3FWNA

Dimeric 6-phosphogluconate dehydrogenase complexed with 6-phosphogluconate and 2'-monophosphoadenosine-5'-diphosphate
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
467
structure length
467
Chain Sequence
SKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDAYAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQIGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEWLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-phosphogluconate dehydrogenase, decarboxylating
publication title Conformational changes associated with cofactor/substrate binding of 6-phosphogluconate dehydrogenase from Escherichia coli and Klebsiella pneumoniae: Implications for enzyme mechanism
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 171
structure length 467
sequence length 467
chains with identical sequence B
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3fwnA02
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 3fwnA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3fwnA01
1YO6A 1UXKA 4BNFA 3LYLA 5AXDA 4FFMA 3OMLA 1E7QA 1EUZA 2Z5LA 3I3OA 1DRWA 4HUJA 3MWEB 3WTCA 5A9TA 3L6DA 3VKUA 1E3SA 1WXDA 2VTDA 4UULA 4CM6A 3JQ6A 2VUSA 2OHXA 2VN8A 3GFGA 4BQRA 1QV6A 4FD3A 4LK3A 3RVDA 1LSJA 1R4MB 1ZH8A 4Y9DA 1PJLA 4WASA 5H83A 3WSVA 4CLXA 2HK7A 3ZV6A 5JBIA 1B3BA 3QVXA 1LSOA 2IXAA 1VKOA 1NTOA 4I5FA 5TT1A 1NVTA 1E1KA 2XXJA 4CM8B 4E5PA 3QY9A 2GERA 3PHJA 6LDHA 1G0OA 3AU8A 4LSMA 2X5JO 4MIYA 4O6VA 1BXGB 2G1UA 4LMRA 1JVBA 3JQ9A 4XA8A 3DBLA 4I8XA 3U4CA 3UICA 5GZ6A 4WCFB 1LLCA 4GL4A 3KTDA 4D45A 2PR2A 4DUPA 1M66A 4URFA 2BFAA 4WE3A 4JQCA 4GMGA 1M76A 4NK5A 3B6ZA 4XKJA 4PLCA 3JQ7A 3PZRA 2YHIB 5I7SA 2Y1EA 2IZ1A 4ZQHA 3GUYA 3H65A 4J0EA 1MC4A 2VYND 3Q3CA 1K89A 2GYYA 2JCXA 3NT4A 4ZQEA 1UDAA 2NADA 3Q0EA 2AQKA 3H3FA 4XCVA 4FFRA 4J4TA 3JYLA 2I3GA 1FK8A 3DC2A 1LUAA 1T2FA 3OJ0A 5BT9A 3MOIA 3ZU3A 5THKA 4FGWA 5JYEA 1HYEA 3ZHBA 2I66A 1UR5A 4W7IA 1DFGA 2TMGA 1ONPA 4KUGA 2DT5A 5JAZA 3QVSA 5U4QA 1MXHA 1F12A 4CLEA 5C5IA 4Q3DA 3PWZA 1VLLA 4FBGA 3SJUA 1FJHA 2R6JA 4I5EA 4IXTA 3EMKA 1OMOA 4F45A 4U8GA 4IQ0A 4QEDA 5JY6A 1WWKA 4WLOA 1U4OA 3EAGA 1U5AA 2BKAA 4NU6A 4TRMA 4CPDA 4I5DA 3N74A 5A3JA 4XGNA 4UUPA 1HYHA 2O2SA 3K8ZA 4GVXA 3D1LA 2Q1SA 1LC0A 4IDFA 4RF2A 4IJUA 5DF1A 1RM4A 2BI8A 3MJVA 5F1OA 1LRLA 4DMMA 3VKVA 2PWZA 4J1TA 4HBGA 1QYXA 4YT4A 3NEPX 2W2KA 1W0CA 1W8DA 4RVFA 3ZWOA 4A10A 1XR3A 4IBOA 4NZ9A 2BFMA 4RDIA 1ENPA 2X9NA 1WDMA 4NK4A 5GY7A 1X7GA 4PVDA 4YTEA 3TZ6A 3WICA 3FNGA 5HTOA 1PR9A 4PLWA 3FN4A 1HWYA 2BHLA 3D0OA 4G2NA 3TWOA 3V2UA 3RD5A 2I6TA 3KYCA 2GDZA 3A9WA 1VL0A 2E4AA 3M6IA 2UUPA 4LRSB 2JKVA 1QSGA 4NJOA 1FDTA 1T2AA 1UAYA 3OIFA 2I3AA 3P5SA 1WZEA 4E5MA 3JYQA 4CMJA 4DLBA 1OX3A 1H94A 3RUIA 3TPCA 1NHWA 4U7WA 4L4RA 4XB2A 4PN3A 4E21A 1ZEMA 1HETA 2D3TA 1ADGA 3KSZO 4K9DA 5CG2A 1ZMOA 1CJCA 3F1LA 3Q1LA 4HXYA 4NQZA 3GNQA 2J3HA 2HO5A 4ID9A 2PTGA 4BNUA 3CTVA 2PK3A 1H9BA 4UVIA 1G6KA 1T2EA 3A4VA 2ZYDA 1HLPA 1IHXA 4QX6A 5L51A 3TNLA 4PLTA 