3FWNA

Dimeric 6-phosphogluconate dehydrogenase complexed with 6-phosphogluconate and 2'-monophosphoadenosine-5'-diphosphate
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
467
structure length
467
Chain Sequence
b'SKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDAYAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQIGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEWLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-phosphogluconate dehydrogenase, decarboxylating
molecule tags Oxidoreductase
source organism Escherichia coli
publication title Conformational changes associated with cofactor/substrate binding of 6-phosphogluconate dehydrogenase from Escherichia coli and Klebsiella pneumoniae: Implications for enzyme mechanism
pubmed doi rcsb
total genus 171
structure length 467
sequence length 467
chains with identical sequence B
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3fwnA02
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 3fwnA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3fwnA01
1HLDA 1BWSA 2VCYA 1EK5A 4EDFA 3A14A 2XOXA 3WTCA 2QRJA 3KSUA 4Z9XA 3P5SA 5G0WA 4H16A 5C5IA 1XQ6A 3CUKA 3MTJA 3WIEA 3DAFA 4B3HA 5DF1A 4IDFA 4KDFA 2JKVA 1T1RA 2P91A 3BMCB 5JC1A 3Q3CA 1TT5A 2AQ8A 4XJTA 1E5LA 1EE9A 1NHWA 1WXDA 4FQ8A 4E21A 2B4RO 2X0NA 1G6KA 3AUTA 3LDHA 2DUUA 3JQFC 2V6BA 1TVEA 2Y1DA 3DOOA 3QIVA 1DC5A 4XB2A 1HLPA 3KB6A 4WLFA 4J3FA 2QHXA 3U9LA 4WLEA 4LW8A 5L95A 2GCGA 2Q2QA 1WNTA 2VNSA 1XHLA 2EP5A 3I9NA 1A9YA 1WW8A 1BSVA 3OETA 4TROA 4XYBA 1KEWA 5KKAA 5B4VA 3GFBA 4I5FA 2O7QA 1N9GB 4AJLA 3L9XA 3KYCB 5HWSA 3INGA 1RKXA 1OC2A 5H81A 3ZNOA 1GADO 2AEMA 3IKTA 4RF5A 3SJ7A 3V5NA 1O5IA 2EKQA 1YL5A 3GR6A 5JAIA 3FWZA 3KYDB 1E1KA 1NAIA 3ZWCA 1IZ0A 3H7AA 1QYXA 4NU6A 2YDYA 4FGWA 1C1XA 3F4LA 2NM0A 4D46A 1GL3A 3E9MA 4Q3AA 2C2YA 1MXHA 3I1JA 3IL2A 3C1AA 2A94A 2Q4EA 1H6DA 2JAHA 1KY5A 3AK4A 3DMTC 5F1PA 3W4KA 4BV9A 3OIDA 2PFGA 4R5HA 2Y0CA 1LDEA 4R3NA 4ZQEA 2ZTVA 2R6JA 3PWSA 4Z6KA 3Q1LA 4HFNA 4XQCA 5DZSA 3JQ8B 3WB9A 4DMLA 4M89A 1AE1A 1WP4A 2NV6A 4AJOA 1E7MA 3IAHA 2YZ7A 1X13A 3ANNA 3I9MA 4WCDA 2QG4A 4CMHA 3EK2A 1EK6A 1ADCA 2AEJA 1H0KA 1N5DA 1DFGA 4R4JA 1HRDA 5DDIP 5I9NA 4Q39A 3JQEA 5DCWA 3NYWA 4OXYA 4Q3NA 4R1UA 2JHFA 1GCOA 4G5HA 5J23A 2CFCA 4I5DA 4JJGA 4BS9A 1OOEA 3U0BA 1MUUA 1GZ6A 4DL9A 4UUNA 1BDBA 2RHRA 1HEUA 4E5PA 1D3AA 4BO8A 3R3JA 4ALKA 4EYEA 1DRWA 1N1GA 3FTNA 4IBOA 4XWYA 4JP2A 3WDSA 2D5CA 4TKMA 1VSVA 4BO6A 3AY6A 2ZB8A 1XCBA 1H2BA 4WK6A 4D0SA 4NMHA 2RCYA 1LC3A 2X58A 4PLYA 3HDHA 3DXFA 2HMUA 4HBGA 3RU7A 3UICA 2BHLA 3FSRA 3HSKA 4YT5A 1E3IA 4MVJD 3VC7A 4L4XA 3FR7A 2PY6A 1E7WA 1ONNA 5JAMA 1DIGA 4IMRA 3QWAA 4FC6A 3TRIA 1X15A 2GN9A 4BQPA 3SVTA 2OBYA 3F46A 5CDGA 5KVCA 1H6BA 1IYZA 1X7GA 5I7SA 2ZB4A 1DHRA 4WLUA 3DZKA 5L3ZA 3RJ5A 4QT0A 3I9JA 1S6YA 1ISJA 4O5OA 2C7VA 2HO5A 3GA0A 1DB3A 4YJDA 4ZU3A 5JAZA 1U8XX 3BIOA 2VUTA 1MLDA 3C24A 2Q50A 3PQFA 2VYVA 3ZI0A 2O2YA 4FFRA 3PPIA 4A7PA 4RF3A 4PLTA 3LF1A 1CETA 3ZV6A 4RO0A 1EUZA 1QXSA 3E03A 1M76A 3QA9A 1A7KA 3JYNA 2ZKLA 4XRGA 2VYND 5ICMA 1ZXLA 4LCEA 1SNYA 1SEVA 3EC7A 4CLRB 3LF2A 5KCZA 2ZQYA 3ZHYA 1SEPA 1VLLA 2PZMA 4E12A 1M6WA 4XQ9A 4UVEA 2QYTA 2GUGA 1MG5A 4RGBA 3ZV3A 3GMSA 3CTMA 4U6QA 4D0RA 1H93A 2O2SA 4OL9A 3KSDO 1GPJA 1ZJYA 1EMDA 3VH2A 2Z1MA 4GSKA 4YB8A 2HMVA 4PRKA 4YBZA 1R0KA 3QWIA 2P4HX 1LRJA 2O3SA 3FNFA 3UFXA 5HS4A 1P1JA 3AY7A 3ZWAA 3PFWO 2FY8A 5G4LA 3PDUA 1PJTA 4NH4A 2X23A 3PIDA 1IB6A 2QRLA 4B7XA 5KJCA 1R15A 2AQHA 3PGXA 4J1NA 5C3MA 1RYDA 1XEAA 5GMOA 1NAYA 1YBVA 1T2EA 3IUPA 3S2EA 1I3LA 3PQDA 1BW9A 3CMMA 3VPGA 4CR6A 2X4GA 3PGJA 1A5ZA 1EDOA 1LDYA 4OAQA 1MB4A 1NVGA 1MGOA 3OSUA 1NP3A 1GQQA 2VT2A 3AU9A 1SBYA 4URFA 4J9VA 1ULSA 2NU7A 4CM6A 4E33A 3ROKA 1IULA 3WLFA 2GNAA 4CM9A 5L4NA 2PA3A 4NBVA 4CQLB 3L9WA 5JLAA 4RF4A 4RCVA 1B14A 1YL6A 2AG5A 4NJOA 5ITWA 3HFSA 3OHSX 3DDNA 4XDYA 2DC1A 1ZVMA 4RLSA 3I9LA 2QQ5A 4IDEA 5I7FA 1VM6A 2GO1A 4EUEA 5G0TA 1O9BA 4YAJA 5KTKA 1VPDA 4HKTA 3IOYA 2ZIZA 1E77A 3O26A 4ROSA 4RZIA 2ZTLA 3FF4A 4U7WA 4E2YA 4O59O 1P9LA 2J5KA 2JFHA 1FK8A 3ZWVA 3UCEA 1TXGA 1DC6A 4AJNA 1YE3A 1ZSVA 1G0NA 2X22A 3RFTA 1F06A 2AHRA 5F1OA 1E7SA 3PHGA 5A9SB 3RI3A 4BO0A 4FCCA 3PYLA 1NWCA 3B70A 4J1QA 3JD1A 4K1LA 1AVYA 4QX6A 5AQ1A 3WSVA 2VHVA 5IDXA 4J43A 4OHUA 2NNLD 4ALIA 4WOKA 3P2OA 1IE3A 2NQ8A 1YL7A 2H63A 1PL7A 4CL8A 4CMIB 5A5FA 1NBOA 2AE1A 1NPYA 3QVSA 4YAKA 1K6XA 3QJ5A 4ZQGA 1LI4A 5JXWA 5H83A 5DBIA 4KWIA 5TRTA 1XLTA 4YA6A 1M2WA 1Y7TA 1AUPA 4GLLA 4CM1A 2CF5A 5C7IO 3WJAA 4OGWA 4J2OA 2ZK7A 3WR5A 4ONEA 3NX4A 3H2SA 4L4SA 3JQAA 1U1IA 3WGOA 5ICSA 4NIMA 5DCUA 2B5WA 2G1UA 2X7HA 4FFLA 3KO8A 1U8FO 2R00A 4ALMA 2C5EA 4UVGA 1SPXA 1KVTA 2ZCUA 3U3XA 4F6LA 2BF7A 4R1TA 4CLDA 1UR5A 4B4WA 4R01A 4DYDA 1PWZA 3VOSA 5AXBA 3LC1O 4TVBA 1J0XO 2P9GA 3AM4A 5IXSA 1F17A 1P1HA 2NTNA 1Y8RA 3RUHA 8ADHA 1YONA 4KUEA 3GRKA 1QMGA 1VI2A 3G79A 2P5YA 1AHHA 4RL6A 4CV1A 1EEHA 2P68A 3N7UA 3JSAA 3OJOA 3NEPX 4WE3A 1OBFO 1HDXA 5AOVA 1BXGB 3D5TA 3ZWYA 5F5NA 2LDXA 1QYCA 1H9BA 4R68A 3ROPA 4GBJA 1T1SA 1F12A 1VSUA 2CF6A 4W82A 3QW2A 3JQ9A 5HS6A 1C1DB 1NWHA 4R5MA 4D79A 5ER6A 1U5CA 1YDEA 1YWGO 4Q3CA 