1KILD

Three-dimensional structure of the complexin/snare complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
66
structure length
66
Chain Sequence
GSARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Three-dimensional structure of the complexin/SNARE complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
molecule keywords Synaptobrevin SNARE motif
total genus 31
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2001-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1kilD00
3B5NA 1HVVA 1T3JA 2XDJA 5CCGD 2H8PD 2NPSA 1SFCA 1URQA 4LGDE 1XTGB 3HD7B 1N7SA 3HD7C 2N1TA 5KJ7A 3P8CE 2PP6A 2N1TD 3RK3D 1SFCC 1SFCB 1URQD 1SFCD 3HD7A 2YMYA 5CCGA 3HTKB 3B5ND 3B5NC 3B5NB 5KJ7C 2HG5D 4WY4A 1N7SC 1N7SB 5CCHA 3M0DC 3RK2B 3RK2C 3RL0D 3VOPA 5CCGC 1L4AB 1L4AC 1L4AD 1KILA 5CCHD 4WY4D 2M8RA 2KOGA 1JTHB 5CCHC 4WY4C 4WY4B 2WZ7A 3RK3B 4W7YA 3RK3C 1GL2A 4JF7A 1GL2B 1GL2C 1URQB 1URQC 3HD7D 1GL2D 1JTHA 4W7ZA 2N1TB 2N1TC 4OH8B 5KJ7D 1KILD 4W80A 1L4AA 1N7SD 3TSIA 1KILB 1KILC 3RL0C 3PP5A 3RK2D 3RL0B 2NPSD 4N78E 2NPSB 2NPSC 1NHLA 2HFED 3KYQA
chains in the Genus database with same CATH superfamily
4H44B 3D71A 1NTMD 3GHGB 3RL0C 1FS0E 2O01J 3CCSP 2HLOA 2JDIH 2K88A 3NFQA 5B66E 3CC4P 3AE9C 1SQVG 2XDJA 3AE3C 3L74D 2P2UA 4EI2A 3H1KJ 1LWUB 2E74D 3R4YA 4OGQC 5CCGD 1KC8Q 2QM7A 3S1KA 1AQTA 1EC5A 1SFCA 2KLVA 1URQA 2NPSA 2FFDB 1GZLA 1SP4A 2BEZF 2Q3EA 4NPFX 3F89A 3TK1A 3VP9A 2IFMA 3CWBD 3TGUJ 4JYBA 2PAJA 3Q5SA 4PV1C 2B87B 1A02F 1MFZA 2N1TA 1Q82Q 2V7QJ 1PP9J 1PIXA 3H1HE 2ZJSE 1VQ7P 3H1LG 4GIFA 2I8DA 5AVXB 1PGOA 1S2EA 1TU3F 1NTZK 2N1TD 1LP1A 1NU1D 4B86A 4IL6X 4YPCA 1QX8A 3TF5A 5AVYB 1AVOA 2P67A 1SFCB 3M9HA 4R4LA 4D6TD 3A0HH 2IBZI 3VMXA 1NVOA 1YITP 1IFIA 2Q3IA 2HODA 4WVZA 5GTIH 1SFCD 1LT1A 1NU1J 1KILE 4LLHA 4DJGA 1KQFB 3CCJP 3PH0A 1RY3A 1NTZG 2YMYA 4IFFA 2E75B 5CCGA 1FOSF 3GMAA 1JY3N 3GW6A 1HGZA 1KB9E 2IFNA 5H2FH 3V2NA 5B5EH 1FZCB 3H1HD 3CXHH 1NWQA 1PFIA 1WRGA 2A45H 4RJTA 4I6MC 3HE4B 1OIPA 2FBWC 1RF0C 5APVA 1NU1E 1FZGA 3C8VA 1VQNP 1DIPA 2WMMA 3L75G 3L73G 3AEAC 3T97A 5CMZA 2JEEA 1KFMA 1H0TB 2ZT9C 1GD2E 4WY4A 1JY2N 1N7SC 3G71P 1R5LA 5M1BA 5GTHE 2ZXXA 1T2KC 1VQ9P 4BRYB 3E1RA 2ZYAA 1EDKA 2E76B 3A0HE 1CW5A 1L4AD 1SQBJ 3A3YB 2C9LY 5CBOA 1JUNA 1SQQD 3IN6A 5AVZB 5KKZC 3AECC 4PD4D 4IOIH 2Q6QA 2CPSA 2KUBA 5CCHC 4WY4B 1BGYD 1R8EA 1YTZI 1WT6A 1SQPK 2M5AA 1LNQA 1M1JC 2WPSA 2WZ7A 2IBZG 3L4FA 3U59A 3VP8A 1HJBA 1BCCE 1ZR4A 1SS1A 2O1KA 1T8ZA 1BGYJ 2PGDA 2XZRA 3D70A 2C9NY 3RGUA 4GT1A 1EZVD 1MKMA 1U7MA 3N4XA 1JB0J 1NTZD 2FKWB 1URQB 1SQQE 1L0LD 2FFDA 4ZMDA 1OMIA 5GTIE 4IFMA 1GL2D 4I7ZC 1IC2A 1XTCC 5AW5B 4D6TG 2HPCB 1VQ8P 2D2CB 4GDOA 3RK3E 3O6QB 1NU1G 4KJMA 4HYTB 1ZMEC 2J58A 2N1TB 2OTKE 1OW8A 3FXDA 3MUDA 3PTZA 5AW7B 3P32A 2KB7P 2K9JA 2R5BA 1BCCG 3MHVA 3P7KA 1IFJA 3USSA 1AVYA 1YYCA 2WSCH 2IBZE 3II6A 3V5BA 5KLVE 2B9BA 2ITAA 4JYCA 1EZVE 1BDCA 3M9BA 3IR9A 1DH3A 1YIJP 1L4AA 1Q90D 1N7SD 4H13C 3VMAA 1Q7YQ 1KILC 4XE5B 2POHA 2YO2A 4RO0A 3RL0B 3L70J 3V4WA 4PD4H 2A06E 3WMM0 1OVRA 1FU1A 2XV5A 3OW2O 3NXSA 4IL6H 1BE3E 2NPSB 1RHZB 1NHLA 4L75A 3BCCE 2FYNC 1N73A 2YIUB 2WSFH 3AE7C 2ZFCA 5AW0B 5APWA 2VRSA 3H1KG 4H44C 1N2DC 3HE5A 3S9OA 3GHGC 2OGUA 3L70G 1T6AA 3CWBG 3W67A 5DJUB 4EOTA 1T3JA 3EWKA 1J2JB 1M57D 1IFMA 1S3JA 2WSCJ 1QGKB 3A0BH 3BVHA 1LWUC 3R2PA 4OGQB 1IJDB 3AEEC 4N3YB 3SFEC 2KXPB 1SVFA 2E76D 1M7LA 2FYUD 1RH5B 2GUSA 2FFDC 5CJ0A 3A5TA 1NTKK 1XTGB 1NKZB 5KLVK 2AXCA 5L8RJ 1RQUA 3ZDMA 1SQPG 2Y0CA 3PJSK 3CPWO 1S1CX 1HBWA 3ABVC 1M1JA 3MP7B 2KNCA 2N9YB 3P8CE 1LP1B 3CWBE 5KJ7A 3Q5RA 2OYIA 3JC22 4ASVA 1L0LG 5TISH 1FAVA 2PP6A 2RKLA 3RK3D 5KLVG 1EZVG 2GM4A 3AE8C 1M8OB 3FWNA 1NAFA 2KNCB 3HTKA 2QA4P 4ZKUA 4C7NB 1EDLA 1HF9A 3H1LE 4NPDA 2B89A 1DD3A 1URQD 2E75D 3MD0A 4H0LD 3I55P 2QJKC 1N7LA 1X0TA 1OZHA 3HUSC 4U3FG 3V2QA 4EYYQ 1S9KE 1SQXD 4HJGH 1FZCC 3MGNA 3QWOC 1AFOA 1P84I 1USDA 1NTKJ 3HTKB 4XA4A 2A06D 5KLVJ 1LWUA 2G3AA 4JPZB 1OW7A 2R3CA 1K9MQ 1K04A 1AA0A 2WQYC 3AE1C 3QH9A 1KYOI 