2FXMA

Structure of the human beta-myosin s2 fragment
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
126
structure length
126
Chain Sequence
PLLKSAEREKEMASMKEEFTRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELTLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myosin heavy chain, cardiac muscle beta isoform
publication title Crystal structures of human cardiac {beta}-myosin II S2-{Delta} provide insight into the functional role of the S2 subfragment
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 61
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2fxmA00
3N7NA 4GIFA 2FXMA 3U1AA 1IC2A 3C9IA 2JEEA 2POHA 4ZKUA 3BATA 5BVZA 4N3YB 3N4XA 1X79B 4ZKPA 3VP9A 3P8CD 1NKNA 4O9BA 5KTBA 4N78D 3VP8A 3U1CA 1WT6A 5BU8B 3HRNA 3U59A 4I1LA 3BASA 5BU5A 3OJAB
chains in the Genus database with same CATH superfamily
1SQXK 3L71D 3RL0D 3L75G 3GF3A 1MZ9A 1S72P 3Q5PA 1KD1Q 2KK7A 1NO4A 1J1EB 3RBXA 1LT9B 1T8ZA 2YIUB 2FKWB 2FYUJ 4WB4A 1IFIA 2UWJE 4CPGA 3H1KJ 1LTJA 4D6TJ 3Q2YA 1HGVA 4L73A 4GDOA 4JYCA 1JTHB 4K3AA 3NTNA 1T2KC 1IFJA 3FGAD 1L0NE 2VRSA 1M1JA 1AVYA 1VQ6P 3PHLA 3HE4A 3V2NA 2ITAA 1J1EC 2WSCJ 2FYUD 2GUVA 1K04A 1LT9C 3MZWB 2YIUC 1L4AD 4D6TD 2ZJSE 4DT0A 1X8YA 1RE3A 1L4AA 3H1LE 4DZOA 1LTGC 2O3JA 3A0HH 2JO1A 1YTZT 2O01H 3I56P 1OW7A 3M0DC 1NH4A 1SQPK 3MIWA 1BDDA 1JOCA 4UB8E 1S4XA 2MJZA 4PD4D 2JEEA 1Q90D 1VQ7P 5AVYB 3HTKA 1FOSF 5KKZB 2QEXP 1X79B 3H1HJ 3O6QB 4AUWA 3F5HA 1VQ9P 1VF5D 2FXPA 1VQKP 1PP9E 1QL1A 1YJWP 2W90A 1SFCB 1N7SB 4NPDA 1SQBD 2C0WA 5CCHC 2JWDA 2M0BA 2I1KA 1LTSC 3H1LG 2YKQA 4I1LA 5CMZA 4OGQD 3BCCG 4GODA 1S5LX 3H32B 1VQ4P 2V7QH 3VTPC 1SLQA 3LIEA 5KKZC 1FDMA 3L70J 1VDFA 2B88A 1SQXJ 1S9KE 1JMBA 1GL2B 5CCGD 1H8AA 3M06A 1EC5A 2K88A 1SFCC 1N7SC 5CCGA 1BGYG 5CJ0A 2HR3A 3CX5E 3AEDC 3L36A 2AXTH 5GTIH 2ZT9D 3KXDA 1PZQA 1RF1B 2CPSA 1EQ7A 1NKNA 4U7JA 5TJHA 3JC22 2QJPC 1NTZK 3L70D 3CPWO 1EXJA 1SQXD 5APYA 4I2LC 1YQ4C 3CCRP 1SQQE 4BXLA 3PLNA 1HGZA 1EZVE 4RESB 3E7KA 1GL2C 1AVOA 4RO0A 1NTMG 3P8MC 1K8AQ 4R4MA 2E76D 1PL5A 2WSFH 1IO4A 2E75B 1RF1C 5GTHE 3CWBE 3AEAC 1IFNA 3M0AA 1PP9D 3MUDA 5BU8B 1KB9I 3H1JE 1DD4A 3BASA 2M5AA 4DOJA 4C7NA 2QVAA 2K1AA 5AVVB 1RY3A 2JDIH 1SQPJ 2FY8A 4I6MC 2ZYDA 3W67A 4RJTA 1WMKA 1SQQG 1JNMA 3FXEA 5KTBA 5B66H 5AW4B 1VQPP 1CW5A 1GW4A 3B8EB 1NTZE 1RE4A 4OH8B 3L72G 2IYOA 2E75C 1P84H 3JSVC 1HJ0A 3EWKA 3RK2B 3GLMA 1U57A 1LJ2A 1LP1A 1R8EA 1SQPD 1EDIA 3OA7A 1AV1A 3CC4P 5KAFH 3Q1MA 2YKOA 3G4SP 1JY3P 3BRTB 1IK9A 1FBMA 2PGDA 2WQYC 3OJAB 2K9JA 1FZAA 1S2EA 2QRXA 3GW6A 1S1CX 2MKVA 5KJ7D 2Z5IA 2QJYC 3JCUE 2J58A 3AE7C 2OGUA 3RK2C 2BEQD 4UB6E 3TSIA 2RH0A 5M1BA 3L74J 4KT0J 1J2JB 1JEKA 5KJ7A 3P32A 3CXHH 2K3RA 1AJYA 3Q3DA 1CI6A 4BRYA 1ZLLA 2WPQA 2POHA 2XKMA 1GZLA 2WT7B 1FZBA 1NU1J 2D2CD 1ZV8A 2N1TD 2QJKB 3A2AA 2FYZA 3H1JD 4PV1D 1T3JA 2FBWC 1BCCJ 1VQMP 5AW9B 2JJLA 5B5EE 3CC7P 1KILE 1KQLA 1SQVK 1HBWA 4GOEA 3VP9A 1YITP 1RF0C 1KMIZ 4N78D 1FDIA 1N7LA 4YTPC 4ZKUA 3V2PA 2A06D 1NTZD 3N7NA 1H89A 1GMJA 1OXZA 1H88A 3V4WA 2KIKA 3PH0A 4L75A 2QJKC 1AQTA 2BASA 1G2CA 1JY3N 4IL6E 4H13B 1PPJG 2Q3EA 5E79H 4H44D 1LTTC 3RK3E 1N73A 1TU3F 2LR2A 4L76A 4EOTA 2HPCB 3CX5I 4U3FE 3G6EP 1IZNB 2OQQA 1M8OB 3AEBC 2OYIB 3OW2O 1KYOH 1YBKA 4IFFA 3PP5A 4KJMA 1EZVI 1GK6A 2O1KA 3P8CD 4O9BA 1MV8A 4H13C 3RGUA 3L71G 2FYUE 3H1KE 2KS1A 1QL2A 3VMAA 3FWNA 4D6TE 3SFEC 2YMKA 3GMAA 1JY2P 4WY4D 2R3SA 3RL0B 5KAIE 1S5LH 3QH9A 1USDA 1EXIA 1NAYA 1H0TA 4WY4A 3KQGA 1GTWA 2OYIC 4DCKA 4TT3H 2B89A 1LGHB 2ZXEB 1W2BO 2ZYAA 3MP7B 1LT1A 2SPZA 3BATA 1LTJB 2L5GB 1QVFO 4PD4E 3F89A 3NFQA 3L4FA 2IPPA 3VYIA 5KLVJ 2AXCA 2O01J 2OYHB 2IFMA 3G9RA 4K35A 1M1JB 1ZW0A 3HE4B 2FYUG 1KQFB 3TDKA 3CCSP 1X22A 2H43A 2WVRA 1SQBE 3RL0C 2W6AA 1Y47A 1SQVJ 3RK3D 3W68A 2H88C 2WZ7A 3M91A 1LTJC 3A5TA 1VPCA 1YIJP 4JBZA 4A7PA 4U3FD 3HE5A 1L4AB 5AVTB 3H1HE 2OYHC 3TNUA 1FOSE 1E79H 2ZFCA 1OZHA 1N86A 