1UXKA 2WM3A 4FOSA 1H6AA 5BSHA 5JNLA 3SBOA 3H9GA 4YRBA 4G2NA 4A26A 2G82A 1VJTA 2PH5A 5TT0A 3WGTA 4BO4A 2Q46A 1QSGA 1GZ3A 3I23A 3HWRA 1P74A 3LLSA 3AU8A 3R0IA 1PX0A 1NFRA 2IODA 4B7CA 4IS2A 4W4TA 4J0FA 2J5RA 2GF2A 4Y6PA 4UUMA 1U3UA 3G0OA 1XELA 2FSVA 3B20A 1J5PA 2Y0DA 1UP7A 3DZIA 4XYLA 5U9CA 3PYMA 2GZ2A 3ICPA 4QUKA 3ASVA 2DPHA 4XIJA 4MO2A 4M1QA 3DEYX 4J2HA 3LT2A 4CMKA 1N92A 2EV9A 3DTTA 2AE2A 2CMDA 2JD1A 3OMLA 3E8XA 1ISFA 2BELA 1YGYA 4XCVA 3EDMA 3BHMA 4TRMA 3UH1A 4FOOA 4AJHA 3F3SA 4XYGA 4CLEA 2NSDA 5IXYA 2IZZA 4U0JA 4RVHA 2B35A 4AICA 4KQWA 2DTEA 4W6ZA 4CPDA 4IJUA 5EN4A 3ETGA 2R2GA 2Z95A 1EVYA 1DFIA 3ZWWA 3DBHA 1LEHA 3TZQA 4JIGA 2PNFA 1Y5RA 5G0UA 1LC0A 3E9NA 3AFMA 3E82A 2EG9A 1IL0A 3MJVA 4FDAA 3ZWXA 4NFHA 3BTOA 4A5OA 2R00C 3UVEA 3D4NA 3VTZA 3PYXA 1J49A 3ASUA 3GDFA 4GWKA 3QVXA 3T4XA 3WBFA 1EZ4A 4ZGWA 1BGVA 5DOVA 2Y99A 2O4CA 4MVJF 5EERA 1TLTA 1PU2A 4DMMA 2BFOA 1E1MA 3EY4A 2OMEA 2O3TA 2RH8A 4WLNA 2UVDA 1EUCA 2WYVA 2OP0A 1AHIA 4PLFA 3V1UA 5CDSA 2VTEA 3CXRA 1JKFA 4OXNA 1QLJA 1JKIA 1B15A 4RPJA 3PJDA 4R51A 4BNMA 3ZU3A 1SO8A 2DBVO 1H9AA 4UEOA 5CP8A 2O50A 4M55A 3FPCA 4PLCA 4WEOA 5DBFA 2F00A 1R0SA 1SMKA 1ZK2A 2ZYGA 2WSBA 3UUWA 1AXGA 1NTOA 2CD9A 1V35A 4JX8A 4RVDA 4AJKA 2ILTA 5EL0A 4XJSA 5JFOA 4YACA 4TRRA 3WFIA 3S2FA 3ZV5A 1PZEA 4R16A 2OXIA 3F6YA 4FGSA 3VZSA 3WFJA 4TVOA 3ETEA 1P0FA 1XGKA 2CDCA 4PRLA 1P3DA 1Z75A 1SOWA 1Q7CA 3E48A 5T57A 2DTXA 3NDRA 4YYZA 5F5LA 4EJ6A 4ID9A 1H5QA 3S2IA 2IEBA 3HN7A 3KVOA 2Q1SA 1JVBA 4R1SA 2CSUA 4NBRA 1B2LA 2VT3A 3MOGA 3ZHZA 4CMEA 1GUFA 3U62A 4Q3EA 4INAA 3A28A 5COAA 4CM4B 4UREA 2W4QA 1OX3A 5GZ6A 3MEQA 4CM8B 1YDWA 2W8ZA 4PG4A 2Y05A 4IS3A 4TZKA 4BNKA 4DPLA 4J4BA 4GMFA 2UV8A 3JCZA 3GG9A 2GRAA 2O48X 2WWRA 4RPHA 4IUYA 4O0LA 4MIYA 5COBA 3FD8A 1WMAA 2HMTA 5A5EA 5A9RA 4BGIA 2Y1CA 2XAAA 1LDMA 1NFQA 1O8CA 3IJPA 4AFNA 1XSEA 2QYSA 1GEGA 2QZZA 1NXQA 2QZ9A 3IUSA 4JROA 5JYEA 1QKIA 2D59A 1GQYA 2X86A 4BMNA 2VYNA 3NDJA 4L4RA 4U8GA 2Q3EA 3MJTA 4ZVVA 3Q2IA 1DRVA 2YFHA 2DPGA 3BMOB 3KLMX 1IOLA 5JSFA 3GUCA 4N5MA 3HN2A 2C82A 5T8KA 1G1AA 4KP7A 3K6JA 1AA0A 1EDZA 3KZVA 5ENDA 1EE2A 1VRWA 4M49A 5DNAA 2EWMA 3RWBA 2OGUA 4RPGA 2O4UX 4YJHB 3VHRA 1GYPA 1NQ5A 2V6FA 4IQ8A 4UVIA 3PJGA 2OHXA 4EW6A 4R54A 5A05A 4J9UE 5BNIA 2ZCVA 4E6PA 2BLLA 3CINA 2QW8A 3Q9UA 3GNSA 2VWQA 4KUGA 2I99A 2NQTA 1I3KA 5IN4A 3VH3A 5FI5A 4L9RA 3GAFA 4RDIA 1L1FA 1XG5A 3GVHA 1XYGA 2BI8A 2NU8A 4W9NC 3Q2KA 4IMPA 1KIFA 1Q2XA 2ZTMA 3WWZA 4JBHA 4AJ4A 1GAEO 1UH5A 3ZNPA 1DIRA 3CZMA 1E3WA 3T7EA 1YXMA 3T7CA 1BDMA 2B4TO 2HK8A 4IQGA 1UUFA 3VKUA 1MP0A 1HZZA 3UXYA 1EVIA 5DCYA 4O1MA 5CPFA 5L4SA 1HXHA 1WZIA 4IZIA 1LSJA 4ZD6A 4LMRA 3RKRA 3M1AA 1ENOA 4YR9A 1GPDG 3JQFA 4A2CA 3JQBA 4J7UA 4IDCA 1EFLA 2GD1O 3LVFO 4AL4A 1WPQA 1XU7A 5CFZA 1DHTA 4F45A 5AVOA 4B4VA 4A10A 3HFGA 2AQKA 3GVPA 4BNXA 4FD3A 1R4MA 2NU6A 3Q9NA 4BB6A 4WCFB 1QYWA 4K9DA 3RBVA 1QYVA 4CODB 3OH8A 3KRTA 3ROMA 4HY3A 3WNQA 1XA0A 4FW8A 4ALLA 2DQ4A 2GN6A 3BMCA 3RASA 1ADFA 4ZHSA 2PH3A 4FC7A 4HNHA 2NTVA 4P4NA 1ORRA 3KSZO 3TJRA 4L74A 2EF1A 4E5MA 4IGFA 4CV2A 2BI7A 1B8VA 4YPOA 3H2ZA 4CL3A 1U5AA 2EXXA 2WE7A 3DFZA 2IYOA 3WYEA 1VL0A 5U4QA 3GAZA 3DO5A 2Q49A 3OQ1A 1CRWG 2O3RA 2HUNA 1W0CA 2XXBA 2V6GA 4XD2A 4XZ3A 1KY4A 2HJRA 1HTBA 3ICCA 4Y8VA 3K30A 5K9ZA 1FF9A 1R4NB 2HLPA 3B1KA 3DZHA 3DZFA 3MCVA 4LVUA 5TS3A 5CG2A 1NHGA 3DAPA 3WLEA 5JBIA 4DBZA 4GL4A 1I2CA 1RM4A 2B37A 5AXAA 4GX0A 3WQSB 1AGNA 1PR9A 4NR0A 3JQAB 5T64A 4MVJE 4CQMA 3OJFA 2FR0A 4R9SA 3T4EA 3TZHA 4AVYA 4FR5A 4E3ZA 1U3TA 3AI1A 2VZ8A 5K6AC 1ZK0A 3QLJA 3IMFA 2PD3A 1HZJA 4ND2A 3EZYA 4BKQA 1KVSA 4DREA 3L0DA 3HG7A 1ZEJA 1E6UA 2PKQP 3DBHB 3FN4A 2UYYA 5BSGA 1OC4A 5KNLA 3EGOA 1X7HA 3QE3A 1XU9A 4KZPA 3GHYA 3L07A 4RVFA 1P31A 2ZATA 4HXYA 3TDKA 1ML3A 3U4HA 3F47A 2PV7A 4CMEC 1Y8QB 4GKVA 5BNFA 4RLHA 5TNXA 3ZU5A 2XXJA 4FFOA 4BV8A 2I9PA 2VRCD 2YHIB 1PJBA 1EQUA 1GZ4A 3G1TA 4L0QA 4GMGA 5BQFA 1HETA 3VDQA 2UDPA 4D7AA 3LQFA 4P38A 3ZCXA 8LDHA 2TMGA 2DFDA 4D42A 3RU9A 3ANLA 1N2SA 2VTDA 3OM9A 1CQJA 3FBGA 4HFRA 4IIUA 1NPDA 4GGPA 2WTBA 1V9LA 2ZYAA 5U1PA 4YAIA 4MKRA 1TI7A 3ONEA 2PD6A 3DONA 5G0SA 1ULUA 1GV0A 3NT5A 1CYDA 1NQOA 4N5NA 4YJFB 1LNQA 1NQTA 3OQBA 3ENKA 4CQMD 1E6WA 2DU8A 2EW2A 1E5QA 4JXKA 4CMJA 4D3SA 2GN8A 4PLZA 4QECA 2D5AA 3B1FA 3STHA 3I52A 4BNWA 3DHYA 1GYQA 4OSPA 5TF4A 2Q2WA 2O3JA 2C2XA 2IZ0A 3F1LA 3OJLA 1YOVA 1C1DA 5C7LO 2Q1WA 1JU9A 1Z7EA 1E7RA 4HV4A 4WLOA 3AUAA 4DPKA 1HDRA 1NQAO 2RH4A 2X9GA 4WUVA 4DPMA 1TA4A 2C20A 1HKUA 1U7HA 3KYBA 1VJ0A 1PJ3A 2BKAA 1KOLA 1V8BA 1GUZA 3I6IA 5CDYA 3QHAA 4J4HA 4R1NA 4I5GA 4FSHA 1TB4A 2I3AA 4DIOA 2JAPA 1K0UA 2YV2A 3GEDA 3LT0A 1U28A 2QIOA 3DTYA 2BFMA 3OIGA 3SEFA 1UP6A 3INRA 1DAOA 1H94A 2X1HA 5MDHA 4KQXA 4QQRA 4KWHA 3VVBA 4BNJA 1PSDA 1YH3A 3AUSA 1QG6A 1FXSA 3VPFA 4A27A 1K2WA 4A73A 4CM4A 5CDTA 5TGDA 1P1KA 3TL2A 3TWOA 2JCYA 4D41A 4A03A 4DC0A 1LRKA 2DLDA 5IZCA 5HA5A 1LDBA 2V65A 2EW8A 1KERA 2P9EA 4E2ZA 3W1VA 5I7EA 1ZKMA 3UCXA 4ZN6A 4J7XA 1P45A 1E3EA 1YS4A 1ZFNA 5T8KC 2E48A 4YVFA 5LDGA 3N74A 4BVAA 1ZW1A 2VUSA 2PR2A 4OIMA 3KYCA 3GPIA 4BO3A 3IC5A 3TZCA 1V0JA 4IDDA 1HDGO 3JQBC 2E37A 3NGLA 4HX5A 3TQHA 2DBQA 5HTOA 4NFSA 4BO1A 3TL3A 5IZ4A 2A4KA 3LU1A 4BGVA 