5JO9A 3VTFA 1NBOA 3B1FA 3WR5A 3I5MA 4W9NA 5EPOA 1I3NA 5KJFA 3QSGA 4QO7A 4RO0A 2AQHA 1J0XO 4UEKA 1MLDA 2C07A 3FF4A 3TN7A 1HYGA 3F5QA 1I2BA 4ZJUA 2NTVA 5TRTA 1LTHR 1VI2A 2E6UX 2PZLA 3OJOA 5T64A 3PYXA 4WLFA 2EJWA 3AY3A 3QWAA 2DTEA 4FGSA 4YWJA 5KTKA 1UDBA 3I4CA 3AM3A 1PQPA 1V3TA 4B4OA 3GA0A 1R0SA 2W4QA 4Z6KA 1TT5A 2BGLA 3FSRA 2I9PA 4R1UA 3G0OA 1YBMA 1YH3A 2X23A 4BMSA 3OEYA 3ANMA 1U2GA 4YRAA 3LC2O 3GDGA 2YV3A 1A4IA 3RJ5A 5JC1A 4KMSA 4G5HA 1VJ1A 1IHYA 1PL7A 1XYGA 3JTMA 1C14A 1EFLA 5TQVA 2V6FA 1DJNA 1GQQA 3KZVA 3JQBA 2HRZA 2ZCVA 4AJKA 2YDYA 1RYEA 2EV9A 3DZHA 1CWUA 1B8PA 4RORA 1HE4A 2B35A 4LSWA 3OEWA 4R5MA 4CUKA 1GTMA 2CZCA 2TMDA 5CDTA 3D3EA 3DHEA 4RGBA 3R0IA 1LSSA 4QXMA 4RF5A 5KIAA 1XWFA 1QG6A 4JXKA 3V2HA 3R3SA 5JO0A 1NVGA 2O3UA 1B16A 4E5YA 4BO5A 1P44A 1P1IA 1ADCA 1ISFA 2FSSA 3DBLB 3GRKA 2VRBA 1JQBA 4P38A 5F1KA 1CRWG 2C5EA 2QRLA 3AI2A 1KVTA 5IZCA 3NTRA 4A7PA 2A35A 2G82A 3WGGA 4BKPA 2JD0A 2FMUA 4ZRNA 1XGKA 1HEUA 4DBVO 3ZI0A 4ZVVA 3SC6A 3JQ7B 1X0XA 2GCGA 1DFIA 3COSA 4AJEA 2C5AA 1PJTA 1QMGA 1UP4A 5EESA 3T4XA 4ALMA 1YVEI 1GFSA 2X6TA 1R16A 1S7CA 1N2SA 1E6EA 2YFQA 3JYPA 1UXIA 2B4RO 5THQA 3ZWPA 1UUFA 1DFHA 1ENOA 1YS4A 1Y5RA 2UYYA 3IP3A 3GVHA 1DEHA 4B7CA 4BNNA 1E6UA 5C7IO 1Q0HA 3HB5X 3RWBA 3WXBA 3OBBA 5KKAA 3P2OA 2RCYA 3G1TA 2B5VA 4KWHA 1SB8A 1M67A 3PRJA 1B0AA 1BVUA 1WMBA 4BV8A 4NBRA 1HDRA 4BL5A 2I5PO 2G76A 3NTQA 3NAQA 3UCFA 3QA9A 1E7WA 1EE9A 3EDMA 5G2OA 3F4LA 1F17A 1HE3A 5U1PA 3ZV5A 1KEPA 3GFBA 2Z95A 3QWIA 4KZPA 3RC7A 1SNYA 4DMLA 3PGJA 2R00C 4YDRA 4HFNA 4ESOA 1RM5A 1HDCA 2Q45A 4F6LA 2FOIA 2AQ8A 4NNJA 4BGVA 2ZYAA 4MVJI 4YVFA 3CSDA 1NPYA 3BXXA 4R1NA 2CMDA 1HT0A 4GX0A 3NGLA 2IZ0A 3S8MA 1H0KA 4W4TA 3ZWAA 1TA4A 1WPQA 1HXHA 3KO8A 1KC3A 3MJEA 5JDIC 5TLSA 1CETA 2QX7A 4PCVA 3WWZA 1M6WA 2DBZA 2P9EA 1ZSVA 4XYEA 4TRRA 1NQ5A 2AE1A 1GV1A 2B36A 3CKYA 2X0RA 2NU6A 4CL8A 1XSEA 2C2XA 4RQUA 5BNTA 4QQRA 1YL5A 3Q9NA 3VH1A 2PH5A 1CQIA 4N18A 2ZTUA 3WNVA 5CEEA 2Q49A 2E82A 1DLIA 2QHXA 4M8SA 1P1JA 3UFXA 2Y1GA 3SVTA 4OIMA 3JQGA 3WIDA 4BNIA 3KYCB 1BVRA 4WECA 1VRWA 3VZPA 1Z7BA 1V35A 4IGFA 1V9LA 3D3WA 5TC4A 1AGNA 2HJRA 3I52A 4M54A 3FD8A 4TVBA 2HAEA 3WGTA 4XYMA 2AEFA 3UW3A 4TRNA 4AJIA 3IKVA 1BWSA 4EEZA 3DQPA 1DHRA 2X4GA 1FDUA 3E1KA 3U49A 1CEQA 4NJMB 3DWFA 3GN1A 1BW9A 3WGYA 5I7EA 2NVUA 1L7DA 2P5UA 2VOJA 3K2EA 5IZCC 1LLUA 2HRBA 2YV2A 4IZIA 3S2GA 1LA2A 1DDOA 1VPDA 4XYGA 1YBAA 5ICSA 3MJCA 4XZ3A 1G1AA 4L4XA 1JKJA 2JAHA 4GLOA 4H15A 4XQEA 3LLSA 4YACA 1ONNA 4GMFA 3VPFA 2QRKA 3PZBA 3D64A 4DVJA 4HFMA 5ILOA 4IDDA 1B26A 1U9JA 2GZ2A 3EUWA 4EI2A 2PLAA 2GO1A 1KOLA 2NNLD 1NQOA 2Z1MA 3I9OA 1RM3A 1NVMB 3E03A 3ZN2A 2E37A 4CV1A 2FPGA 5DT9A 4B4WA 1CIVA 3HUDA 1T2CA 1DXYA 2FR8A 1NAHA 2PA3A 2PD3A 2QRJA 4KP7A 2EJVA 4TROA 1LU9A 3PYMA 2FWMX 3FTPA 2VRCD 4XYLA 1YKFA 1U3VA 4S1VA 4DBZA 3RU9A 1NX6A 4UAGA 1LDNA 4F46A 3GAFA 4FW8A 3H9UA 1TT5B 1T4DA 4IPTA 1UP7A 2C82A 3IUPA 3OM9A 1NR1A 2CFCA 4F3YA 4N5NA 3O03A 4HADA 2AG8A 1M75A 2GSDA 4Q3EA 1I5RA 2AG5A 3DMYA 2GR9A 5B12A 5L9AA 