1M1JC 2OARA 1KC8Q 3IFMA 4B86A 4GIFA 5H2FE 3L75J 2YXQB 1J1DB 1KQSO 4EIJA 2V7QJ 4XFJA 1OMIA 3G3ZA 1T2KD 4PJ0H 1JY2N 3I55P 1QGKB 2HG5D 1SQVD 1QVGO 3VOPA 3H1KD 2R5BA 2OTLP 1URQD 1EDLA 1SQBG 1K9MQ 2OTJP 1RE3C 4MN4C 1L4AC 3L70E 1VF5B 1URQA 1SQXE 2M8RA 3H6PA 5B66E 5APVA 5CHXA 2P67A 3BRVB 3L75D 1BDCA 2PAJA 2KLUA 1LT9A 1FS0E 1ZXGA 1J1DC 3B4SA 2HFED 1FDOA 1L0NG 1NTMK 1NWQA 2A45G 2Y9ZA 4OGQB 1PFIA 4Y28J 2IBZD 3GHGA 3FXDA 4IFMA 1KV4A 2J5UA 5KAFE 4IFDK 2H89C 3Q5RA 1VF5C 2G3AA 2WSFJ 1Y9BA 3CCEP 3CMAP 1OVUA 3L70G 2QM7A 2C9NY 1SQXG 2ZVOB 2ZT9B 5AW8B 3T97A 2OYOA 2C0XA 4OVNF 1OVVA 3H1HD 2IYPA 4OGQC 1Q86Q 3D6YA 3WU2H 1JO5A 1EDJA 2FYNB 1Q7YQ 1RQUA 3CCLP 5TISE 2WITA 5CCGC 2HODA 1NOHA 1SQPE 1ZP0C 4WBAA 3C1LA 1PP9G 1FZFA 1WRGA 1SP4A 1MFTA 1IFMA 3EFFK 2ZT9C 2E76B 3PJSK 1KB9H 2M5AB 3BCCJ 1NU1K 5AVUB 2AEFA 4C7NB 1KFMA 5AVSB 1D7MA 2B87A 2N9BA 4R4LA 5AVZB 2FYNC 4W7ZA 4C7RA 2XDJA 1YJNP 1HVVA 2QIWA 1BGYJ 3U1AA 1A02F 1Z56A 1SQPG 3BCCD 1PGJA 1Q2NA 4PD4I 1FJPA 2M3BA 3D70A 2E76C 2IDBA 1OW8A 1LP1B 2FFDA 5E79E 1RHZB 1YQ3C 3PRJA 5AW1B 3L37A 2E74D 1JY2O 2E42A 5AVXB 3CLQA 2QA4P 1NTMJ 1EZVG 2QE7H 4ASWA 3TYYA 4N78E 2K9JB 1RE4C 1L0LK 1BSHA 2A06E 1NGMB 1NU1E 2KXPB 4XA4A 3CXHD 4N3YB 2XU6A 3SSUA 4IL6X 1YYCA 3WUTA 1IK7A 4EYYQ 2R5DA 2KZIA 1BCCE 3BVHA 3CWBG 2G8YA 1CI6B 3IR9A 4BRYB 3L35A 2E43A 4UB8H 2A45I 3TF5A 3H1JG 1NTMD 1UIIA 1YJ9P 4BWNA 3HUSA 1GW3A 2N1TB 4WWIA 1Q81Q 2KSEA 3L72J 3ABVC 1T6AA 4PV1B 2GM4A 2KP8A 2AEJA 2R32A 1LTBC 4AYCA 1DIPA 2LKMA 2NPSD 5KJ7C 2A06G 1NTZG 1EDKA 3A7OA 3SWKA 3P8CE 2NPSA 1ZN5A 3ITKA 1USEA 3RK2D 1HF9A 5KLVK 2IZ1A 4KHXA 5CBOA 3AE1C 1GD2E 3UIAA 3L72D 3AE4C 1G2CB 2WSSH 3H1IJ 2N1TC 4ZMDA 1NYHA 3TGUJ 2PP6A 3VMYA 4PV1C 2I1JA 2WSEH 1SVFA 2B9BA 1N73B 3L74D 2QSIA 1AFOA 2YNYA 3CX5H 4H44B 3V2QA 2O1JA 2Y9YA 2I8DA 3OAKA 2KUBA 1KYOD 1NTKK 2NRGA 1U7JA 1ZR2A 1M57D 1NU1D 2BCCJ 3HD7D 3SWFA 1KFNA 2FXOA 1AQ5A 1VQLP 1YI2P 2GUSA 1R5SA 3H1ID 3KYQA 3L73J 4GT1A 2XV5A 3CCVP 1OWAA 1VQ8P 3TGUD 3HD7A 1JUNA 3WUVA 1BCCD 5C39A 1VQOP 1AA0A 3NXSA 1FZCA 3EFGA 1RF0A 2YKPA 1G1IA 1Y8AA 2KS1B 4M3LA 1N73C 1XTGB 1KQGB 3C9IA 4JPZB 3D71A 4JQ0D 4GOFA 3A0HE 2Y0DA 1DEBA 1DEEG 4H44C 3B71A 1IFDA 1L0LJ 4H0LD 3WUUA 2BCCD 2KI7B 1JM0A 1H0TB 4WY4B 3L73D 1N8RQ 1M90Q 2PFXA 1CZQA 1PGPA 1NKZB 2E5TA 4HJGH 1KILB 2ZYGA 1ZRTD 1SQVE 2YO3A 3GF7A 1VQ5P 2W83C 4XE5B 1L0LD 2KNCA 1IJDB 1N2DC 3AE6C 1NHLA 2NZ2A 2R44A 2WTYA 4WY4C 3L75E 4U3FG 1HTLC 5APTA 5AW6B 1PPJD 1R5LA 2Y0EA 3HE5B 3RL0g 1DD3A 5KLIB 3RK3B 5AVQB 1KILC 1GK4A 1L0NK 3L71J 3S4RA 2YMYA 3VP8A 3I5CA 3R2PA 2XZRA 5AW2B 2IBZE 2AXTE 5GTIE 1SQVG 1BE3J 5AVWB 1X0TA 3KZIH 4QMAA 3H1KG 3JCUH 2LXBA 5APWA 5AW0B 2Z5HA 3GG2A 4D6TG 3FWLA 3USSA 3B5ND 1LWUA 4UB6H 5K5GB 5APSA 1WT6A 3AE3C 4LC1A 1FJKA 4EI2A 2Q5UA 3B5NA 5L8RJ 1CSBA 2JWAA 5KLVD 5KLIC 1URQB 3RK3C 1FAVA 3M9HA 1GU5A 1NTKJ 3CMEP 5APQA 1GU4A 1BE3D 3U59A 1FC2C 4DJGA 2FXMA 4N6JA 1KORA 3V5BA 1M7LA 2W6BA 4Z1MH 2Q9IA 1FZEA 2IBZG 5B5EH 3N4XA 3HTKB 3LW5H 2OYHA 2CK3H 3GHGB 2M3EA 1NVOA 2HLOA 3WMM0 1T3UA 1NTKD 3P7KA 4YPCA 1URQC 3FX0A 3E1RA 3VMXA 5DJTB 3RBZA 4ZKPA 2R3CA 1JCDA 1OIPA 4Y99B 3H1HG 1JY3O 1MFZA 2P1JA 3T97B 1KTMA 4IL6H 4YXDC 3C8VA 3H25A 1PIXA 4LLHA 2IX7C 1P84E 1RQVA 1KN7A 3AE5C 3VMZA 1JTHA 1LTIC 1SQBJ 3GHGC 1S3JA 3BCCE 3M0DA 3TK1A 2HODB 3Q5SA 3CCQP 4IOIH 2Y0CA 1PV3A 1MKMA 5AVRB 1KB9D 4L74A 2AEMA 1W2EA 3A0BH 4Y99C 1BGYE 3AEGC 1W5CE 2QG4A 1SQQK 1L0NJ 2B87B 5CCHD 4ZNCA 3CXHE 1K73Q 5CCHA 1OVRA 3VN0A 5KAIH 2QJPB 2ZAEB 2Z4EA 1ZOYC 3AEFC 3CCUP 2WPSA 4PD4H 1NTME 2BEZF 2WSCH 3H1LJ 1L0ND 1OW6A 1M1KQ 3KDPB 3O6QA 3R4YA 2FFDB 1SFCD 1N7SD 1OFCX 3M9BA 1RH5B 1DX7A 1KZUB 1N7SA 1SFCA 1XTCC 3IF4A 3CL3D 1VL2A 4OWFA 2E74B 4NPFX 3MD0A 1FE6A 3CD6P 2XNXA 1P84D 1PP9J 3H1LD 1GL2D 3H32A 1A02J 1GL2A 2FFDC 2IZ0A 3MUDC 2JR8A 3HRNA 3L72E 2H8PD 3EQ2A 2A45H 1DH3A 5H2FH 2IBZI 3SFDC 4HYTB 2P58A 3L74E 2OTKE 1BGYD 1RF1A 2E74C 3KPEA 3HUSB 