3V2PA 5AVUB 1AJYA 3C9IA 1EQ7A 2B88A 4ASWA 2MKVA 3GHGA 3L70E 1LTBC 3KQGA 5K5GB 2YKPA 3H1IJ 5TISE 3KXDA 4H44D 2H89C 1K05A 1BDDA 1NO4A 3V2RA 3HRNA 1GK6A 3EFFK 2R5DA 5AW1B 5CCHA 1L0NE 3B8EB 2CK3H 3GF7A 1GK4A 3RBZA 2ZT9D 1EZVI 1S9KD 1LTSC 5CCGC 3CCEP 1VQPP 1YJNP 1HWTC 1HH0A 1YBKA 3M0DA 2ZXEB 3EQ2A 2E76C 1DD4A 2OQQA 1Z56A 1KILA 5KKZB 3BRVB 1OXZA 1PGQA 3T97B 1U57A 1ZN5A 4XFJA 1NU1K 1JCDA 2HR3A 2IX7C 4C7RA 5BU5A 1VQOP 1GU5A 3D6YA 1MZ9A 1T3UA 3AEFC 4WY4C 3S4RA 3VMZA 2HPCA 1VQ6P 1RQVA 1FZAA 1KYOD 1FDOA 2FYZA 2FXOA 2LXBA 3B4SA 3E1IA 4W7YA 3RK3C 1UIXA 1JY3P 1YTZT 3AEBC 1LGHB 5TJHA 5B5EE 2A06G 3CCMP 3CC7P 1PL5A 2Z5IA 3HUSA 4JF7A 4ZNCA 1N8RQ 3H1IE 5E79E 2R3SA 1NTME 3A7OA 4WBAA 1K8AQ 3AEGC 2IZ1A 1IK9A 1M56D 1KYOH 1URQC 3CWBJ 1SQVK 3H1LD 5AW4B 2GA1A 3H1JG 3HD7D 1MV8A 1SQQG 4Y99C 2E43A 1VQKP 1NTMK 3GG2A 5KLIB 1GW3A 1NTZE 2QM8A 1YJWP 1JCCA 1SQXE 1X22A 1PPJG 1JTHA 3JCUE 2OYIB 1KV4A 1BGYG 4C7NA 4U3FJ 5APQA 3L71J 4OH8B 3L75E 1RE3A 2IDBA 5KAIE 1ZW0A 2CPBA 3FXEA 1SQXG 2E5YA 3RL0g 1YQ3C 1Q2NA 3FWLA 3L36A 3NTNA 4TLFA 2IYPA 2P58A 2L5GB 3H1ID 4U3FD 1VF5B 1FZBA 1X8YA 2AEMA 4H13B 3K5BA 1Q86Q 2Z4EA 2RH0A 3PP5A 1NTMG 1FE6A 1IZNB 1LT9B 1OFCX 2LXCB 3CX5I 1KN7A 2P10A 4H13D 3H1HJ 2WSFJ 5AW8B 3W68A 4D6TE 3CCLP 4EIJA 1VDFA 2WPVB 3TYYA 1Y47A 2A45I 2NPSC 1GDTA 2E5TA 1NTMJ 2OYOA 2XU6A 5B66H 2FYNB 2YIUC 2I1JA 3L75D 4KT0J 2GUVA 4EDFA 3WU2H 1OVVA 4OVNF 1ZLLA 1H0TA 1USEA 3H1KD 1N73C 1P84H 5APXA 2AXTH 1FZEA 1JOCA 1RF0A 1S5LX 4Z1MH 2E74C 1HVVA 1QEXA 1CI6B 1PGJA 2QG4A 2ZVNB 1L0LK 3V6IA 4ZKPA 4A7PA 1YHQP 1KYOE 2H8PD 3IF4A 1PP9E 3A2AA 1M90Q 2QE7H 2QEXP 2RMZA 4AQRD 5E79H 4K35A 2KZIA 4BRYA 1GMJA 2V4HA 1CSBA 3CCVP 4OWFA 3HD7C 1PPJD 3AE6C 3H1LJ 2BCCG 2HODB 2FYUE 1RE3C 3U1AA 1EDIA 1PZQA 4AYCA 4C46A 3SWFA 1DX7A 3H1KE 2N9BA 3G9RA 4HKZH 3VMYA 2B87A 5CHXA 5KAIH 4GODA 2QVAA 4NPEA 2H43A 1HGVA 3H1JJ 4O9BA 1PP9D 2LR2A 2QJYB 3SSUA 1KZUB 3F5HA 1FJKA 1NTZJ 3G3ZA 3KDPB 3L35A 4I2LC 3SFDC 1L0LJ 1JMBA 3C1LA 2Y0EA 1IO4A 1R5SA 2QJKB 3HUSB 2QIWA 5AW6B 4DCKA 5KAFH 1VQ5P 1BCCD 4D6TJ 3L37A 3BCCG 2Q5UA 2FXMA 1Y8AA 3B5ND 1QVFO 1G1JA 4M3LA 1L0LE 2C0XA 2AXTE 3AE5C 3G6EP 2WVRA 1H89A 2JP3A 3B5NB 3PRJA 5KJ7C 3CLQA 3CXHE 3WUTA 2IZ0A 3MZWB 1KB9H 1RE4A 3SWKA 2QSIA 1VF5D 2YMKA 3Q1MA 2JWAA 3L70D 5C39A 3M0DC 3RK2C 3CL3D 3RL0D 3VOPA 2KSEA 1L4AC 1KD1Q 3L74J 2IBZD 1KQSO 1E5WA 3RK2D 1HJ0A 1VPCA 2AEFA 3OJAB 1LT9A 1ZXGA 3FGAD 1T2KD 3P8MC 2HYNA 5CCHD 2XNXA 3L72G 2M8RA 1NYHA 3CX5H 2KOGA 1JTHB 1SQBD 1SQBG 3KHUA 3TGUD 4GOEA 1NOHA 4PJ0H 1SQQJ 3U1CA 1A02J 3VTPC 1FZCA 3CD6P 2Y0DA 2OTJP 2P1JA 1NH4A 2G8YA 3RK3B 1SQPJ 2FY8A 1ZV8A 3O6QA 3TNUA 2KS1A 1YQ4C 3WUVA 2K3RA 4HB1A 1SQXK 2NZ2A 3HE4A 3H1JD 4BXLA 2L91A 3IAOA 3CXHI 3L71E 2Q7CA 2LKMA 4GKGA 1GL2B 2W6BA 5KAFE 4DOJA 2YKQA 1ZRTD 2V7QH 1VL2A 1J1EC 1AV1A 1JY2O 2ZAEB 4Y99B 5BVZA 2WTYA 5KLIC 2KP8A 2M3EA 5AVSB 3N7NA 1BCCJ 4N78D 1KFNA 1OWAA 5APUA 1JEKA 2OARA 3L72E 4K3AA 4YXWH 3JSVC 2OYIC 2PFXA 5APSA 3H1HG 5AW2B 4IFDK 2WSEJ 1QL2A 1FC2C 1LTTC 2OYHB 2YXRB 4UB8H 1SQQK 2FYUK 2QJPB 2R44A 2Z5HA 3CX5E 5BU8B 1NTKG 2H88C 4IL6E 1HUCA 1WMKA 2KLUA 4KHXA 2KZJA 1S5LH 4W80A 4BWNA 1D7MA 3P8CD 1Q81Q 5CBNA 1VF5C 1VQ4P 2Y9YA 4H0LB 3TSIA 1SQXJ 2UWJE 3IFMA 1JM0A 1LT9C 2P7JA 2Y9ZA 1JMMA 1SQPE 4U3FE 1YJ9P 1DEBA 4N78E 1S72P 4QMAA 4WB4A 3VYIA 3D6ZA 1FZFA 2O1JA 2YO3A 1LTJB 3M0AA 1GU4A 2OTLP 1FOSE 2K37A 2KYVA 3TDKA 1FJPA 1OW6A 1SQVJ 3BASA 3KYQA 3AEDC 3L74E 1CI6A 3LIDA 1W2BO 1J1DB 3I5CA 1N73B 2H7HA 1LTJA 1N86A 2M0BA 2C0WA 3B5NA 3M06A 4PJ0E 3TGUE 2E74B 2FYUJ 4OGQD 3V4QA 3LW5H 2O3JA 1NGMB 1EDJA 1SQPD 3TNUB 4JBZA 2WSEH 1X9VA 1KB9I 3GLMA 1W2EA 2M3BA 4N6JA 3H1JE 1W5CE 4LGDE 2JR8A 1X79B 3MTUE 3HD7B 1N7SA 1ZR2A 1E79H 2W27A 4PV1B 3Q2YA 1ZRTE 2JWDA 1LTGC 2K9JB 3H32A 3MUDC 5APYA 3BATA 5GTHH 4YXDC 2OYHA 1FBMA 2BASA 2ZYGA 3KPEA 3BRTB 4CPGA 1OVUA 1PPJE 1GTWA 2Q9IA 2YKOA 1BE3J 1L0NG 2YNYA 4LC1A 2QRXA 2BEQD 1HTLC 1PP9G 1SQBK 2QJYC 4R4MA 1SFCC 2K9YA 1RF1B 1SQVE 1IFNA 3Q3DA 2WPQA 3M9QA 1BE3D 5AW3B 2YXQB 3H1IG 