2FXMA

Structure of the human beta-myosin s2 fragment
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
126
structure length
126
Chain Sequence
PLLKSAEREKEMASMKEEFTRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELTLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Contractile protein
molecule keywords Myosin heavy chain, cardiac muscle beta isoform
publication title Crystal structures of human cardiac {beta}-myosin II S2-{Delta} provide insight into the functional role of the S2 subfragment
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2fxmA00
3P8CD 4ZKUA 4ZKPA 1NKNA 2FXMA 3OJAB 3N4XA 4GIFA 1WT6A 4N3YB 5BU8B 3VP9A 3BATA 1X79B 3HRNA 3VP8A 3BASA 4I1LA 4O9BA 2POHA 3C9IA 3U1CA 1IC2A 5KTBA 4N78D 3U59A 5BVZA 5BU5A 3N7NA 3U1AA 2JEEA
chains in the Genus database with same CATH superfamily
1PFIA 1LP1B 1SQQJ 3CD6P 3D71A 4U3FJ 3WUTA 1GD2E 1NAYA 1GK4A 1VQ7P 4L73A 2UWJE 3RBXA 1Q82Q 1GK6A 4GODA 3JSVC 2XU6A 1IC2A 5KAIH 3P32A 1Q2NA 3RK2C 3KYQA 2QA4P 1T2KD 4HKZH 3A3YB 3WU2E 3A0HE 3KZIH 4IFFA 4AQRD 1N2DC 3H1KD 1JNMA 2O01N 1M90Q 3D70A 1G2CB 3KQGA 1ZMEC 1L4AD 4AUWA 2SPZA 1LWUB 3CWBD 3MD0A 5CMZA 3CLQA 3KHUA 1CI6B 2QJYB 2IZ1A 2QJPC 1VQ8P 1JY3O 2E76C 3CCUP 3L75E 1NWQA 4UB6H 2Q5UA 1RY3A 5AVZB 1BGYD 3VOPA 1U7JA 1K04A 1NTMG 3WMM0 3CX5E 1KTMA 3RL0g 1N7SD 2MKVA 2W6AA 4EOTA 3B71A 1OIPA 2KS1A 1IFMA 2Y9YA 1URQB 2RMZA 2FYUD 5APQA 2I1JA 2J59M 3M0AA 2M8RA 2DW3A 1UIXA 3IF4A 1FJPA 1UIIA 4B86A 3QWOC 4UB8E 1AVOA 1OVVA 1FDOA 3H1IJ 1CSBA 4MN4C 1AQ5A 1JTHB 1KQLA 4DCKA 1DX7A 3H1JJ 2YO2A 1AJYA 5KTBA 2QVAA 1G2CA 3L74G 1NYHA 4PD4E 3V2QA 2IYOA 2Q7CA 1SQBE 2D2CD 1X9VA 1MKMA 5AW6B 3OJAB 3Q5RA 1J1DB 3KPEA 1N8RQ 1PV3A 2FYUK 3LIEA 4W80A 2AXCA 3B5NB 2ZJSE 3RGUA 1X22A 3D6YA 1JY2N 1EZVD 3JCUH 3L70G 1SQQD 5H2FH 1URQA 4N3YB 4JBZA 4K3AA 3AEEC 3HE4A 5KJ7D 1BCCE 3L73J 1S4XA 1YTZI 3GLMA 5APTA 1BE3E 1EC5A 3MZWB 5GTHH 4H0LD 1DEBA 1ZN5A 2LKMA 1SFCB 1LT9B 2GUSA 4H44C 2OYIC 2OTKE 1JTHA 2H89C 3AE3C 1EDKA 2KXPB 1PPJE 4GKGA 1L0NJ 2PRRA 2W90A 2N1TD 5AW4B 5APXA 1P84D 1MZ9A 2YKPA 3F89A 2QM8A 2ZXEB 1HTLC 1SQQK 1DIPA 1RE3C 1NGMB 2JDIH 4R4MA 5AVTB 2KYVA 3MUDA 2Q3EA 1NTKJ 4XFJA 2WITA 3AE4C 2E5TA 4PV1B 2ZVOB 5AW5B 1Z56A 1N73B 1JY3N 3BCCE 3T97A 4EYYQ 2YXQB 1M1JB 2YKQA 1KZUB 1HVVA 1KMIZ 1HH0A 3H1KE 1SQXG 2V7QH 3EQ2A 3CWBE 2JWAA 4KJMA 5CJ4A 3AE1C 4ZKPA 2KP8A 1D7MA 3P8MC 5AVUB 1JB0J 2ZXXA 3A2AA 1SQVD 3HUSA 3H1HJ 3EWKA 3VTPC 3ZDMA 3AEBC 1URQD 2FFDC 5GTIH 2FYUE 2FBWC 1KN7A 1SS1A 4H13C 2G3AA 4WY4B 3G3ZA 2C9LY 2B89A 3SFDC 1NU1J 1FU1A 1QX8A 1OVRA 2POHA 1DD3A 3L73D 2QM7A 2QJPB 2E76B 1LTJC 5E79H 2Q1KA 2BCCG 4C46A 1SQPJ 3PHLA 3GMAA 1YQ3C 2Q6QA 3M9QA 2GM4A 4IL6X 1FC2C 1KILE 1VQOP 3GF3A 4OGQC 4RKUJ 5KLVG 2G8YA 2M5AB 4PJ0E 3B5ND 1PIXA 3OW2O 1VQLP 1AFOA 3SFEC 4D6TJ 1IFDA 5CCGA 2VRSA 1GL2B 2KNCB 1SQQE 1VPCA 1NTKD 4U3FE 3AE9C 1OX3A 1X0TA 4Y28J 2Z5HA 3CCEP 4I6MC 2HODB 2XNXA 2A06D 1WRGA 3HTKA 4XE5B 2IBZE 1L0LJ 1PP9G 5BVZA 1SFCD 2Z4EA 3G4SP 2H7HA 4BRYB 2YKOA 1S5LH 1L0NK 2KIKA 1FZCC 1MUUA 3NFQA 5AVXB 3V4QA 1X8YA 1HGZA 3OAKA 3P8CE 1FZGA 2Q3IA 5APWA 1YTZT 2AXTE 4PD4D 1P84E 1NTMJ 1SQBD 3E1IA 4DT0A 2K9JA 3CL3D 3L72G 1NTKK 2V7QJ 5B66E 2E75C 4W7YA 2YNYA 1EDLA 5L8RJ 2WSEH 1RH5B 1QLED 1PL5A 4PV1D 2HLOA 4WB4A 1JUNA 2QE7H 3II6A 3BRVB 3FXEA 1GTWA 1GL2A 2KNCA 3QH9A 2PFXA 1AVYA 1N7SA 1PZQA 3E7KA 1H0TB 3CMAP 2LR2A 2R44A 3H1IE 1BCCD 4U7JA 1WMKA 3V2NA 3GHGC 1BE3D 1JY2O 2KLUA 1SQPD 3HUSC 3H1JE 2O3JA 1J1EB 2AEJA 4A7PA 3L74J 3D6ZA 3HD7A 3VMYA 2KUBA 3MTUE 2FXOA 2OQQA 1NTZJ 3A0BE 2H8PD 3H25A 1KYOH 3FGAD 2XNDH 3CXHI 3BVHA 3TNUA 4KHXA 3L4FA 1KILA 1NU1K 4WY4D 4YXDC 4JF7A 1BSNA 1PPJG 2K88A 4HH2A 1HUCA 4LC1A 1YHQP 4Y99C 3L73E 2E76D 2JP3A 3RK3C 3TGUJ 1FZEA 1RF1A 1SQPK 1T8ZA 1L0LD 3Q1MA 3CCJP 1OMIA 3CXHH 3BCCD 5AW2B 3E1RA 1M7LA 1Y47A 5KJ7A 4IFMA 1QVFO 2FFDB 4TT3H 3C9IA 1XTCC 5KAIE 1L0NE 3GW6A 2ZT9C 2XKMA 