2O3QA 3ZWMA 4LISA 4BMVA 1V3UA 1HT0A 1CDOA 1GFSA 3LYLA 3PQEA 4NG5A 2NACA 3JQDA 1F0YA 4FN4A 3V1TC 3CKYA 4UVDA 1ID1A 3FRJA 3JQ7B 4AJ1A 4YTEA 2ZJ0A 1WWKA 1E3LA 1MX3A 2BGKA 4OJNA 2OBNA 1YKFA 4IXTA 1MG0A 3JYOA 4WEQA 3D3WB 5IN5A 3DBLB 5C7OO 4MINA 1Y1PA 1BVUA 3EW7A 3TF5A 4NJMB 4RPKA 3W6UA 1KC3A 2OP1A 1P77A 4W7IA 5KWEA 1Y9AA 2VN8A 2OUIA 3GZNA 5IG2A 2C59A 3U4CA 4E4YA 3SJUA 1YOVB 2YYYA 1V3TA 4BO2A 2CUKA 1M75A 3DOJA 1I0ZA 2PWZA 2E4AA 3P19A 5L7YA 2DKNA 1FDTA 3W8FA 3H5AA 3DWFA 3CH6A 4PVDA 3RAJA 3JTMA 1UXGA 5BSEA 3H9JA 1XIVA 3LT4A 1KC1A 1WLYA 5ILGA 2A92A 5JS6A 1RPNA 3BA1A 1X7DA 5AYVA 2JL1A 2DM6A 3FPLA 1YB1A 1A27A 4PGFA 2ZB7A 3L4SO 1P0CA 4B8ZA 4RDHA 4RQUA 3RFVA 3DHEA 2Y66A 4H3VA 4U0KA 3ZU4A 1OI7A 1SOVA 5JYDA 1IUKA 4OYRA 4XRRA 4KOAA 4CR8A 2VHXA 1O95A 3OA0A 4N7RA 4HP8A 5IDYA 4CMIA 4RZHA 3B6ZA 3DFUA 2IZ1A 3GC6A 4EEZA 4BQRA 1I5RA 1B7GO 2J8ZA 3FWNA 3KBOA 3WYBA 2Y0EA 3ENNA 3JQ6A 3L77A 4M54A 4BO7A 5IZCC 5KVSA 5B4TA 4O6VA 3TOZA 3M6IA 4DBVO 2HMWA 4CMCA 3D4OA 4PZDA 1VL6A 1E7QA 5L7TA 3D3EA 1E6EA 5JDIC 1OAAA 1EFKA 1Z45A 1DIHA 3B1JA 3QVOA 2Z1NA 3M2TA 5CDUA 3ANMA 2W90A 4CUJA 5FEUA 3ON5A 2OO5A 3WMXA 2RIRA 4IJVA 4LRSB 5JDCC 4ALNA 4ND3A 2DTDA 2VRCA 1KYQA 4IJWA 4RVUA 3MJ4A 3I6QA 4BKOA 3UGKA 1JAXA 2NVUA 2W2LA 2YHUA 4FJ0A 5EIOA 5HBRA 1O0SA 1NASA 2BFPA 3AM5A 4QFDA 1LLDA 2W2KB 2ZTUA 4M87A 3K8ZA 4HFJA 3OJEA 1Y8RB 2OZPA 1DC4A 4RVSA 4BIIA 1DSSG 3AJRA 3NRCA 4UVHA 4JK3A 4XR4A 1T2CA 1ADBA 3EVTA 1ZXBA 2DUWA 2AA3A 1Q0HA 2GYYA 1R4NA 3RC7A 3DZGA 2GSDA 3H9QA 3QRWA 3PJFA 3ZGYA 3E1KA 3ROQA 3L4BC 1S7CA 4AJIA 3NJ8A 3QQPA 3ZWOA 4EITA 4Q3DA 3VTFA 1NNUA 2WJPA 3PTZA 3E18A 1I32A 3DBRB 4XGIA 4Z3DA 4GH5A 4JLWA 4IDBA 4Y67A 1EBUA 1QRRA 3QV1A 1W4ZA 5L51A 1MC4A 3OICA 4JBIA 5F1KA 3HE3A 1CJCA 2G17A 4IDAA 3U09A 4KTTE 3WOHA 1ONOA 5A9TA 3GUYA 4HADA 3PRJA 4CUKA 4LSWA 4ZICA 1VJ1A 3OJ0A 2CDBA 2CDAA 3E5MA 5JAQA 3DBLA 1PIWA 3GEMA 2J5QA 3RSHA 1YQXA 4Z0PA 5JCJA 3GGGA 4IPTA 2J3IA 1M67A 3VPSA 5FWNA 1K6JA 4E30A 1GEEA 5JO0A 4YQYA 2Q2VA 3SC6A 1BMDA 5JCJD 1NR1A 4IM7A 1N1EA 5THQA 2EJVA 3H5NA 1ZJZA 4FFMA 1NFFA 3F5QA 3O9ZA 5CEJA 1UZNA 1JA9A 1XQ1A 4PG7A 3LK7A 1B26A 3AWDA 4CM3A 4M86A 2D0IA 4AG3A 3G17A 3IIEA 3GLQA 5TLSA 2JD2A 5I9LA 4D45A 3X2EA 3GHHA 3ULKA 2IYPA 1WZEA 2Q4BA 5TJ9A 1AXEA 1FMCA 2BMAA 3F4BA 4NQZA 4QSMA 2X0IA 3COSA 3RFXA 4OKIA 1PZHA 3RQSA 1UAGA 3MOIA 4NK4A 5B37A 5DT9A 1PGOA 1A4UA 1ZZEA 2J3KA 1PEDA 1KBZA 2E82A 1LSUA 4E5YA 2H6EA 1X1TA 2WD7B 1A7AA 3LZ6A 5IJZA 1DDOA 3RD5A 1T24A 2HCTA 4LRTB 4BNGA 3TZ6A 3GDGA 3D4PA 3SXPA 4TZTA 3ZHXA 3WGIA 4Q3BA 4A0SA 3PZBA 4J0EA 2JFFA 5DOZA 1PQPA 2W2LD 2NWQA 4C7KA 3F9IA 3RUFA 2JHGA 5T6BA 1GD1O 4MDHA 3NKLA 4BNFA 4YXFA 4BUCA 4XA8A 2VUUA 4WNCA 2V7PA 3MJSA 2OORA 3K92A 2BGLA 4LCJA 4DGSA 4Y6SA 1Z74A 1D8AA 4WKGA 5G0VA 5A03A 1Q7GA 3RC9A 2A9FA 1PL6A 3I9OA 2Q1UA 4P8RA 1T2AA 3C85A 1QYDA 1W73A 3I83A 2Y1OA 4CR7A 1I36A 4ITUA 3WBBA 3V8BA 4HUJA 4XQEA 4YWJA 3D1LA 1O89A 4MOWA 1CF2O 5TQVA 2VQ3A 1TT7A 4DIBA 4Q9NA 3I5MA 3VZPA 4FFNA 2Y1FA 1F8FA 2EEZA 5ES3A 1LLCA 5KJ6A 4DLLA 2HK9A 1DBVO 4I9UA 5CPBA 3WYCA 2OFPA 1O94A 3S2GA 2VWHA 1D1TA 1BW9B 5JE8A 1SAYA 4FPXA 5L40A 4QEDA 3RKUA 2FPIA 1GV1A 1QLHA 4B8WA 3H6KA 4U5QA 4BNZA 4CM7A 1LDGA 5A3VA 3RBXA 1ZCJA 1DPGA 1SB9A 3AW9A 4ILKA 3ITDA 4RQTA 3CPSA 3FBTA 3ZWPA 1LA2A 1UZMA 3OEWA 3UF0A 4MVJI 3AI2A 4F6CA 5EESA 4NBTA 1PS0A 1E3JA 4WCFC 4EJ0A 5HRUA 1SC6A 4GLOA 4CMAA 4PZEA 2IRWA 1UAYA 3GEGA 1JKJA 1XWFA 4CUZA 4EUFA 3PHHA 3WICA 3RIHA 3GGPA 3QWHA 4PLWA 5JC8A 1PS9A 4C4OA 1Y8QA 1A71A 1T26A 4AJJA 3DHNA 4IGEA 1K89A 3HHPA 1LLUA 4TMFA 1ZIDA 4ZRNA 1WAMA 3MJCA 3KM0A 2ZJ1A 1EQ2A 1HE3A 2VWPA 4XB1A 4DC1A 2GLXA 3DBRA 1RYEA 3UAGA 3BHIA 3WIDA 3GN2A 3RROA 3DMYA 4MP6A 4FFPA 1L7DA 4E13A 3H3FA 2GR9A 5I9MA 4E2XA 1FDWA 2FP4A 5LCXA 4EZBA 2SCUA 2NVWA 1UP4A 1IHYA 4CM9D 3UW3A 1IHXA 5A3JA 5CEEA 1XDWA 3E9QA 5I8WA 1NVMB 4UULA 1HWYA 4BNVA 3KLPX 3VVCA 4GKBA 1C0PA 3VAZA 2YQ5A 2FN7A 3IP3A 5CG1A 2Y1EA 3H4VA 2VZ0A 4GPD1 5EJ2A 1UXHA 3BMQA 4N18A 3DL2A 1LJ8A 1EVJA 3M1LA 4G81A 4W99A 4NNJA 3E5RA 4I1IA 1C0KA 4BL5A 2D1YA 3TZKA 1T4BA 2EIHA 4YDRA 4D3FA 2YV1A 5JY6A 3KUXA 1I30A 3RC1A 4AJPA 3MZ0A 3G49A 2X5JO 3ZU2A 3W4IA 1JQBA 2NTJA 1D4FA 3LC7O 4WOJA 4BGUA 1BRMA 3PXXA 4BHTA 1I10A 3LC2O 1ENPA 4BKPA 4GI2A 1I8TA 4BNUA 4ESOA 5AXDA 2EKLA 1DJQA 3CE6A 2ZYDA 1E3WB 1LQUA 3GMDA 4Y98A 4XQGA 4DVJA 1B8PA 5A1TA 1QV7A 1LUAA 4GX1A 5ILOA 2C5AA 1JWAB 4KDEA 5EQFA 3AOGA 3ORFA 4PG6A 1B8UA 1G0OA 1PQWA 4B79A 4RVGA 4MP3A 4DXHA 4CMBA 4FJ2A 5G4KB 2H1SA 3SX2A 3O8QB 1FDSA 2BFAA 1C3VA 3U4IA 4J6FA 2WYUA 1ISHA 5COQA 2GZ1A 3BYZA 3GFGA 3G1UA 3PHIA 1KS9A 5A06A 4CM5A 2UUOA 1T25A 4LK3A 2VHWA 2ZB3A 4YRDA 4GVLA 1J6UA 2HRBA 3HNPA 3OFSA 1HE2A 2I76A 3BHJA 2WD7A 1UDAA 2FMUA 1JWBB 1WDLA 1HE4A 4PLPA 4W9NA 1YJ8A 4YQZA 1LSOA 1I24A 3O38A 2D4AA 3BMNB 3FR8A 4CJXA 4BGEA 3WJ7A 3PDJA 3UN1A 1CIVA 1PJ2A 1LRLA 3JYLA 3W4JA 3NTQA 1PWXA 5KJFA 2P2SA 3TNLA 3H9UA 3QSGA 2EHDA 4WLVA 1CWUA 2W98A 1PJCA 1ADGA 1DXYA 2UUPA 3DB2A 2XPCA 2PLAA 2P4QA 1DJNA 1NYTA 2FPGA 3VPXA 5A04A 6LDHA 2RBEA 3GVCA 1E92A 1R12A 4XDZA 4JQCA 2NVUB 3L6EA 1HDYA 1P33A 4AJ2A 3W6ZA 3KHUA 1NM5A 1DC3A 5IFLA 3JQGA 3TFOA 1YVEI 1W8DA 1N9GA 2GZ3A 2HK7A 3ZN2A 1Q0QA 