2WWWA 3HD7A 5H2FE 1K73Q 2W83C 1FDMA 4HH2A 1ZOYC 1P84D 2BCCE 2E75C 2WITA 4JQ0D 4MN4C 2J59M 2W8ZA 4U7JA 3RBXA 1LTAC 1LTIC 1U7JA 2D2CD 2FXPA 2KI7B 3KZIH 3PLNA 4RKUJ 1BSHA 2AEJA 2NRGA 3OA7A 5AVVB 5KTBA 2O01N 3B5NC 3L73E 3LIEA 4TT3H 1NTKD 4L74A 1M1KQ 3HE5B 3CMEP 1SQVD 3L74G 3KZIE 2HG5D 2WT7B 1G1IA 1QLED 2ZT9B 1G2CB 1N7SB 3NMDA 5EFWB 3LW5J 2A45G 1H8AA 1NJIQ 3RK2B 1KMIZ 3BCCJ 3CI9A 2O01H 3CXHD 5CJ4A 1H88A 1KTMA 1L4AB 4PD4E 4DT0A 1L0NK 1DEEG 1FDIA 1MFTA 2JO1A 1KQGB 1PGPA 2Q1KA 2WSSH 3AE2C 2WT7A 3O8ZA 3ITKA 3L75J 1BGYE 2E42A 1QVGO 1S5LE 1VQLP 4L73A 4AUWA 1AQ5A 4WY4D 1PV3A 2W6AA 4GOFA 4PD4I 3CCRP 1S4XA 3I56P 3EFGA 1IK7A 2KSJA 1G2CA 2J5UA 2ZYDA 1IFDA 2WPRA 1ZP0C 5APTA 1M1JB 1YI2P 1EXJA 3CMAP 1SQBE 2MJZA 1EXIA 1GL2A 5AVRB 2W90A 1JNMA 1VQMP 2XKMA 5AVQB 1GL2C 1Y9BA 1NAYA 2SPZA 2W6JH 4UB6H 1KQLA 2PRRA 1KORA 1J1EB 1QL1A 2RN0A 3Q5PA 1L0NJ 3FX0A 4PV1D 3OAKA 3CC2P 3L71D 3L71G 4I7ZB 2K1AA 3G4SP 1P84E 2BCCD 2D2CC 5AW9B 2XNDH 2KS1B 4W7ZA 1JO5A 5KLVD 3AE4C 1UIIA 1L0ND 1RF1A 2N1TC 2DW3A 3H32B 2OYHC 3TGUG 2IPPA 2QJPC 1IFPA 3GF3A 2BCCJ 3L72D 5KJ7D 2ZVOB 2KIKA 3CCUP 1OX3A 1JY3O 3L73D 2KK7A 3B71A 3JCUH 1NTKE 1KILD 3M91A 4RESB 5DJTB 3CCQP 1LJ2A 3E7KA 2IYOA 2R32A 4H0LC 3CX5D 1KILB 1BE3G 3L72J 4Y28J 1CZQA 3H6PA 1KB9D 4YTPC 3PHLA 3L73J 1NKNA 4WWIA 2FYUG 3BCCD 2NPSD 4I1LA 1RF1C 3UIAA 4UB6E 5AVTB 4DZOA 5AVWB 2I1KA 1SLQA 3A0BE 3MIWA 4L76A 3WUUA 2JKVA 1LTJC 3SWYA 4UB8E 1L2PA 2JJLA 1RE4C 2HFED 2M5AB 1JY2P 3VN0A 1GW4A 3H25A 1BSNA 1MUUA 3WU2E 1J1DC
chains in the Genus database with same CATH topology
3GHGB 2HLOA 3NFQA 2XDJA 5CCGD 2P2UA 1LWUB 2QM7A 2KLVA 1SFCA 2NPSA 1URQA 2FFDB 1GZLA 1SP4A 3TK1A 3VP9A 2IFMA 4JYBA 2PAJA 1A02F 1MFZA 2N1TA 4GIFA 5AVXB 2N1TD 1NTZK 4B86A 5AVYB 2P67A 3M9HA 1SFCB 3VMXA 1IFIA 2Q3IA 2HODA 1SFCD 4LLHA 1RY3A 2YMYA 4IFFA 5CCGA 1FOSF 1JY3N 1HGZA 2IFNA 1FZCB 3V2NA 1PFIA 1WRGA 2A45H 4I6MC 3HE4B 1RF0C 5APVA 1FZGA 3T97A 5CMZA 2JEEA 1KFMA 1GD2E 4WY4A 1JY2N 1N7SC 1T2KC 1CW5A 1L4AD 2C9LY 3A3YB 1JUNA 5AVZB 2CPSA 5CCHC 4WY4B 1YTZI 1WT6A 1SQPK 1M1JC 2WPSA 2WZ7A 3U59A 3L4FA 3VP8A 1HJBA 1ZR4A 2O1KA 1T8ZA 2XZRA 2C9NY 4GT1A 3N4XA 2FKWB 1URQB 2FFDA 4IFMA 1GL2D 1IC2A 5AW5B 2HPCB 4HYTB 2J58A 2N1TB 3MUDA 5AW7B 3P32A 2KB7P 2R5BA 3P7KA 1IFJA 1YYCA 2WSCH 3II6A 3V5BA 4JYCA 3M9BA 3IR9A 1DH3A 1L4AA 1N7SD 1KILC 4XE5B 2POHA 2YO2A 3RL0B 3WMM0 1FU1A 2XV5A 3NXSA 2NPSB 1NHLA 1N73A 2WSFH 5AW0B 2ZFCA 5APWA 2VRSA 1N2DC 3HE5A 3GHGC 4EOTA 1T3JA 1J2JB 1IFMA 3BVHA 1LWUC 3R2PA 1IJDB 4N3YB 1SVFA 1M7LA 2GUSA 2FFDC 5CJ0A 3A5TA 1NTKK 1XTGB 1NKZB 5KLVK 1HBWA 1M1JA 2OYIA 5KJ7A 3P8CE 1FAVA 2PP6A 3RK3D 2GM4A 1NAFA 3HTKA 4ZKUA 4C7NB 1URQD 3MD0A 1S9KE 1N7LA 3HUSC 3V2QA 3MGNA 1AFOA 1FZCC 4XA4A 3HTKB 1LWUA 2R3CA 3V2PA 5AVUB 3C9IA 1EQ7A 3GHGA 1LTBC 3KQGA 2YKPA 1NO4A 3V2RA 3HRNA 1GK6A 5AW1B 2R5DA 5CCHA 3B8EB 1NWQA 1GK4A 1S9KD 1LTSC 5CCGC 1HWTC 1HH0A 3M0DA 2ZXEB 3EQ2A 1Z56A 1KILA 3BRVB 1OXZA 1ZN5A 1NU1K 1JCDA 2IX7C 4C7RA 5BU5A 1GU5A 1MZ9A 1T3UA 4WY4C 3VMZA 2HPCA 1FZAA 2FYZA 3E1IA 3RK3C 4W7YA 1JY3P 1YTZT 1LGHB 2Z5IA 3HUSA 4JF7A 3A7OA 4WBAA 5AW4B 1IK9A 1URQC 3V4WA 1SQVK 3HD7D 1MV8A 4Y99C 2E43A 1NTMK 1GW3A 2QM8A 1JCCA 1JTHA 2OYIB 4C7NA 5APQA 4OH8B 1RE3A 2CPBA 3L36A 3NTNA 2L5GB 2Z4EA 1FZBA 1X8YA 3PP5A 1LT9B 5AW8B 4EIJA 1VDFA 3TYYA 2A45I 2NPSC 1GDTA 2XU6A 2I1JA 2GUVA 1ZLLA 1N73C 5APXA 1FZEA 1JOCA 1RF0A 1HVVA 1CI6B 1L0LK 4ZKPA 2H8PD 3A2AA 4AQRD 1CSBA 3HD7C 2HODB 4C46A 4AYCA 1RE3C 3U1AA 3SWFA 1DX7A 2N9BA 3VMYA 5CHXA 2H43A 1HGVA 4O9BA 2H7HA 1KZUB 3G3ZA 1FJKA 1RF1C 4I2LC 3KDPB 3L35A 1IO4A 5AW6B 3HUSB 3L37A 2Q5UA 2FXMA 3B5ND 1G1JA 4M3LA 2C0XA 1H89A 3B5NB 5KJ7C 3CLQA 1RE4A 3M0DC 3RK2C 3CL3D 3RL0D 3VOPA 1L4AC 1E5WA 1T2KD 1VPCA 3OJAB 1LT9A 3P8MC 2HYNA 5CCHD 2XNXA 2M8RA 2KOGA 1JTHB 1NOHA 3U1CA 1A02J 3VTPC 1FZCA 2P1JA 1NH4A 3RK3B 1ZV8A 1SQXK 3HE4A 2Q7CA 2LKMA 4GKGA 1GL2B 2W6BA 4DOJA 2YKQA 2WTYA 1J1EC 4Y99B 1JY2O 5BVZA 2KP8A 1FDMA 5AVSB 3N7NA 5APUA 4N78D 1KFNA 1OWAA 2OARA 2OYIC 5APSA 5AW2B 