1PGQA 3U1CA 2Q3IA 2WSEJ 2W27A 3AECC 1KYOE 5APUA 4YXWH 3D6ZA 3V4QA 3PTZA 3H1IE 3TGUE 1L2PA 2NPSB 4C46A 2E75D 1LTAC 1YTZI 2W8ZA 4HKZH 2QJYB 2XNDH 1S9KD 3AE9C 1SQQJ 1S5LE 1NJIQ 3HUSC 1MUUA 2WPRA 3L74G 5CBNA 1HWTC 4JYBA 2BCCE 3MTUE 3KHUA 2RMZA 2D2CB 1G1JA 2H7HA 3CX5D 1QX8A 3L73E 1ZR4A 4EDFA 3CI9A 3MHVA 2C9LY 3QWOC 2WWWA 1M56D 3CCMP 4ASVA 4WVZA 1NU1G 3V2RA 2HYNA 3CWBJ 2NPSC 3AEEC 2WMMA 1E5WA 3H1IG 4HB1A 5DJUB 1YHQP 1ZRTE 1SQQD 3H1JJ 3KZIE 2E5YA 1EZVD 3TGUG 3V6IA 5AW3B 1BCCG 1L0LE 1P84I 4JF7A 2L91A 3MGNA 3HD7B 2K37A 1FU1A 3ZDMA 1FZCB 2D2CC 2P7JA 4W80A 4LGDE 5TISH 5AW5B 3M9QA 2KB7P 2JKVA 1HJBA 4W7YA 5BVZA 2BCCG 2JP3A 3CWBD 1NTZJ 3NMDA 1PPJE 3AE8C 4GKGA 3L73G 1QEXA 2N9YB 4HH2A 1X9VA 2N1TA 1FZGA 1SS1A 2KOGA 3SWYA 4H0LB 5APXA 2V4HA 2Q6QA 4PJ0E 1Q82Q 3S9OA 4RKUJ 3HD7C 2FYUK 1ZMEC 3CC2P 2O01N 2YO2A 2YXRB 2K9YA 1FZCC 1PGOA 2J59M 1UIXA 1L0LG 2W6JH 1BSNA 3CXHI 1LNQA 3O8ZA 4TLFA 2P2UA 2KYVA 3L71E 2KNCB 5KLVE 2WT7A 1JB0J 2KZJA 5GTHH 5AW7B 5BU5A 3E1IA 4H0LC 1BE3E 2RN0A 3IN6A 3K5BA 1HH0A 1K05A 1GDTA 4NPEA 3G71P 1U7MA 5EFWB 2RKLA 1HUCA 2ZXXA 2DW3A 1SQBK 1NAFA 1NTKE 2LXCB 3A0BE 4H13D 1JMMA 3LIDA 4I7ZB 3LW5J 2P10A 3S1KA 1LWUB 2PRRA 2CPBA 5KLVG 1IFPA 2QM8A 3AE2C 2Q7CA 3B5NB 1IC2A 2WPVB 2IFNA 3WU2E 2HPCA 1BE3G 1JCCA 3TNUB 2KSJA 2GA1A 3A3YB 1VQNP 2ZVNB 3II6A 1KILD 2OYIA 2KLVA 4I7ZC 1QLED 1KYOI 1LWUC 1KB9E 1KILA 1NTKG 4U3FJ 5CJ4A 2Q1KA 1OX3A 3CCJP 3IAOA 4AQRD 3B5NC
chains in the Genus database with same CATH topology
4N78E 3N7NA 1H89A 1SQXK 1RE4C 1OXZA 1H88A 1L0LK 3V4WA 5CCHD 3RL0D 1MZ9A 4XA4A 4N3YB 2XU6A 1YYCA 1NO4A 1J1EB 5CCHA 3VN0A 2BASA 1G2CA 1JY3N 2R5DA 1LT9B 3BVHA 1T8ZA 2FKWB 4WB4A 1CI6B 1IFIA 3IR9A 3L35A 1LTTC 2Z4EA 2E43A 1N73A 2A45I 1LTJA 4EOTA 2HPCB 1HGVA 2WPSA 2WSCH 4JYCA 1JTHB 3KDPB 3NTNA 3HUSA 2FFDB 1T2KC 1SFCD 1N7SD 1IFJA 4AQRD 1GW3A 2VRSA 1M1JA 2N1TB 3M9BA 2OYIB 2GM4A 2KP8A 3HE4A 3V2NA 1DX7A 1KZUB 1N7SA 1SFCA 1XTCC 2R32A 3CL3D 1LTBC 4AYCA 2LKMA 4IFFA 2NPSD 3PP5A 1J1EC 5KJ7C 1GK6A 2O1KA 3P8CD 4O9BA 2GUVA 1MV8A 1LT9C 3A7OA 3MD0A 1L4AD 3P8CE 2NPSA 1ZN5A 3RK2D 1QL2A 2XNXA 5KLVK 1GL2D 4KHXA 1X8YA 1RE3A 1GD2E 3H32A 1L4AA 4DZOA 1JY2P 3UIAA 1A02J 4WY4D 1LTGC 1YTZT 2O01H 1GL2A 3M0DC 2FFDC 1NH4A 3RL0B 1G2CB 1SQPK 3MIWA 3HRNA 2N1TC 1JOCA 3KQGA 2PP6A 4WY4A 3VMYA 1GTWA 2OYIC 2H8PD 2I1JA 2MJZA 3EQ2A 2WSEH 2ZXEB 1LGHB 2JEEA 1SVFA 1N73B 2A45H 1DH3A 1AFOA 3BATA 1LTJB 2L5GB 2YNYA 5AVYB 3NFQA 3L4FA 2IPPA 4HYTB 3VYIA 3HTKA 1FOSF 2OYHB 1X79B 3V2QA 2O1JA 1RF1A 2IFMA 3KPEA 3HUSB 4AUWA 3U1CA 1M1JB 3OAKA 2Q3IA 1NTKK 1QL1A 1ZR2A 2W27A 3HD7D 3SWFA 3HE4B 1KFNA 1AQ5A 1SFCB 1N7SB 5APUA 2GUSA 3KYQA 4GT1A 2XV5A 1OWAA 3V4QA 2C0WA 2H43A 5CCHC 3RL0C 3HD7A 1JUNA 2I1KA 1LTSC 2W6AA 2YKQA 3NXSA 3EFGA 1FZCA 1RF0A 2YKPA 4I1LA 1G1IA 2NPSB 4C46A 5CMZA 3RK3D 4M3LA 1N73C 2WZ7A 1XTGB 3M91A 1LTJC 3C9IA 1LTAC 3A5TA 1YTZI 1VPCA 3H32B 1S9KD 3HE5A 1DEBA 1L4AB 1SLQA 3LIEA 5AVTB 3VTPC 1FDMA 2OYHC 3TNUA 1VDFA 1S9KE 1FOSE 1IFDA 3HUSC 2ZFCA 1GL2B 5CCGD 1N86A 1H8AA 1M1JC 1MUUA 3M06A 2OARA 2WPRA 1HWTC 4JYBA 3MTUE 4WY4B 3IFMA 1G1JA 2H7HA 4B86A 4GIFA 1J1DB 1SFCC 1N7SC 5CCGA 5CJ0A 1ZR4A 4EIJA 3L36A 3CI9A 2C9LY 1T2KD 3G3ZA 1CZQA 2WWWA 1JY2N 2HG5D 1NKZB 1RF1B 1KILB 2CPSA 1EQ7A 3V2RA 2HYNA 1NKNA 3VOPA 2NPSC 2R5BA 1URQD 2YO3A 1E5WA 1NTZK 4XE5B 5APYA 1RE3C 4I2LC 5AW3B 1L4AC 1URQA 1HGZA 2M8RA 4RESB 1IJDB 3H6PA 5APVA 4JF7A 1N2DC 1GL2C 5CHXA 3MGNA 2P67A 3HD7B 3BRVB 1NHLA 1FU1A 2PAJA 1FZCB 2WTYA 4WY4C 1LT9A 2P7JA 4W80A 1J1DC 4LGDE 2HFED 1HTLC 5AW5B 3P8MC 3M9QA 5APTA 5AW6B 2KB7P 1HJBA 1NTMK 4W7YA 5BVZA 1NWQA 3HE5B 2WSFH 2A45G 1IO4A 3RK3B 3NMDA 1RF1C 5AVQB 1PFIA 4GKGA 1KILC 1GK4A 1L0NK 1IFNA 2YMYA 3M0AA 3VP8A 3MUDA 5BU8B 3GHGA 4HH2A 1X9VA 3BASA 2N1TA 1FZGA 3I5CA 3R2PA 4IFMA 4DOJA 2XZRA 5AW2B 2KOGA 3SWYA 4C7NA 5AVVB 5APXA 1RY3A 4IFDK 5AVWB 4I6MC 3HD7C 2FYUK 5APWA 5AW0B 2Z5HA 2YO2A 3B5ND 