5KOIA 3OECA 1VE9A 3PFFA 1VC2A 2JD0A 3IJRA 3BTSA 1R16A 3OIFA 2X5OA 4NPCA 3HB4X 3SLKA 3QWFA 3FCOA 2B0JA 2HAEA 3GNTA 5JW6A 1FJHA 4K6FA 4S3MA 3BMNA 3NJ4A 4J4TA 1BVRA 3A4VA 4TKLA 1RJWA 1KETA 5TX7A 3WNVA 1HDCA 1BXZA 3C1OA 1NVTA 3NV9A 3WGHA 3EVNA 4CLXA 1N7GA 5KJEA 4BNLA 4MIOA 2JCVA 3MWEB 1ENZA 1LSSA 1B3BA 4B7UA 5ENVA 1YBAA 3GZ4A 2B5VA 4L75A 2Q99A 4MVJH 4YAGA 3BXXA 5TT1A 3QY9A 1RM3A 4IQ0A 3KXDA 1PZFA 1C14A 1QR6A 5BT9A 4EI2A 5K0ZA 4AJEA 2G76A 2WYWA 4RORA 3HZZA 4K28A 1MFPA 3DAGA 4QTZA 4BKUA 2DAPA 1IPFA 3JQAD 3JD4A 3ZDFA 5L53A 2VOJA 3LSYA 1HE5A 1PJ4A 4JN6B 1UDCA 3KEQA 2YHIA 3RUCA 3SLGA 2NLOA 5JMWA 2AXQA 3VKVA 3ADOA 3IS3A 1I33A 3HDYA 1JW9B 4OMUA 4UEKA 1N7HA 1P1RA 1ZSYA 1U3WA 1ENYA 4L8VA 3WWYA 2ET6A 4F3YA 5KVVA 4BO5A 1ZMTA 5JY1A 1U7TA 2YQ4A 1R66A 2O7SA 4NZ9A 1Y81A 3Q11A 1HSOA 2VNAA 1AN9A 2H5LA 1SCUA 5IDQA 2GPTA 4JCOA 4YEDA 4Z9FA 2I3GA 4L76A 2C54A 4QXMA 4OO3A 3AM3A 2VOEA 1Z82A 1U4OA 2BRUA 2D3TA 3H5RA 1HL3A 3GH3A 5G2OA 2VZ9A 2WMDA 3EZLA 4NJMA 5FF9A 4TWRA 1P44A 4ND5A 2C0CA 1NAHA 3BTUA 7ADHA 1RM0A 4DQXA 4HFMA 4XGNA 2QRKA 3QVTA 2WD8A 3PIIA 3BTVA 3PI7A 3D64A 1ZH8A 3JQ7A 4PVCA 5HM8A 1KEUA 4YJFA 1B16A 4BNNA 4X54A 5FI3A 4KTVE 3RJ9A 1R4MB 2GASA 2OL4A 3DC2A 3H9EO 2P9CA 2FSSA 4ZJUA 7MDHA 4NFYA 3U4DA 2B69A 2DVMA 4J90A 4XKJA 2HQ1A 1GY8A 1R37A 2YW9A 4F46A 3V1YA 3PEFA 3ONDA 1SB8A 3RC2A 4YT8A 3CZRA 1H2HA 4JP3A 3UKOA 5L4LA 3ZH2A 1E7YA 4DYVA 1KEVA 4MIEA 5H82A 1F8GA 3K73O 3ZW8A 1DLJA 2C7GA 3K96A 4NBUA 4II2A 1GQ2A 5TJHA 3QWBA 3RUAA 5F21A 1ZNQO 3OQ6A 3ZW9A 2CY0A 3NAQA 3ZWNA 4BNHA 3I4FA 3DZJA 4JNKA 4DWVA 4E0BA 3DBVO 3A9WA 3K2EA 5GZ1A 3WG9A 1BXGA 3WGGA 4PN3A 5TSDA 2NUAA 1JLLA 3TPCA 3Q0EA 1T2DA 4B4UA 4BOYA 4D43A 3GZNB 4RPLA 2A35A 1U9JA 1C0IA 1P1FA 4EJMA 4TQGA 3MWDB 3N58A 4OOFA 4GWGA 3ZNQA 1A72A 4XYEA 2PKRA 1UXIA 4PFJA 4S1VA 1LBEA 3IDSA 2EGHA 1GR0A 4QO7A 3ITKA 3WMWA 2JJYA 2NADA 2PZKA 1PJQA 4DQVA 1E3SA 1I2ZA 3GVXA 4DLBA 2NVBA 2PGLA 4JJFA 2CNBA 2EKPA 4G65A 1PJLA 1X1EA 4WCFA 3ST7A 2DBRA 9LDTA 3HDJA 1C0LA 5BR7A 4NU5A 4YJGB 4PZCA 4WNIA 4JGBA 1Y9EA 4BB5A 5MGBA 4E32A 4R41A 4WJZA 1XKQA 1A4IA 3V2GA 3AOEA 3AY3A 2B83A 1V6AA 2Y67A 3EHEA 4L73A 4UAGA 2J3HA 4HWKA 3PWZA 1H6CA 3ONFA 3TFQA 2FWMX 3CEAA 3EYWA 4YJHA 3LLVA 4CLOA 1JAYA 1Q0LA 4WGGA 2JFGA 3KEOA 1KVRA 4ND4A 4WECA 4RF2A 5KKCA 4E5KA 2I6TA 3PHLA 2FRDA 2IEDA 3PJEA 1LLQA 6ADHA 4DQUA 4XIYA 4DUPA 4YCAA 1P1IA 3MTGA 3NGXA 1EBFA 1C1XB 4BO9A 2YDXA 1KEPA 2E6UX 3C1TA 4I5EA 1X0XA 5JCXA 3MJEA 4RJTA 1PTJA 1B0AA 2FPPA 1X14A 2PZJA 2AEFA 2AG8A 3JV7A 3K5PA 1QV6A 2RAFA 4NHEA 3R1IA 5DP1A 5KIAA 3W8EA 3GG2A 5JDCA 3GN1A 1PL8A 1YQGA 4BNYA 3BAZA 5IDWA 4J49A 3GY0A 3VZRA 2FOIA 5A9SA 3JQ8A 3NT4A 4GVXA 4P4GA 3K9QO 1JN0A 2EP7A 4PLVA 1LU9A 3ZWBA 1FDVA 2X6TA 1MC5A 4I8XA 3OF2A 1PGPA 1PR3A 3O8QA 5IAAA 2AMFA 2E49A 4EEXA 3C7AA 3FHLA 2O3UA 4H15A 1PZGA 1J4AA 2PD4A 1NX6A 4M8SA 1LDNA 5TC4A 5CEFA 5LDHA 1GDHA 4ZQHA 4YJGA 4II3A 4XX0A 1NPTO 5GY7A 3WSWA 3NT2A 2HRZA 3L4BA 2VHZA 1I2BA 1D1SA 2DFVA 5AXCA 4GSLA 2BH9A 3EUWA 1TT5B 4CLHA 5I8ZA 1X0VA 4UUPA 1YBMA 1PQUA 3JD3A 1MFZA 1ZK4A 3PLNA 2PTGA 4CV3A 4JBGA 1T4DA 1JVSA 1HSZA 4UEJA 5ADHA 3C7CB 4PCVA 3TN7A 4K6CA 2PZLA 1BTOA 2GGSA 2YJZA 4OQYA 3RBZA 3JYQA 4GX5A 3VZQA 5CAEA 3UHAA 3GGOA 4CV0A 3FI9A 3EAGA 3V2HA 4NDNE 4CM8A 1ONPA 5C37A 1L7EA 1O6ZA 1WMBA 1ZUD1 1DFHA 3FNGA 4CQLA 4KUHA 3D3WA 3DMTA 4XR9A 1HDOA 4J7CA 1DRUA 2YUTA 3S1LA 4ALJA 3JYPA 1ZK1A 4W7HA 1K6IA 2B4QA 3AFNA 4GAEA 5JDIA 1OMOA 3WS7A 1ZSNA 1LQTA 3CTVA 2I5PO 2OOSA 3JQCA 2IXAA 4BNIA 4J16A 4DA9A 4IDGA 3PK0A 5FFFA 1DO8A 4YT4A 1JDJA 2VYVD 3D0OA 4KMSA 1WDMA 1YQDA 3L6OO 4B4OA 3KETA 3FNEA 3NTOA 3QP9A 4MKZA 1IZ9A 3IKVA 3PVZA 1DOHA 1ZMOA 1KVQA 1PJSA 3WX0A 2J3JA 3PHJA 4TSKA 4C7JA 1K5HA 1MV8A 1NR7A 1CERA 3JD0A 3WGZA 2J6IA 1HYEA 4CLRA 3O4RA 4XGKA 4TRNA 4Z0HO 3DR3A 3OEYA 5A02A 3WGYA 3L6DA 4J91A 5EINA 1MA0A 4B3JA 2X9NA 4XYMA 2GN4A 3U5TA 3F5SA 4IXWA 4LMPA 4MVJA 4O63O 4ZRMA 4J1TA 4IY1A 3NTRA 5B1YA 3VDRA 1LXCA 5DULA 3JQ9C 1ZK3A 2XF8A 4DLAA 3O03A 3ZHBA 4OM8A 3P2YA 3ZV4A 1DEHA 2IE0A 1GYRA 3GT0A 1U2GA 3HDQA 3RUIA 4IZHA 1YB4A 2JCXA 3U49A 3GNQA 2PKQO 4UUOA 3WTBA 4FIZA 1N8KA 5JO9A 1BHSA 1Z6ZA 3GRPA 4NI5A 1WVGA 5L9AA 5T5QA 1ISMA 4GQAA 1VL8A 5L45A 2WEKA 4CQMB 2Z5LA 4EGFA 2TMDA 4IINA 2IXBA 1I01A 1B3RA 3DZBA 2AW5A 5LC1A 1I3MA 2HU2A 5DP2A 3IP1A 1EVZA 2F1KA 2HSDA 4CMGA 3VH1A 2LDBA 1Q1NA 1W6UA 1U3VA 1VKNA 3A06A 1IPEA 4D3DA 4QO8A 2PGJA 3VPHA 2CVZA 3ADPA 4FBGA 3S8MA 1Y6JA 4MJLA 4DRYA 4P22A 5GZ3A 1LX6A 2QX7A 3H3JA 5EQDA 1VKOA 3CMCO 3JD2A 3WGQA 3CIFA 2HKIA 5IF3A 4LN1A 3TSCA 1Z73A 1T2FA 3P7MA 3M2PA 1BXKA 3K31A 2YFQA 3LT1A 2FZWA 2I65A 3C7DB 3E6AA 3UOGA 1RWBA 2BD0A 1YB5A 3GF4A 4ND1A 5F3RA 1D7OA 1IY8A 1WDKA 1DIBA 3TOXA 4WPGA 4D44A 5CHEA 4Y9DA 4MKXA 4YT2A 1PGJA 1Z7BA 3AI3A 5THKA 2D2IA 4HNGA 4PG5A 4BMSA 1UXJA 3HJAA 1MXFA 1QP8A 1DAPA 1HYHA 1KVUA 4MVJG 3I9KA 2DT5A 3ZNNA 2EGGA 1EUDA 2HDHA 2HMSA 3OP4A 2NU9A 3HQ4O 4OXKA 3RUDA 3S55A 2Y68A 4FJ1A 4ZQBA 2PGDA 3FTPA 1A9ZA 3VH4A 5B4UA 1FDUA 3HADA 1OFGA 3ETDA 4GGOA 4YRAA 2GERA 2X0RA 3CSDA 4LVCA 3UCFA 1YJQA 4I9NA 2CVQA 5BSFA 3WQRA 2FHSA 4OOEA 2POQX 3F1KA 3NUGA 3EMKA 5T67A 2EJWA 2BGMA 2IDZA 4DTIA 1U2DA 3G3EA 1K3TA 1TEHA 3PLRA 4OQZA 