4IFDK 1QL2A 1LTTC 2OYHB 1SQQK 2FYUK 2Z5HA 5BU8B 1HUCA 4KHXA 4W80A 3P8CD 3TSIA 3IFMA 1LT9C 2P7JA 1JMMA 1DEBA 4N78E 4WB4A 3VYIA 1FZFA 2O1JA 2YO3A 1LTJB 3M0AA 1GU4A 1FOSE 2KYVA 1FJPA 3BASA 3KYQA 3LIDA 1CI6A 1N73B 1J1DB 3I5CA 1LTJA 1N86A 3M06A 2C0WA 3B5NA 3V4QA 3LW5H 3TNUB 2WSEH 1X9VA 1W2EA 2M3BA 4N6JA 4LGDE 1X79B 3MTUE 3HD7B 1N7SA 1ZR2A 2W27A 1LTGC 3H32A 5APYA 3BATA 2OYHA 1FBMA 2BASA 3KPEA 3BRTB 1GTWA 2Q9IA 2YKOA 2YNYA 4LC1A 1HTLC 1SQBK 1SFCC 1RF1B 1IFNA 2WPQA 3M9QA 5AW3B 2WWWA 3HD7A 4HH2A 2WITA 2J59M 1LTAC 1LTIC 3OA7A 5AVVB 5KTBA 3B5NC 3LIEA 3HE5B 2WT7B 2HG5D 1G1IA 1G2CB 1N7SB 3NMDA 2A45G 1H8AA 3RK2B 3CI9A 5CJ4A 2O01H 1H88A 1L4AB 1L0NK 2WT7A 3O8ZA 4AUWA 2E42A 1AQ5A 4WY4D 2W6AA 3EFGA 2KSJA 1G2CA 1IFDA 2WPRA 5APTA 1M1JB 1J1DC 2MJZA 1GL2A 5AVRB 1JNMA 2XKMA 1GL2C 1KQLA 1J1EB 1QL1A 3OAKA 5AW9B 4W7ZA 1JO5A 1RF1A 2N1TC 3H32B 2OYHC 2IPPA 5KJ7D 1JY3O 3M91A 4RESB 1KILD 2R32A 1KILB 3TNUA 3RK2D 3RL0C 1CZQA 3H6PA 1NKNA 2NPSD 4I1LA 3UIAA 5AVTB 4DZOA 5AVWB 2I1KA 1SLQA 3MIWA 1LTJC 3SWYA 2JJLA 1RE4C 2HFED 3VN0A 1JY2P 1GW4A 5AVQB 1MUUA 1XTCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B5N A;  1HVV A;  1T3J A;  2XDJ A;  5CCG D;  2H8P D;  2NPS A;  1SFC A;  1URQ A;  4LGD E;  1XTG B;  3HD7 B;  1N7S A;  3HD7 C;  2N1T A;  5KJ7 A;  3P8C E;  2PP6 A;  2N1T D;  3RK3 D;  1SFC C;  1SFC B;  1URQ D;  1SFC D;  3HD7 A;  2YMY A;  5CCG A;  3HTK B;  3B5N D;  3B5N C;  3B5N B;  5KJ7 C;  2HG5 D;  4WY4 A;  1N7S C;  1N7S B;  5CCH A;  3M0D C;  3RK2 B;  3RK2 C;  3RL0 D;  3VOP A;  5CCG C;  1L4A B;  1L4A C;  1L4A D;  1KIL A;  5CCH D;  4WY4 D;  2M8R A;  2KOG A;  1JTH B;  5CCH C;  4WY4 C;  4WY4 B;  2WZ7 A;  3RK3 B;  4W7Y A;  3RK3 C;  1GL2 A;  4JF7 A;  1GL2 B;  1GL2 C;  1URQ B;  1URQ C;  3HD7 D;  1GL2 D;  1JTH A;  4W7Z A;  2N1T B;  2N1T C;  4OH8 B;  5KJ7 D;  1KIL D;  4W80 A;  1L4A A;  1N7S D;  3TSI A;  1KIL B;  1KIL C;  3RL0 C;  3PP5 A;  3RK2 D;  3RL0 B;  2NPS D;  4N78 E;  2NPS B;  2NPS C;  1NHL A;  2HFE D;  3KYQ A; 
#chains in the Genus database with same CATH topology
 4H44 B;  3D71 A;  1NTM D;  3GHG B;  3RL0 C;  1FS0 E;  2O01 J;  3CCS P;  2HLO A;  2JDI H;  2K88 A;  3NFQ A;  5B66 E;  3CC4 P;  3AE9 C;  1SQV G;  2XDJ A;  3AE3 C;  3L74 D;  2P2U A;  4EI2 A;  3H1K J;  1LWU B;  2E74 D;  3R4Y A;  4OGQ C;  5CCG D;  1KC8 Q;  2QM7 A;  3S1K A;  1AQT A;  1EC5 A;  1SFC A;  2KLV A;  1URQ A;  2NPS A;  2FFD B;  1GZL A;  1SP4 A;  2BEZ F;  2Q3E A;  4NPF X;  3F89 A;  3TK1 A;  3VP9 A;  2IFM A;  3CWB D;  3TGU J;  4JYB A;  2PAJ A;  3Q5S A;  4PV1 C;  2B87 B;  1A02 F;  1MFZ A;  2N1T A;  1Q82 Q;  2V7Q J;  1PP9 J;  1PIX A;  3H1H E;  2ZJS E;  1VQ7 P;  3H1L G;  4GIF A;  2I8D A;  5AVX B;  1PGO A;  1S2E A;  1TU3 F;  1NTZ K;  2N1T D;  1LP1 A;  1NU1 D;  4B86 A;  4IL6 X;  4YPC A;  1QX8 A;  3TF5 A;  5AVY B;  1AVO A;  2P67 A;  1SFC B;  3M9H A;  4R4L A;  4D6T D;  3A0H H;  2IBZ I;  3VMX A;  1NVO A;  1YIT P;  1IFI A;  2Q3I A;  2HOD A;  4WVZ A;  5GTI H;  1SFC D;  1LT1 A;  1NU1 J;  1KIL E;  4LLH A;  4DJG A;  1KQF B;  3CCJ P;  3PH0 A;  1RY3 A;  1NTZ G;  2YMY A;  4IFF A;  2E75 B;  5CCG A;  1FOS F;  3GMA A;  1JY3 N;  3GW6 A;  1HGZ A;  1KB9 E;  2IFN A;  5H2F H;  3V2N A;  5B5E H;  1FZC B;  3H1H D;  3CXH H;  1NWQ A;  1PFI A;  1WRG A;  2A45 H;  4RJT A;  4I6M C;  3HE4 B;  1OIP A;  2FBW C;  1RF0 C;  5APV A;  1NU1 E;  1FZG A;  3C8V A;  1VQN P;  1DIP A;  2WMM A;  3L75 G;  3L73 G;  3AEA C;  3T97 A;  5CMZ A;  2JEE A;  1KFM A;  1H0T B;  2ZT9 C;  1GD2 E;  4WY4 A;  1JY2 N;  1N7S C;  3G71 P;  1R5L A;  5M1B A;  5GTH E;  2ZXX A;  1T2K C;  1VQ9 P;  4BRY B;  3E1R A;  2ZYA A;  1EDK A;  2E76 B;  3A0H E;  1CW5 A;  1L4A D;  1SQB J;  3A3Y B;  2C9L Y;  5CBO A;  1JUN A;  1SQQ D;  3IN6 A;  5AVZ B;  5KKZ C;  3AEC C;  4PD4 D;  4IOI H;  2Q6Q A;  2CPS A;  2KUB A;  5CCH C;  4WY4 B;  1BGY D;  1R8E A;  1YTZ I;  1WT6 A;  1SQP K;  2M5A A;  1LNQ A;  1M1J C;  2WPS A;  2WZ7 A;  2IBZ G;  3L4F A;  3U59 A;  3VP8 A;  1HJB A;  1BCC