1FZCC 1LWUA 2QM7A 1JNMA 2J59M 5KTBA 2C9NY 5APSA 1WT6A 5AW4B 4LC1A 5AW8B 1FJKA 3O8ZA 3T97A 2P2UA 2Q5UA 1CW5A 1GW4A 3B5NA 1CSBA 2C0XA 3B8EB 1RE4A 2KYVA 4OH8B 1URQB 3RK3C 1FAVA 3M9HA 2WT7A 1GU5A 1JO5A 3RK2B 5APQA 1GU4A 3U59A 5AW7B 5BU5A 3E1IA 2WITA 5CCGC 2HODA 1NOHA 3OA7A 2FXMA 4N6JA 4WBAA 3V5BA 1M7LA 2W6BA 1HH0A 1GDTA 1FZFA 2Q9IA 1FZEA 2YKOA 1WRGA 3N4XA 1SP4A 3HTKB 3LW5H 2OYHA 1IFMA 1JY3P 3BRTB 1IK9A 1FBMA 3GHGB 2HLOA 3OJAB 3WMM0 1NU1K 5AVUB 1T3UA 4C7NB 1FZAA 1KFMA 3P7KA 1HUCA 5AVSB 1URQC 5KJ7D 2Z5IA 1SQBK 1NAFA 2J58A 2N9BA 5AVZB 3RK2C 1JMMA 3VMXA 3LIDA 3TSIA 4ZKPA 2R3CA 1JCDA 4W7ZA 1LWUB 1J2JB 4C7RA 5KJ7A 2XDJA 3P32A 2CPBA 1HVVA 4Y99B 1JY3O 1MFZA 2P1JA 1CI6A 2QM8A 2Q7CA 1ZLLA 3U1AA 3B5NB 1A02F 1IC2A 2WPQA 2POHA 2XKMA 4LLHA 2IX7C 2IFNA 3V2PA 1GZLA 2HPCA 2WT7B 1Z56A 1FZBA 1JCCA 3TNUB 3VMZA 1ZV8A 2N1TD 2KSJA 1FJPA 2M3BA 3A2AA 1JTHA 2FYZA 1LTIC 3GHGC 1T3JA 3M0DA 2FFDA 3A3YB 3TK1A 2HODB 3II6A 1KILD 2JJLA 5AW9B 5AW1B 2OYIA 3L37A 2KLVA 5AVRB 1KQLA 1SQVK 1LWUC 1HBWA 1JY2O 2E42A 1KILA 5AVXB 3CLQA 1W2EA 3VP9A 4Y99C 1RF0C 5CJ4A 4N78D 1N7LA 4ZKUA 3TYYA 1SQQK 3B5NC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7N A;  4GIF A;  2FXM A;  3U1A A;  1IC2 A;  3C9I A;  2JEE A;  2POH A;  4ZKU A;  3BAT A;  5BVZ A;  4N3Y B;  3N4X A;  1X79 B;  4ZKP A;  3VP9 A;  3P8C D;  1NKN A;  4O9B A;  5KTB A;  4N78 D;  3VP8 A;  3U1C A;  1WT6 A;  5BU8 B;  3HRN A;  3U59 A;  4I1L A;  3BAS A;  5BU5 A;  3OJA B; 
#chains in the Genus database with same CATH topology
 1SQX K;  3L71 D;  3RL0 D;  3L75 G;  3GF3 A;  1MZ9 A;  1S72 P;  3Q5P A;  1KD1 Q;  2KK7 A;  1NO4 A;  1J1E B;  3RBX A;  1LT9 B;  1T8Z A;  2YIU B;  2FKW B;  2FYU J;  4WB4 A;  1IFI A;  2UWJ E;  4CPG A;  3H1K J;  1LTJ A;  4D6T J;  3Q2Y A;  1HGV A;  4L73 A;  4GDO A;  4JYC A;  1JTH B;  4K3A A;  3NTN A;  1T2K C;  1IFJ A;  3FGA D;  1L0N E;  2VRS A;  1M1J A;  1AVY A;  1VQ6 P;  3PHL A;  3HE4 A;  3V2N A;  2ITA A;  1J1E C;  2WSC J;  2FYU D;  2GUV A;  1K04 A;  1LT9 C;  3MZW B;  2YIU C;  1L4A D;  4D6T D;  2ZJS E;  4DT0 A;  1X8Y A;  1RE3 A;  1L4A A;  3H1L E;  4DZO A;  1LTG C;  2O3J A;  3A0H H;  2JO1 A;  1YTZ T;  2O01 H;  3I56 P;  1OW7 A;  3M0D C;  1NH4 A;  1SQP K;  3MIW A;  1BDD A;  1JOC A;  4UB8 E;  1S4X A;  2MJZ A;  4PD4 D;  2JEE A;  1Q90 D;  1VQ7 P;  5AVY B;  3HTK A;  1FOS F;  5KKZ B;  2QEX P;  1X79 B;  3H1H J;  3O6Q B;  4AUW A;  3F5H A;  1VQ9 P;  1VF5 D;  2FXP A;  1VQK P;  1PP9 E;  1QL1 A;  1YJW P;  2W90 A;  1SFC B;  1N7S B;  4NPD A;  1SQB D;  2C0W A;  5CCH C;  2JWD A;  2M0B A;  2I1K A;  1LTS C;  3H1L G;  2YKQ A;  4I1L A;  5CMZ A;  4OGQ D;  3BCC G;  4GOD A;  1S5L X;  3H32 B;  1VQ4 P;  2V7Q H;  3VTP C;  1SLQ A;  3LIE A;  5KKZ C;  1FDM A;  3L70 J;  1VDF A;  2B88 A;  1SQX J;  1S9K E;  1JMB A;  1GL2 B;  5CCG D;  1H8A A;  3M06 A;  1EC5 A;  2K88 A;  1SFC C;  1N7S C;  5CCG A;  1BGY G;  5CJ0 A;  2HR3 A;  3CX5 E;  3AED C;  3L36 A;  2AXT H;  5GTI H;  2ZT9 D;  3KXD A;  1PZQ A;  1RF1 B;  2CPS A;  1EQ7 A;  1NKN A;  4U7J A;  5TJH A;  3JC2 2;  2QJP C;  1NTZ K;  3L70 D;  3CPW O;  1EXJ A;  1SQX D;  5APY A;  4I2L C;  1YQ4 C;  3CCR P;  1SQQ E;  4BXL A;  3PLN A;  1HGZ A;  1EZV E;  4RES B;  3E7K A;  1GL2 C;  1AVO A;  4RO0 A;  1NTM G;  3P8M C;  1K8A Q;  4R4M A;  2E76 D;  1PL5 A;  2WSF H;  1IO4 A;  2E75 B;  1RF1 C;  5GTH E;  3CWB E;  3AEA C;  1IFN A;  3M0A A;  1PP9 D;  3MUD A;  5BU8 B;  1KB9 I;  3H1J E;  1DD4 A;  3BAS A;  2M5A A;  4DOJ A;  4C7N A;  2QVA A;  2K1A A;  5AVV B;  1RY3 A;  2JDI H;  1SQP J;  2FY8 A;  4I6M C;  2ZYD A;  3W67 A;  4RJT A;  1WMK A;  1SQQ G;  1JNM A;  3FXE A;  5KTB A;  5B66 H;  5AW4 B;  1VQP P;  1CW5 A;  1GW4 A;  3B8E B;  1NTZ E;  1RE4 A;  4OH8 B;  3L72 G;  2IYO A;  2E75 C;  1P84 H;  3JSV C;  1HJ0 A;  3EWK A;  3RK2 B;  3GLM A;  1U57 A;  1LJ2 A;  1LP1 A;  1R8E A;  1SQP D;  1EDI A;  3OA7 A;  1AV1 