2D1YA 2AQIA 1ZJZA 2D59A 2OP1A 1ISIA 1D1TA 1PJ2A 3D4OA 4D44A 4D0SA 5EERA 4HKTA 5A02A 2O2YA 3H9GA 3L6EA 4DA9A 5CFZA 3K96A 3LK7A 4XJSA 2C59A 3C7CB 2HK9A 4TWRA 1LJ8A 1KBZA 2HMWA 4BGIA 4OM8A 2F1KA 3CEAA 2O23A 4OKNA 2DLDA 1GD1O 2OGUA 3GNTA 2YY7A 1QYVA 3HDQA 2IEDA 1PR3A 1VM6A 5IDQA 4B4VA 3VZRA 2IZZA 4PLZA 3PGXA 4XGIA 3HDYA 1EVZA 4J91A 2DC1A 4MKRA 1U8FO 1P77A 3TOZA 2Y0DA 4K6CA 5HS4A 1R6DA 5HRUA 4J49A 4DIFA 1ZMTA 1K6IA 2RBEA 4ZHSA 2HU2A 1SZJG 3WOHA 3F4BA 5BNIA 4BO1A 4CM8A 4E0BA 5CEJA 4Z0TA 1HL3A 3KV3O 4XGKA 1UZLA 4PG8A 1XEAA 3HFSA 4BKUA 2B4TO 1ML3A 3TZCA 3VVBA 4WNCA 2DUWA 3RFTA 4BKRA 1H6BA 5JE8A 1ENYA 2XAAA 3FHLA 3HDJA 4E2WA 3IKTA 4ZQGA 2DBRA 3AY7A 3RCBA 1Z45A 1G0NA 3OSUA 1YQDA 2YHIA 4B8WA 2J5KA 1L1FA 3LSYA 4J9UE 5KWEA 1Q7CA 2Q2QA 4Y6SA 4DYVA 2W90A 3PK0A 1C0LA 1KERA 4E31A 4D42A 1I33A 2JHGA 3I9KA 3ZV4A 4N5LA 2DBQA 3F3SA 3QLJA 4YT5A 4BIIA 4WLUA 3VDRA 1E1MA 4NPCA 1A7KA 5JC8A 4Z3DA 2ZIZA 1A4UA 1JWBB 2VHVA 1ZW1A 4KDEA 4DQUA 3LC1O 5LCXA 1I3LA 3AUUA 4J90A 1R15A 5ER6A 2PD4A 3GPIA 2G0TA 5G0UA 4NI5A 3UGKA 3JSAA 1KVUA 3AM5A 3O8QA 2H6EA 3RASA 4LCEA 4TRJA 3X2EA 3PHHA 4LN1A 4NFHA 4R1TA 4E4YA 4I5GA 4WK6A 3Q2KA 4JIGA 3LT1A 4R01A 4ZD6A 2EKPA 3GRPA 1I36A 2NWQA 4AJOA 4J1NA 4DGSA 1WDKA 2RAFA 1Q0QA 2QG4A 4BMVA 3EZLA 4WLEA 1EMDA 1EQUA 2HQ1A 3KUXA 5CPBA 1EK5A 3ZWXA 3RUAA 4CM5A 3QE3A 4BNTA 3DL2A 1WAMA 2LDXA 3P2YA 5DULA 1Z73A 2X0JA 3BZUA 3BMCA 3U0BA 1MXFA 4G65A 3AI3A 3W4IA 3JQGB 5DBGA 3ZHXA 4BB6A 1IOLA 3V1YA 1E7YA 1P1RA 2VWHA 2FPIA 4BHTA 1Z7EA 1E5QA 1S6YA 1HRDA 3B20A 3D3WB 3JQFC 5COQA 4BNGA 1ZKMA 2V6GA 1ULSA 2G17A 3RBZA 1H2BA 2JJYA 5B4UA 1KEVA 4JX8A 3UCXA 1DC4A 5KVVA 4TKMA 3JQDA 1R37A 4JCOA 3I23A 1U3WA 3DZBA 3PEFA 3W6ZA 2NVBA 2NVUB 4AJJA 4BNKA 1ZXBA 3RUCA 3ZW9A 3WBBA 2CNBA 4OSPA 1U4SA 3OIDA 3GHHA 5IJZA 4M86A 4OYRA 3WG9A 3RUDA 1Q0LA 4EDFA 1LLQA 4PG5A 4YAIA 4LVUA 4TMFA 5DNAA 1NM5A 1LLDA 1HDGO 2FR1A 4GBJA 2ZQZA 4WCFC 3INTA 2WE8A 1E7RA 2W8ZA 1P0CA 3IAHA 4WKGA 2WYWA 4DIOA 1X14A 1LQTA 9LDBA 1LBEA 2JCVA 1ZK4A 5C7OO 5IDWA 3NGXA 2QQ5A 4E12A 2CSUA 3GUCA 4FJ0A 1HSZA 3D5QA 3DBHA 1N8KA 3K9QO 3OJFA 1NR7A 1ZUD1 3UN1A 4MVJP 4R54A 2VYVA 2ZB8A 3G79A 2PKQP 2Y67A 1Q2XA 2Q1WA 4PLFA 3SLGA 4YRBA 8ADHA 2AEJA 4XD2A 1Y1PA 3HQ4O 4NHEA 1M6HA 4R9SA 1SOVA 4IGEA 3SJ7A 2B69A 3GVIA 3IOYA 1A27A 2WE7A 5JMPA 2VT2A 3UUWA 1PJQA 3GOHA 4J7UA 4FC7A 1YE3A 1JTVA 3ZGYA 1HSOA 2WD8A 3ETDA 1ZNQO 2Y0EA 3BA1A 4WPGA 3K2BA 5JPIA 4GGPA 3NV9A 1HE2A 5JAQA 1I10A 5L53A 4OXKA 3BTOA 1I30A 2XPCA 1KYQA 4ND3A 3AW9A 4WNIA 4C7JA 4DPMA 2BF7A 4B3HA 2Q1UA 4CQLA 4MVJH 4DYDA 1AUPA 2PGJA 5G0VA 4BNHA 3IDSA 3FNFA 3IP1A 3ZWVA 4GSKA 4TKLA 1DO8A 5IXYA 1E1NA 4I1IA 4IIUA 4W7HA 5B4VA 2AA3A 2VNAA 4FS3A 1E5LA 1O89A 3WFIA 1LEHA 4O5OA 3L4SO 1DRVA 1Y8QA 4CM4A 4AICA 1ZK3A 4XR9A 4W99A 4AJ1A 4YXFA 4CUJA 2BD0A 3DDNA 5TJHA 2X5KO 3BAZA 3DHYA 2RH4A 1FDSA 3UKOA 4JK3A 3QJ5A 4UUNA 3DAGA 1NYTA 4YJHA 5L3ZA 3VC7A 3DFUA 4RVHA 3LF1A 4AVYA 2Y1FA 4BNWA 4DLLA 2AHRA 3LQFA 3T4EA 3TL3A 1O95A 1T4BA 1EK6A 1Y9AA 1K2WA 2Q50A 1JAYA 