1GW4A 4H13B 2ZYDA 3KZIE 1FDIA 2GUVA 5DJTB 2FY8A 1KQGB 4EIJA 1KC8Q 1X79B 5APVA 1VQNP 2NRGA 2QEXP 3H1KG 1GL2D 1KORA 2E74B 1LTJB 3PH0A 4RESB 3V2RA 4GT1A 3I56P 1HBWA 2CK3H 1JMBA 2JR8A 2N1TA 1K73Q 1NTKE 5CCHC 1S72P 3PTZA 1L0LK 3HE5B 4UB6E 1KB9I 1OW7A 5M1BA 1S2EA 1G1JA 2A06E 1T2KC 3G6EP 1VL2A 2E42A 1IFPA 1LP1A 1BGYG 4DOJA 2NZ2A 4OGQB 3CCSP 1VF5D 4JYBA 2WSEJ 2H43A 4NPEA 1L4AC 1L2PA 3HD7D 1NKNA 3WUUA 2FXPA 1JEKA 3TYYA 2FYUG 3CCMP 2GA1A 1NTMK 1NJIQ 3O8ZA 2ITAA 2QJKC 5AVWB 2KB7P 1KB9H 1NTZD 1LWUA 1KILD 3RL0B 2H88C 1FZFA 1CI6A 3B4SA 1JCCA 1QL2A 5AW9B 1N7SC 3H1HE 1Q7YQ 1NHLA 2N9BA 2FYNB 2NPSC 1ZRTD 5B5EH 3Q3DA 3AEDC 1FZCB 2IDBA 2WPVB 2P7JA 1GMJA 3CCQP 2E5YA 1XTGB 5AW0B 3FX0A 3VMXA 3PJSK 4U3FD 1IO4A 3H32B 3TGUD 3BASA 1M56D 2O1JA 3K5BA 2BCCJ 4L75A 2RKLA 2IBZD 3CC7P 3JCUE 1KQSO 1SQPE 5H2FE 1EZVG 2V4HA 1OZHA 1NTZK 2E75B 3I55P 2XZRA 1SQQG 3LIDA 3PP5A 2M0BA 3VP9A 2ZAEB 3VP8A 5C39A 1SP4A 4HYTB 2BEQD 4Z1MH 5KLVJ 2KSJA 1ZW0A 3P8CD 5GTHE 1HF9A 1N7LA 1LGHB 2Y0DA 1AA0A 4WBAA 1RE4A 4BWNA 4D6TE 3F5HA 1EQ7A 3PRJA 1NO4A 2M3BA 5EFWB 5APYA 1Q90D 3GHGB 2OYHB 3B5NA 5KJ7C 4ASVA 3S9OA 3VMZA 5CJ0A 2AEMA 2KZJA 3M9HA 1MFZA 1M1KQ 5BU8B 2P10A 3W67A 1PP9J 4O9BA 1L0LE 1FZBA 3OA7A 2WT7B 3EFGA 3N7NA 3H1ID 1YYCA 2CPBA 3MGNA 3H1JD 1LT1A 1SFCA 1LT9A 4RO0A 5KLIB 2B9BA 4OH8B 2W6BA 1IFIA 2A45G 1KFNA 2HR3A 3L37A 2ZFCA 2O01H 4TLFA 4I2LC 1NTME 4L74A 3SWKA 3VMAA 3L72J 3CCRP 4YPCA 3RK3B 1H88A 2E74D 1K8AQ 1K9MQ 3NTNA 3RK2B 3L71J 3W68A 5KAFH 1LTTC 2RH0A 2KK7A 2OYHA 3O6QB 4DJGA 5TISH 1JMMA 4OGQD 2ZT9B 1FJKA 1SQVG 5AVQB 5GTIE 2BCCD 1LWUC 2QIWA 1N73A 5BU5A 1NOHA 2WPRA 1RF0A 4JPZB 1EXJA 2OTLP 1EZVI 1A02F 2LXBA 1M1JA 1QGKB 3H1LJ 3MIWA 4HB1A 5TJHA 2YMYA 3RL0D 4N78D 5KLVD 1NTZE 1E79H 3BRTB 3FWNA 1L0ND 3L73G 3AE6C 5E79E 2B88A 3CXHD 1FDMA 2RN0A 1ZOYC 1CW5A 1URQC 2I1KA 2IX7C 1FS0E 1ZRTE 1E5WA 2K3RA 1GW3A 4GDOA 1W5CE 4NPDA 2P58A 3S1KA 3USSA 3AE2C 2FXMA 3JC22 1GU4A 2WVRA 1VQ9P 3TGUE 2BEZF 1MV8A 2QJKB 4WY4A 3L75G 1YJNP 4IL6H 1OWAA 2E75D 2R3SA 3EFFK 4OWFA 5DJUB 5KLVK 2P1JA 1NTKG 2QSIA 3S4RA 2NPSB 2AEFA 1J1DC 2IFMA 1RQUA 2JWDA 4EI2A 3ABVC 1QEXA 2A06G 5APUA 3MUDC 1VDFA 1S5LE 2IFNA 1W2EA 1ZR2A 3H1HD 2M5AA 2P67A 1IZNB 3L71D 3CC4P 1FBMA 1EDIA 4C7NB 1Q86Q 1PGOA 4H44B 1HGVA 2OYIB 2O01J 1BGYJ 1T3JA 4BXLA 1LT9C 1NU1D 1SQBG 1KYOI 5AW7B 3CC2P 4YXWH 3V2PA 3IR9A 4M3LA 2HODA 2XDJA 3TF5A 2WSCH 2YMKA 5K5GB 1M8OB 3M9BA 4BRYA 3H1LD 3H6PA 1H89A 5KKZC 2K1AA 3TSIA 3RK3D 4ZKUA 4W7ZA 1BCCG 4KT0J 3VN0A 3RK2D 1VQ4P 3C1LA 1BE3G 4D6TD 1LTAC 4ZNCA 2JO1A 1DEEG 3L70J 4GOEA 2ZT9D 3UIAA 1KYOE 1M1JC 3C8VA 1K05A 4C7RA 2OYIA 1BDDA 1U57A 3SWFA 2KS1B 2R3CA 2BCCE 3U59A 4HJGH 2LXCB 3CX5I 2W83C 1H0TA 1KQFB 1PGJA 3WU2H 3A0HH 3CCLP 5CCHD 3LW5H 4N78E 5KLVE 5CCGC 1RHZB 1RE3A 2M3EA 3TK1A 1N86A 3CXHE 1L0LG 4YTPC 1MFTA 1AQTA 3G9RA 2WZ7A 3BCCG 1NTMD 5CBOA 4WY4C 4L76A 3Q5PA 1FE6A 3CX5H 2K9YA 3CWBG 4PD4I 1YBKA 4OVNF 1PP9E 4UB8H 2QG4A 2I8DA 2IZ0A 3IAOA 4QMAA 1IFNA 1HJBA 3HE4B 3NMDA 1SQXJ 2NPSD 3A5TA 3CPWO 4CPGA 1IK7A 1KD1Q 4R4LA 2KOGA 4EDFA 2WPSA 3L74D 2YO3A 1YJ9P 2FFDA 4PD4H 1ZXGA 3AEAC 1A02J 3L72E 1BSHA 2WQYC 2FKWB 1GL2C 2WSCJ 3AE7C 1FZAA 1SLQA 4I1LA 3L71E 1YQ4C 1FOSE 4H44D 1NAFA 1EXIA 1KB9E 3L70D 2WMMA 1LTJA 2YIUC 1NTZG 1R8EA 2ZYGA 1NU1E 4XA4A 1SQVJ 1VF5C 3HE5A 2PAJA 1USEA 1KFMA 5AW1B 3HD7C 3MP7B 3M0DA 2WPQA 5B5EE 3SSUA 1JM0A 3FXDA 2QRXA 3B8EB 2OARA 2KSEA 1NKZB 4ZMDA 4JYCA 3L36A 2WWWA 4GOFA 1IFJA 3H1LE 1TU3F 3T97B 3AE8C 4U3FG 1KILC 2D2CC 2Y9ZA 3TGUG 5APSA 3RK3E 3G71P 3I5CA 2JKVA 3NXSA 2B87B 4I7ZC 1PGQA 1S1CX 2IBZG 3V5BA 3BATA 2R5BA 1ZR4A 1RF1C 2W6JH 2L5GB 3AEGC 3LW5J 2ZVNB 5AVSB 2PP6A 4AYCA 3HUSB 1QVGO 3P7KA 3PLNA 3Q5SA 1FZCA 5KKZB 3L75J 5AW3B 3KXDA 2N9YB 1J1EC 3CMEP 4H0LC 1M57D 1OFCX 3V6IA 1PGPA 3H32A 1IJDB 1SQXD 1WT6A 1OW8A 4H13D 1SVFA 1OW6A 1YJWP 2N1TC 1USDA 1JOCA 2P2UA 3V4WA 2IPPA 4Y99B 4JQ0D 1S9KD 3H1IG 1GU5A 3R4YA 