A;  3CC4 P;  5KAF H;  3Q1M A;  2YKO A;  3G4S P;  1JY3 P;  3BRT B;  1IK9 A;  1FBM A;  2PGD A;  2WQY C;  3OJA B;  2K9J A;  1FZA A;  1S2E A;  2QRX A;  3GW6 A;  1S1C X;  2MKV A;  5KJ7 D;  2Z5I A;  2QJY C;  3JCU E;  2J58 A;  3AE7 C;  2OGU A;  3RK2 C;  2BEQ D;  4UB6 E;  3TSI A;  2RH0 A;  5M1B A;  3L74 J;  4KT0 J;  1J2J B;  1JEK A;  5KJ7 A;  3P32 A;  3CXH H;  2K3R A;  1AJY A;  3Q3D A;  1CI6 A;  4BRY A;  1ZLL A;  2WPQ A;  2POH A;  2XKM A;  1GZL A;  2WT7 B;  1FZB A;  1NU1 J;  2D2C D;  1ZV8 A;  2N1T D;  2QJK B;  3A2A A;  2FYZ A;  3H1J D;  4PV1 D;  1T3J A;  2FBW C;  1BCC J;  1VQM P;  5AW9 B;  2JJL A;  5B5E E;  3CC7 P;  1KIL E;  1KQL A;  1SQV K;  1HBW A;  4GOE A;  3VP9 A;  1YIT P;  1RF0 C;  1KMI Z;  4N78 D;  1FDI A;  1N7L A;  4YTP C;  4ZKU A;  3V2P A;  2A06 D;  1NTZ D;  3N7N A;  1H89 A;  1GMJ A;  1OXZ A;  1H88 A;  3V4W A;  2KIK A;  3PH0 A;  4L75 A;  2QJK C;  1AQT A;  2BAS A;  1G2C A;  1JY3 N;  4IL6 E;  4H13 B;  1PPJ G;  2Q3E A;  5E79 H;  4H44 D;  1LTT C;  3RK3 E;  1N73 A;  1TU3 F;  2LR2 A;  4L76 A;  4EOT A;  2HPC B;  3CX5 I;  4U3F E;  3G6E P;  1IZN B;  2OQQ A;  1M8O B;  3AEB C;  2OYI B;  3OW2 O;  1KYO H;  1YBK A;  4IFF A;  3PP5 A;  4KJM A;  1EZV I;  1GK6 A;  2O1K A;  3P8C D;  4O9B A;  1MV8 A;  4H13 C;  3RGU A;  3L71 G;  2FYU E;  3H1K E;  2KS1 A;  1QL2 A;  3VMA A;  3FWN A;  4D6T E;  3SFE C;  2YMK A;  3GMA A;  1JY2 P;  4WY4 D;  2R3S A;  3RL0 B;  5KAI E;  1S5L H;  3QH9 A;  1USD A;  1EXI A;  1NAY A;  1H0T A;  4WY4 A;  3KQG A;  1GTW A;  2OYI C;  4DCK A;  4TT3 H;  2B89 A;  1LGH B;  2ZXE B;  1W2B O;  2ZYA A;  3MP7 B;  1LT1 A;  2SPZ A;  3BAT A;  1LTJ B;  2L5G B;  1QVF O;  4PD4 E;  3F89 A;  3NFQ A;  3L4F A;  2IPP A;  3VYI A;  5KLV J;  2AXC A;  2O01 J;  2OYH B;  2IFM A;  3G9R A;  4K35 A;  1M1J B;  1ZW0 A;  3HE4 B;  2FYU G;  1KQF B;  3TDK A;  3CCS P;  1X22 A;  2H43 A;  2WVR A;  1SQB E;  3RL0 C;  2W6A A;  1Y47 A;  1SQV J;  3RK3 D;  3W68 A;  2H88 C;  2WZ7 A;  3M91 A;  1LTJ C;  3A5T A;  1VPC A;  1YIJ P;  4JBZ A;  4A7P A;  4U3F D;  3HE5 A;  1L4A B;  5AVT B;  3H1H E;  2OYH C;  3TNU A;  1FOS E;  1E79 H;  2ZFC A;  1OZH A;  1N86 A;  1M1J C;  2OAR A;  1KC8 Q;  3IFM A;  4B86 A;  4GIF A;  5H2F E;  3L75 J;  2YXQ B;  1J1D B;  1KQS O;  4EIJ A;  2V7Q J;  4XFJ A;  1OMI A;  3G3Z A;  1T2K D;  4PJ0 H;  1JY2 N;  3I55 P;  1QGK B;  2HG5 D;  1SQV D;  1QVG O;  3VOP A;  3H1K D;  2R5B A;  2OTL P;  1URQ D;  1EDL A;  1SQB G;  1K9M Q;  2OTJ P;  1RE3 C;  4MN4 C;  1L4A C;  3L70 E;  1VF5 B;  1URQ A;  1SQX E;  2M8R A;  3H6P A;  5B66 E;  5APV A;  5CHX A;  2P67 A;  3BRV B;  3L75 D;  1BDC A;  2PAJ A;  2KLU A;  1LT9 A;  1FS0 E;  1ZXG A;  1J1D C;  3B4S A;  2HFE D;  1FDO A;  1L0N G;  1NTM K;  1NWQ A;  2A45 G;  2Y9Z A;  4OGQ B;  1PFI A;  4Y28 J;  2IBZ D;  3GHG A;  3FXD A;  4IFM A;  1KV4 A;  2J5U A;  5KAF E;  4IFD K;  2H89 C;  3Q5R A;  1VF5 C;  2G3A A;  2WSF J;  1Y9B A;  3CCE P;  3CMA P;  1OVU A;  3L70 G;  2QM7 A;  2C9N Y;  1SQX G;  2ZVO B;  2ZT9 B;  5AW8 B;  3T97 A;  2OYO A;  2C0X A;  4OVN F;  1OVV A;  3H1H D;  2IYP A;  4OGQ C;  1Q86 Q;  3D6Y A;  3WU2 H;  1JO5 A;  1EDJ A;  2FYN B;  1Q7Y Q;  1RQU A;  3CCL P;  5TIS E;  2WIT A;  5CCG C;  2HOD A;  1NOH A;  1SQP E;  1ZP0 C;  4WBA A;  3C1L A;  1PP9 G;  1FZF A;  1WRG A;  1SP4 A;  1MFT A;  1IFM A;  3EFF K;  2ZT9 C;  2E76 B;  3PJS K;  1KB9 H;  2M5A B;  3BCC J;  1NU1 K;  5AVU B;  2AEF A;  4C7N B;  1KFM A;  5AVS B;  1D7M A;  2B87 A;  2N9B A;  4R4L A;  5AVZ B;  2FYN C;  4W7Z A;  4C7R A;  2XDJ A;  1YJN P;  1HVV A;  2QIW A;  1BGY J;  3U1A A;  1A02 F;  1Z56 A;  1SQP G;  3BCC D;  1PGJ A;  1Q2N A;  4PD4 I;  1FJP A;  2M3B A;  3D70 A;  2E76 C;  2IDB A;  1OW8 A;  1LP1 B;  2FFD A;  5E79 E;  1RHZ B;  1YQ3 C;  3PRJ A;  5AW1 B;  3L37 A;  2E74 D;  1JY2 O;  2E42 A;  5AVX B;  3CLQ A;  2QA4 P;  1NTM J;  1EZV G;  2QE7 H;  4ASW A;  3TYY A;  4N78 