1M66A 1ARZA 3OA2A 4NK5A 1ZO8A 2AQIA 5I7VA 4LSMA 4YAEA 3JQGB 3I4CA 3D5QA 1M6HA 3D7LA 2WDZA 4RV9A 5EMHA 1OZAA 2YV3A 3AUUA 4N5LA 3HB5X 1HYGA 3AOEC 4J1SA 3RCBA 1ZBQA 3KYDA 5ER9A 1Y5MA 3ABIA 5L7WA 1YRLA 5A4DA 2P5UA 5BNTA 3W8DA 5JMPA 5G4KA 1PS8A 1XR3A 2B36A 4Y6RA 5JPIA 2G5CA 2HJSA 2DBZA 1CQIA 2FR8A 2Y93A 5KVQA 3WQQA 4IIVA 1E0DA 1R6DA 1LTHR 2X5KO 4E31A 2Y1GA 4R3WA 2V6MA 3GOHA 4OKNA 4MVJP 2VWGA 4R69A 4MP8A 4XEHA 9LDBA 2Q1TA 2EERA 2H9IA 1HF3A 2D8AA 4IJKA 2I67A 1CEQA 1E1LA 1PGQA 1GCUA 3GK3A 3X2FA 2CVOA 4CLOB 5KJ1A 4GX2A 2X9VA 3RVDA 3WXBA 4E2WA 3R3SA 4B3IA 4FS3A 3SC4A 1UJMA 4PIVA 1ZEMA 2VRBA 3GVIA 2FZEA 2X0JA 4R9RA 2ZQZA 4Z0TA 4WASA 5DBGA 3DOCA 5DN9A 2C29D 4Z9YA 3V2UA 3BMOA 3INTA 5ITVA 5FYDA 3NDIA 4EBFA 1UDBA 1ISGA 5B12A 4P4LA 1JTVA 4PLHA 2GDZA 3DQPA 4PG8A 4MVJM 4NBWA 4JJIA 4OSOA 2YY7A 4ZQFA 3ZZNA 1U4SA 4BKRA 3GPDG 3K2BA 3PWKA 1ISIA 4FB5A 2C07A 4U6SA 4DIFA 1GUYA 2Q45A 3C8MA 5K6AA 1YO6A 4E5NA 3IQDB 3R6DA 1F14A 3RUEA 1RM5A 2W2KA 4N54A 1QORA 2VHYA 2FR1A 4I08A 2WE8A 4QFCA 1I3NA 2UAGA 3PP8A 3FNHA 2RHCA 4MPDA 1DLIA 3BMQB 1R0LA 4Z3KA 4OH1A 3I3OA 3QVWA 3KV3O 1E1NA 3GQVA 1GU7A 2PK3A 1V3VA 4EUHA 4LGVA 3KOUA 1GTMA 4I9HA 1PGNA 4K26A 5EPOA 2G0TA 3Q6IA 3PZRA 1UZLA 4BNTA 2CZCA 3BZUA 4H7PA 1BG6A 2O23A 3A1NA 3KTDA 4ZA2A 5TIIA 3H65A 3H8VA 1SZJG 1DIAA 3HUDA 1Q7BA 3GDOA 3OBBA 4PLGA 1HDZA 2I66A 3C3XA 4TRJA 2X8LA
chains in the Genus database with same CATH superfamily
4E15A 4J16C 13PKA 4H31A 4W9MC 2DB3A 2VCYA 2QP3A 1EK5A 1PT8A 2ZWMA 1RADA 4QBIA 4D57A 4EKNB 3RU2A 4QOIA 4ZYTA 2PUFA 3I1IA 3F8WA 3WTCA 4ARCA 1KHHA 2ZVJA 5G0WA 3GJZA 1GTL1 3P5SA 3VDMA 2I1VB 2SKEA 2G28A 2KSQA 4PHFA 3CUKA 3DOEA 1Y48E 4BY9E 4PD4H 2AMYA 3MTJA 4L9SA 2B3DA 3WIEA 3DAFA 4B3HA 3NIGB 3A0UA 4KDFA 1G98A 1R0YA 3MINA 4R2MA 2FZKA 4K7JA 3Q3CA 5LVAA 1G1IA 1P84E 4LI0A 5KB3A 1VKZA 3DE2X 3HLTA 1G8KA 1WXDA 1LK5A 2G36A 2HBYA 4FQ8A 4X1KA 4JI6B 4OUKX 2X0KA 1IK9A 2X0NA 5FJJA 3ZY2A 1QDUA 2DUUA 2H5IA 4FUQA 1NQUA 1QHGA 2WBLC 3I28A 4P5PA 5BR4A 1F2DA 2H3HA 2CHEA 2V6BA 3SKVA 1DC5A 2GRUA 4YJKA 3ZGNA 1J23A 1HLPA 1PQ4A 5FOUA 1SM4A 1YULA 3CUYA 3DM9B 4DLWA 4YCCA 3D6VA 4A2QA 5DM60 4FHDA 1N2OA 4EG8A 4MKIA 1BOOA 5FFMA 4QARA 1KSGA 2C03A 3GFVA 5L95A 4FGJA 2EP5A 1DADA 1KAHA 5LOVB 1BSVA 4TROA 3G59A 4XYBA 1NW7A 5ED4A 3JWJA 2WUFA 4C03A 1Z7YA 4OQPA 4BQOA 4CFYA 2ZSAA 3TTYA 1N9GB 4R8VA 1FFXA 2VQDA 5CTAA 3KYCB 2V0GA 1GZDA 4HQOA 4UQPA 1KILD 5I5EA 1J39A 1RKXA 4CIWA 3LHIA 1GADO 2RK3A 2I91A 3BJRA 2C9LY 3LGSA 2Z5HA 1GPNA 4RIGA 3K9HA 1P0MA 3H1KE 3UV6A 3PJSK 1K1EA 3GPCA 5JAIA 4LF5B 3CMEP 2QIWA 1E1KA 1NAIA 3H0KA 3PGVA 5KDDA 1R0WA 1PWHA 3VYIA 1ESNA 2XGJA 3UK6A 1JI3A 3N7AA 2P6RA 1G63A 1XRQA 2A5FA 1C1XA 2QJOA 3OLVA 1PF7E 3KZKA 3I1JA 1UFKA 1IJDB 3L75D 3NOVA 1ISPA 2JAHA 3F7MA 3AK4A 2YXRB 2PP6A 3N28A 3TECE 5AHRA 2M2IA 3OIDA 4LFAB 4PFKA 4DM3A 3LYUA 2WTXA 1RAHA 4D3XA 4PNEA 4BFLA 2IWHA 3AFOA 4W5NA 4HEA1 2ZTVA 4G36A 4YUZA 1UIXA 3H6GA 4B6FA 4H44C 5KOJB 2I6UA 4L5YA 5K2OA 3ZCSA 1RE0A 5DZSA 4RAOA 2VAVA 3D3NA 1SQXE 3JQ8B 3R7LA 1SXPA 3B7PA 3OZWA 4DMLA 5KQGA 3ZQ4A 1GL6A 1GL7A 2XZLA 4FZ3A 3VP8A 3IUJA 1IK6A 5EQJB 4MKHA 2NV6A 4IG4A 1KILA 1E7MA 2PSHA 2YZ7A 2ZFUA 3B12A 2I6SA 3PGMA 4ZT5A 3RF6A 3EK2A 4AW9A 3E81A 5BV0A 3WI7A 4F2WA 1I1OA 2O0KA 4E46A 1DFGA 2QTVB 4P0PB 1O0CA 3QKSB 3CCRP 5E6RB 2YIDA 1AH2A 3OESA 4L72A 1RWWA 1ZJJA 3ANYB 5JJBA 2JFNA 2Q3BA 2XBLA 4N7BA 3KQMA 1RZVA 2V98A 3HB0A 4OU5A 1GUDA 4NOKA 3E7KA 4DAOA 4G5HA 1N0HA 5J4YA 2QAGA 1OOEA 1V45E 1W30A 3FPGA 4DL9A 2A5GA 4UUNA 2L91A 2RHRA 1HEUA 4KQ1A 4I55B 3AJ9A 2IQ5A 4OXRA 4BTEA 2VA9A 2CXXA 4EYEA 1N1GA 1FTYA 4EHDA 1HFWA 3WDSA 1VLHA 1FS6A 1SXHA 1Y4ZA 3RK3C 4TKMA 3E27A 2L2QA 1I4WA 4I3HA 5CDHA 1L0BA 2E42A 3AEYA 5I9SA 4EYKA 4LPSA 1LW6E 4GR9A 4G0QA 1R8SA 2PSDA 1AY0A 4E03A 1PSZA 4KBFA 2BHLA 1SJ9A 4G1UC 2J3EA 1XDBA 2FV8A 3MBKA 4V1CI 2I9KA 3X1ZA 1BCCD 1CG6A 2HREA 3GJQA 4EJSA 1TU4A 3E9RA 2C61A 5BW8A 5IJ0B 2PY6A 4M7OA 1FFHA 2BN4A 5JAMA 1KRHA 5APTA 4IHJB 2OBYA 2Z3VA 3F46A 3KBBA 4CG3A 5C4MA 4MI6A 1IYZA 4B40A 5CDGA 2QUBA 3WL3A 2ZB4A 1DHRA 4KO8A 4YO7A 1LNZA 1KWGA 1IWOA 5LA6A 3IT3A 1NTKE 4UHHA 5L3ZA 4PZZA 4QT0A 3UYLA 1S6YA 5IC6A 5JAZA 2HO5A 3GA0A 3RVLA 1DB3A 1U0JA 1JI0A 3BIOA 2QSJA 2VUTA 2ZR0A 3OAAA 5H8WA 3C24A 3LZCA 1EZVE 1XRRA 4FFRA 3PPIA 4EMTA 4XCXA 3AEDC 1F7UA 4F3TA 3QF4B 1JL3A 2NPIA 4Y28J 3AG6A 4YRJA 1EUZA 3FTCA 1JG1A 2I0FA 1JU3A 4I6MC 1D2HA 3CKKA 1A7KA 3GJ4A 4FLEA 5LFAA 1QHHB 2ZT8A 2W93A 5HK9A 5APWA 2ZKLA 4XRGA 4Q4JA 1YKGA 1JTHB 3R8CA 5ICMA 4LCEA 3CYFA 1Z6PA 2WF8A 1N2EA 3EC7A 3LDGA 4CLRB 2KLVA 2H85A 3H5IA 5BV8A 2VS1A 4D97A 4I1PA 4F96A 3AC0A 5BVGB 1TO6A 1BMQA 5CYPA 1VLLA 1WKCA 2HADA 4GLFA 4RD0A 4YQFA 1XL1A 2Q5QA 5K0CA 4KIWA 2H06A 4CWAA 3I6BA 5AW1A 5KSYA 3MWEA 1NL3A 4EFMA 1Y1TA 1O58A 2GPBA 3GMSA 4L9WA 4JY7A 3CTMA 4MB2A 3EBLA 3ZV3A 3ZLJA 3MHVA 1CRQA 4OL9A 4BC1A 3KSDO 3G0IA 1I4DD 1MJGM 4CKCB 5F9MA 5M2QA 1SU6A 4GI1A 2VPPA 4FWIB 1JDZA 4BP9A 2PO7A 3CF0A 2GAIA 4YB8A 4YBZA 1OASA 2IVFA 4C7RA 2BMFA 1M1JA 1G20A 2GTHA 1XTRA 3UFXA 2N1TD 1EZZA 1KHTA 1NQVA 1P5HA 3K6RA 3PB3A 1Z2AA 4EOTA 1SC3A 5G4LA 1V48A 3QW4B 4DLYA 2HI0A 2JLWA 1XWIA 2X23A 1D5CA 1OYWA 2BI4A 4RY8A 1QIDA 4LNUB 3WQBA 1XYVA 