2B87A 1KV4A 2O1KA 2IYPA 3RBZA 2R32A 3H1JG 3TDKA 1VQ6P 5CHXA 1BGYE 3GHGA 4ASWA 1ZV8A 1SQBJ 2WSFH 1KYOD 5CBNA 1U7MA 3KDPB 1SQXK 2OYOA 1AV1A 1YI2P 1LJ2A 2CPSA 2W8ZA 3CI9A 5KAFE 2R5DA 2WSSH 2BASA 2ZYAA 2WT7A 2XV5A 2QJYC 2HPCB 3HTKB 5TISE 4GIFA 4LGDE 1LTBC 3L74E 3FWLA 1JO5A 4DZOA 2J58A 2MJZA 3M91A 1BCCJ 1JCDA 2E74C 2HG5D 1NH4A 5AVVB 1DD4A 2IBZI 4PJ0H 1BE3J 1Y9BA 3VYIA 1VQ5P 2HFED 3AEFC 1YIJP 1J2JB 3M0DC 2C0WA 1ZLLA 2C9NY 3L70E 1SQVK 2Q9IA 1L4AB 2K9JB 1L0NG 1NVOA 1S5LX 1CZQA 2C0XA 3L75D 3SWYA 1GZLA 1BDCA 2Z5IA 1P84I 1PP9D 3O6QA 3CX5D 1EZVE 3ITKA 1VQMP 3L35A 1IK9A 4NPFX 1YITP 1N7SB 2HYNA 1RE4C 1OVUA 3IFMA 2OTJP 4WWIA 3N4XA 3RL0C 1H8AA 4K35A 5AW8B 1R5SA 2KI7B 2HPCA 1VQKP 2K37A 1LTGC 2OGUA 2YIUB 4IL6E 2A45I 1LNQA 3B5NC 2AXTH 2FYNC 3BCCJ 3AE5C 1P84H 5CCHA 2E43A 3L72D 1VF5B 5AVRB 1S3JA 2KLVA 3H1KJ 3HD7B 5B66H 3MHVA 3CWBJ 4RJTA 1JY2P 2PGDA 2JEEA 1KB9D 1G1IA 1L4AA 3TNUB 3GF7A 2FYZA 1KILB 2D2CB 2A45H 1SFCC 4N6JA 3H1HG 2KZIA 1HJ0A 1VQPP 4I7ZB 2WTYA 1LTIC 2YXRB 1SQXE 1ZP0C 1W2BO 2Y0EA 3L71G 2JJLA 3WUVA 2FYUJ 1QL1A 1RF1B 1T6AA 1OXZA 3GG2A 1R5LA 2WSFJ 3HRNA 3U1CA 3A7OA 3Q2YA 1NU1G 1FAVA 4LLHA 1DH3A 2NPSA 1Q81Q 3A0BH 1S9KE 2OYHC 2Y0CA 1RQVA 1LTSC 2W27A 4WVZA 2J5UA 1GDTA 4H0LB 3CCVP 1SQPG 1SQBK 4PV1C 2L91A 3H1LG 3M06A 1N73C 1PPJD 1RF0C 1T3UA 5CCGD 4IFDK 3AECC 1SQVE 1FOSF 4C7NA 2N1TB 3R2PA 1Y8AA 1EDJA 1HWTC 1JY3P 4D6TG 3IN6A 4IOIH 5KLIC 3U1AA 5AVYB
chains in the Genus database with same CATH topology
2Z4EA 2O01H 2H7HA 1PFIA 4I2LC 1LTJA 2YKOA 1L0NK 1FZCC 1MUUA 3RK3B 3NFQA 1H88A 5AVXB 1GD2E 4XA4A 1GK4A 3V4QA 1X8YA 3NTNA 3HE5A 3RK2B 1GK6A 1HGZA 2PAJA 2XU6A 1IC2A 3P32A 1KFMA 5AW1B 3HD7C 3OAKA 3M0DA 3P8CE 2WPQA 1FZGA 3RK2C 2Q3IA 3KYQA 5APWA 1T2KD 1YTZT 3B8EB 2OARA 1LTTC 1NKZB 3A3YB 4JYCA 3L36A 2WWWA 2OYHA 4IFFA 1IFJA 4AQRD 3E1IA 1N2DC 1JMMA 1JNMA 3CL3D 1NTKK 1G2CB 3KQGA 1L4AD 4AUWA 1LWUB 3MD0A 5CMZA 1KILC 4W7YA 1FJKA 2YNYA 3CLQA 2WSEH 1CI6B 5APSA 5AVQB 1LWUC 1N73A 5BU5A 1NOHA 2WPRA 1RF0A 3I5CA 1JY3O 2HLOA 3NXSA 4WB4A 1JUNA 3II6A 3BRVB 1NWQA 1GTWA 2Q5UA 1GL2A 1RY3A 5AVZB 3V5BA 1A02F 1M1JA 3VOPA 3BATA 1N7SA 2R5BA 1ZR4A 3WMM0 1RF1C 2L5GB 3MIWA 2YMYA 1N7SD 3RL0D 4N78D 3BRTB 4EOTA 2W6AA 5AVSB 2PP6A 1IFMA 4AYCA 1URQB 3HUSB 3P7KA 3V2NA 3GHGC 1FDMA 5APQA 2I1JA 2J59M 1JY2O 1CW5A 1URQC 3M0AA 3HUSC 2I1KA 1FZCA 2M8RA 1J1EB 1FJPA 5AW3B 4B86A 2IX7C 1J1EC 1E5WA 1GW3A 3H32A 3HD7A 3VMYA 3MTUE 1CSBA 1IJDB 2H8PD 1AQ5A 1JTHB 2FXMA 1KQLA 1GU4A 1DX7A 1WT6A 1MV8A 4WY4A 3BVHA 1SVFA 2YO2A 3TNUA 4KHXA 3L4FA 5KTBA 1KILA 1NU1K 2N1TC 4WY4D 1G2CA 1OWAA 3V2QA 1JOCA 4JF7A 2P2UA 2IPPA 4Y99B 2Q7CA 3V4WA 4HH2A 5KLVK 1X9VA 1S9KD 1HUCA 4LC1A 2P1JA 4Y99C 5AW6B 3OJAB 1J1DB 1GU5A 3KPEA 2NPSB 2FYUK 3LIEA 4W80A 2O1KA 3RK3C 1J1DC 3B5NB 1FZEA 2IFMA 1RF1A 1SQPK 1T8ZA 2R32A 1JY2N 5APUA 5CHXA 5AW2B 1VDFA 1M7LA 5KJ7A 3GHGA 2IFNA 1ZV8A 1W2EA 4IFMA 1ZR2A 2WSFH 1URQA 4N3YB 3KDPB 1SQXK 2FFDB 5KJ7D 3HE4A 3C9IA 1XTCC 2P67A 2CPSA 2XKMA 1GW4A 3CI9A 1YTZI 1FBMA 2R5DA 2BASA 5APTA 4C7NB 1HGVA 2WT7A 2OYIB 1DEBA 2XV5A 1ZN5A 2LKMA 1SFCB 1LT9B 2GUSA 2HPCB 2GUVA 3HTKB 4GIFA 2OYIC 1T3JA 4LGDE 1LT9C 1LTBC 4EIJA 1X79B 1JTHA 5APVA 1JO5A 1GL2D 4DZOA 2J58A 2MJZA 3M91A 1LTJB 5AW7B 4RESB 3V2RA 4GT1A 1HBWA 4GKGA 3V2PA 3IR9A 4M3LA 1JCDA 2HODA 2N1TA 2HG5D 1NH4A 2XDJA 2WSCH 5CCHC 5AVVB 1L0LK 2N1TD 3HE5B 5AW4B 5APXA 1MZ9A 2YKPA 3VYIA 1G1JA 2HFED 2QM8A 2ZXEB 3M9BA 1T2KC 1HTLC 1SQQK 2E42A 3H6PA 1J2JB 3M0DC 2C0WA 1H89A 1RE3C 1ZLLA 4DOJA 2C9NY 1SQVK 2Q9IA 3TSIA 1L4AB 4JYBA 3RK3D 4ZKUA 2H43A 4W7ZA 5AVTB 1L4AC 2KYVA 3MUDA 2WITA 1NKNA 3HD7D 3VN0A 3RK2D 1CZQA 2C0XA 3SWYA 3TYYA 1GZLA 5AW5B 1Z56A 2Z5IA 1N73B 1NTMK 1LTAC 3O8ZA 1JY3N 5AVWB 3T97A 2KB7P 1M1JB 2YKQA 1LWUA 1KZUB 3L35A 1IK9A 1HVVA 1N7SB 1KILD 2HYNA 3RL0B 1RE4C 3UIAA 1FZFA 1CI6A 1HH0A 1M1JC 1JCCA 1QL2A 3IFMA 5AW9B 4C7RA 1N7SC 3N4XA 3RL0C 1H8AA 3EQ2A 2OYIA 5AW8B 3SWFA 2HPCA 1NHLA 2N9BA 5CJ4A 2R3CA 2NPSC 1LTGC 3U59A 2A45I 3B5NC 1FZCB 4ZKPA 2KP8A 2P7JA 2E43A 5CCHA 1XTGB 3P8MC 5AVUB 5AVRB 5AW0B 3VMXA 3A2AA 1IO4A 2KLVA 5CCHD 3H32B 3HD7B 3HUSA 3LW5H 3BASA 3VTPC 4N78E 5CCGC 1URQD 2O1JA 2FFDC 1RE3A 1JY2P 3TK1A 1N86A 2JEEA 1G1IA 4WY4B 2WZ7A 3G3ZA 1L4AA 3TNUB 2C9LY 2FYZA 1NTZK 4WY4C 1KILB 2XZRA 3LIDA 3PP5A 3VP9A 2A45H 1SFCC 1FU1A 3VP8A 1SP4A 4N6JA 2POHA 4HYTB 2QM7A 2WTYA 1LTIC 2KSJA 1LTJC 3P8CD 1N7LA 1LGHB 2JJLA 1QL1A 4WBAA 1RE4A 1RF1B 4C46A 1OXZA 1EQ7A 3HRNA 1NO4A 3U1CA 2M3BA 3M9QA 3A7OA 2GM4A 5APYA 1FAVA 4LLHA 3GHGB 2OYHB 1DH3A 2NPSA 1IFNA 3B5NA 1HJBA 5KJ7C 1S9KE 3VMZA 2OYHC 3HE4B 3NMDA 5CJ0A 2NPSD 3A5TA 1LTSC 2W27A 3M9HA 3B5ND 1MFZA 1GDTA 1AFOA 5BU8B 2KOGA 2WPSA 4O9BA 1SQBK 1FZBA 3OA7A 3M06A 2WT7B 1IFDA 3EFGA 5CCGA 2YO3A 1N73C 2FFDA 2VRSA 1RF0C 3N7NA 1A02J 1GL2B 1T3UA 5CCGD 1VPCA 1YYCA 2FKWB 1GL2C 4IFDK 1FZAA 1FOSF 4C7NA 2CPBA 1SLQA 2Z5HA 4I6MC 3MGNA 2HODB 2N1TB 3R2PA 2XNXA 1SFCA 1LT9A 4I1LA 1WRGA 1HWTC 3HTKA 1JY3P 1FOSE 4OH8B 2W6BA 4XE5B 1IFIA 2A45G 1KFNA 1NAFA 1SFCD 3L37A 5BVZA 3U1AA 5AVYB 2ZFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P8C D;  4ZKU A;  4ZKP A;  1NKN A;  2FXM A;  3OJA B;  3N4X A;  4GIF A;  1WT6 A;  4N3Y B;  5BU8 B;  3VP9 A;  3BAT A;  1X79 B;  3HRN A;  3VP8 A;  3BAS A;  4I1L A;  4O9B A;  2POH A;  3C9I A;  3U1C A;  1IC2 A;  5KTB A;  4N78 D;  3U59 A;  5BVZ A;  5BU5 A;  3N7N A;  3U1A A;  2JEE A; 
#chains in the Genus database with same CATH topology
 1PFI A;  1LP1 B;  1SQQ J;  3CD6 P;  3D71 A;  4U3F J;  3WUT A;  1GD2 E;  1NAY A;  1GK4 A;  1VQ7 P;  4L73 A;  2UWJ E;  3RBX A;  1Q82 Q;  1GK6 A;  4GOD A;  3JSV C;  2XU6 A;  1IC2 A;  5KAI H;  3P32 A;  1Q2N A;  3RK2 C;  3KYQ A;  2QA4 P;  1T2K D;  4HKZ H;  3A3Y B;  3WU2 E;  3A0H E;  3KZI H;  4IFF A;  4AQR D;  1N2D C;  3H1K D;  1JNM A;  2O01 N;  1M90 Q;  3D70 A;  1G2C B;  3KQG A;  1ZME C;  1L4A D;  4AUW A;  2SPZ A;  1LWU B;  3CWB D;  3MD0 A;  5CMZ A;  3CLQ A;  3KHU A;  1CI6 B;  2QJY B;  2IZ1 A;  2QJP C;  1VQ8 P;  1JY3 O;  2E76 C;  3CCU P;  3L75 E;  1NWQ A;  4UB6 H;  2Q5U A;  1RY3 A;  5AVZ B;  1BGY D;  3VOP A;  1U7J A;  1K04 A;  1NTM G;  3WMM 0;  3CX5 E;  1KTM A;  3RL0 g;  1N7S D;  2MKV A;  2W6A A;  4EOT A;  3B71 A;  1OIP A;  2KS1 A;  1IFM A;  2Y9Y A;  1URQ B;  2RMZ A;  2FYU D;  5APQ A;  2I1J A;  2J59 M;  3M0A A;  2M8R A;  2DW3 A;  1UIX A;  3IF4 A;  1FJP A;  1UII A;  4B86 A;  3QWO C;  4UB8 E;  1AVO A;  1OVV A;  1FDO A;  3H1I J;  1CSB A;  4MN4 C;  1AQ5 A;  1JTH B;  1KQL A;  4DCK A;  1DX7 A;  3H1J J;  2YO2 A;  1AJY A;  5KTB A;  2QVA A;  1G2C A;  3L74 G;  1NYH A;  4PD4 E;  3V2Q A;  2IYO A;  2Q7C A;  1SQB E;  2D2C D;  1X9V A;  1MKM A;  5AW6 B;  3OJA B;  3Q5R A;  1J1D B;  3KPE A;  1N8R Q;  1PV3 A;  2FYU K;  3LIE A;  4W80 A;  2AXC A;  3B5N B;  2ZJS E;  3RGU A;  1X22 A;  3D6Y A;  1JY2 N;  1EZV D;  3JCU H;  3L70 G;  1SQQ D;  5H2F H;  1URQ A;  4N3Y B;  4JBZ A;  4K3A A;  3AEE C;  3HE4 A;  5KJ7 D;  1BCC E;  3L73 J;  1S4X A;  1YTZ I;  3GLM A;  5APT A;  1BE3 E;  1EC5 A;  3MZW B;  5GTH H;  4H0L D;  1DEB A;  1ZN5 A;  2LKM A;  1SFC B;  1LT9 B;  2GUS A;  4H44 C;  2OYI C;  2OTK E;  1JTH A;  2H89 C;  3AE3 C;  1EDK A;  2KXP B;  1PPJ E;  4GKG A;  1L0N J;  2PRR A;  2W90 A;  2N1T D;  5AW4 B;  5APX A;  1P84 D;  1MZ9 A;  2YKP A;  3F89 A;  2QM8 A;  2ZXE B;  1HTL C;  1SQQ K;  1DIP A;  1RE3 C;  1NGM B;  2JDI H;  4R4M A;  5AVT B;  2KYV A;  3MUD A;  2Q3E A;  1NTK J;  4XFJ A;  2WIT A;  3AE4 C;  2E5T A;  4PV1 B;  2ZVO B;  5AW5 B;  1Z56 A;  1N73 B;  1JY3 N;  3BCC E;  3T97 A;  4EYY Q;  2YXQ B;  1M1J B;  2YKQ A;  1KZU B;  1HVV A;  1KMI Z;  1HH0 A;  3H1K E;  1SQX G;  2V7Q H;  3EQ2 A;  3CWB E;  2JWA A;  4KJM A;  5CJ4 A;  3AE1 C;  4ZKP A;  2KP8 A;  1D7M A;  3P8M C;  5AVU B;  1JB0 J;  2ZXX A;  3A2A A;  1SQV D;  3HUS A;  3H1H J;  3EWK