQ A;  2QJK C;  5AVT B;  2QJP C;  3PTZ A;  1W2B O;  3R4Y A;  2FYU G;  2KK7 A;  5GTI E;  4XE5 B;  2KOG A;  1LWU B;  5E79 E;  1NTK K;  5TIS H;  1LTS C;  2RH0 A;  3H1K J;  2PRR A;  5KAI H;  2WT7 A;  1G1J A;  1GW4 A;  1GDT A;  3L71 G;  4PV1 D;  2J59 M;  3L70 J;  4H0L D;  3HD7 B;  1L2P A;  4H44 D;  2QRX A;  4W7Y A;  4EYY Q;  3FWL A;  1BGY E;  3VN0 A;  1K04 A;  1A02 J;  2B88 A;  3VMY A;  2O01 N;  4OH8 B;  1JY3 P;  4IFM A;  2QE7 H;  4W7Z A;  1KB9 D;  2MJZ A;  3EFF K;  1KIL B;  3PH0 A;  1YTZ I;  1QGK B;  2Y0C A;  3TGU G;  1M90 Q;  2IBZ G;  2BCC E;  1MFT A;  2IYP A;  3S9O A;  5AW3 B;  1T3J A;  1IK9 A;  4JYC A;  3H1J E;  1YI2 P;  1IFN A;  2H8P D;  2JR8 A;  1JY3 N;  3P8C E;  1SQQ K;  2KXP B;  3GG2 A;  1RY3 A;  2YO2 A;  3PP5 A;  2XV5 A;  2KSE A;  1T3U A;  4Y99 B;  5CJ0 A;  3KZI H;  1KIL A;  1YJW P;  1IO4 A;  2V7Q J;  4N78 E;  2JKV A;  1RE4 A;  3T97 A;  1NTK D;  2J5U A;  2Q6Q A;  2LR2 A;  2WMM A;  2ZXX A;  3BRT B;  4L74 A;  1IK7 A;  4D6T E;  1HF9 A;  3RK3 D;  2AXT E;  2RN0 A;  2WPQ A;  5K5G B;  3CC7 P;  1A02 F;  2N1T D;  1L0L J;  4GKG A;  1PV3 A;  2OYH C;  2Y9Y A;  4OGQ B;  1NKZ B;  3AE1 C;  3PHL A;  3G3Z A;  2R3C A;  2IBZ I;  1JCC A;  1SQX J;  1EDK A;  4PD4 E;  4UB6 E;  1S5L X;  2FYN B;  3CCR P;  1J2J B;  1FZG A;  2KZI A;  1FZC C;  3W68 A;  1AQ5 A;  1QL1 A;  1SQQ D;  4C46 A;  3GLM A;  2Q3I A;  2GA1 A;  1IFD A;  5KAF H;  3I56 P;  2BAS A;  1KYO E;  2CK3 H;  3H1H J;  1SQP J;  2XKM A;  1HUC A;  1D7M A;  1L4A C;  3L36 A;  2QEX P;  1VF5 C;  2LXC B;  1XTG B;  1NTM G;  3IAO A;  5CCG D;  1L0N J;  1NTM J;  3VMA A;  4XA4 A;  3L73 D;  1RE3 C;  3A0H H;  1GK4 A;  1OFC X;  1YJ9 P;  3CCJ P;  2P58 A;  1SP4 A;  3H1L E;  1S9K D;  4U3F J;  1PL5 A;  3CCS P;  1T8Z A;  3CWB E;  3BCC E;  2IPP A;  3L72 E;  1KN7 A;  4JBZ A;  1FZA A;  3NTN A;  2QA4 P;  3MGN A;  1OZH A;  1ZV8 A;  3HUS C;  5KJ7 D;  3VP8 A;  2FXM A;  2A06 E;  2WPV B;  1ZR2 A;  1NTK G;  1QVF O;  2QJY B;  5AVW B;  4L76 A;  1VQ4 P;  2B87 B;  3MIW A;  4HJG H;  4RJT A;  3B4S A;  2QG4 A;  3D6Z A;  1RF0 C;  4H13 D;  2ZT9 C;  2R3S A;  5KKZ C;  4DT0 A;  1AVY A;  1KIL D;  1OW6 A;  3RK2 C;  2E76 C;  4N3Y B;  1PP9 J;  3CD6 P;  3EWK A;  4BRY B;  4LC1 A;  3HTK A;  2WSS H;  1TU3 F;  3M0D A;  2B87 A;  2W83 C;  5AW9 B;  2QJK B;  1PGQ A;  2WSC H;  1SFC D;  3AEB C;  4HYT B;  4YPC A;  5AW8 B;  1BE3 D;  2QJP B;  1J1D C;  2O3J A;  4BRY A;  1SQQ G;  1OIP A;  4WWI A;  1N7S D;  1KB9 E;  5AW1 B;  1J1E C;  1GZL A;  2BCC D;  1Q2N A;  3AE8 C;  2RKL A;  4HH2 A;  2W90 A;  3OW2 O;  3P8C D;  3H1I D;  1URQ D;  3M9H A;  1NU1 J;  2HYN A;  1RF1 C;  3UIA A;  3L73 G;  2OYI C;  4N78 D;  1YYC A;  1NJI Q;  2W8Z A;  1PGJ A;  1IFJ A;  3M06 A;  1FOS E;  2KB7 P;  3WU2 E;  3VMZ A;  3U1A A;  1S5L H;  2YKQ A;  3G6E P;  2QIW A;  2Z5I A;  1AJY A;  1FDM A;  2KYV A;  4D6T D;  1P84 H;  3NMD A;  3IFM A;  3V2P A;  3C9I A;  3KZI E;  5KLV J;  3MP7 B;  4A7P A;  1NTZ J;  3L74 G;  2HG5 D;  2FFD C;  2R5D A;  3RL0 C;  2GUV A;  3P32 A;  2AEF A;  3TYY A;  1HH0 A;  2XZR A;  1K9M Q;  1EDL A;  3A5T A;  1ZN5 A;  1Q86 Q;  3AE7 C;  1T6A A;  1GL2 A;  3D6Y A;  1UII A;  1IC2 A;  1KYO D;  1W5C E;  2K88 A;  1OWA A;  2OYH B;  1WT6 A;  4C7R A;  1SQV J;  1DEE G;  3CXH I;  1QVG O;  1OVR A;  1BGY G;  1OVU A;  2M0B A;  2XDJ A;  4OWF A;  3EFG A;  5AVX B;  5AW6 B;  1ZXG A;  3QWO C;  1M7L A;  2P1J A;  4IL6 E;  2ZXE B;  4W80 A;  2NPS B;  3CX5 I;  1T2K C;  2I1K A;  1PPJ E;  2L5G B;  2OYH A;  2BCC G;  3H1L D;  3H1J G;  3BCC D;  3L72 D;  5AW4 B;  5AW5 B;  1S9K E;  4KHX A;  1N2D C;  1L4A B;  2XND H;  3KXD A;  2IDB A;  2ZVN B;  4AUW A;  1VF5 B;  1GU5 A;  2NPS A;  3E7K A;  5BU5 A;  1KQS O;  3S1K A;  1WRG A;  2A06 D;  1BSH A;  2E75 D;  2J58 A;  2D2C D;  1LTA C;  2MKV A;  3CCV P;  5B66 H;  4KT0 J;  1SQB J;  3M91 A;  1OW7 A; 
#chains in the Genus database with same CATH homology
 3TK1 A;  2YNY A;  1LWU C;  3V2N A;  3U1C A;  3B5N D;  1M1J C;  1G1I A;  3BRT B;  3MUD A;  3RK2 D;  1NH4 A;  1AFO A;  3HTK B;  3M9Q A;  2N9B A;  3NFQ A;  3RK3 D;  1JMM A;  1N7L A;  1CW5 A;  2HFE D;  4JF7 A;  2QM7 A;  2WPQ A;  5AW2 B;  3WMM 0;  3HD7 C;  3V2R A;  4GIF A;  2C0X A;  1A02 F;  2W6A A;  5APS A;  1VDF A;  2N1T D;  4GKG A;  4C7N B;  1LTJ C;  1JTH B;  3SWY A;  1FBM A;  3OA7 A;  2OYH C;  1M1J B;  4N6J A;  1NKZ B;  4O9B A;  2P2U A;  3G3Z A;  2R3C A;  3B5N C;  4IFD K;  3LIE A;  1JCC A;  1SQB K;  3VP9 A;  3M9B A;  1KZU B;  2Q9I A;  2H7H A;  3V4W A;  3KYQ A;  1JOC A;  1J2J B;  1FZG A;  2W27 A;  3IR9 A;  1FZC C;  1H89 A;  4DOJ A;  5CCH D;  5APX A;  1RE4 C;  1X8Y A;  3OJA