4CJXA 3I1JA 3CTMA 3E9NA 1PGNA 2VZ9A 1I3KA 1EBUA 2DM6A 3L9WA 2Q2WA 4M49A 1DC3A 2CUKA 4HP8A 4DIBA 2YQ4A 3W4KA 3ZV3A 3VH2A 2V6MA 1AXGA 3GMDA 2IE0A 3GQVA 5IN5A 2DTXA 2X5OA 1GUFA 2OXIA 2I99A 3AOGA 1H9AA 3OJLA 3VVCA 1YXMA 5A5EA 2OBYA 2ZTVA 2DFDA 4MO2A 4ITUA 4CMHA 4NR0A 5I9MA 1C3VA 3ENKA 3E5RA 5IG2A 1CYDA 3O8QB 1BDMA 2FZEA 2NQTA 4ND5A 1GPJA 1KC1A 1R0LA 5EQDA 2V7PA 2J3JA 5JMWA 1AN9A 3DZIA 1Y5MA 1Y8RA 5BSGA 1GYPA 1X1TA 3C3XA 2Y93A 1QYWA 2JD2A 4MP6A 3WQRA 4OOEA 3WWYA 4BVAA 3WMWA 1X15A 4BQPA 3BMCB 3KOUA 3G17A 1R12A 1J6UA 2C29D 1MC5A 3OJEA 4FQ8A 3MWDB 4RPGA 5L40A 3IL2A 1F0YA 1YJQA 4R3NA 3ZWWA 1EQ2A 3BIOA 5IAAA 3VPSA 4U0KA 2NV6A 3KB6A 5MGBA 4HV4A 1K6XA 5A03A 1RKXA 1EEHA 2I67A 5TS3A 3GHYA 2IDZA 1JLLA 3M2TA 4J9VA 4ONEA 1GQ2A 3ANNA 1SEPA 1H2HA 3ZWBA 5JCJD 3FI9A 3BYZA 1YOVB 4JLWA 5EN4A 3PHLA 1QORA 1IZ9A 1OC2A 2D4AA 3SBOA 3H4VA 4CODB 4WEQA 5AXAA 1E3WA 3VAZA 1GYQA 3QVOA 2ZQYA 4RPKA 4BO7A 1NWHA 1NQAO 2GD1O 1I0ZA 4XQCA 2HMVA 4IMRA 4NJMA 3JQ9C 1CQJA 2UV8A 4RLSA 3ENNA 1VSVA 2ZKLA 9LDTA 4C4OA 3VPHA 2POQX 1U7HA 1LI4A 2OBNA 3VH3A 1GU7A 2IODA 5EMHA 1ZXLA 1PJ4A 2PH3A 3PLNA 3DBHB 1A72A 1CDOA 5AXCA 2GGSA 1K5HA 2P9CA 4JP3A 3JQAD 1IB6A 3E9MA 4E5KA 4D79A 4BO4A 2AW5A 1FXSA 1KVRA 4QO8A 1EFKA 4WGGA 3VOSA 5DOVA 2OO5A 2J3KA 3JCZA 3ZU2A 4OH1A 5MDHA 3PDJA 4JBGA 5COBA 3LLVA 2BGKA 4HNHA 4NFYA 1N92A 5L95A 3HN2A 4L9RA 2DFVA 5T8KA 4L74A 4ALIA 4BNVA 4J1QA 1NFQA 4A26A 1V6AA 4UREA 2WSBA 3ZNQA 3OFSA 3WS7A 2H9IA 1TB4A 3CPSA 4CL3A 2D8AA 2JFFA 2VQ3A 1PGOA 3CZMA 5F3RA 4CQLB 2UUOA 4H16A 3A1NA 3AU9A 4E6PA 4J3FA 4UEOA 5B1YA 2OOSA 2P68A 5JCXA 3DOJA 1ID1A 5JFOA 1E77A 1Y8QB 1J4AA 2GN8A 3FNEA 3GGPA 3PFFA 1Z75A 4CM4B 5U9CA 1WVGA 4D3DA 2VYNA 4E30A 4AFNA 3NTOA 4IQGA 1CF2O 5GZ3A 2EERA 1Q1NA 2CY0A 1PS0A 3KYBA 1WW8A 1SPXA 4BGUA 3ZWYA 1A7AA 1GR0A 1HF3A 3GVXA 1TI7A 2GZ1A 1DOHA 2HMSA 4JGBA 4YJHB 4LMPA 1DIGA 2VOEA 1KETA 3Q11A 1ZZEA 2HJSA 4GKBA 3JQ8A 2ILTA 4A5OA 2CF6A 3KHUA 3JD1A 4DL9A 3WGZA 3D5TA 1ZSNA 4GX5A 1N9GB 1HDXA 1JW9B 2NM0A 3PDUA 3HADA 4MKZA 1YGYA 1ZEJA 1H6CA 3EYWA 3W1VA 3I9LA 5BSFA 5CAEA 4D3FA 4ZGWA 1YL6A 2LDBA 5CHEA 4EW6A 4I9NA 1MP0A 2GASA 3L4BA 4EITA 1PJCA 4FB5A 4RJTA 4XIJA 3S1LA 3H5NA 3KEQA 3RFXA 3FWNA 1DLJA 2EEZA 1TEHA 4GX2A 1H6DA 1ZJYA 1PTJA 3GLQA 3PIIA 5JLAA 3W8EA 5DCWA 2SCUA 1PL6A 3MOGA 5C37A 4R5HA 3T7EA 5B4TA 3VPXA 3PVZA 4LGVA 4DREA 4G81A 3LT4A 1YWGO 2NU7A 4W9NC 1KEUA 2ZB3A 3O9ZA 5LC1A 4EJ6A 3GVPA 4XIYA 4TZTA 3HFGA 4RVDA 4A0SA 1SO8A 1N1GA 3EY4A 3NRCA 2Y0CA 4MVJD 4WEOA 5DCYA 4R69A 3M2PA 2EW8A 2ZJ1A 4D0RA 2EW2A 2BMAA 1OOEA 1B7GO 1Y8RB 2YZ7A 2CD9A 4IJVA 2HDHA 4I08A 1NHGA 4IJKA 1U3TA 5T8KC 4E32A 1X1EA 5L4SA 2FRDA 4B7UA 5TX7A 1YJ8A 3OQ1A 1JU9A 1E92A 3C8MA 1Z82A 5ES3A 1QYCA 4BO3A 3WYEA 4K26A 2O3TA 1B3RA 4IJWA 2YYYA 4O59O 1IULA 1QLHA 3CE6A 2Y05A 3H5RA 5A9SA 3UCEA 3WGOA 3G49A 3WQSB 1BTOA 2VWPA 3GGOA 4YEDA 5KOIA 2XOXA 3PLRA 4INAA 3DBRA 3NDIA 4Y98A 4YA6A 1PQUA 3F9IA 3INRA 1R4NA 3JQBC 1DAOA 4XDZA 1V3VA 1E7SA 4WOJA 3C1TA 3WJAA 3LDHA 4Q3CA 3TZHA 4MVJF 1BXZA 