4B7XA 1IIRA 5KJCA 3M0AA 3L0PA 1MO2A 2HODA 1JKXA 3JAWA 3PGXA 4B9AA 4EO7A 5C3MA 4RTMA 1YBVA 4FGLA 1EFTA 1SQBK 3IUPA 5LMCA 1Z17A 1I3LA 3PNBA 3A27A 5BN1A 4B81A 1QIIA 2QTBA 1NKSA 3O92A 4JI2B 2PT7A 3CMMA 4JJKA 3VPGA 1CUSA 2ZJ8A 1FP1D 3B1XA 4DWJA 3CB4A 2HCBA 3C39A 3IQWA 3CC7P 4DLZA 1LDYA 2PX8A 3ZDYB 2LXBA 2AD1A 5KTOA 1NVGA 4FW9A 4OQLA 1Q7TA 2FUKA 4GOXA 5T41A 3UO8B 4B33A 2MMGA 1T9CA 1FSFA 1KQLA 1L7VC 3CA8A 4J9VA 1AJYA 4YRTA 4OQQA 5AVSA 3SQLA 1XTGB 4ER3A 4G5YA 2ZUVA 1IULA 2WPQA 2XE6A 2PA3A 3OZ7A 4N6OA 5CIQA 4YCLA 1RTKA 2YWGA 3L9WA 3NWJA 2C57A 4RK6A 5AVWA 1CR1A 4Z51A 1PKXA 1IHDA 2VDKB 1XQVA 3OHSX 2XB2A 4RLSA 2FFHA 2IDKA 4LZPA 5A5DA 1R9GA 4Q16A 2QM7A 1NLFA 1UMBA 2Z57A 5H16A 1O9BA 2R7MA 3JVVA 4YAJA 5ICFA 4NCHA 2CBZA 2WABA 4QJ3A 2HV9A 1T9HA 6AT1A 2CXSA 1OW7A 1NTZG 5KLVD 3FDIA 4Q4CA 3C1UA 4O59O 3ZE1B 4N76A 3F6EX 2J5KA 4B3TB 3UOWA 1DJMA 2PLRA 1T6XA 3WYGA 4F7WA 2X2FA 1QK3A 2NTEA 3LDFA 5KDLA 4AJNA 2X22A 4CDNA 3RFTA 3V3KA 3HA2A 1LVHA 1D2MA 3KKOA 4BLSA 5A9SB 4OIFA 1KZ4A 1QV9A 1D6SA 2QRGA 3OQIB 3PYLA 3SYMA 1N78A 4LDJA 4J1QA 1L5FA 1Q86Q 1AVYA 4K1LA 2DW3A 3ORHA 3GEHA 1IOVA 2UVPB 4CHGA 3A1UA 1HH4A 3RRBA 5CBNA 1K66A 1WQ3A 3ELUA 4DA0A 1OVRA 2O01N 1IE3A 1WF3A 2NQ8A 3G82C 1PL7A 3OWHA 4WOKA 5ECWA 5CLGA 4CL8A 1NPYA 1Z4JA 5CCEA 2WQ6A 3QJ5A 4MGZR 5JXWA 5D8DA 4OGFA 1XLTA 1OVUA 1L4MA 1T9GR 1I1HA 1AUPA 5J4LA 1OZFA 1ECGA 2WTEA 2CPSA 3EQ8A 4JVMA 5C7IO 2CXPA 3IDAA 1NNLA 4Y2UA 4OGWA 4MVWA 1XV5A 4E7OA 3T3DA 2YO2A 3WR5A 5FOVA 3K0FB 2IYYA 3BWYA 1TUGA 1JAHA 2WHQA 3JQAA 4M9ZA 1ZRSA 1N73B 1KB9I 2CCJA 5DCUA 4F4HA 4KPUA 4P93A 3C97A 2A0FA 2EZ4A 1NOKA 1PLKA 2AWOA 3F74A 4YUVA 3V48A 5IT4A 3L2OB 1KJWA 3F7TA 2WW8A 4EX7A 2BRUC 3AF1A 2BGUA 4DRXA 2ZEJA 4V02A 2JS7A 3EA0A 5HIAA 2H11A 1X80A 1SQVJ 3QPVA 2KS1B 3LCUA 2FPLA 2BTQB 2JGDA 1UR5A 2Q29A 3CX8A 3P0EA 5DHRA 3BKXA 3CVJA 2IBZD 1D04A 4LDPA 1ESDA 2XYVA 2FFRA 1FLNA 5T7BA 4BBAA 2FYUK 3VOSA 1DT3A 3E1GA 5MFPA 2J9FA 3LC1O 4UBLA 4EF5A 2PIAA 4KU4A 3GW6A 4U7HA 2LCIA 2PMWB 4Q9KA 2P9GA 1CZQA 4I81A 5IM4A 3LXMA 4YREA 1P1HA 2ZBUA 1YZFA 2FYTA 4OQXA 2LKDA 1L1EA 2QVLA 4MUIA 4NHOA 3RUHA 2B30A 2XUAA 3DTNA 1YRHA 3HCFA 4WK2B 3SE0A 3WDLA 4QWWA 1L4AB 1VI2A 3G79A 1SUAA 3O8RA 2PUGA 5AM0A 5AJYA 3MB8A 1Q11A 2P68A 3N7UA 3C7KA 3DMNA 3ECSA 3V42A 4EG6A 3U7RA 4OBXA 5FADA 1L5WA 5BQ3A 2ZFCA 3OMXA 1HDXA 2VP4A 3D5TA 5AOVA 1E2IA 5CGZA 2LDXA 2FWPA 4R68A 1XZGA 3ROPA 3U19A 2O1WA 2CF6A 1X0TA 2ZIAA 2MR5A 5AW8A 1U0BB 4I6JA 2CD7A 2IEZA 3EFBA 1F1JA 1U5CA 3JARB 5IU6A 1UXKA 2P2DA 4FONA 2GDJA 2RH0A 4HDSA 1NH4A 1H6AA 5JNLA 2PQMA 5B5EH 1KB9E 3EQ2A 4U1RA 3W6NA 1MEOA 1LBSA 3H9GA 1FC0A 2ZRFA 1WCYA 3KNZA 2WWTA 3Q3VA 5IBQA 4YRBA 3WL7A 4MCIA 1V1RB 4D3ZA 1WKVA 3DL4A 3QBTA 4V0RA 1EJ6A 2QRNA 4A26A 2PH5A 3B1YA 1AZWA 4EYQA 5I4CA 3EGEA 4QTYA 1QSGA 1DH3A 2IL1A 1GZ3A 1VB5A 1ES9A 4KE8A 3I23A 4P4SB 4UE6A 3FWYA 4AZSA 1Y8CA 2IS2A 5EFWB 4V0SA 5JHGB 5KJ7A 4MPRA 1QIJA 1QVRA 4FE7A 3V7NA 4W4TA 4B7CA 1W85B 3ABZA 2ZT9C 2AG6A 2GF2A 1UINA 4UUMA 2H1OA 5F2KA 1U3UA 8MHTA 2IDMA 1XELA 2FSVA 3MBIA 3PPVA 2G9RA 2VDOB 4GOJA 2GZMA 4N65A 4D5EA 2XRMA 1JPJA 4Q4HA 3C41J 4G5GA 1J0DA 1ZL0A 3DVSX 1PZXA 3PYMA 4XAQA 4Y6LA 5EP4A 1QF7A 4QNRA 3QVMA 1FTGA 1K7FB 1XCLA 2FDXA 3RTDA 2WR8A 1M2GA 2DPHA 2LD4A 5FX2A 1Y5IA 3HEMA 4MO2A 4Z7OB 4U7FA 5C81A 2KZJA 2YBDA 1KEZA 3DEYX 5DXFA 5BMVF 2C8JA 2GK7A 2QLBA 2WWWA 1NN1A 2EV9A 3ESCA 1IVNA 4JODA 2DH5A 4NBSA 2WY2D 1EGHA 1Y82A 2ATCA 2GPJA 3E8XA 3KZ1E 4NABA 1ISFA 4XCQA 5G3ZA 2EHJA 2QTZA 2Z5GA 3IAFA 1G59A 1KDPA 3BHMA 5B2EA 4FOOA 3FB4A 3VPBA 3F3SA 1JV2B 2NSDA 4MUXA 5KKNB 3OTGA 1DDGA 1RLJA 1EYZA 2IZZA 4P32A 4RHYA 5CT5A 4MS3B 4NATA 4RHFA 4U0JA 5JTTA 2ZBGA 2MINA 4WVLA 4KQWA 3NHUA 1GA6A 3IHKA 4W6ZA 4N3YB 5IBPA 4CPDA 1PV1A 1OCEA 1Q20A 3FAZA 3IB6A 1C9MA 1G8PA 5EN4A 5K2MA 2ZPUA 4P3XA 1X1AA 4UOEA 1ORHA 2VT7A 1P2BA 3THYB 1B41A 5BRJA 1OXUA 1U8YA 3L73J 2HF9A 1LC0A 4HGOA 3E9NA 3C3DA 5EHQA 3Q8KA 1QNLA 2O06A 3GYGA 1V16B 4D92A 5IT9A 4OI0A 1E2MA 2CNWA 3CR7A 1GNQA 2VJLA 3MAGA 3VTZA 2K9JB 2NZYA 3O3OB 3PDWA 4MXDA 3ASUA 4HNRA 4C0KA 3MIIA 3QWOC 1IAQA 2VF4X 4ZGWA 4P84A 3DULA 4O2BA 1LP1A 2CMKA 3SI7A 2PM8A 2A06E 1AZSC 4U3JB 3M3HA 3C1LA 4MVJF 2AJBA 1Y33E 5D51S 2I4RA 4YRGA 2PHZA 2RIPA 3PD7A 4N41A 1G3MA 3VMYA 2BFOA 3WRXA 1R8QA 1TX4B 2GI4A 2ONCA 5EJ8A 4QGGA 1N7IA 3DGFC 4QATA 4X1YB 3F2IA 4PLFA 5CDSA 3K0CC 3CXRA 4QZVA 3OZSA 4MEBA 1W8IA 5K3DA 1RF0A 2D2CD 1GG5A 2WP8J 3BDAA 3D7NA 5T4BA 1RCTE 2C7PA 3NRJA 2P9BA 4BNMA 2Q0HA 4UEOA 1H9AA 3OE7A 1F0KA 3CZ4A 1JG2A 1D4ZA 2IHBA 3AEKB 1S96A 2DP4E 2V3VA 3OJXA 4FK8A 4KRXA 2PX3A 4LJ8A 4JJEA 3BWXA 2O50A 1N2DC 1V11B 4LS3A 5CP8A 1SA0A 3B1ZA 3R77A 4DCKA 3VAYA 1W85A 3E2MA 2J7PA 1NTOA 2YVUA 3RNLA 2QENA 4AJKA 4TVKA 3AFIA 2XDYA 4EMBA 5IVPA 4MYSA 4TRRA 2D6FA 1CQXA 2AR0A 1TMYA 3AHEA 3FDXA 1PZEA 5BOSB 3K32A 4C7MA 2NAPA 4F38A 1KEKA 2GUVA 1J0CA 1S2MA 1TQ8A 3ETEA 1XGKA 1RE3A 2UWJE 1OLOA 1Z75A 3K1AA 4X6UA 1N6PA 1O6GA 1JMKC 4LYDA 1Q7CA 3DUFA 1SQPK 2NYAA 1E63A 2XDWA 3DD5A 3GO4A 3IURA 5B1DA 5IW8A 3WYFA 5JIBA 4EJ6A 1H5QA 1M2OA 4BPBA 5CJ4A 2HQRA 2Q1SA 4G0UA 2OG1A 5GVSA 1JVBA 1JZTA 1QIMA 2Y2VA 3T6KA 2VT3A 4H1TA 4NXMB 4KDRA 1VQ5P 1TKRA 4XTRA 2NZJA 1ZGHA 4OBEA 4P80A 3HVUA 