A;  3VTP C;  3ZDM A;  3AEB C;  1URQ D;  2FFD C;  5GTI H;  2FYU E;  2FBW C;  1KN7 A;  1SS1 A;  4H13 C;  2G3A A;  4WY4 B;  3G3Z A;  2C9L Y;  2B89 A;  3SFD C;  1NU1 J;  1FU1 A;  1QX8 A;  1OVR A;  2POH A;  1DD3 A;  3L73 D;  2QM7 A;  2QJP B;  2E76 B;  1LTJ C;  5E79 H;  2Q1K A;  2BCC G;  4C46 A;  1SQP J;  3PHL A;  3GMA A;  1YQ3 C;  2Q6Q A;  3M9Q A;  2GM4 A;  4IL6 X;  1FC2 C;  1KIL E;  1VQO P;  3GF3 A;  4OGQ C;  4RKU J;  5KLV G;  2G8Y A;  2M5A B;  4PJ0 E;  3B5N D;  1PIX A;  3OW2 O;  1VQL P;  1AFO A;  3SFE C;  4D6T J;  1IFD A;  5CCG A;  2VRS A;  1GL2 B;  2KNC B;  1SQQ E;  1VPC A;  1NTK D;  4U3F E;  3AE9 C;  1OX3 A;  1X0T A;  4Y28 J;  2Z5H A;  3CCE P;  4I6M C;  2HOD B;  2XNX A;  2A06 D;  1WRG A;  3HTK A;  4XE5 B;  2IBZ E;  1L0L J;  1PP9 G;  5BVZ A;  1SFC D;  2Z4E A;  3G4S P;  2H7H A;  4BRY B;  2YKO A;  1S5L H;  1L0N K;  2KIK A;  1FZC C;  1MUU A;  3NFQ A;  5AVX B;  3V4Q A;  1X8Y A;  1HGZ A;  3OAK A;  3P8C E;  1FZG A;  2Q3I A;  5APW A;  1YTZ T;  2AXT E;  4PD4 D;  1P84 E;  1NTM J;  1SQB D;  3E1I A;  4DT0 A;  2K9J A;  3CL3 D;  3L72 G;  1NTK K;  2V7Q J;  5B66 E;  2E75 C;  4W7Y A;  2YNY A;  1EDL A;  5L8R J;  2WSE H;  1RH5 B;  1QLE D;  1PL5 A;  4PV1 D;  2HLO A;  4WB4 A;  1JUN A;  2QE7 H;  3II6 A;  3BRV B;  3FXE A;  1GTW A;  1GL2 A;  2KNC A;  3QH9 A;  2PFX A;  1AVY A;  1N7S A;  1PZQ A;  3E7K A;  1H0T B;  3CMA P;  2LR2 A;  2R44 A;  3H1I E;  1BCC D;  4U7J A;  1WMK A;  3V2N A;  3GHG C;  1BE3 D;  1JY2 O;  2KLU A;  1SQP D;  3HUS C;  3H1J E;  2O3J A;  1J1E B;  2AEJ A;  4A7P A;  3L74 J;  3D6Z A;  3HD7 A;  3VMY A;  2KUB A;  3MTU E;  2FXO A;  2OQQ A;  1NTZ J;  3A0B E;  2H8P D;  3H25 A;  1KYO H;  3FGA D;  2XND H;  3CXH I;  3BVH A;  3TNU A;  4KHX A;  3L4F A;  1KIL A;  1NU1 K;  4WY4 D;  4YXD C;  4JF7 A;  1BSN A;  1PPJ G;  2K88 A;  4HH2 A;  1HUC A;  4LC1 A;  1YHQ P;  4Y99 C;  3L73 E;  2E76 D;  2JP3 A;  3RK3 C;  3TGU J;  1FZE A;  1RF1 A;  1SQP K;  1T8Z A;  1L0L D;  3Q1M A;  3CCJ P;  1OMI A;  3CXH H;  3BCC D;  5AW2 B;  3E1R A;  1M7L A;  1Y47 A;  5KJ7 A;  4IFM A;  1QVF O;  2FFD B;  4TT3 H;  3C9I A;  1XTC C;  5KAI E;  1L0N E;  3GW6 A;  2ZT9 C;  2XKM A;  1GW4 A;  4H13 B;  2ZYD A;  3KZI E;  1FDI A;  2GUV A;  5DJT B;  2FY8 A;  1KQG B;  4EIJ A;  1KC8 Q;  1X79 B;  5APV A;  1VQN P;  2NRG A;  2QEX P;  3H1K G;  1GL2 D;  1KOR A;  2E74 B;  1LTJ B;  3PH0 A;  4RES B;  3V2R A;  4GT1 A;  3I56 P;  1HBW A;  2CK3 H;  1JMB A;  2JR8 A;  2N1T A;  1K73 Q;  1NTK E;  5CCH C;  1S72 P;  3PTZ A;  1L0L K;  3HE5 B;  4UB6 E;  1KB9 I;  1OW7 A;  5M1B A;  1S2E A;  1G1J A;  2A06 E;  1T2K C;  3G6E P;  1VL2 A;  2E42 A;  1IFP A;  1LP1 A;  1BGY G;  4DOJ A;  2NZ2 A;  4OGQ B;  3CCS P;  1VF5 D;  4JYB A;  2WSE J;  2H43 A;  4NPE A;  1L4A C;  1L2P A;  3HD7 D;  1NKN A;  3WUU A;  2FXP A;  1JEK A;  3TYY A;  2FYU G;  3CCM P;  2GA1 A;  1NTM K;  1NJI Q;  3O8Z A;  2ITA A;  2QJK C;  5AVW B;  2KB7 P;  1KB9 H;  1NTZ D;  1LWU A;  1KIL D;  3RL0 B;  2H88 C;  1FZF A;  1CI6 A;  3B4S A;  1JCC A;  1QL2 A;  5AW9 B;  1N7S C;  3H1H E;  1Q7Y Q;  1NHL A;  2N9B A;  2FYN B;  2NPS C;  1ZRT D;  5B5E H;  3Q3D A;  3AED C;  1FZC B;  2IDB A;  2WPV B;  2P7J A;  1GMJ A;  3CCQ P;  2E5Y A;  1XTG B;  5AW0 B;  3FX0 A;  3VMX A;  3PJS K;  4U3F D;  1IO4 A;  3H32 B;  3TGU D;  3BAS A;  1M56 D;  2O1J A;  3K5B A;  2BCC J;  4L75 A;  2RKL A;  2IBZ D;  3CC7 P;  3JCU E;  1KQS O;  1SQP E;  5H2F E;  1EZV G;  2V4H A;  1OZH A;  1NTZ K;  2E75 B;  3I55 P;  2XZR A;  1SQQ G;  3LID A;  3PP5 A;  2M0B A;  3VP9 A;  2ZAE B;  3VP8 A;  5C39 A;  1SP4 A;  4HYT B;  2BEQ D;  4Z1M H;  5KLV J;  2KSJ A;  1ZW0 A;  3P8C D;  5GTH E;  1HF9 A;  1N7L A;  1LGH B;  2Y0D A;  1AA0 A;  4WBA A;  1RE4 A;  4BWN A;  4D6T E;  3F5H A;  1EQ7 A;  3PRJ A;  1NO4 A;  2M3B A;  5EFW B;  5APY A;  1Q90 D;  3GHG B;  2OYH B;  3B5N A;  5KJ7 C;  4ASV A;  3S9O A;  3VMZ A;  5CJ0 