4L73A 5G4LA 3MJ4A 3HB4X 2WDZA 4FN4A 3DBVO 1E3WB 1I32A 1PWXA 1SEVA 3S55A 4CMEA 3ETEA 4XDYA 1DBVO 4FC6A 2UDPA 4NBTA 4RL6A 1XU9A 4J2HA 4ALKA 2NTJA 1T1RA 5JDCA 3U5TA 4L8VA 3C1OA 1CERA 4YJFA 2VTEA 4NG5A 3K92A 3QVWA 3D4PA 4QUKA 2HK8A 5DBIA 5TGDA 4QSMA 1BMDA 5DDIP 1DAPA 3QP9A 2BFPA 4B4UA 1YQGA 1LDMA 2CVOA 3L77A 1XELA 3PQDA 4LRTB 3V8BA 3JQCA 4YQYA 2NSDA 2H1SA 2X22A 3AOEA 4RCVA 4AJNA 4YPOA 2JFGA 3ROMA 4IDGA 1LDBA 5EL0A 2Y1CA 3G1UA 3IC5A 1P31A 3N58A 3KETA 5KCZA 4JJGA 3TZKA 4BGEA 4OOFA 4DTIA 1EUDA 4MOWA 5AXBA 4BB5A 1B15A 1ZO8A 3RI3A 4BV9A 1IUKA 2VZ0A 4II3A 1HDYA 1U1IA 1W4ZA 3OICA 1XG5A 4RPHA 4DWVA 3JD3A 3WGIA 3HNPA 4WCDA 3BHMA 2WYUA 2O7QA 1OBFO 2EG9A 2O4UX 2Y66A 4RQTA 2VZ8A 4UUOA 3DHNA 4XWYA 4YT2A 5IDYA 1NWCA 2B5WA 3GVCA 4RVSA 3TF5A 1BXKA 4YR9A 3DFZA 4FOSA 3OHSX 1NPDA 2P4HX 1XQ6A 1GZ6A 1AA0A 4CLHA 4L75A 4XQ9A 6ADHA 1BDBA 4DPKA 2ZJ0A 3LF2A 2A9FA 2OMEA 4WUVA 5G4KA 3C7AA 2GZ3A 4E5NA 3UOGA 5A9RA 3HJAA 3R6DA 2ZB7A 1YBVA 1ZK0A 5J23A 3RBVA 3WDSA 4ND4A 4NMHA 5JXWA 4CV2A 4GSLA 3RC9A 5KJ1A 3WJ7A 2VWGA 1AXEA 5EQFA 4I9HA 3JQ8B 5G0SA 3ZNPA 4FJ1A 3ZNNA 2PKRA 4Z0PA 3GY0A 1E1LA 5CDSA 4PFJA 4RPLA 1QRRA 3E5MA 4R51A 1W6UA 4Q9NA 2NU8A 4BMNA 4LCJA 4MP3A 4MVJA 5ENVA 5HA5A 3IS3A 2GPTA 2X7HA 2X86A 3TJRA 2YDXA 5H82A 1LXCA 1O9BA 4GPD1 4O0LA 1XDWA 3UXYA 5TIIA 4OGWA 1UZNA 3I9MA 2ZTMA 4E13A 1ISGA 1I24A 2OUIA 3KBOA 1XKQA 3NUGA 2PFGA 1T1SA 1X7HA 5LDHA 1WLYA 1LDGA 5L4NA 3ICCA 2XF8A 5GZ1A 1OI7A 1AHHA 4EJ0A 1C1XA 1KVSA 2O7SA 4IDAA 3W6UA 3S2EA 1B2LA 3IJRA 4J4HA 4KQWA 3HDHA 2EHDA 5FEUA 4OSOA 4TQGA 2YJZA 5K6AA 2FY8A 2CDBA 3PQEA 4BUCA 3AUTA 3PJEA 1PIWA 3O38A 4RDHA 2C2YA 4EUEA 2YFHA 1ENZA 4IS2A 2GLXA 4YBZA 4ZICA 4F6CA 3WIEA 5CDGA 4OXNA 2H5LA 1PU2A 3W4JA 3K5PA 1VE9A 4C7KA 4J7XA 1PGQA 1DIAA 5EIOA 1IY8A 3ITKA 1PS8A 5KJ6A 3FR8A 2BI7A 2D0IA 5JSFA 2DAPA 4YCAA 4GVLA 3SEFA 3D7LA 3U4HA 4Y8VA 1J49A 1E3EA 4KTTE 4GGOA 5A5FA 5A9SB 1JN0A 2WJPA 4QFCA 3AFNA 4CM7A 1N5DA 4N54A 3DBRB 4EZBA 3MEQA 1R4NB 1OC4A 3SX2A 4BO6A 2B4QA 5ITVA 1RJWA 2PGLA 4X54A 3JQAB 4AJLA 1O94A 3H7AA 3ZH2A 1U28A 4LW8A 4ZA2A 1EZ4A 3QV1A 2DTDA 3TRIA 3AUSA 1N7GA 1A5ZA 3GPDG 1PZEA 3HHPA 3RC1A 2HMUA 4FFOA 4L0QA 4XX0A 3QVTA 4MDHA 4BOYA 4Z9XA 3DTTA 4QTZA 3DXFA 1K0UA 3CUKA 3H2SA 2VRCA 3FPLA 1NAIA 4PLYA 4YJFB 2VHWA 4XRGA 1YOVA 2X9GA 3Q9UA 1ZFNA 5T5QA 1Z6ZA 3B1JA 3TOXA 1ADBA 1MB4A 4J6FA 5BSEA 1U3UA 1NAYA 1T26A 1O6ZA 2QW8A 5F1PA 4WLVA 1VL6A 3U62A 3E48A 1IE3A 5DZSA 1TT7A 1DB3A 1QV7A 2J6IA 2EIHA 3H2ZA 3GEGA 3ADOA 3KYDA 3GMSA 3AJRA 2X58A 1F8GA 1PZHA 5KVCA 3JV7A 3RUEA 2O3SA 2HCTA 4MIOA 3ZCXA 1SOWA 5HS6A 3JD4A 3CH6A 4FSHA 3Q6IA 1I01A 2HMTA 5FYDA 4P22A 4I9UA 1C0PA 4TSKA 4PLPA 2IYPA 4NH4A 1BRMA 2WMDA 1QLJA 4R1SA 1UXJA 3IMFA 1GUYA 1C1DA 1YDWA 1A9YA 1FDWA 1KEWA 4OAQA 3WYBA 1LQUA 1PS9A 3E18A 5GMOA 1D7OA 2C0CA 4IDBA 3WNQA 4ROSA 1I8TA 3ZHZA 4NBWA 1XU7A 2ZTLA 1EVJA 3TL2A 4BO8A 4H7PA 1SB9A 2Q3EA 2NLOA 2IXBA 3ABIA 2BH9A 1O8CA 3FWZA 3ICPA 3OH8A 4GWGA 4ZQBA 5T57A 1ZCJA 3EZYA 3U3XA 4CLRA 5CG1A 1BGVA 4BO9A 2W2LD 4JROA 