4CF3A 5JS8A 3GV0A 4CM4B 3FGOA 3PX2A 4UREA 1L5YA 3K2QA 4FZJA 4J0JA 1TAGA 2N1TA 1ZOPA 1URQC 1CUDA 2M6SA 1EFUA 3H4IA 3KKEA 4C0AC 2W8ZA 1FUYB 4LECA 4BRSA 1XTJA 1R6TA 4IS3A 4BNKA 1V6SA 3G1WA 3KSAC 1BE8A 1WZCA 2UV8A 4MUHA 2BR4A 2PLFA 2WJYA 1STOA 2GRAA 3GI1A 4QJIA 1CJUC 5K1ZA 1J2TA 3PNQA 4IUYA 2VDNB 4K9LA 4F4IA 3VKHA 2PZGA 4WXRA 4GKAA 1NXPA 1II9A 1WMAA 2GCNA 2NUPA 1DXQA 4I50B 5A5EA 4UBJA 5AHOA 2BEKA 3KALA 4JI1B 2BEVA 1O8CA 1GGFA 1QONA 4DUGD 2QM0A 1EXDA 3CXHE 1XSEA 1NUPA 4RDXA 1PEKE 4KPGA 1NXQA 1SUIA 1VCOA 1GAXA 4LIPD 5SZJA 3U16A 3HP7A 2QZ9A 2ATEA 3IUSA 4JROA 4RD3A 4ZYLA 2F55A 3L72G 4M98A 2ZAEB 1QIKA 1EG7A 2X86A 4CYMA 5CA1F 1TEVA 4U8GA 2X2EA 2YNMC 3JWHA 3LI2A 4EZIA 4ZVVA 3FPSA 2IX9A 2YFHA 2KW5A 5DXJA 5PNTA 1E1RA 1N2GA 1VIVA 3BMOB 2PYZA 6CHYA 1WUJS 1HR0B 1O1YA 3WLJA 1IOLA 4IRXA 5JD5A 3GUCA 2XHZA 3NM4A 4YRCA 1E3QA 2OZKA 3BRVB 1G1AA 1SRQA 1KFKB 2XB6A 3HU1A 3WRWA 1Q19A 3KZVA 5ISMA 1EE2A 1SN7A 4M49A 4AN1A 3DDZX 4GODA 3IO3A 2XD9A 1H3NA 2GARA 1JE0A 2JFYA 3SR3A 1K6MA 1LS6A 2C8VA 2CMGA 2O0LA 1NMXA 4FLFA 3VHRA 1J06A 1M2VB 8ATCA 1GYPA 1NQ5A 3J7TA 3HXMA 3VJMA 2QT0A 3REQB 1W34A 1N3IA 3RFCA 3IODA 4F5YA 1MIOB 4CEHB 3DDOA 3CWBD 1DTEA 2GPNA 3NUZA 4GMKA 5FQNA 3AEQB 3QOFA 2UUCB 1G4UR 4JLUA 2P2UA 4NLLA 2D4HA 1MQSA 4KUGA 4HS9A 2NQTA 1AKEA 3I30X 4S35A 3NYRA 5AP9A 5BXQC 5FI5A 4O2LA 1N9KA 1W4BA 5E7IA 2WZDA 4YAUA 1TECE 3GVHA 1XYGA 2BI8A 4UHDA 2NU8A 2AZTA 4Q5IA 1Q2XA 2WSLA 4AJ4A 1R6XA 4DSAA 1I7NA 1LWOA 2Q3FA 4C01A 3N39C 4KX5A 2WA1A 3AUKA 4G63A 4FBMA 3EGVA 1E3DA 5DGHA 5F3DA 1FYDA 1YXMA 3VNUA 1QHNA 1IQRA 1BDMA 4BQNA 2B4TO 4BGDA 3USSA 1ZRTD 2PVCA 1MP0A 1N5KA 2Q1KA 1JB9A 4KQFA 3PC3A 5DCYA 1G66A 4OJTA 1Y8ZA 1Z9BA 1IU9A 2R25B 4ZMDA 1X74A 1KMNA 2NG1A 3QUSA 2QQGA 3RKRA 3MC1A 4IH4A 3WLLA 4J07A 4C29A 4R4MA 4HJXA 2QX4A 3FUWA 4WZAA 2G9UA 2D7JA 3O21A 1VPCA 1IRXA 3M1IA 3OE7D 4M0FA 3WO0A 3MSCA 4BRWA 3HVJA 2IYAA 4C3UA 4YPVA 2GD1O 3LVFO 2OSBA 1J2UA 1DXHA 3BD7A 5APQA 2WT8A 4PZAA 4ZFNA 2P6PA 3VP9A 4RYLA 5ECDA 3TCNA 5LXTF 3V4SA 2G5PA 4BXLA 1UT8A 1R4MA 4KYVA 4P7BA 3GMIA 2Q7DA 3OQVA 3A1FA 5IEBA 4K9DA 3RBVA 4CODB 1ABBA 3OH8A 2IE8A 5GJCA 3UEOA 1NTMJ 1OW3B 1EUCB 2YXDA 1XALA 4LY3A 4K9PA 3WHLA 2AN5A 2OCDA 3RASA 4QGAA 2FWAA 4NPFX 1U7ZA 2P79A 2VIIA 1Z0UA 4HZIA 1P9OA 5J1TB 1XKLA 1X7XB 4FC7A 3RVNA 4AKSA 2P2GA 3K1YA 2CJWA 4XQ0A 5HQ3B 2NTVA 3UPUA 2XNXA 1C5KA 2ZVQX 2HA5A 5AJVB 3TJRA 2B8NA 3M82A 4MI9A 5KCMA 4Y2RA 2BI7A 1DD3A 2C3UA 1KWKA 2WSIA 5FUBA 2H43A 4URHA 3T38A 1S3SA 1TNDA 2EXXA 2IYOA 4RK4A 1YRQA 2CBGA 2XWSA 3QFCA 4LKRA 4QBHA 4ZZIA 1GRRA 4FSXA 5ALIA 1D6MA 2Q49A 1J8DA 3OQ1A 1IBLB 2DWCA 2O3RA 5JH7B 1W0CA 2V6GA 1SC1A 3DVAA 1XCJA 4NX2A 4X1KB 3TE6A 4JKYA 4BE4A 2HIMA 3MCVA 5ARDA 4DMCA 3DAPA 4BEJA 1PR1A 2V6IA 3P71T 4PX9A 2BYTA 4CEIA 2O9JA 2GETA 2TYSB 1MO3A 1YOBA 3H1AA 5EG5A 4N9WA 5AXAA 3WQSB 1KAOA 1RCFA 2UZAA 4GX0A 4JB2A 4EVQA 5LJIA 2E5YA 4V2UA 1E9VA 4CQMA 1N77A 1FOSF 1XVUA 2A5DA 5EP2A 4AVYA 4FR5A 2OV2A 2OTCA 1LH0A 2B92A 2NN3C 3CLHA 2CLCX 5M29A 3DL7A 2FFDA 1WUKS 1Z4MA 2PMDA 3D5EA 5AW5B 2PXXA 3QLJA 2JKZA 3IMFA 1MJFA 2OFOA 4AQRD 1RBQA 3JWEA 4LJ9A 2QVBA 3UG6A 3JWIA 2LPMA 1Z0JA 2XSZA 3HG7A 2HMYB 3GRZA 1ZEJA 3K1ZA 3MHTA 3VV3A 4MW0A 2EBWA 1T5BA 2QMUA 4PY2A 3P0JA 4Q47A 5JASA 3R7WA 4HYTA 3MJHA 1ITZA 2XOEA 3EISA 1X7HA 3B6IA 3ILVA 1LBTA 3ZY6A 5LQRA 4DV3B 2VK4A 3KPVA 1Z28A 2CFSA 2R6CA 2Y4NA 2EWWA 3IPLA 3L07A 1WCXA 3VR0A 4MGEA 3WKCA 4EYOA 1RXVA 4J2TA 1WW3A 1M1JB 2PV7A 3AILA 2QSIA 4JUBA 3NQ41 4FFOA 3LUKA 2I9PA 2BM1A 3G1TA 1PJBA 1EQUA 3OBIA 3AR6A 1N2JA 3FOAA 3N5KA 3TSWA 2HJGA 3T3MB 3VDQA 5IHPA 4HYQA 5JNWA 1Z15A 3UKDA 2WT9A 2MSKA 4FYWA 2ZZMA 4IIJB 2DFDA 4D42A 1KO8A 3ANLA 3PF8A 4I55F 2WNHA 3NM6B 3KR1A 2G0AA 3U1AA 2IHUA 2OHIA 3WMRA 2VTDA 1H0TB 1IDOA 5E1BA 2GM3A 2WQ7A 2H4WA 3FPHA 3ILHA 4GGPA 3CUTA 5E9WA 5JRJA 5IULC 1C2TA 3TGUG 1D09A 2H0RA 3N2GB 1EPUA 4OJYA 3ISJA 3LUDA 5IVHA 2PD6A 2AD5A 4F4DA 2QTWB 4RZXA 1F4LA 1BA2A 5G0SA 4HVLA 2WB4A 2A45H 3ZQUA 2E4WA 1RCUA 1GV0A 4IEIA 1CYDA 2FP3A 5ULLA 3HSYA 1H4QA 4I55A 1IFNA 2I54A 1TFRA 4CQMD 3SF0A 5EFOA 2X0DA 3SG0A 5IC4A 1DKOA 3SJZA 2GJSA 3WMFA 2DU8A 1E5QA 5AVYB 1IG0A 1DG1G 1S8OA 4JXKA 2GN8A 4PLZA 2M6LA 3ZDAA 4KEAA 1CLUA 1P9WA 2RDMA 3HUEA 4R0VA 3VZRA 2WPRA 1SCDA 3GJRA 2AFVA 1BQ3A 1QPGA 2C2BA 3I52A 2ZRPA 3STHA 4EFNA 5CXUA 4KDCA 4D26A 2R1TB 2YWXA 2ZRAA 3CW9A 5LQJA 4UXJA 1KYZA 1ZY2A 2A2ZA 2PS3A 3GLMA 2OCPA 5C7LO 4CQNA 3KOZA 2ZGVA 3ZHSA 4G0NA 1H9CA 3WLSA 5J1SB 1BN7A 3TE7A 1GGVA 2MHCA 3TZEA 1IBKB 3S1AB 2XKAA 3RS0A 5A5VA 2CUNA 3A3YB 1J09A 1NQAO 2I3DA 1INLA 2UZ1B 1RIFA 2X9GA 4UC0A 4D82A 4FUTA 4C2UA 5AICA 2DQYA 3IYLW 1J22A 4BWVA 1KOLA 4F2DA 3CX5H 1KJIA 1N0WA 2RMKA 3C6KA 1PNVA 3TBKA 1LPNA 1H2AS 4NICA 3WJ2A 3I5XA 5ALRA 2XDJA 1TB4A 4OD0A 3UMVA 3F90A 3FB1A 2YV2A 4DIOA 1XZQA 3L0ZA 1MVNA 1ZUIA 5JXJA 3G2OA 4QTXA 2PN1A 2NU8B 4TTSA 4NZMA 1OT5A 2D5BA 4A8PA 4EGSA 4QLBA 4QVGA 3FPEA 1QG6A 5D84A 1YZ3A 4HGZA 2VDMB 4C4PA 4UD2A 4RTOA 4B3SB 1OD6A 2HHAA 5TGDA 4KWEA 1W9HA 3TWOA 4BE9A 2X6QA 4IJ6A 4KNYA 4ZEMA 2DLDA 2XMCA 1R9JA 4OPMA 5HPYB 1KH3A 3PNMA 1LDBA 1P60A 5DYNA 5ADVA 1KERA 1MZVA 1Z56C 2OB2A 2UYHA 4KGVA 4Q4DA 1ECFA 3W1VA 4YRSA 4ZN6A 2E5TA 3I37X 5FFNA 4TMTA 