E;  2K9J B;  1RE4 C;  1L0L K;  1BSH A;  2A06 E;  1NGM B;  1NU1 E;  2KXP B;  4XA4 A;  3CXH D;  4N3Y B;  2XU6 A;  3SSU A;  4IL6 X;  1YYC A;  3WUT A;  1IK7 A;  4EYY Q;  2R5D A;  2KZI A;  1BCC E;  3BVH A;  3CWB G;  2G8Y A;  1CI6 B;  3IR9 A;  4BRY B;  3L35 A;  2E43 A;  4UB8 H;  2A45 I;  3TF5 A;  3H1J G;  1NTM D;  1UII A;  1YJ9 P;  4BWN A;  3HUS A;  1GW3 A;  2N1T B;  4WWI A;  1Q81 Q;  2KSE A;  3L72 J;  3ABV C;  1T6A A;  4PV1 B;  2GM4 A;  2KP8 A;  2AEJ A;  2R32 A;  1LTB C;  4AYC A;  1DIP A;  2LKM A;  2NPS D;  5KJ7 C;  2A06 G;  1NTZ G;  1EDK A;  3A7O A;  3SWK A;  3P8C E;  2NPS A;  1ZN5 A;  3ITK A;  1USE A;  3RK2 D;  1HF9 A;  5KLV K;  2IZ1 A;  4KHX A;  5CBO A;  3AE1 C;  1GD2 E;  3UIA A;  3L72 D;  3AE4 C;  1G2C B;  2WSS H;  3H1I J;  2N1T C;  4ZMD A;  1NYH A;  3TGU J;  2PP6 A;  3VMY A;  4PV1 C;  2I1J A;  2WSE H;  1SVF A;  2B9B A;  1N73 B;  3L74 D;  2QSI A;  1AFO A;  2YNY A;  3CX5 H;  4H44 B;  3V2Q A;  2O1J A;  2Y9Y A;  2I8D A;  3OAK A;  2KUB A;  1KYO D;  1NTK K;  2NRG A;  1U7J A;  1ZR2 A;  1M57 D;  1NU1 D;  2BCC J;  3HD7 D;  3SWF A;  1KFN A;  2FXO A;  1AQ5 A;  1VQL P;  1YI2 P;  2GUS A;  1R5S A;  3H1I D;  3KYQ A;  3L73 J;  4GT1 A;  2XV5 A;  3CCV P;  1OWA A;  1VQ8 P;  3TGU D;  3HD7 A;  1JUN A;  3WUV A;  1BCC D;  5C39 A;  1VQO P;  1AA0 A;  3NXS A;  1FZC A;  3EFG A;  1RF0 A;  2YKP A;  1G1I A;  1Y8A A;  2KS1 B;  4M3L A;  1N73 C;  1XTG B;  1KQG B;  3C9I A;  4JPZ B;  3D71 A;  4JQ0 D;  4GOF A;  3A0H E;  2Y0D A;  1DEB A;  1DEE G;  4H44 C;  3B71 A;  1IFD A;  1L0L J;  4H0L D;  3WUU A;  2BCC D;  2KI7 B;  1JM0 A;  1H0T B;  4WY4 B;  3L73 D;  1N8R Q;  1M90 Q;  2PFX A;  1CZQ A;  1PGP A;  1NKZ B;  2E5T A;  4HJG H;  1KIL B;  2ZYG A;  1ZRT D;  1SQV E;  2YO3 A;  3GF7 A;  1VQ5 P;  2W83 C;  4XE5 B;  1L0L D;  2KNC A;  1IJD B;  1N2D C;  3AE6 C;  1NHL A;  2NZ2 A;  2R44 A;  2WTY A;  4WY4 C;  3L75 E;  4U3F G;  1HTL C;  5APT A;  5AW6 B;  1PPJ D;  1R5L A;  2Y0E A;  3HE5 B;  3RL0 g;  1DD3 A;  5KLI B;  3RK3 B;  5AVQ B;  1KIL C;  1GK4 A;  1L0N K;  3L71 J;  3S4R A;  2YMY A;  3VP8 A;  3I5C A;  3R2P A;  2XZR A;  5AW2 B;  2IBZ E;  2AXT E;  5GTI E;  1SQV G;  1BE3 J;  5AVW B;  1X0T A;  3KZI H;  4QMA A;  3H1K G;  3JCU H;  2LXB A;  5APW A;  5AW0 B;  2Z5H A;  3GG2 A;  4D6T G;  3FWL A;  3USS A;  3B5N D;  1LWU A;  4UB6 H;  5K5G B;  5APS A;  1WT6 A;  3AE3 C;  4LC1 A;  1FJK A;  4EI2 A;  2Q5U A;  3B5N A;  5L8R J;  1CSB A;  2JWA A;  5KLV D;  5KLI C;  1URQ B;  3RK3 C;  1FAV A;  3M9H A;  1GU5 A;  1NTK J;  3CME P;  5APQ A;  1GU4 A;  1BE3 D;  3U59 A;  1FC2 C;  4DJG A;  2FXM A;  4N6J A;  1KOR A;  3V5B A;  1M7L A;  2W6B A;  4Z1M H;  2Q9I A;  1FZE A;  2IBZ G;  5B5E H;  3N4X A;  3HTK B;  3LW5 H;  2OYH A;  2CK3 H;  3GHG B;  2M3E A;  1NVO A;  2HLO A;  3WMM 0;  1T3U A;  1NTK D;  3P7K A;  4YPC A;  1URQ C;  3FX0 A;  3E1R A;  3VMX A;  5DJT B;  3RBZ A;  4ZKP A;  2R3C A;  1JCD A;  1OIP A;  4Y99 B;  3H1H G;  1JY3 O;  1MFZ A;  2P1J A;  3T97 B;  1KTM A;  4IL6 H;  4YXD C;  3C8V A;  3H25 A;  1PIX A;  4LLH A;  2IX7 C;  1P84 E;  1RQV A;  1KN7 A;  3AE5 C;  3VMZ A;  1JTH A;  1LTI C;  1SQB J;  3GHG C;  1S3J A;  3BCC E;  3M0D A;  3TK1 A;  2HOD B;  3Q5S A;  3CCQ P;  4IOI H;  2Y0C A;  1PV3 A;  1MKM A;  5AVR B;  1KB9 D;  4L74 A;  2AEM A;  1W2E A;  3A0B H;  4Y99 C;  1BGY E;  3AEG C;  1W5C E;  2QG4 A;  1SQQ K;  1L0N J;  2B87 B;  5CCH D;  4ZNC A;  3CXH E;  1K73 Q;  5CCH A;  1OVR A;  3VN0 A;  5KAI H;  2QJP B;  2ZAE B;  2Z4E A;  1ZOY C;  3AEF C;  3CCU P;  2WPS A;  4PD4 H;  1NTM E;  2BEZ F;  2WSC H;  3H1L J;  1L0N D;  1OW6 A;  1M1K Q;  3KDP B;  3O6Q A;  3R4Y A;  2FFD B;  1SFC D;  1N7S D;  1OFC X;  3M9B A;  1RH5 B;  1DX7 A;  1KZU B;  1N7S A;  1SFC A;  1XTC C;  3IF4 A;  3CL3 D;  1VL2 A;  4OWF A;  2E74 B;  4NPF X;  3MD0 A;  1FE6 A;  3CD6 P;  2XNX A;  1P84 D;  1PP9 J;  3H1L D;  1GL2 D;  3H32 A;  1A02 J;  