1T25A 2PGDA 1FMCA 5G4KB 4PRKA 4ILKA 2O50A 3UHAA 1Q7GA 3LU1A 3UF0A 4WLNA 2AE2A 4HNGA 3ULKA 3DB2A 4Z9FA 4J1SA 3TQHA 1DPGA 3RJ9A 3GAZA 4AJHA 4MIEA 3O4RA 1DIRA 1NPTO 5KKCA 3AM4A 1YB1A 5FWNA 4IDCA 1O0SA 2ZCUA 4CMAA 4EBFA 1JVSA 4IMPA 4BNYA 1E3LA 2V6BA 3R3JA 3A06A 3PTZA 1DC6A 5K0ZA 3STHA 1NXQA 4BNZA 2D2IA 2HKIA 4JJFA 4P4GA 2EGGA 1SAYA 1PQWA 3PP8A 5IZ4A 2F00A 5LDGA 3RAJA 5DCUA 2O3RA 5IXSA 4PLHA 4KUHA 3H9QA 5CEFA 3CZRA 5KVQA 1P9LA 2EKQA 1N9GA 3NDRA 2WYVA 4O1MA 3RFVA 4ALNA 4ALJA 2ZYGA 1R0KA 5KNLA 1C1XB 2Z1NA 1WMAA 4EGFA 2QZZA 3ASUA 3EHEA 4GX1A 4OQZA 4JNKA 1PGPA 1UAGA 2X0IA 1JWAB 3IJPA 4RZIA 1YB5A 2P91A 2A94A 2JCYA 3VH4A 4D46A 4OMUA 3ONFA 2Y1DA 4BS9A 3VPGA 2I76A 4OJNA 4CV3A 3K73O 3HZZA 1MFPA 3PJDA 3SXPA 5CDUA 4NU5A 2QYTA 4YT8A 3DO5A 1WP4A 3ZZNA 1PJ3A 2EXXA 1U2DA 1DIBA 2HLPA 5I8ZA 4IXWA 1H6AA 2J8ZA 2XXBA 3DZJA 3RIHA 3SLKA 1SC6A 3PWKA 3DOOA 1ISJA 3GZ4A 2V65A 5FI3A 4DRYA 2VNSA 1RYDA 3ZW8A 5AVOA 5JS6A 3INGA 3QIVA 2J5RA 1X13A 3IUSA 3C1AA 1MG5A 4RLHA 2BELA 4MVJG 1NASA 4CMIA 1LDYA 1HTBA 3GR6A 4Z0HO 4UVDA 1T2DA 4Q39A 4WJZA 2PNFA 1A71A 3O26A 3KLMX 5EINA 3MZ0A 3EW7A 1Y9EA 3H9EO 1PX0A 4AL4A 2EP5A 4CLOA 3H8VA 3FBTA 1LX6A 3NX4A 4XYBA 2DU8A 2X9VA 3NKLA 4IZHA 2C7GA 3WGHA 4HFRA 5BSHA 4WOKA 1YL7A 4DLAA 1XQ1A 1P33A 1IYZA 1TVEA 4BO2A 1KY5A 3IQDB 2DPGA 4YAJA 5FI5A 3ST7A 3WB9A 3WMXA 1OZAA 4UVHA 3W8DA 1XLTA 5A06A 1GY8A 3MJSA 1YRLA 1X7DA 3C85A 2FHSA 3F5SA 3KRTA 2G5CA 3WLEA 3NJ4A 1E3JA 4XRRA 2A92A 2EP7A 2NUAA 3FPCA 4PLGA 4K28A 4JJIA 2VHZA 5C7LO 5IF3A 1IPFA 5BNFA 4EEXA 4CQMD 4RZHA 4D41A 1KS9A 3ROPA 2WEKA 1ZBQA 3F46A 3GDFA 5JAMA 4R9RA 2D5CA 4QT0A 1C0KA 3F6YA 2NQ8A 3TSCA 3V5NA 4RVGA 1QP8A 4RPJA 4YJGB 3PIDA 1P45A 5A1TA 5L45A 4EJMA 4KDFA 5L4LA 4S3MA 3KYDB 1HDZA 3LT2A 3AFMA 3BMNB 1B8VA 3WGQA 1VC2A 2VUTA 2QYSA 4XEHA 4CM9D 3H3JA 3V1TC 3VDQA 4HFJA 3GNSA 4Y6PA 1YONA 4M55A 4U5QA 4R41A 3K6JA 4UVGA 4BO0A 3DEYX 4XR4A 4KQXA 3L0DA 5EJ2A 2W2LA 4HX5A 1EVIA 1Y6JA 5DP2A 1JKFA 2JD1A 5A04A 1GCUA 2OORA 1VJ0A 5JAIA 2CF5A 4J2OA 4Y67A 4J7CA 4PGFA 1NQTA 1PWZA 1ZK1A 5HM8A 1D4FA 2GN9A 2YHUA 1C1DB 3VTZA 4DQXA 4MVJM 1LRJA 1UXGA 3NJ8A 3VZSA 3GZNA 5A05A 1UZMA 3L9XA 4KWIA 3PPIA 1GEGA 3C7DB 3H5AA 1PL8A 3KVOA 4R4JA 1R66A 1E7MA 2YUTA 3AY6A 1ORRA 4MINA 5ILGA 1OFGA 1MFZA 2JHFA 1LC3A 4IIVA 3UH1A 1QR6A 4U0JA 4ALLA 3QQPA 4CR8A 4RV9A 3LVFO 4CLRB 4K6FA 3B70A 1AE1A 1F14A 2AMFA 2HSDA 3HG7A 2VT3A 2I65A 4GI2A 5JNLA 1DRUA 1BG6A 2D5AA 3E9QA 5A3VA 2E48A 3WX0A 3HE3A 1UDCA 3FCOA 2O3JA 2R00A 3WQQA 4A2CA 2IYOA 5FF9A 4JBHA 4E33A 1UH5A 3CMCO 4IY1A 4UUMA 1RM0A 3ANLA 5F5LA 1DHTA 4E2ZA 4E2YA 5DP1A 3WYCA 4XJTA 5JYDA 4TVOA 4GLLA 1DIHA 1UXHA 2GN6A 2FR0A 4YAKA 5JDIA 1KIFA 4PG6A 1HZJA 4EUFA 3E82A 1GDHA 1U7TA 1ISHA 1QKIA 3T7CA 5IDXA 1EE2A 5I7VA 3A28A 3OA2A 3GG9A 2EGHA 3OIGA 3VHRA 3EC7A 1P1KA 4XB1A 3S2IA 3GN2A 5G0TA 3Q2IA 4GQAA 1PSDA 3JYNA 3ON5A 3I6QA 1HLDA 1Y7TA 4MP8A 2GF2A 1HDOA 5ICMA 3ZNOA 2CVQA 2YQ5A 2UAGA 2C7VA 2UVDA 3FBGA 1HE5A 4ND1A 5CPFA 1C0IA 3F47A 4IQ8A 4AG3A 1K3TA 1GL3A 4DC0A 4FCCA 