1E3EA 3C5VA 3TUZC 2WU3A 1GNPA 3HD7A 1JEDA 1Z6AA 3P9IA 1M74A 2E48A 1HEIA 5LQKA 1XD2A 3N74A 3L75J 4G0VA 2EZ9A 2RC5A 4V2IA 3GFOA 1Y80A 5FJIA 1KYTA 3KYCA 1LV7A 4OIMA 4EW2A 2JFVA 1YI0A 4BO3A 3TBFA 1XN4A 2B8EA 3VR6D 1WVMA 2HXGA 4UAVA 5IKXA 1B4DA 4MDFA 1Z68A 1ST2A 1Y1RA 4LLHA 4MB6A 5HTOA 4B3GA 4H0LD 3BXEA 4HWSA 1SCQA 5IZ4A 4JKOA 2O3QA 2VHJA 4LISA 1U2SA 4M6WA 2QGZA 1AVOA 3BAFA 1NU6A 3VTKA 2WUDA 4EENA 4NG5A 2G6TA 1DWQA 2YJTD 3IUEA 3PDIA 1G8HA 5DX0A 3BL5A 4ARSA 4DCPA 3BRQA 1N8NA 4UQOA 3E15A 1HQDA 3IP8A 2YFKA 3I5CA 2OBMA 2Q1YA 4KO3S 3TLBA 2AIRA 2OLKA 4AJ1A 2Y9YA 2NW6A 4BZXA 3ZDBA 3OP1A 2ZJ0A 2JI7A 5F98A 3IA2A 2R5WA 1E3LA 1MX3A 2WP0A 3SX4A 1UKZA 3M0DA 1C29B 1O87A 2GAFA 4PSUA 4WEQA 4ZEOA 1JFFA 4GR5A 1Q90D 5JOQA 1TCAA 1FFCA 4P82A 3M9LA 5IN5A 3KQVA 1GKYA 4ZZ1A 3EW7A 1LW7A 3U7JA 3W0LB 5F3WB 4X7RA 4RPKA 2HV8A 3W6UA 1ZITA 2FMXA 5EJFA 3L8EA 1E1QA 2XOKD 1IC2A 1P77A 4W7IA 1PHRA 1GKLA 1J1UA 5IG2A 3MUFA 2QJRA 2YYYA 1V3TA 3GT4A 1M75A 3BQ9A 4ICIA 1M2KA 2YR0A 4ZVKA 5L6MB 1JH8A 2E4AA 3KJIA 5L7YA 1S3JA 3ZXSA 2J7KA 3IAM6 4PC6A 3W8FA 1T6AA 4EHKA 3N0XA 4OHMA 4KGDA 5JD6A 3CH6A 1A9QA 4V39A 3EVEA 1S2IA 1UXGA 4I4IA 5BSEA 3H9JA 1UDXA 1LI7A 3A6LA 3LT4A 3L7CA 4YJ2F 3FVRA 3ENQA 5JS6A 2KBEA 2JL1A 1EXJA 3DFKA 3CZQA 4DQ0A 4KBGA 4PGFA 5BQ5A 5JS2A 2JFBA 3BE4A 5AW0A 1E6KA 4DJDC 3AV3A 3CCVP 2AUTA 3AKDA 3QELB 1QO0D 3RF7A 4B8ZA 3HZOA 4FEYA 5LBIA 3WGLA 3FDJA 3UMYA 3JRWA 1SOVA 3L8ZA 1XD9A 1IUKA 2G06A 3NDBB 3SICE 4KHPB 2J09A 2CKDA 3FUXA 5A0TA 2QE7A 1T0PA 4MV5A 3RVRA 4DSNA 3B3JA 1FB5A 1KAQA 3LM8A 3R40A 1O95A 4O4IF 1QOQB 1IN6A 1TYCA 3A6HA 5E3JA 2FN8A 1XTZA 3U1CA 1PDWA 2OCIA 1BCSA 5I7AA 1JHAA 3DFUA 1FYWA 4MA0A 1S5LH 4L6AA 4ZI5A 4L51A 4DNPA 1NGSA 1U7DA 4YV2A 1JS1X 1DAIA 2WAYA 4LRWA 2PJRA 2ZSDA 3CL3D 1B7GO 1E2QA 3AVTA 1RHRA 3BWCA 3MTDA 4CBVA 3KBOA 2DEUA 2R0QC 3HA5A 4P35A 3EN0A 1Z6QA 4M54A 3RYCB 1K98A 2JA2A 4ZI2A 3LFTA 4JLMA 1ZV8A 2D54A 5CD9A 1EA5A 3I5YA 1WT6A 2HMWA 5GTHH 2Q27A 1XMJA 3DE6X 3O9VA 4XOUA 2C9OA 3LWDA 4FN5A 1E7QA 4KXFB 9ABPA 4L78A 4LF6B 3BXOA 1Y3DE 1NNEA 1JY3O 4UEQA 5JDIC 1EFKA 1DIHA 1Z0IA 3B1JA 4B6QA 2JW5A 1CUZA 2WVJA 4AAYA 2C99A 1TMKA 1KP3A 3IIKA 3ON5A 3T1OA 3DEHA 5FEUA 4HX9A 2OO5A 2CHVA 3GEEA 5LBTA 3WMXA 5CB0A 5ADWA 4IJVA 4LRSB 5NLLA 1X8KA 3LCVB 1SCKA 1C4OA 2CE2X 2DTDA 3A7DA 3MUOA 2P0YA 2FFDC 4ND3A 4BZPA 1SQPJ 4RVUA 3T7DA 4BKOA 4Z4CA 2A9QA 3UGKA 1BGYD 1JAXA 3N87A 3UMRA 1PNTA 1O0SA 2V5UA 1NXWA 4Y6GB 1XNRB 3L6UA 4ENSA 2MMCA 3AM5A 2KI5A 1LLDA 3RYFA 1RWKA 1JB0J 5SY6A 3WB2A 1K73Q 2RGXA 4RIEA 1EK2A 4F04A 3FMVA 1R5JA 3K8ZA 3NP9A 4DUYB 3OJEA 1Y8RB 4UTRA 5DTIA 1A1SA 2Q3CA 4BIIA 3AJRA 5ITZB 3NRCA 2DCMA 1EFCA 1ULZA 2VXBA 3I76A 4I50F 1LBQA 1ZXBA 2AA3A 2GYYA 4I46A 3MCTA 1AGYA 4RNCA 3HMKA 5AW9A 3H9QA 4YO8A 4BLPA 1WXHA 1SP4A 2YXLA 3IDFA 5BT8A 3F3YA 1CUXA 4JOBA 1V37A 1S7CA 4B3RB 3ZEIA 2PGXA 3JVUA 1GILA 3OZTA 3VTFA 2NP6A 4R40A 4LOJA 3DBRB 2QMYA 5IC5A 4GH5A 3O0DA 4E5UA 1DP4A 3KV1A 2DOKA 1W4ZA 3CUWA 2ANCA 1W49A 1XQ9A 5I7UA 2WU8A 4JBWA 3I62A 4JBIA 1MT3A 5F1KA 3NEAA 4YXWH 1CJCA 2G5TA 1P81A 1ZOYC 4IDAA 2P0AA 4JB0A 4KTTE 5BW6B 3L72E 2R3CA 1ONOA 2GF0A 1QF6A 4HADA 4K46A 1KR5A 3B5NC 1L4BA 2CDBA 3OCUA 4B44A 1QCCA 2IYVA 5KPJA 1PIWA 1YQUA 1F51E 2FPPB 4RM3A 4TPKA 4AMVA 4D8TA 2YHBA 4ZVMA 3EIEA 3K16A 1UK8A 3WVNA 2RKLA 3DEJA 3GGGA 4B76A 4C43A 4MQ5A 4LV5B 1X2EA 2HJWA 3AKCA 1K6JA 5JO0A 1GEEA 2CE7A 2Q2VA 2FW7A 1T5SA 1Y7LA 3DDHA 3P2IA 3TI7A 2PEYA 1UM8A 5JCJD 1QVFO 1NR1A 2IYNA 1CUHA 1ZAKA 2YJGA 5THQA 5K6RA 1RZUA 1E58A 1OFUX 5AHKA 1ZJZA 3PEWA 1NFFA 3F5QA 3L70G 4MQEA 4BC0A 4CV0A 4AMZA 3T5PA 1W1IA 4I66A 1UZNA 2AOUA 4GOND 4OK3A 4MGHA 5E9JA 1B26A 2DH6A 2OY0A 4NEQA 2D0IA 2FPIB 3W79A 5HIMA 5EIHA 1F9AA 3U31A 3IIEA 2VF2A 1W2BO 3GLQA 3PBKA 5D1NA 5CMZA 5TLSA 2W8BB 3B3GA 3A26A 2ZAIA 1ZOSA 2KPOA 3X2EA 1L0NE 2X9LA 1DX7A 3IELA 2FSIA 1P9RA 3ZHRA 4EW1A 2IYPA 3NJRA 1K9VF 3AXSA 3GUVA 3LDUA 4UXIA 4QL3A 4RCZA 3V9PA 5BQPA 4D9HA 4BX0A 4OKIA 5K03A 5AKEA 2JLXA 5JJIA 2AG0A 1VQ1A 3Q8WA 1TU0A 4C6TA 1D2AA 5B37A 4EPWA 1PGOA 1G1MA 3JZFA 3I0ZA 2A1UA 1A4UA 3E5NA 1L0LK 5KYYB 1BE3D 1MB9A 4AIIA 2VKQA 3EAQA 4G56A 1E2KA 2EFEB 2QX8A 2YHSA 2NPSA 2H6EA 4K40A 4QAJA 3B2NA 2ESRA 1A7AA 3RU3A 3O8OA 1HOXA 3AGPA 3BRWD 2D1RA 3TZ6A 3GNLA 3ZHXA 1TF5A 1GGNA 3R20A 1V7QA 2I8LA 4AKEA 4J0EA 1PFKA 2YNYA 1SQQK 1Z47A 4OY3A 4U3JA 5LWHA 2JFFA 5DOZA 5JYBA 3K9BA 4CKBB 4FCTA 1NONA 4QA9A 4C7KA 4YPFA 5DM4A 2FK8A 1GZHB 4NOMA 3RUFA 5AK5A 2GXQA 5C39A 3UHOA 4BUCA 5BU8B 3U3MA 3MP7B 1G64A 2ZYIA 4PSKA 5HEKA 4AXXA 4AZ0A 3K92A 2BGLA 2QTLA 4TLAA 1XVAA 2ZBEA 4EFLA 1B6TA 4QMAA 2MTBA 3W04A 5G0VA 5CFQA 5TQ2B 4R8LA 2ZITA 3I9OA 2Q1UA 3N5CA 2F3QA 2G71A 4JLJA 4U9HS 3VBEA 3R4YA 4XIIA 3S40A 4U7GA 3I83A 1T4MA 1VBNA 4MJXA 5BN3B 1RPAA 2Y1OA 2HGSA 3ZBQA 1P6XA 1GRVA 3WBBA 1SQPD 4QVKA 3LX4A 4HUJA 2A0KA 1D1PA 2PGOA 4Y6QA 4C14A 2FUNB 4RKYA 5AVRA 4YWJA 5D5PA 1TA9A 1O89A 3N2LA 2Q07A 4Q1DA 3ZQKA 1CF2O 3C0KA 1H89A 3V2IA 4Q9NA 3S44A 4UM8B 2NUTB 4LJ7A 2IYFA 4OG2A 4FXPA 4R2IA 1I51A 2ZS7A 4Y2VA 2IUEA 1VQ6P 2HK9A 3GJ7A 1AS3A 1WG8A 4G01B 1YHYA 5ESWA 2QPLA 1GQRA 1A77A 1YHQP 3C4VA 4IKEA 4L0DA 2HHCA 5CPBA 5JE8A 3TCXB 2QP4A 3FFAA 2O1XA 2QD3A 4FHGA 4YRQA 4QEDA <