A;  2AEM A;  2KZJ A;  3M9H A;  1MFZ A;  1M1K Q;  5BU8 B;  2P10 A;  3W67 A;  1PP9 J;  4O9B A;  1L0L E;  1FZB A;  3OA7 A;  2WT7 B;  3EFG A;  3N7N A;  3H1I D;  1YYC A;  2CPB A;  3MGN A;  3H1J D;  1LT1 A;  1SFC A;  1LT9 A;  4RO0 A;  5KLI B;  2B9B A;  4OH8 B;  2W6B A;  1IFI A;  2A45 G;  1KFN A;  2HR3 A;  3L37 A;  2ZFC A;  2O01 H;  4TLF A;  4I2L C;  1NTM E;  4L74 A;  3SWK A;  3VMA A;  3L72 J;  3CCR P;  4YPC A;  3RK3 B;  1H88 A;  2E74 D;  1K8A Q;  1K9M Q;  3NTN A;  3RK2 B;  3L71 J;  3W68 A;  5KAF H;  1LTT C;  2RH0 A;  2KK7 A;  2OYH A;  3O6Q B;  4DJG A;  5TIS H;  1JMM A;  4OGQ D;  2ZT9 B;  1FJK A;  1SQV G;  5AVQ B;  5GTI E;  2BCC D;  1LWU C;  2QIW A;  1N73 A;  5BU5 A;  1NOH A;  2WPR A;  1RF0 A;  4JPZ B;  1EXJ A;  2OTL P;  1EZV I;  1A02 F;  2LXB A;  1M1J A;  1QGK B;  3H1L J;  3MIW A;  4HB1 A;  5TJH A;  2YMY A;  3RL0 D;  4N78 D;  5KLV D;  1NTZ E;  1E79 H;  3BRT B;  3FWN A;  1L0N D;  3L73 G;  3AE6 C;  5E79 E;  2B88 A;  3CXH D;  1FDM A;  2RN0 A;  1ZOY C;  1CW5 A;  1URQ C;  2I1K A;  2IX7 C;  1FS0 E;  1ZRT E;  1E5W A;  2K3R A;  1GW3 A;  4GDO A;  1W5C E;  4NPD A;  2P58 A;  3S1K A;  3USS A;  3AE2 C;  2FXM A;  3JC2 2;  1GU4 A;  2WVR A;  1VQ9 P;  3TGU E;  2BEZ F;  1MV8 A;  2QJK B;  4WY4 A;  3L75 G;  1YJN P;  4IL6 H;  1OWA A;  2E75 D;  2R3S A;  3EFF K;  4OWF A;  5DJU B;  5KLV K;  2P1J A;  1NTK G;  2QSI A;  3S4R A;  2NPS B;  2AEF A;  1J1D C;  2IFM A;  1RQU A;  2JWD A;  4EI2 A;  3ABV C;  1QEX A;  2A06 G;  5APU A;  3MUD C;  1VDF A;  1S5L E;  2IFN A;  1W2E A;  1ZR2 A;  3H1H D;  2M5A A;  2P67 A;  1IZN B;  3L71 D;  3CC4 P;  1FBM A;  1EDI A;  4C7N B;  1Q86 Q;  1PGO A;  4H44 B;  1HGV A;  2OYI B;  2O01 J;  1BGY J;  1T3J A;  4BXL A;  1LT9 C;  1NU1 D;  1SQB G;  1KYO I;  5AW7 B;  3CC2 P;  4YXW H;  3V2P A;  3IR9 A;  4M3L A;  2HOD A;  2XDJ A;  3TF5 A;  2WSC H;  2YMK A;  5K5G B;  1M8O B;  3M9B A;  4BRY A;  3H1L D;  3H6P A;  1H89 A;  5KKZ C;  2K1A A;  3TSI A;  3RK3 D;  4ZKU A;  4W7Z A;  1BCC G;  4KT0 J;  3VN0 A;  3RK2 D;  1VQ4 P;  3C1L A;  1BE3 G;  4D6T D;  1LTA C;  4ZNC A;  2JO1 A;  1DEE G;  3L70 J;  4GOE A;  2ZT9 D;  3UIA A;  1KYO E;  1M1J C;  3C8V A;  1K05 A;  4C7R A;  2OYI A;  1BDD A;  1U57 A;  3SWF A;  2KS1 B;  2R3C A;  2BCC E;  3U59 A;  4HJG H;  2LXC B;  3CX5 I;  2W83 C;  1H0T A;  1KQF B;  1PGJ A;  3WU2 H;  3A0H H;  3CCL P;  5CCH D;  3LW5 H;  4N78 E;  5KLV E;  5CCG C;  1RHZ B;  1RE3 A;  2M3E A;  3TK1 A;  1N86 A;  3CXH E;  1L0L G;  4YTP C;  1MFT A;  1AQT A;  3G9R A;  2WZ7 A;  3BCC G;  1NTM D;  5CBO A;  4WY4 C;  4L76 A;  3Q5P A;  1FE6 A;  3CX5 H;  2K9Y A;  3CWB G;  4PD4 I;  1YBK A;  4OVN F;  1PP9 E;  4UB8 H;  2QG4 A;  2I8D A;  2IZ0 A;  3IAO A;  4QMA A;  1IFN A;  1HJB A;  3HE4 B;  3NMD A;  1SQX J;  2NPS D;  3A5T A;  3CPW O;  4CPG A;  1IK7 A;  1KD1 Q;  4R4L A;  2KOG A;  4EDF A;  2WPS A;  3L74 D;  2YO3 A;  1YJ9 P;  2FFD A;  4PD4 H;  1ZXG A;  3AEA C;  1A02 J;  3L72 E;  1BSH A;  2WQY C;  2FKW B;  1GL2 C;  2WSC J;  3AE7 C;  1FZA A;  1SLQ A;  4I1L A;  3L71 E;  1YQ4 C;  1FOS E;  4H44 D;  1NAF A;  1EXI A;  1KB9 E;  3L70 D;  2WMM A;  1LTJ A;  2YIU C;  1NTZ G;  1R8E A;  2ZYG A;  1NU1 E;  4XA4 A;  1SQV J;  1VF5 C;  3HE5 A;  2PAJ A;  1USE A;  1KFM A;  5AW1 B;  3HD7 C;  3MP7 B;  3M0D A;  2WPQ A;  5B5E E;  3SSU A;  1JM0 A;  3FXD A;  2QRX A;  3B8E B;  2OAR A;  2KSE A;  1NKZ B;  4ZMD A;  4JYC A;  3L36 A;  2WWW A;  4GOF A;  1IFJ A;  3H1L E;  1TU3 F;  3T97 B;  3AE8 C;  4U3F G;  1KIL C;  2D2C C;  2Y9Z A;  3TGU G;  5APS A;  3RK3 E;  3G71 P;  3I5C A;  2JKV A;  3NXS A;  2B87 B;  4I7Z C;  1PGQ A;  1S1C X;  2IBZ G;  3V5B A;  3BAT A;  2R5B A;  1ZR4 A;  1RF1 C;  2W6J H;  2L5G B;  3AEG C;  3LW5 J;  2ZVN B;  5AVS B;  2PP6 A;  4AYC A;  3HUS B;  1QVG O;  3P7K A;  3PLN A;  3Q5S A;  1FZC A;  5KKZ B;  3L75 J;  5AW3 B;  3KXD A;  2N9Y B;  1J1E C;  3CME P;  4H0L C;  