5CDYA 1NP3A 2GUGA 4DQVA 3IIEA 1MG0A 4HY3A 1U8XX 2X1HA 3I83A 1IZ0A 1MA0A 5IFLA 4MJLA 3ETGA 3PHIA 1W73A 3DONA 4H3VA 5TNXA 1I3MA 3GH3A 4Q3AA 1GYRA 1ZK2A 1H5QA 3QWBA 4MKXA 4BKQA 3DZGA 2Q1TA 2WD7A 1PEDA 4U6SA 5F21A 4M1QA 2W98A 4BNLA 4IUYA 4TZKA 4B79A 1WDLA 1DSSG 7MDHA 3ZU5A 1B8UA 3KSDO 5JCJA 1H93A 4LVCA 1QXSA 4PZCA 1L7EA 1Q7BA 4ZQFA 3WBFA 2JAPA 3BMOA 4CMIB 4CQMA 1JA9A 5F5NA 3GG2A 1SCUA 4Z3KA 3OETA 4A73A 4CMBA 3RBXA 4J0FA 2OL4A 7ADHA 1D8AA 3RU7A 1E0DA 3GT0A 3RUHA 4CLOB 1DC5A 4A27A 3CINA 1F8FA 4R3WA 1FDVA 3U9LA 5TJ9A 3CIFA 2IEBA 3ONDA 3RSHA 3NYWA 2Y99A 4CM9A 4FOOA 3PFWO 3ZU4A 3L07A 4ZN6A 4PG7A 4W82A 4D7AA 4N7RA 1LSUA 2GNAA 3F1KA 1ULUA 1YQXA 2DKNA 3KM0A 3U4DA 1RWBA 2B0JA 4PRLA 3L6OO 4J4BA 3JQAA 3BMQA 1ARZA 2PKQO 3GC6A 4FFLA 1P3DA 3ONEA 1N1EA 1Z74A 1EVYA 5ENDA 1MGOA 4FR5A 4AJPA 4KTVE 5L7TA 2YW9A 3EVNA 2W2KB 3ZDFA 3V1UA 2QZ9A 1A9ZA 3ZHYA 3MJTA 3KLPX 1J5PA 1LNQA 2BRUA 1X0VA 2RH8A 1KY4A 4PLVA 4RF4A 4OL9A 1E6WA 3DAPA 5B37A 2DQ4A 1EDZA 3H6KA 4OQYA 2PZMA 2B37A 3BHIA 4FFPA 3DMTA 1ZIDA 2FSVA 1LDEA 4DPLA 1I2ZA 2QIOA 4ZRMA 3KXDA 2EF1A 3A14A 4P8RA 1PJBA 3CMMA 1FF9A 2P5YA 3L4BC 3BTUA 8LDHA 4NIMA 5TSDA 3WLFA 4DXHA 3FNHA 2FPPA 5I7FA 3BTSA 4M87A 3DR3A 1VSUA 2YV1A 4PZDA 1YB4A 5TT0A 2DVMA 1EUCA 4FJ2A 5AQ1A 3GZNB 4YAEA 4PIVA 2PV7A 4FFNA 3TFOA 3EVTA 1NFFA 4Q3NA 2P2SA 4IDEA 3OECA 1PZGA 3P7MA 1YDEA 2BGMA 1P1FA 2C20A 3D4NA 4B7XA 3GF4A 3WSWA 2ZATA 2VWQA 2Y68A 5T6BA 4YRDA 2CVZA 3PJGA 3I9NA 4Z9YA 3RROA 5ITWA 1GZ4A 4PZEA 2J3IA 4IS3A 1ONOA 3KEOA 3TZQA 2X8LA 4NDNE 3FTNA 1XHLA 3PJFA 5KJEA 5A4DA 2PZJA 3AWDA 3K31A 3NT5A 3JD0A 2DPHA 2P4QA 3CXRA 2PD6A 4FIZA 3DZFA 4UVEA 3ADPA 5G0WA 1ADFA 4FDAA 4R68A 3MTJA 1LRKA 3LZ6A 2GN4A 4CMCA 2E49A 1ISMA 1GQYA 3X2FA 1P1HA 4EUHA 3AK4A 1VJTA 4O63O 4QECA 3EK2A 2VHXA 4NBUA 4HWKA 2AEMA 3QWHA 1GADO 3QWFA 3QRWA 3K30A 1GPDG 1JAXA 2FN7A 2GRAA 1WNTA 1AHIA 2VYVD 4CMEC 4BNXA 3PWSA 2Q2VA 3JQFA 1I2CA 3PHGA 2DUUA 2FP4A 3B1KA 2VCYA 5JDCC 3U4IA 3HSKA 3H9JA 1R4MA 4FPXA 2PY6A 3FR7A 4II2A 2VUUA 2Q4EA 2RIRA 2VHYA 2Y1OA 3QW2A 5TF4A 1PJSA 3DMTC 4Y6RA 5HWSA 3OP4A 1VL8A 4NFSA 1GUZA 4L4SA 4L76A 4P4LA 3MCVA 2NU9A 3UVEA 3PYLA 2JFHA 5KVSA 2Q4BA 4IM7A 1QYDA 4AJ2A 4B3JA 3RKRA 1GZ3A 1PZFA 1BXGA 1V0JA 4OXYA 2Q99A 3RUFA 3ASVA 4UEJA 4AJ4A 4BNMA 4KUEA 2WD7B 3AOEC 1SBYA 4WCFA 3ITDA 3ROQA 1IL0A 5L7YA 1M2WA 1UP6A 3ROKA 1E3IA 3GGGA 4CV0A 3GEDA 3WFJA 1BHSA 3OF2A 1UJMA 4ZU3A 2EWMA 2IRWA 2OZPA 3OQBA 1XA0A 3ZWCA 3BMOB 4CQMB 5KJCA 3OQ6A 5I9NA 3VZQA 3I9JA 4B3IA 4JN6B 2B83A 2PZKA 4CUZA 4GWKA 3JQEA 4JP2A 3OA0A 3AUAA 4J16A 4KOAA 2BFOA 3E6AA 5K9ZA 1RPNA 4N5MA 3NT2A 2P9GA 2C54A 1AVYA 2O3QA 1VKNA 4D43A 4GH5A 3MTGA 4CM3A 1TXGA 3QHAA 4NBVA 2OFPA 2R2GA 4LISA 4CMGA 2NVWA 4RF3A 5L7WA 3AI1A 4CR6A 4YAGA 3DAFA 3G3EA 3P19A 1BSVA 1T24A 2CDAA 1OAAA 4YJDA 3BMQB 2ZK7A 5JY1A 3BHJA 1NNUA 3PQFA 5COAA 2ET6A 4CR7A 3DTYA 3TFQA 3R1IA 5AYVA 5AOVA 3FRJA 3E8XA 1PGJA 2FZWA 4W6ZA 3RKUA 1B14A 1D3AA 1P74A 2WWRA 1ZSYA 3KSUA 4BKOA 4GKVA 1GV0A 5BR7A 1GAEO 2H63A 2CDCA 4J43A 3I4FA 