B;  2WTY A;  1AQ5 A;  5APQ A;  1YTZ T;  1QL1 A;  4C46 A;  1QL2 A;  4I1L A;  1CSB A;  3TNU B;  1FAV A;  2Q3I A;  4C7N A;  2GUS A;  3B5N B;  1IFD A;  3H6P A;  1L0L K;  1LWU A;  1DEB A;  2IFM A;  2FYU K;  1M1J A;  3CL3 D;  3RK2 B;  4I2L C;  4WY4 D;  2E42 A;  2BAS A;  3TSI A;  1ZR4 A;  1G2C B;  1JY2 O;  3RK3 B;  2WWW A;  3V2Q A;  2XKM A;  1SQX K;  1HUC A;  2C9L Y;  4I6M C;  2XNX A;  3H32 B;  1N86 A;  1SLQ A;  3BAS A;  4Y99 C;  1FZC B;  1L4A C;  1LT9 B;  5CMZ A;  3MTU E;  3L36 A;  1LTT C;  3HD7 A;  2N1T B;  4WBA A;  2IX7 C;  1XTG B;  1IFM A;  1RF0 A;  5CCG D;  1LTJ A;  4ZKU A;  3TNU A;  2IFN A;  1CZQ A;  4XA4 A;  1GD2 E;  3GHG C;  4B86 A;  1RE3 C;  3B5N A;  1GK4 A;  1J1D B;  5AVS B;  1ZLL A;  1PFI A;  1G2C A;  1GL2 D;  5KTB A;  3KPE A;  1SP4 A;  1SQP K;  4EIJ A;  1S9K D;  1FJP A;  3H32 A;  2VRS A;  1FZC A;  1GU4 A;  1LT9 A;  1T8Z A;  5AW7 B;  1J1E B;  2IPP A;  2KSJ A;  2N1T A;  3HE4 B;  2KP8 A;  1JNM A;  5APY A;  3U59 A;  1FZA A;  3NTN A;  3MGN A;  1OXZ A;  1KFN A;  2CPB A;  4WY4 B;  1L0N K;  1NTM K;  1ZV8 A;  3HUS C;  3LID A;  4ZKP A;  5KJ7 D;  3L37 A;  3VP8 A;  2O1K A;  2FXM A;  2Z5H A;  3RL0 D;  4AQR D;  1ZR2 A;  2FKW B;  3OAK A;  3BRV B;  1L4A A;  1HGV A;  5AVW B;  5CCH A;  4GT1 A;  1RF1 B;  2OYI B;  3MIW A;  4M3L A;  2M3B A;  2R32 A;  1JY2 N;  2WIT A;  2WT7 B;  5BVZ A;  3HE4 A;  1RF0 C;  2A45 H;  2WSE H;  5CJ4 A;  1HVV A;  3HUS B;  3GHG A;  1RE3 A;  2HPC A;  2KLV A;  1FZE A;  4WY4 A;  3II6 A;  1NOH A;  1GL2 B;  4DZO A;  1KIL D;  1CI6 B;  3RK2 C;  1JY3 O;  3BAT A;  2WPS A;  2NPS D;  4N3Y B;  1NWQ A;  4LC1 A;  3RK3 C;  1MUU A;  3NXS A;  3HTK A;  2P7J A;  4EOT A;  3CI9 A;  1LT9 C;  3M0D A;  2OYI A;  2WZ7 A;  1NAF A;  5CCG A;  3A2A A;  2N1T C;  2A45 G;  5AW9 B;  2W6B A;  4LLH A;  2C9N Y;  1Z56 A;  3SWF A;  1HJB A;  2WSC H;  3M0A A;  2FFD B;  3HUS A;  1JTH A;  1LTG C;  1SFC D;  3L35 A;  3RL0 B;  3MD0 A;  4HYT B;  1IFI A;  5AW8 B;  1CI6 A;  1J1D C;  5AVU B;  1KFM A;  3N7N A;  1T2K D;  2FYZ A;  2WSF H;  3N4X A;  2M8R A;  2OAR A;  2YKP A;  5CCH C;  3E1I A;  2JEE A;  1N7S D;  5AW1 B;  3BVH A;  2Z4E A;  1J1E C;  1FZB A;  3A3Y B;  1FU1 A;  1GZL A;  2H43 A;  3V5B A;  3I5C A;  2LKM A;  5KJ7 A;  4HH2 A;  2FFD A;  1W2E A;  3R2P A;  5AW0 B;  2ZFC A;  2WPR