1GL2 A;  2FFD C;  2IZ0 A;  3MUD C;  2JR8 A;  3HRN A;  3L72 E;  2H8P D;  3EQ2 A;  2A45 H;  1DH3 A;  5H2F H;  2IBZ I;  3SFD C;  4HYT B;  2P58 A;  3L74 E;  2OTK E;  1BGY D;  1RF1 A;  2E74 C;  3KPE A;  3HUS B;  1PGQ A;  3U1C A;  2Q3I A;  2WSE J;  2W27 A;  3AEC C;  1KYO E;  5APU A;  4YXW H;  3D6Z A;  3V4Q A;  3PTZ A;  3H1I E;  3TGU E;  1L2P A;  2NPS B;  4C46 A;  2E75 D;  1LTA C;  1YTZ I;  2W8Z A;  4HKZ H;  2QJY B;  2XND H;  1S9K D;  3AE9 C;  1SQQ J;  1S5L E;  1NJI Q;  3HUS C;  1MUU A;  2WPR A;  3L74 G;  5CBN A;  1HWT C;  4JYB A;  2BCC E;  3MTU E;  3KHU A;  2RMZ A;  2D2C B;  1G1J A;  2H7H A;  3CX5 D;  1QX8 A;  3L73 E;  1ZR4 A;  4EDF A;  3CI9 A;  3MHV A;  2C9L Y;  3QWO C;  2WWW A;  1M56 D;  3CCM P;  4ASV A;  4WVZ A;  1NU1 G;  3V2R A;  2HYN A;  3CWB J;  2NPS C;  3AEE C;  2WMM A;  1E5W A;  3H1I G;  4HB1 A;  5DJU B;  1YHQ P;  1ZRT E;  1SQQ D;  3H1J J;  3KZI E;  2E5Y A;  1EZV D;  3TGU G;  3V6I A;  5AW3 B;  1BCC G;  1L0L E;  1P84 I;  4JF7 A;  2L91 A;  3MGN A;  3HD7 B;  2K37 A;  1FU1 A;  3ZDM A;  1FZC B;  2D2C C;  2P7J A;  4W80 A;  4LGD E;  5TIS H;  5AW5 B;  3M9Q A;  2KB7 P;  2JKV A;  1HJB A;  4W7Y A;  5BVZ A;  2BCC G;  2JP3 A;  3CWB D;  1NTZ J;  3NMD A;  1PPJ E;  3AE8 C;  4GKG A;  3L73 G;  1QEX A;  2N9Y B;  4HH2 A;  1X9V A;  2N1T A;  1FZG A;  1SS1 A;  2KOG A;  3SWY A;  4H0L B;  5APX A;  2V4H A;  2Q6Q A;  4PJ0 E;  1Q82 Q;  3S9O A;  4RKU J;  3HD7 C;  2FYU K;  1ZME C;  3CC2 P;  2O01 N;  2YO2 A;  2YXR B;  2K9Y A;  1FZC C;  1PGO A;  2J59 M;  1UIX A;  1L0L G;  2W6J H;  1BSN A;  3CXH I;  1LNQ A;  3O8Z A;  4TLF A;  2P2U A;  2KYV A;  3L71 E;  2KNC B;  5KLV E;  2WT7 A;  1JB0 J;  2KZJ A;  5GTH H;  5AW7 B;  5BU5 A;  3E1I A;  4H0L C;  1BE3 E;  2RN0 A;  3IN6 A;  3K5B A;  1HH0 A;  1K05 A;  1GDT A;  4NPE A;  3G71 P;  1U7M A;  5EFW B;  2RKL A;  1HUC A;  2ZXX A;  2DW3 A;  1SQB K;  1NAF A;  1NTK E;  2LXC B;  3A0B E;  4H13 D;  1JMM A;  3LID A;  4I7Z B;  3LW5 J;  2P10 A;  3S1K A;  1LWU B;  2PRR A;  2CPB A;  5KLV G;  1IFP A;  2QM8 A;  3AE2 C;  2Q7C A;  3B5N B;  1IC2 A;  2WPV B;  2IFN A;  3WU2 E;  2HPC A;  1BE3 G;  1JCC A;  3TNU B;  2KSJ A;  2GA1 A;  3A3Y B;  1VQN P;  2ZVN B;  3II6 A;  1KIL D;  2OYI A;  2KLV A;  4I7Z C;  1QLE D;  1KYO I;  1LWU C;  1KB9 E;  1KIL A;  1NTK G;  4U3F J;  5CJ4 A;  2Q1K A;  1OX3 A;  3CCJ P;  3IAO A;  4AQR D;  3B5N C; 
#chains in the Genus database with same CATH homology
 4N78 E;  3N7N A;  1H89 A;  1SQX K;  1RE4 C;  1OXZ A;  1H88 A;  1L0L K;  3V4W A;  5CCH D;  3RL0 D;  1MZ9 A;  4XA4 A;  4N3Y B;  2XU6 A;  1YYC A;  1NO4 A;  1J1E B;  5CCH A;  3VN0 A;  2BAS A;  1G2C A;  1JY3 N;  2R5D A;  1LT9 B;  3BVH A;  1T8Z A;  2FKW B;  4WB4 A;  1CI6 B;  1IFI A;  3IR9 A;  3L35 A;  1LTT C;  2Z4E A;  2E43 A;  1N73 A;  2A45 I;  1LTJ A;  4EOT A;  2HPC B;  1HGV A;  2WPS A;  2WSC H;  4JYC A;  1JTH B;  3KDP B;  3NTN A;  3HUS A;  2FFD B;  1T2K C;  1SFC D;  1N7S D;  1IFJ A;  4AQR D;  1GW3 A;  2VRS A;  1M1J A;  2N1T B;  3M9B A;  2OYI B;  2GM4 A;  2KP8 A;  3HE4 A;  3V2N A;  1DX7 A;  1KZU B;  1N7S A;  1SFC A;  1XTC C;  2R32 A;  3CL3 D;  1LTB C;  4AYC A;  2LKM A;  4IFF A;  2NPS D;  3PP5 A;  1J1E C;  5KJ7 C;  1GK6 A;  2O1K A;  3P8C D;  4O9B A;  2GUV A;  1MV8 A;  1LT9 C;  3A7O A;  3MD0 A;  1L4A D;  3P8C E;  2NPS A;  1ZN5 A;  3RK2 D;  1QL2 A;  2XNX A;  5KLV K;  1GL2 D;  4KHX A;  1X8Y A;  1RE3 A;  1GD2 E;  3H32 A;  1L4A A;  4DZO A;  1JY2 P;  3UIA A;  1A02 J;  4WY4 D;  1LTG C;  1YTZ T;  2O01 H;  1GL2 A;  3M0D C;  2FFD C;  1NH4 A;  3RL0 B;  1G2C B;  1SQP K;  3MIW A;  3HRN A;  2N1T C;  1JOC A;  3KQG A;  2PP6 A;  4WY4 A;  3VMY A;  1GTW A;  2OYI C;  2H8P D;  2I1J A;  2MJZ A;  3EQ2 A;  2WSE H;  2ZXE B;  1LGH B;  2JEE A;  1SVF A;  1N73 B;  2A45 H;  1DH3 A;  1AFO A;  3BAT A;  1LTJ B;  2L5G B;  2YNY A;  5AVY B;  3NFQ A;  3L4F A;  2IPP A;  4HYT B;  3VYI A;  