E;  1ZR4 A;  1SS1 A;  2O1K A;  1T8Z A;  1BGY J;  2PGD A;  2XZR A;  3D70 A;  2C9N Y;  3RGU A;  4GT1 A;  1EZV D;  1MKM A;  1U7M A;  3N4X A;  1JB0 J;  1NTZ D;  2FKW B;  1URQ B;  1SQQ E;  1L0L D;  2FFD A;  4ZMD A;  1OMI A;  5GTI E;  4IFM A;  1GL2 D;  4I7Z C;  1IC2 A;  1XTC C;  5AW5 B;  4D6T G;  2HPC B;  1VQ8 P;  2D2C B;  4GDO A;  3RK3 E;  3O6Q B;  1NU1 G;  4KJM A;  4HYT B;  1ZME C;  2J58 A;  2N1T B;  2OTK E;  1OW8 A;  3FXD A;  3MUD A;  3PTZ A;  5AW7 B;  3P32 A;  2KB7 P;  2K9J A;  2R5B A;  1BCC G;  3MHV A;  3P7K A;  1IFJ A;  3USS A;  1AVY A;  1YYC A;  2WSC H;  2IBZ E;  3II6 A;  3V5B A;  5KLV E;  2B9B A;  2ITA A;  4JYC A;  1EZV E;  1BDC A;  3M9B A;  3IR9 A;  1DH3 A;  1YIJ P;  1L4A A;  1Q90 D;  1N7S D;  4H13 C;  3VMA A;  1Q7Y Q;  1KIL C;  4XE5 B;  2POH A;  2YO2 A;  4RO0 A;  3RL0 B;  3L70 J;  3V4W A;  4PD4 H;  2A06 E;  3WMM 0;  1OVR A;  1FU1 A;  2XV5 A;  3OW2 O;  3NXS A;  4IL6 H;  1BE3 E;  2NPS B;  1RHZ B;  1NHL A;  4L75 A;  3BCC E;  2FYN C;  1N73 A;  2YIU B;  2WSF H;  3AE7 C;  2ZFC A;  5AW0 B;  5APW A;  2VRS A;  3H1K G;  4H44 C;  1N2D C;  3HE5 A;  3S9O A;  3GHG C;  2OGU A;  3L70 G;  1T6A A;  3CWB G;  3W67 A;  5DJU B;  4EOT A;  1T3J A;  3EWK A;  1J2J B;  1M57 D;  1IFM A;  1S3J A;  2WSC J;  1QGK B;  3A0B H;  3BVH A;  1LWU C;  3R2P A;  4OGQ B;  1IJD B;  3AEE C;  4N3Y B;  3SFE C;  2KXP B;  1SVF A;  2E76 D;  1M7L A;  2FYU D;  1RH5 B;  2GUS A;  2FFD C;  5CJ0 A;  3A5T A;  1NTK K;  1XTG B;  1NKZ B;  5KLV K;  2AXC A;  5L8R J;  1RQU A;  3ZDM A;  1SQP G;  2Y0C A;  3PJS K;  3CPW O;  1S1C X;  1HBW A;  3ABV C;  1M1J A;  3MP7 B;  2KNC A;  2N9Y B;  3P8C E;  1LP1 B;  3CWB E;  5KJ7 A;  3Q5R A;  2OYI A;  3JC2 2;  4ASV A;  1L0L G;  5TIS H;  1FAV A;  2PP6 A;  2RKL A;  3RK3 D;  5KLV G;  1EZV G;  2GM4 A;  3AE8 C;  1M8O B;  3FWN A;  1NAF A;  2KNC B;  3HTK A;  2QA4 P;  4ZKU A;  4C7N B;  1EDL A;  1HF9 A;  3H1L E;  4NPD A;  2B89 A;  1DD3 A;  1URQ D;  2E75 D;  3MD0 A;  4H0L D;  3I55 P;  2QJK C;  1N7L A;  1X0T A;  1OZH A;  3HUS C;  4U3F G;  3V2Q A;  4EYY Q;  1S9K E;  1SQX D;  4HJG H;  1FZC C;  3MGN A;  3QWO C;  1AFO A;  1P84 I;  1USD A;  1NTK J;  3HTK B;  4XA4 A;  2A06 D;  5KLV J;  1LWU A;  2G3A A;  4JPZ B;  1OW7 A;  2R3C A;  1K9M Q;  1K04 A;  1AA0 A;  2WQY C;  3AE1 C;  3QH9 A;  1KYO I;  3V2P A;  5AVU B;  1AJY A;  3C9I A;  1EQ7 A;  2B88 A;  4ASW A;  2MKV A;  3GHG A;  3L70 E;  1LTB C;  3KQG A;  5K5G B;  2YKP A;  3H1I J;  5TIS E;  3KXD A;  4H44 D;  2H89 C;  1K05 A;  1BDD A;  1NO4 A;  3V2R A;  3HRN A;  1GK6 A;  3EFF K;  2R5D A;  5AW1 B;  5CCH A;  1L0N E;  3B8E B;  2CK3 H;  3GF7 A;  1GK4 A;  3RBZ A;  2ZT9 D;  1EZV I;  1S9K D;  1LTS C;  5CCG C;  3CCE P;  1VQP P;  1YJN P;  1HWT C;  1HH0 A;  1YBK A;  3M0D A;  2ZXE B;  3EQ2 A;  2E76 C;  1DD4 A;  2OQQ A;  1Z56 A;  1KIL A;  5KKZ B;  3BRV B;  1OXZ A;  1PGQ A;  3T97 B;  1U57 A;  1ZN5 A;  4XFJ A;  1NU1 K;  1JCD A;  2HR3 A;  2IX7 C;  4C7R A;  5BU5 A;  1VQO P;  1GU5 A;  3D6Y A;  1MZ9 A;  1T3U A;  3AEF C;  4WY4 C;  3S4R A;  3VMZ A;  2HPC A;  1VQ6 P;  1RQV A;  1FZA A;  1KYO D;  1FDO A;  2FYZ A;  2FXO A;  2LXB A;  3B4S A;  3E1I A;  4W7Y A;  3RK3 C;  1UIX A;  1JY3 P;  1YTZ T;  3AEB C;  1LGH B;  5TJH A;  5B5E E;  2A06 G;  3CCM P;  3CC7 P;  1PL5 A;  2Z5I A;  3HUS A;  4JF7 A;  4ZNC A;  1N8R Q;  3H1I E;  5E79 E;  2R3S A;  1NTM E;  3A7O A;  4WBA A;  1K8A Q;  3AEG C;  2IZ1 A;  1IK9 A;  1M56 D;  1KYO H;  1URQ C;  3CWB J;  1SQV K;  3H1L D;  5AW4 B;  2GA1 A;  3H1J G;  3HD7 D;  1MV8 A;  1SQQ G;  4Y99 C;  2E43 A;  1VQK P;  1NTM K;  3GG2 A;  5KLI B;  1GW3 A;  1NTZ E;  2QM8 A;  1YJW P;  1JCC A;  1SQX E;  1X22 A;  1PPJ G;  1JTH A;  3JCU E;  2OYI B;  1KV4 A;  1BGY G;  4C7N A;  4U3F J;  5APQ A;  3L71 J;  4OH8 B;  3L75 E;  1RE3 A;  2IDB A;  5KAI E;  1ZW0 A;  2CPB A;  3FXE A;  1SQX G;  2E5Y A;  3RL0 g;  1YQ3 C;  1Q2N A;  3FWL A;  3L36 A;  3NTN A;  4TLF A;  2IYP A;  2P58 A;  2L5G B;  3H1I D;  4U3F D;  1VF5 B;  1FZB A;  1X8Y A;  