1M57 D;  1OFC X;  3V6I A;  1PGP A;  3H32 A;  1IJD B;  1SQX D;  1WT6 A;  1OW8 A;  4H13 D;  1SVF A;  1OW6 A;  1YJW P;  2N1T C;  1USD A;  1JOC A;  2P2U A;  3V4W A;  2IPP A;  4Y99 B;  4JQ0 D;  1S9K D;  3H1I G;  1GU5 A;  3R4Y A;  2B87 A;  1KV4 A;  2O1K A;  2IYP A;  3RBZ A;  2R32 A;  3H1J G;  3TDK A;  1VQ6 P;  5CHX A;  1BGY E;  3GHG A;  4ASW A;  1ZV8 A;  1SQB J;  2WSF H;  1KYO D;  5CBN A;  1U7M A;  3KDP B;  1SQX K;  2OYO A;  1AV1 A;  1YI2 P;  1LJ2 A;  2CPS A;  2W8Z A;  3CI9 A;  5KAF E;  2R5D A;  2WSS H;  2BAS A;  2ZYA A;  2WT7 A;  2XV5 A;  2QJY C;  2HPC B;  3HTK B;  5TIS E;  4GIF A;  4LGD E;  1LTB C;  3L74 E;  3FWL A;  1JO5 A;  4DZO A;  2J58 A;  2MJZ A;  3M91 A;  1BCC J;  1JCD A;  2E74 C;  2HG5 D;  1NH4 A;  5AVV B;  1DD4 A;  2IBZ I;  4PJ0 H;  1BE3 J;  1Y9B A;  3VYI A;  1VQ5 P;  2HFE D;  3AEF C;  1YIJ P;  1J2J B;  3M0D C;  2C0W A;  1ZLL A;  2C9N Y;  3L70 E;  1SQV K;  2Q9I A;  1L4A B;  2K9J B;  1L0N G;  1NVO A;  1S5L X;  1CZQ A;  2C0X A;  3L75 D;  3SWY A;  1GZL A;  1BDC A;  2Z5I A;  1P84 I;  1PP9 D;  3O6Q A;  3CX5 D;  1EZV E;  3ITK A;  1VQM P;  3L35 A;  1IK9 A;  4NPF X;  1YIT P;  1N7S B;  2HYN A;  1RE4 C;  1OVU A;  3IFM A;  2OTJ P;  4WWI A;  3N4X A;  3RL0 C;  1H8A A;  4K35 A;  5AW8 B;  1R5S A;  2KI7 B;  2HPC A;  1VQK P;  2K37 A;  1LTG C;  2OGU A;  2YIU B;  4IL6 E;  2A45 I;  1LNQ A;  3B5N C;  2AXT H;  2FYN C;  3BCC J;  3AE5 C;  1P84 H;  5CCH A;  2E43 A;  3L72 D;  1VF5 B;  5AVR B;  1S3J A;  2KLV A;  3H1K J;  3HD7 B;  5B66 H;  3MHV A;  3CWB J;  4RJT A;  1JY2 P;  2PGD A;  2JEE A;  1KB9 D;  1G1I A;  1L4A A;  3TNU B;  3GF7 A;  2FYZ A;  1KIL B;  2D2C B;  2A45 H;  1SFC C;  4N6J A;  3H1H G;  2KZI A;  1HJ0 A;  1VQP P;  4I7Z B;  2WTY A;  1LTI C;  2YXR B;  1SQX E;  1ZP0 C;  1W2B O;  2Y0E A;  3L71 G;  2JJL A;  3WUV A;  2FYU J;  1QL1 A;  1RF1 B;  1T6A A;  1OXZ A;  3GG2 A;  1R5L A;  2WSF J;  3HRN A;  3U1C A;  3A7O A;  3Q2Y A;  1NU1 G;  1FAV A;  4LLH A;  1DH3 A;  2NPS A;  1Q81 Q;  3A0B H;  1S9K E;  2OYH C;  2Y0C A;  1RQV A;  1LTS C;  2W27 A;  4WVZ A;  2J5U A;  1GDT A;  4H0L B;  3CCV P;  1SQP G;  1SQB K;  4PV1 C;  2L91 A;  3H1L G;  3M06 A;  1N73 C;  1PPJ D;  1RF0 C;  1T3U A;  5CCG D;  4IFD K;  3AEC C;  1SQV E;  1FOS F;  4C7N A;  2N1T B;  3R2P A;  1Y8A A;  1EDJ A;  1HWT C;  1JY3 P;  4D6T G;  3IN6 A;  4IOI H;  5KLI C;  3U1A A;  5AVY B; 
#chains in the Genus database with same CATH homology
 2Z4E A;  2O01 H;  2H7H A;  1PFI A;  4I2L C;  1LTJ A;  2YKO A;  1L0N K;  1FZC C;  1MUU A;  3RK3 B;  3NFQ A;  1H88 A;  5AVX B;  1GD2 E;  4XA4 A;  1GK4 A;  3V4Q A;  1X8Y A;  3NTN A;  3HE5 A;  3RK2 B;  1GK6 A;  1HGZ A;  2PAJ A;  2XU6 A;  1IC2 A;  3P32 A;  1KFM A;  5AW1 B;  3HD7 C;  3OAK A;  3M0D A;  3P8C E;  2WPQ A;  1FZG A;  3RK2 C;  2Q3I A;  3KYQ A;  5APW A;  1T2K D;  1YTZ T;  3B8E B;  2OAR A;  1LTT C;  1NKZ B;  3A3Y B;  4JYC A;  3L36 A;  2WWW A;  2OYH A;  4IFF A;  1IFJ A;  4AQR D;  3E1I A;  1N2D C;  1JMM A;  1JNM A;  3CL3 D;  1NTK K;  1G2C B;  3KQG A;  1L4A D;  4AUW A;  1LWU B;  3MD0 A;  5CMZ A;  1KIL C;  4W7Y A;  1FJK A;  2YNY A;  3CLQ A;  2WSE H;  1CI6 B;  5APS A;  5AVQ B;  1LWU C;  1N73 A;  5BU5 A;  1NOH A;  2WPR A;  1RF0 A;  3I5C A;  1JY3 O;  2HLO A;  3NXS A;  4WB4 A;  1JUN A;  3II6 A;  3BRV B;  1NWQ A;  1GTW A;  2Q5U A;  1GL2 A;  1RY3 A;  5AVZ B;  3V5B A;  1A02 F;  1M1J A;  3VOP A;  3BAT A;  1N7S A;  2R5B A;  1ZR4 A;  3WMM 0;  1RF1 C;  2L5G B;  3MIW A;  2YMY A;  1N7S D;  3RL0 D;  4N78 D;  3BRT B;  4EOT A;  2W6A A;  5AVS B;  2PP6 A;  1IFM A;  4AYC A;  1URQ B;  3HUS B;  3P7K A;  3V2N A;  3GHG C;  1FDM A;  5APQ A;  2I1J A;  2J59 M;  1JY2 O;  1CW5 A;  1URQ C;  3M0A A;  3HUS C;  2I1K A;  1FZC A;  2M8R A;  1J1E B;  1FJP A;  5AW3 B;  4B86 A;  2IX7 C;  1J1E C;  1E5W A;  1GW3 A;  3H32 A;  3HD7 A;  3VMY A;  3MTU E;  1CSB A;  1IJD B;  2H8P D;  1AQ5 A;  