3HTK A;  1FOS F;  2OYH B;  1X79 B;  3V2Q A;  2O1J A;  1RF1 A;  2IFM A;  3KPE A;  3HUS B;  4AUW A;  3U1C A;  1M1J B;  3OAK A;  2Q3I A;  1NTK K;  1QL1 A;  1ZR2 A;  2W27 A;  3HD7 D;  3SWF A;  3HE4 B;  1KFN A;  1AQ5 A;  1SFC B;  1N7S B;  5APU A;  2GUS A;  3KYQ A;  4GT1 A;  2XV5 A;  1OWA A;  3V4Q A;  2C0W A;  2H43 A;  5CCH C;  3RL0 C;  3HD7 A;  1JUN A;  2I1K A;  1LTS C;  2W6A A;  2YKQ A;  3NXS A;  3EFG A;  1FZC A;  1RF0 A;  2YKP A;  4I1L A;  1G1I A;  2NPS B;  4C46 A;  5CMZ A;  3RK3 D;  4M3L A;  1N73 C;  2WZ7 A;  1XTG B;  3M91 A;  1LTJ C;  3C9I A;  1LTA C;  3A5T A;  1YTZ I;  1VPC A;  3H32 B;  1S9K D;  3HE5 A;  1DEB A;  1L4A B;  1SLQ A;  3LIE A;  5AVT B;  3VTP C;  1FDM A;  2OYH C;  3TNU A;  1VDF A;  1S9K E;  1FOS E;  1IFD A;  3HUS C;  2ZFC A;  1GL2 B;  5CCG D;  1N86 A;  1H8A A;  1M1J C;  1MUU A;  3M06 A;  2OAR A;  2WPR A;  1HWT C;  4JYB A;  3MTU E;  4WY4 B;  3IFM A;  1G1J A;  2H7H A;  4B86 A;  4GIF A;  1J1D B;  1SFC C;  1N7S C;  5CCG A;  5CJ0 A;  1ZR4 A;  4EIJ A;  3L36 A;  3CI9 A;  2C9L Y;  1T2K D;  3G3Z A;  1CZQ A;  2WWW A;  1JY2 N;  2HG5 D;  1NKZ B;  1RF1 B;  1KIL B;  2CPS A;  1EQ7 A;  3V2R A;  2HYN A;  1NKN A;  3VOP A;  2NPS C;  2R5B A;  1URQ D;  2YO3 A;  1E5W A;  1NTZ K;  4XE5 B;  5APY A;  1RE3 C;  4I2L C;  5AW3 B;  1L4A C;  1URQ A;  1HGZ A;  2M8R A;  4RES B;  1IJD B;  3H6P A;  5APV A;  4JF7 A;  1N2D C;  1GL2 C;  5CHX A;  3MGN A;  2P67 A;  3HD7 B;  3BRV B;  1NHL A;  1FU1 A;  2PAJ A;  1FZC B;  2WTY A;  4WY4 C;  1LT9 A;  2P7J A;  4W80 A;  1J1D C;  4LGD E;  2HFE D;  1HTL C;  5AW5 B;  3P8M C;  3M9Q A;  5APT A;  5AW6 B;  2KB7 P;  1HJB A;  1NTM K;  4W7Y A;  5BVZ A;  1NWQ A;  3HE5 B;  2WSF H;  2A45 G;  1IO4 A;  3RK3 B;  3NMD A;  1RF1 C;  5AVQ B;  1PFI A;  4GKG A;  1KIL C;  1GK4 A;  1L0N K;  1IFN A;  2YMY A;  3M0A A;  3VP8 A;  3MUD A;  5BU8 B;  3GHG A;  4HH2 A;  1X9V A;  3BAS A;  2N1T A;  1FZG A;  3I5C A;  3R2P A;  4IFM A;  4DOJ A;  2XZR A;  5AW2 B;  2KOG A;  3SWY A;  4C7N A;  5AVV B;  5APX A;  1RY3 A;  4IFD K;  5AVW B;  4I6M C;  3HD7 C;  2FYU K;  5APW A;  5AW0 B;  2Z5H A;  2YO2 A;  3B5N D;  1FZC C;  1LWU A;  2QM7 A;  1JNM A;  2J59 M;  5KTB A;  2C9N Y;  5APS A;  1WT6 A;  5AW4 B;  4LC1 A;  5AW8 B;  1FJK A;  3O8Z A;  3T97 A;  2P2U A;  2Q5U A;  1CW5 A;  1GW4 A;  3B5N A;  1CSB A;  2C0X A;  3B8E B;  1RE4 A;  2KYV A;  4OH8 B;  1URQ B;  3RK3 C;  1FAV A;  3M9H A;  2WT7 A;  1GU5 A;  1JO5 A;  3RK2 B;  5APQ A;  1GU4 A;  3U59 A;  5AW7 B;  5BU5 A;  3E1I A;  2WIT A;  5CCG C;  2HOD A;  1NOH A;  3OA7 A;  2FXM A;  4N6J A;  4WBA A;  3V5B A;  1M7L A;  2W6B A;  1HH0 A;  1GDT A;  1FZF A;  2Q9I A;  1FZE A;  2YKO A;  1WRG A;  3N4X A;  1SP4 A;  3HTK B;  3LW5 H;  2OYH A;  1IFM A;  1JY3 P;  3BRT B;  1IK9 A;  1FBM A;  3GHG B;  2HLO A;  3OJA B;  3WMM 0;  1NU1 K;  5AVU B;  1T3U A;  4C7N B;  1FZA A;  1KFM A;  3P7K A;  1HUC A;  5AVS B;  1URQ C;  5KJ7 D;  2Z5I A;  1SQB K;  1NAF A;  2J58 A;  2N9B A;  5AVZ B;  3RK2 C;  1JMM A;  3VMX A;  3LID A;  3TSI A;  4ZKP A;  2R3C A;  1JCD A;  4W7Z A;  1LWU B;  1J2J B;  4C7R A;  5KJ7 A;  2XDJ A;  3P32 A;  2CPB A;  1HVV A;  4Y99 B;  1JY3 O;  1MFZ A;  2P1J A;  1CI6 A;  2QM8 A;  2Q7C A;  1ZLL A;  3U1A A;  3B5N B;  1A02 F;  1IC2 A;  2WPQ A;  2POH A;  2XKM A;  4LLH A;  2IX7 C;  2IFN A;  3V2P A;  1GZL A;  2HPC A;  2WT7 B;  1Z56 A;  1FZB A;  1JCC A;  3TNU B;  3VMZ A;  1ZV8 A;  2N1T D;  2KSJ A;  1FJP A;  2M3B A;  3A2A A;  1JTH A;  2FYZ A;  1LTI C;  3GHG C;  1T3J A;  3M0D A;  2FFD A;  3A3Y B;  3TK1 A;  2HOD B;  3II6 A;  1KIL D;  2JJL A;  5AW9 B;  5AW1 B;  2OYI A;  3L37 A;  2KLV A;  5AVR B;  1KQL A;  1SQV K;  1LWU C;  1HBW A;  1JY2 O;  2E42 A;  1KIL A;  5AVX B;  3CLQ A;  1W2E A;  3VP9 A;  4Y99 C;  1RF0 C;  5CJ4 A;  4N78 D;  1N7L A;  4ZKU A;  3TYY A;  1SQQ K;  3B5N C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...