2AEM A;  4H13 B;  3K5B A;  1Q86 Q;  2Z4E A;  2RH0 A;  3PP5 A;  1NTM G;  1FE6 A;  1IZN B;  1LT9 B;  1OFC X;  2LXC B;  3CX5 I;  1KN7 A;  2P10 A;  4H13 D;  3H1H J;  2WSF J;  5AW8 B;  3W68 A;  4D6T E;  3CCL P;  4EIJ A;  1VDF A;  2WPV B;  3TYY A;  1Y47 A;  2A45 I;  2NPS C;  1GDT A;  2E5T A;  1NTM J;  2OYO A;  2XU6 A;  5B66 H;  2FYN B;  2YIU C;  2I1J A;  3L75 D;  4KT0 J;  2GUV A;  4EDF A;  3WU2 H;  1OVV A;  4OVN F;  1ZLL A;  1H0T A;  1USE A;  3H1K D;  1N73 C;  1P84 H;  5APX A;  2AXT H;  1FZE A;  1JOC A;  1RF0 A;  1S5L X;  4Z1M H;  2E74 C;  1HVV A;  1QEX A;  1CI6 B;  1PGJ A;  2QG4 A;  2ZVN B;  1L0L K;  3V6I A;  4ZKP A;  4A7P A;  1YHQ P;  1KYO E;  2H8P D;  3IF4 A;  1PP9 E;  3A2A A;  1M90 Q;  2QE7 H;  2QEX P;  2RMZ A;  4AQR D;  5E79 H;  4K35 A;  2KZI A;  4BRY A;  1GMJ A;  2V4H A;  1CSB A;  3CCV P;  4OWF A;  3HD7 C;  1PPJ D;  3AE6 C;  3H1L J;  2BCC G;  2HOD B;  2FYU E;  1RE3 C;  3U1A A;  1EDI A;  1PZQ A;  4AYC A;  4C46 A;  3SWF A;  1DX7 A;  3H1K E;  2N9B A;  3G9R A;  4HKZ H;  3VMY A;  2B87 A;  5CHX A;  5KAI H;  4GOD A;  2QVA A;  4NPE A;  2H43 A;  1HGV A;  3H1J J;  4O9B A;  1PP9 D;  2LR2 A;  2QJY B;  3SSU A;  1KZU B;  3F5H A;  1FJK A;  1NTZ J;  3G3Z A;  3KDP B;  3L35 A;  4I2L C;  3SFD C;  1L0L J;  1JMB A;  3C1L A;  2Y0E A;  1IO4 A;  1R5S A;  2QJK B;  3HUS B;  2QIW A;  5AW6 B;  4DCK A;  5KAF H;  1VQ5 P;  1BCC D;  4D6T J;  3L37 A;  3BCC G;  2Q5U A;  2FXM A;  1Y8A A;  3B5N D;  1QVF O;  1G1J A;  4M3L A;  1L0L E;  2C0X A;  2AXT E;  3AE5 C;  3G6E P;  2WVR A;  1H89 A;  2JP3 A;  3B5N B;  3PRJ A;  5KJ7 C;  3CLQ A;  3CXH E;  3WUT A;  2IZ0 A;  3MZW B;  1KB9 H;  1RE4 A;  3SWK A;  2QSI A;  1VF5 D;  2YMK A;  3Q1M A;  2JWA A;  3L70 D;  5C39 A;  3M0D C;  3RK2 C;  3CL3 D;  3RL0 D;  3VOP A;  2KSE A;  1L4A C;  1KD1 Q;  3L74 J;  2IBZ D;  1KQS O;  1E5W A;  3RK2 D;  1HJ0 A;  1VPC A;  2AEF A;  3OJA B;  1LT9 A;  1ZXG A;  3FGA D;  1T2K D;  3P8M C;  2HYN A;  5CCH D;  2XNX A;  3L72 G;  2M8R A;  1NYH A;  3CX5 H;  2KOG A;  1JTH B;  1SQB D;  1SQB G;  3KHU A;  3TGU D;  4GOE A;  1NOH A;  4PJ0 H;  1SQQ J;  3U1C A;  1A02 J;  3VTP C;  1FZC A;  3CD6 P;  2Y0D A;  2OTJ P;  2P1J A;  1NH4 A;  2G8Y A;  3RK3 B;  1SQP J;  2FY8 A;  1ZV8 A;  3O6Q A;  3TNU A;  2KS1 A;  1YQ4 C;  3WUV A;  2K3R A;  4HB1 A;  1SQX K;  2NZ2 A;  3HE4 A;  3H1J D;  4BXL A;  2L91 A;  3IAO A;  3CXH I;  3L71 E;  2Q7C A;  2LKM A;  4GKG A;  1GL2 B;  2W6B A;  5KAF E;  4DOJ A;  2YKQ A;  1ZRT D;  2V7Q H;  1VL2 A;  1J1E C;  1AV1 A;  1JY2 O;  2ZAE B;  4Y99 B;  5BVZ A;  2WTY A;  5KLI C;  2KP8 A;  2M3E A;  5AVS B;  3N7N A;  1BCC J;  4N78 D;  1KFN A;  1OWA A;  5APU A;  1JEK A;  2OAR A;  3L72 E;  4K3A A;  4YXW H;  3JSV C;  2OYI C;  2PFX A;  5APS A;  3H1H G;  5AW2 B;  4IFD K;  2WSE J;  1QL2 A;  1FC2 C;  1LTT C;  2OYH B;  2YXR B;  4UB8 H;  1SQQ K;  2FYU K;  2QJP B;  2R44 A;  2Z5H A;  3CX5 E;  5BU8 B;  1NTK G;  2H88 C;  4IL6 E;  1HUC A;  1WMK A;  2KLU A;  4KHX A;  2KZJ A;  1S5L H;  4W80 A;  4BWN A;  1D7M A;  3P8C D;  1Q81 Q;  5CBN A;  1VF5 C;  1VQ4 P;  2Y9Y A;  4H0L B;  3TSI A;  1SQX J;  2UWJ E;  3IFM A;  1JM0 A;  1LT9 C;  2P7J A;  2Y9Z A;  1JMM A;  1SQP E;  4U3F E;  1YJ9 P;  1DEB A;  4N78 E;  1S72 P;  4QMA A;  4WB4 A;  3VYI A;  3D6Z A;  1FZF A;  2O1J A;  2YO3 A;  1LTJ B;  3M0A A;  1GU4 A;  2OTL P;  1FOS E;  2K37 A;  2KYV A;  3TDK A;  1FJP A;  1OW6 A;  1SQV J;  3BAS A;  3KYQ A;  3AED C;  3L74 E;  1CI6 A;  3LID A;  1W2B O;  1J1D B;  3I5C A;  1N73 B;  2H7H A;  1LTJ A;  1N86 A;  2M0B A;  2C0W A;  3B5N A;  3M06 A;  4PJ0 E;  3TGU E;  2E74 B;  2FYU J;  4OGQ D;  3V4Q A;  3LW5 H;  2O3J A;  1NGM B;  1EDJ A;  1SQP D;  3TNU B;  4JBZ A;  2WSE H;  1X9V A;  1KB9 I;  3GLM A;  1W2E A;  2M3B A;  4N6J A;  3H1J E;  1W5C E;  4LGD E;  2JR8 A;  1X79 B;  3MTU E;  3HD7 B;  1N7S A;  1ZR2 A;  1E79 H;  2W27 A;  4PV1 B;  3Q2Y A;  1ZRT E;  2JWD A;  1LTG C;  2K9J B;  3H32 A;  3MUD C;  5APY A;  3BAT A;  5GTH H;  4YXD C;  2OYH A;  