1JTH B;  2FXM A;  1KQL A;  1GU4 A;  1DX7 A;  1WT6 A;  1MV8 A;  4WY4 A;  3BVH A;  1SVF A;  2YO2 A;  3TNU A;  4KHX A;  3L4F A;  5KTB A;  1KIL A;  1NU1 K;  2N1T C;  4WY4 D;  1G2C A;  1OWA A;  3V2Q A;  1JOC A;  4JF7 A;  2P2U A;  2IPP A;  4Y99 B;  2Q7C A;  3V4W A;  4HH2 A;  5KLV K;  1X9V A;  1S9K D;  1HUC A;  4LC1 A;  2P1J A;  4Y99 C;  5AW6 B;  3OJA B;  1J1D B;  1GU5 A;  3KPE A;  2NPS B;  2FYU K;  3LIE A;  4W80 A;  2O1K A;  3RK3 C;  1J1D C;  3B5N B;  1FZE A;  2IFM A;  1RF1 A;  1SQP K;  1T8Z A;  2R32 A;  1JY2 N;  5APU A;  5CHX A;  5AW2 B;  1VDF A;  1M7L A;  5KJ7 A;  3GHG A;  2IFN A;  1ZV8 A;  1W2E A;  4IFM A;  1ZR2 A;  2WSF H;  1URQ A;  4N3Y B;  3KDP B;  1SQX K;  2FFD B;  5KJ7 D;  3HE4 A;  3C9I A;  1XTC C;  2P67 A;  2CPS A;  2XKM A;  1GW4 A;  3CI9 A;  1YTZ I;  1FBM A;  2R5D A;  2BAS A;  5APT A;  4C7N B;  1HGV A;  2WT7 A;  2OYI B;  1DEB A;  2XV5 A;  1ZN5 A;  2LKM A;  1SFC B;  1LT9 B;  2GUS A;  2HPC B;  2GUV A;  3HTK B;  4GIF A;  2OYI C;  1T3J A;  4LGD E;  1LT9 C;  1LTB C;  4EIJ A;  1X79 B;  1JTH A;  5APV A;  1JO5 A;  1GL2 D;  4DZO A;  2J58 A;  2MJZ A;  3M91 A;  1LTJ B;  5AW7 B;  4RES B;  3V2R A;  4GT1 A;  1HBW A;  4GKG A;  3V2P A;  3IR9 A;  4M3L A;  1JCD A;  2HOD A;  2N1T A;  2HG5 D;  1NH4 A;  2XDJ A;  2WSC H;  5CCH C;  5AVV B;  1L0L K;  2N1T D;  3HE5 B;  5AW4 B;  5APX A;  1MZ9 A;  2YKP A;  3VYI A;  1G1J A;  2HFE D;  2QM8 A;  2ZXE B;  3M9B A;  1T2K C;  1HTL C;  1SQQ K;  2E42 A;  3H6P A;  1J2J B;  3M0D C;  2C0W A;  1H89 A;  1RE3 C;  1ZLL A;  4DOJ A;  2C9N Y;  1SQV K;  2Q9I A;  3TSI A;  1L4A B;  4JYB A;  3RK3 D;  4ZKU A;  2H43 A;  4W7Z A;  5AVT B;  1L4A C;  2KYV A;  3MUD A;  2WIT A;  1NKN A;  3HD7 D;  3VN0 A;  3RK2 D;  1CZQ A;  2C0X A;  3SWY A;  3TYY A;  1GZL A;  5AW5 B;  1Z56 A;  2Z5I A;  1N73 B;  1NTM K;  1LTA C;  3O8Z A;  1JY3 N;  5AVW B;  3T97 A;  2KB7 P;  1M1J B;  2YKQ A;  1LWU A;  1KZU B;  3L35 A;  1IK9 A;  1HVV A;  1N7S B;  1KIL D;  2HYN A;  3RL0 B;  1RE4 C;  3UIA A;  1FZF A;  1CI6 A;  1HH0 A;  1M1J C;  1JCC A;  1QL2 A;  3IFM A;  5AW9 B;  4C7R A;  1N7S C;  3N4X A;  3RL0 C;  1H8A A;  3EQ2 A;  2OYI A;  5AW8 B;  3SWF A;  2HPC A;  1NHL A;  2N9B A;  5CJ4 A;  2R3C A;  2NPS C;  1LTG C;  3U59 A;  2A45 I;  3B5N C;  1FZC B;  4ZKP A;  2KP8 A;  2P7J A;  2E43 A;  5CCH A;  1XTG B;  3P8M C;  5AVU B;  5AVR B;  5AW0 B;  3VMX A;  3A2A A;  1IO4 A;  2KLV A;  5CCH D;  3H32 B;  3HD7 B;  3HUS A;  3LW5 H;  3BAS A;  3VTP C;  4N78 E;  5CCG C;  1URQ D;  2O1J A;  2FFD C;  1RE3 A;  1JY2 P;  3TK1 A;  1N86 A;  2JEE A;  1G1I A;  4WY4 B;  2WZ7 A;  3G3Z A;  1L4A A;  3TNU B;  2C9L Y;  2FYZ A;  1NTZ K;  4WY4 C;  1KIL B;  2XZR A;  3LID A;  3PP5 A;  3VP9 A;  2A45 H;  1SFC C;  1FU1 A;  3VP8 A;  1SP4 A;  4N6J A;  2POH A;  4HYT B;  2QM7 A;  2WTY A;  1LTI C;  2KSJ A;  1LTJ C;  3P8C D;  1N7L A;  1LGH B;  2JJL A;  1QL1 A;  4WBA A;  1RE4 A;  1RF1 B;  4C46 A;  1OXZ A;  1EQ7 A;  3HRN A;  1NO4 A;  3U1C A;  2M3B A;  3M9Q A;  3A7O A;  2GM4 A;  5APY A;  1FAV A;  4LLH A;  3GHG B;  2OYH B;  1DH3 A;  2NPS A;  1IFN A;  3B5N A;  1HJB A;  5KJ7 C;  1S9K E;  3VMZ A;  2OYH C;  3HE4 B;  3NMD A;  5CJ0 A;  2NPS D;  3A5T A;  1LTS C;  2W27 A;  3M9H A;  3B5N D;  1MFZ A;  1GDT A;  1AFO A;  5BU8 B;  2KOG A;  2WPS A;  4O9B A;  1SQB K;  1FZB A;  3OA7 A;  3M06 A;  2WT7 B;  1IFD A;  3EFG A;  5CCG A;  2YO3 A;  1N73 C;  2FFD A;  2VRS A;  1RF0 C;  3N7N A;  1A02 J;  1GL2 B;  1T3U A;  5CCG D;  1VPC A;  1YYC A;  2FKW B;  1GL2 C;  4IFD K;  1FZA A;  1FOS F;  4C7N A;  2CPB A;  1SLQ A;  2Z5H A;  4I6M C;  3MGN A;  2HOD B;  2N1T B;  3R2P A;  2XNX A;  1SFC A;  1LT9 A;  4I1L A;  1WRG A;  1HWT C;  3HTK A;  1JY3 P;  1FOS E;  4OH8 B;  2W6B A;  4XE5 B;  1IFI A;  2A45 G;  1KFN A;  1NAF A;  1SFC D;  3L37 A;  5BVZ A;  3U1A A;  5AVY B;  2ZFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...