A;  4WY4 C;  1LTB C;  3P8C D;  2HOD B;  1URQ D;  3L4F A;  1EQ7 A;  3M9H A;  1NKN A;  2E43 A;  2HYN A;  3P7K A;  3UIA A;  1RF1 C;  3M0D C;  4LGD E;  3KQG A;  2OYI C;  1JY2 P;  4N78 D;  1SQV K;  5CCG C;  1YYC A;  4JYB A;  2Q7C A;  1NHL A;  5AVZ B;  3VMX A;  1SFC B;  3HE5 B;  2Q5U A;  1IFJ A;  3M06 A;  1FOS E;  5CHX A;  1JO5 A;  2KB7 P;  3VYI A;  3VMZ A;  3U1A A;  2YKQ A;  1N73 C;  1VPC A;  1GL2 C;  2HLO A;  2A45 I;  1DH3 A;  2O1J A;  2Z5I A;  5AVV B;  1FJK A;  2HOD A;  4IFF A;  3HD7 D;  3A7O A;  1GK6 A;  1FDM A;  3P8M C;  1N7S B;  2KYV A;  3NMD A;  2C0W A;  3IFM A;  2P67 A;  4WB4 A;  1NU1 K;  3V4Q A;  3V2P A;  1FZF A;  3C9I A;  1XTC C;  4AYC A;  2YKO A;  1E5W A;  1SFC A;  3HE5 A;  5APW A;  4RES B;  5KJ7 C;  2HG5 D;  5AVT B;  1N73 B;  2FFD C;  2R5D A;  2YMY A;  5AVR B;  3RL0 C;  2GUV A;  1URQ B;  3P32 A;  2GM4 A;  1JCD A;  2JJL A;  3HRN A;  3TYY A;  1HBW A;  1X9V A;  1HH0 A;  2XZR A;  2YO3 A;  4XE5 B;  1N7S A;  2KOG A;  1LWU B;  1RF1 A;  1NTK K;  1LTS C;  2I1J A;  1NO4 A;  3A5T A;  2XU6 A;  2WT7 A;  1ZN5 A;  1G1J A;  1GW4 A;  1GDT A;  2O01 H;  5KLV K;  1IJD B;  2J59 M;  3B8E B;  1H88 A;  1KIL C;  1HWT C;  1N73 A;  1GW3 A;  1L4A D;  1GL2 A;  1NTZ K;  3HD7 B;  2NPS C;  1URQ A;  1IC2 A;  2POH A;  4W7Y A;  1LTJ B;  2PP6 A;  1OWA A;  2OYH B;  2R5B A;  3VN0 A;  1HTL C;  1WT6 A;  1A02 J;  4C7R A;  3VMY A;  1SVF A;  4OH8 B;  2QM8 A;  1JY3 P;  1X79 B;  4IFM A;  1MZ9 A;  4W7Z A;  2XDJ A;  2MJZ A;  3EFG A;  5AVX B;  1KIL B;  5AW6 B;  1YTZ I;  1SFC C;  1M7L A;  2P1J A;  2ZXE B;  4W80 A;  2NPS B;  1FOS F;  1GTW A;  5APV A;  1T2K C;  1H8A A;  2I1K A;  5AW3 B;  1T3J A;  2CPS A;  1DX7 A;  1KQL A;  1IK9 A;  4JYC A;  2L5G B;  2PAJ A;  5BU8 B;  2OYH A;  1IFN A;  1N7S C;  1LGH B;  2H8P D;  1JY3 N;  1MFZ A;  3P8C E;  3O8Z A;  1SQQ K;  5AVQ B;  1RY3 A;  2YO2 A;  3PP5 A;  2XV5 A;  3KDP B;  3CLQ A;  5AW4 B;  5AW5 B;  1S9K E;  4KHX A;  1N2D C;  3EQ2 A;  1T3U A;  4Y99 B;  5CJ0 A;  5APU A;  1L4A B;  1KIL A;  1JUN A;  5APT A;  3VOP A;  3LW5 H;  1IO4 A;  4AUW A;  1LTI C;  5AVY B;  1GU5 A;  2NPS A;  4N78 E;  3VTP C;  3T97 A;  1RE4 A;  5BU5 A;  1HGZ A;  1URQ C;  1WRG A;  2J58 A;  1LTA C;  1MV8 A;  3GHG B;  2HPC B;  3M91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...