1FBM A;  2BAS A;  2ZYG A;  3KPE A;  3BRT B;  4CPG A;  1OVU A;  1PPJ E;  1GTW A;  2Q9I A;  2YKO A;  1BE3 J;  1L0N G;  2YNY A;  4LC1 A;  2QRX A;  2BEQ D;  1HTL C;  1PP9 G;  1SQB K;  2QJY C;  4R4M A;  1SFC C;  2K9Y A;  1RF1 B;  1SQV E;  1IFN A;  3Q3D A;  2WPQ A;  3M9Q A;  1BE3 D;  5AW3 B;  2YXQ B;  3H1I G;  2WWW A;  3HD7 A;  5H2F E;  1K73 Q;  2W83 C;  1FDM A;  4HH2 A;  1ZOY C;  1P84 D;  2BCC E;  2E75 C;  2WIT A;  4JQ0 D;  4MN4 C;  2J59 M;  2W8Z A;  4U7J A;  3RBX A;  1LTA C;  1LTI C;  1U7J A;  2D2C D;  2FXP A;  2KI7 B;  3KZI H;  3PLN A;  4RKU J;  1BSH A;  2AEJ A;  2NRG A;  3OA7 A;  5AVV B;  5KTB A;  2O01 N;  3B5N C;  3L73 E;  3LIE A;  4TT3 H;  1NTK D;  4L74 A;  1M1K Q;  3HE5 B;  3CME P;  1SQV D;  3L74 G;  3KZI E;  2HG5 D;  2WT7 B;  1G1I A;  1QLE D;  2ZT9 B;  1G2C B;  1N7S B;  3NMD A;  5EFW B;  3LW5 J;  2A45 G;  1H8A A;  1NJI Q;  3RK2 B;  1KMI Z;  3BCC J;  3CI9 A;  2O01 H;  3CXH D;  5CJ4 A;  1H88 A;  1KTM A;  1L4A B;  4PD4 E;  4DT0 A;  1L0N K;  1DEE G;  1FDI A;  1MFT A;  2JO1 A;  1KQG B;  1PGP A;  2Q1K A;  2WSS H;  3AE2 C;  2WT7 A;  3O8Z A;  3ITK A;  3L75 J;  1BGY E;  2E42 A;  1QVG O;  1S5L E;  1VQL P;  4L73 A;  4AUW A;  1AQ5 A;  4WY4 D;  1PV3 A;  2W6A A;  4GOF A;  4PD4 I;  3CCR P;  1S4X A;  3I56 P;  3EFG A;  1IK7 A;  2KSJ A;  1G2C A;  2J5U A;  2ZYD A;  1IFD A;  2WPR A;  1ZP0 C;  5APT A;  1M1J B;  1YI2 P;  1EXJ A;  3CMA P;  1SQB E;  2MJZ A;  1EXI A;  1GL2 A;  5AVR B;  2W90 A;  1JNM A;  1VQM P;  2XKM A;  5AVQ B;  1GL2 C;  1Y9B A;  1NAY A;  2SPZ A;  2W6J H;  4UB6 H;  1KQL A;  2PRR A;  1KOR A;  1J1E B;  1QL1 A;  2RN0 A;  3Q5P A;  1L0N J;  3FX0 A;  4PV1 D;  3OAK A;  3CC2 P;  3L71 D;  3L71 G;  4I7Z B;  2K1A A;  3G4S P;  1P84 E;  2BCC D;  2D2C C;  5AW9 B;  2XND H;  2KS1 B;  4W7Z A;  1JO5 A;  5KLV D;  3AE4 C;  1UII A;  1L0N D;  1RF1 A;  2N1T C;  2DW3 A;  3H32 B;  2OYH C;  3TGU G;  2IPP A;  2QJP C;  1IFP A;  3GF3 A;  2BCC J;  3L72 D;  5KJ7 D;  2ZVO B;  2KIK A;  3CCU P;  1OX3 A;  1JY3 O;  3L73 D;  2KK7 A;  3B71 A;  3JCU H;  1NTK E;  1KIL D;  3M91 A;  4RES B;  5DJT B;  3CCQ P;  1LJ2 A;  3E7K A;  2IYO A;  2R32 A;  4H0L C;  3CX5 D;  1KIL B;  1BE3 G;  3L72 J;  4Y28 J;  1CZQ A;  3H6P A;  1KB9 D;  4YTP C;  3PHL A;  3L73 J;  1NKN A;  4WWI A;  2FYU G;  3BCC D;  2NPS D;  4I1L A;  1RF1 C;  3UIA A;  4UB6 E;  5AVT B;  4DZO A;  5AVW B;  2I1K A;  1SLQ A;  3A0B E;  3MIW A;  4L76 A;  3WUU A;  2JKV A;  1LTJ C;  3SWY A;  4UB8 E;  1L2P A;  2JJL A;  1RE4 C;  2HFE D;  2M5A B;  1JY2 P;  3VN0 A;  1GW4 A;  3H25 A;  1BSN A;  1MUU A;  3WU2 E;  1J1D C; 
#chains in the Genus database with same CATH homology
 3GHG B;  2HLO A;  3NFQ A;  2XDJ A;  5CCG D;  2P2U A;  1LWU B;  2QM7 A;  2KLV A;  1SFC A;  2NPS A;  1URQ A;  2FFD B;  1GZL A;  1SP4 A;  3TK1 A;  3VP9 A;  2IFM A;  4JYB A;  2PAJ A;  1A02 F;  1MFZ A;  2N1T A;  4GIF A;  5AVX B;  2N1T D;  1NTZ K;  4B86 A;  5AVY B;  2P67 A;  3M9H A;  1SFC B;  3VMX A;  1IFI A;  2Q3I A;  2HOD A;  1SFC D;  4LLH A;  1RY3 A;  2YMY A;  4IFF A;  5CCG A;  1FOS F;  1JY3 N;  1HGZ A;  2IFN A;  1FZC B;  3V2N A;  1PFI A;  1WRG A;  2A45 H;  4I6M C;  3HE4 B;  1RF0 C;  5APV A;  1FZG A;  3T97 A;  5CMZ A;  2JEE A;  1KFM A;  1GD2 E;  4WY4 A;  1JY2 N;  1N7S C;  1T2K C;  1CW5 A;  1L4A D;  2C9L Y;  3A3Y B;  1JUN A;  5AVZ B;  2CPS A;  5CCH C;  4WY4 B;  1YTZ I;  1WT6 A;  1SQP K;  1M1J C;  2WPS A;  2WZ7 A;  3U59 A;  3L4F A;  3VP8 A;  1HJB A;  1ZR4 A;  2O1K A;  1T8Z A;  2XZR A;  2C9N Y;  4GT1 A;  3N4X A;  2FKW B;  1URQ B;  2FFD A;  4IFM A;  1GL2 D;  1IC2 A;  5AW5 B;  2HPC B;  4HYT B;  2J58 A;  2N1T B;  3MUD A;  5AW7 B;  3P32 A;  2KB7 P;  2R5B A;  3P7K A;  1IFJ A;  1YYC A;  2WSC H;  3II6 A;  3V5B A;  4JYC A;  3M9B A;  3IR9 A;  1DH3 A;  1L4A A;  1N7S D;  1KIL C;  4XE5 B;  2POH A;  2YO2 A;  3RL0 B;  3WMM 0;  1FU1 A;  2XV5 A;  3NXS A;  2NPS B;  1NHL A;  1N73 A;  2WSF H;  5AW0 B;  2ZFC A;  5APW A;  2VRS A;  1N2D C;  3HE5 A;  3GHG C;  4EOT A;  1T3J A;  1J2J B;  1IFM A;  3BVH A;  1LWU C;  3R2P A;  1IJD B;  4N3Y B;  1SVF A;  1M7L A;  2GUS A;  2FFD C;  5CJ0 A;  3A5T A;  1NTK K;  1XTG B;  1NKZ B;  5KLV K;  1HBW A;  1M1J A;  2OYI A;  5KJ7 A;  3P8C E;  1FAV A;  2PP6 A;  3RK3 D;  2GM4 A;  1NAF A;  3HTK A;  4ZKU A;  4C7N B;  1URQ D;  3MD0 A;  1S9K E;  1N7L A;  3HUS C;  3V2Q A;  3MGN A;  1AFO A;  1FZC C;  4XA4 A;  3HTK B;  1LWU A;  2R3C A;  3V2P A;  5AVU B;  3C9I A;  1EQ7 A;  3GHG A;  1LTB C;  3KQG A;  2YKP A;  1NO4 A;  3V2R A;  3HRN A;  1GK6 A;  5AW1 B;  2R5D A;  5CCH A;  3B8E B;  1NWQ A;  1GK4 A;  1S9K D;  1LTS C;  5CCG C;  1HWT C;  1HH0 A;  3M0D A;  2ZXE B;  3EQ2 A;  1Z56 A;  1KIL A;  3BRV B;  1OXZ A;  1ZN5 A;  1NU1 K;  1JCD A;  2IX7 C;  4C7R A;  5BU5 A;  1GU5 A;  1MZ9 A;  1T3U A;  4WY4 C;  3VMZ A;  2HPC A;  1FZA A;  2FYZ A;  3E1I A;  3RK3 C;  4W7Y A;  1JY3 P;  1YTZ T;  1LGH B;  2Z5I A;  3HUS A;  4JF7 A;  3A7O A;  4WBA A;  5AW4 B;  1IK9 A;  1URQ C;  3V4W A;  1SQV K;  3HD7 D;  1MV8 A;  4Y99 C;  2E43 A;  1NTM K;  1GW3 A;  2QM8 A;  1JCC A;  1JTH A;  2OYI B;  4C7N A;  5APQ A;  4OH8 B;  1RE3 A;  2CPB A;  3L36 A;  3NTN A;  2L5G B;  2Z4E A;  1FZB A;  1X8Y A;  3PP5 A;  1LT9 B;  5AW8 B;  4EIJ A;  1VDF A;  3TYY A;  2A45 I;  2NPS C;  1GDT A;  2XU6 A;  2I1J A;  2GUV A;  1ZLL A;  1N73 C;  5APX A;  1FZE A;  1JOC A;  1RF0 A;  1HVV A;  1CI6 B;  1L0L K;  4ZKP A;  2H8P D;  3A2A A;  4AQR D;  1CSB A;  3HD7 C;  2HOD B;  4C46 A;  4AYC A;  1RE3 C;  3U1A A;  3SWF A;  1DX7 A;  2N9B A;  3VMY A;  5CHX A;  2H43 A;  1HGV A;  4O9B A;  2H7H A;  1KZU B;  3G3Z A;  1FJK A;  1RF1 C;  4I2L C;  3KDP B;  3L35 A;  1IO4 A;  5AW6 B;  3HUS B;  3L37 A;  2Q5U A;  2FXM A;  3B5N D;  1G1J A;  4M3L A;  2C0X A;  1H89 A;  3B5N B;  5KJ7 C;  3CLQ A;  1RE4 A;  3M0D C;  3RK2 C;  3CL3 D;  3RL0 D;  3VOP A;  1L4A C;  1E5W A;  1T2K D;  1VPC A;  3OJA B;  1LT9 A;  3P8M C;  2HYN A;  5CCH D;  2XNX A;  2M8R A;  2KOG A;  1JTH B;  1NOH A;  3U1C A;  1A02 J;  3VTP C;  1FZC A;  2P1J A;  1NH4 A;  3RK3 B;  1ZV8 A;  1SQX K;  3HE4 A;  2Q7C A;  2LKM A;  4GKG A;  1GL2 B;  2W6B A;  4DOJ A;  2YKQ A;  2WTY A;  1J1E C;  4Y99 B;  1JY2 O;  5BVZ A;  2KP8 A;  1FDM A;  5AVS B;  3N7N A;  5APU A;  4N78 D;  1KFN A;  1OWA A;  2OAR A;  2OYI C;  5APS A;  5AW2 B;  4IFD K;  1QL2 A;  1LTT C;  2OYH B;  1SQQ K;  2FYU K;  2Z5H A;  5BU8 B;  1HUC A;  4KHX A;  4W80 A;  3P8C D;  3TSI A;  3IFM A;  1LT9 C;  2P7J A;  1JMM A;  1DEB A;  4N78 E;  4WB4 A;  3VYI A;  1FZF A;  2O1J A;  2YO3 A;  1LTJ B;  3M0A A;  1GU4 A;  1FOS E;  2KYV A;  1FJP A;  3BAS A;  3KYQ A;  3LID A;  1CI6 A;  1N73 B;  1J1D B;  3I5C A;  1LTJ A;  1N86 A;  3M06 A;  2C0W A;  3B5N A;  3V4Q A;  3LW5 H;  3TNU B;  2WSE H;  1X9V A;  1W2E A;  2M3B A;  4N6J A;  4LGD E;  1X79 B;  3MTU E;  3HD7 B;  1N7S A;  1ZR2 A;  2W27 A;  1LTG C;  3H32 A;  5APY A;  3BAT A;  2OYH A;  1FBM A;  2BAS A;  3KPE A;  3BRT B;  1GTW A;  2Q9I A;  2YKO A;  2YNY A;  4LC1 A;  1HTL C;  1SQB K;  1SFC C;  1RF1 B;  1IFN A;  2WPQ A;  3M9Q A;  5AW3 B;  2WWW A;  3HD7 A;  4HH2 A;  2WIT A;  2J59 M;  1LTA C;  1LTI C;  3OA7 A;  5AVV B;  5KTB A;  3B5N C;  3LIE A;  3HE5 B;  2WT7 B;  2HG5 D;  1G1I A;  1G2C B;  1N7S B;  3NMD A;  2A45 G;  1H8A A;  3RK2 B;  3CI9 A;  5CJ4 A;  2O01 H;  1H88 A;  1L4A B;  1L0N K;  2WT7 A;  3O8Z A;  4AUW A;  2E42 A;  1AQ5 A;  4WY4 D;  2W6A A;  3EFG A;  2KSJ A;  1G2C A;  1IFD A;  2WPR A;  5APT A;  1M1J B;  1J1D C;  2MJZ A;  1GL2 A;  5AVR B;  1JNM A;  2XKM A;  1GL2 C;  1KQL A;  1J1E B;  1QL1 A;  3OAK A;  5AW9 B;  4W7Z A;  1JO5 A;  1RF1 A;  2N1T C;  3H32 B;  2OYH C;  2IPP A;  5KJ7 D;  1JY3 O;  3M91 A;  4RES B;  1KIL D;  2R32 A;  1KIL B;  3TNU A;  3RK2 D;  3RL0 C;  1CZQ A;  3H6P A;  1NKN A;  2NPS D;  4I1L A;  3UIA A;  5AVT B;  4DZO A;  5AVW B;  2I1K A;  1SLQ A;  3MIW A;  1LTJ C;  3SWY A;  2JJL A;  1RE4 C;  2HFE D;  3VN0 A;  1JY2 P;  1GW4 A;  5AVQ B;  1MUU A;  1XTC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...