5ADHA 5FFFA 3GK3A 2WTBA 5IN4A 3N7UA 1JDJA 1GCOA 3ZWMA 5DOZA 1V3UA 3V2GA 1Y81A 4DC1A 4CMKA 4E3ZA 2O4CA 2O48X 3RC2A 4GAEA 3LC7O 2WM3A 3HWRA 3WTBA 3GDOA 2NTNA 1SMKA 1JKIA 4YB8A 1D1SA 5JW6A 5HBRA 4XQGA 3HN7A 1GEEA 4YJGA 1V8BA 3M1AA 2AXQA 1F06A 3M1LA 3SC4A 1BW9B 3BMNA 5T67A 2ZB4A 4OO3A 1MX3A 4M89A 4IINA 4YYZA 3DOCA 1N7HA 4YQZA 5C3MA 5ER9A 1EDOA 1O5IA 1DJQA 4Q3BA 4MVJE 1MV8A 1EBFA 4PG4A 5K6AC 1IPEA 1P0FA 2NACA 3PI7A 4MPDA 4EYEA 1HZZA 4OKIA 1KVQA 3DZKA 4QFDA 4CM1A 3W8FA 5I9LA 4OHUA 3BTVA 4JBIA 3GEMA 2BLLA 1U5CA 3EGOA 3I6IA 2OP0A 1WZIA 2RHRA 1NFRA 3JD2A 2X0NA 3JYOA 2A4KA 1HKUA 5DBFA 2JL1A 4D3SA 4B8ZA 5I8WA 2Q46A 2RHCA 3PXXA 3LT0A 5H81A 4PVCA 5DN9A 3TDKA 1MUUA 1XCBA 4E2XA 5BQFA 4U6QA 4ND2A 3RQSA 1K6JA 4A03A 3U09A 4K1LA 5CP8A 2EKLA 1ZVMA 2J5QA 1XIVA 1TLTA 3ORFA 3S2FA 3UAGA 3NDJA 3C24A 4CLDA 4RVUA 3ZWNA 2DBVO 4R16A 4P4NA 4BNJA 2HUNA
chains in the Genus database with same CATH superfamily
5EHNA 4JB0A 1N2HA 5PGMA 3IQFA 2CNNA 1OFUX 5E2BA 4CCWA 1W88B 5HZHA 5CLGA 3ESXA 4H7HA 2OARA 1LWUC 5ALFA 1ZP6A 3WIUA 1RJGA 3K0HA 4YQEA 1E0AA 4GL4A 2CLEB 1NF2A 5FUBA 4R71A 2YHIB 2QRMA 2GF0A 3H65A 2ODBA 2NADA 1IH8A 1TM2A 2CDRA 4J4TA 2JC3A 1MPXA 4PZZA 4AUWA 3CLRD 1DFGA 5JJIA 5ALSA 3VO1A 3JZIA 5GAJA 4U8GA 5K2MA 1Z29A 1D9ZA 3ZE2B 3ZIAD 3M9BA 2OGSA 2TMYA 2VF5X 4RF2A 5DYIA 2ATEA 1PNVA 3EWNA 1W8DA 4FDVA 2NUTA 3I1YA 5GY7A 4AW9A 3V2UA 2P9YA 3M6IA 3GLIA 3CWBD 1E4OA 1OX3A 3OZRA 5IULC 4OYYA 4FYXA 4LGYA 3DVAA 4JAVC 4QVGA 1PJRA 3NOQA 4QC2A 4CL2A 4M98A 4HRAA 3TN7A 3FF4A 2NTVA 1M56D 4N3AA 4CYMA 2BF4A 2IW3A 2WNIA 1UDBA 3I4CA 3BXZA 3GA0A 2BHRA 4V0KA 4UB6E 4RH1A 1JM0A 1KF0A 4KMSA 4JIMA 4Z0NA 2ZUUA 2QN8A 4F4FA 1CWUA 1WOMA 2O59A 3O4FA 4RORA 4DV6B 4QSHA 1XZHA 1M1KQ 2ONKA 3DHEA 3V2HA 1JHOA 2XWPA 2O3UA 3VMZA 3B85A 2C5EA 2YUIA 4KFCA 1KVTA 4LV8B 5IZCA 2DG2A 5A0FA 2OM6A 4ZI7F 1UDRA 1GITA 5I51A 3ZI0A 3KJQA 1X0XA 3OFKA 1E5DA 4AJEA 3U5ZB 4C2TA 2W42A 5IWAB 1M3SA 5FTMA 3ZWPA 1XVVA 4FGUA 5EXTA 3DOHA 4PW0A 1VB5A 1WEHA 1Q0HA 2VHQA 2WUEA 2NX2A 1KDOA 1XHFA 3T9CA 1YJXA 1OYWA 3UWDA 2ZAGA 5EJGA 3VSCA 8AT1A 1HE3A 5U1PA 1IUNA 1KEPA 4FNOA 3UJAA 4CKEA 4IIJB 4BX0A 3O75A 3BH6A 2XY4A 4E4RA 1CT9A 2QX7A 1A8QA 3IEVA 2YIUC 1ZOPA 2Q9IA 2WPRA 1RHMA 1YE8A 4DUZB 4NV0A 5BV7A 5CK4A 1GSAA 2F9LA 2AC7A 2ZSBA 4N7BA 4WZBB 1X74A 4EL5A 2L2QA 5JZOA 1QTIA 1BWSA 2C92A 1N1MA 4CFYA 2F8SA 3V7UA 4F8YA 2X42A 2NVUA 1SURA 3VO9A 1WXFA 1LA2A 1SQXJ 3HJBA 3ZHOA 4XZ3A 1B23P 2O0LA 3FFTA 1RF1B 5B1EA 1R50A 2ZXXA 2CUTA 4HFMA 3FWLA 3SHFA 4X63A 3C3KA 4MKHA 2XUKA 2HJVA 3N2IA 4NBSA 3CX7A 4ZT6A 1NAHA 4WDQA 2QRJA 5IW8A 3K2IA 4WCVA 1YKFA 4S1VA 3OAKA 3G2QA 2OT3B 2OO3A 1TYEB 4P7FA 3UT5A 4LY0A 4AXBA 2CFCA 2JFZA 2DH5A 4N5NA 1OPXA 3AVVA 2VPXA 1E2GA 1UANA 3QSYA 3OTQA 3WV4A 1A02J 2ZI5A 1E59A 2HK9A 3CLUC 5G1OA 5FI0B 3LDUA 1GCIA 1PR3A 2BRUC 2Y9ZA 2P4SA 4E4TA 2C78A 4I1VA 3TIIA 2DC1A 1IN4A 2Q9BA 1JQ3A 1DQPA 1KI7A 4HD8A 1WW2A 2FAXA 4S1OA 3JZAA 1Y6FA 4FBMA 1HI9A 1OCEA 3NTXA 2DBRA 4U7FA 3DO8A 2WSCJ 1Z4PX 3FPSA 2DBQA 3QLJA 3DBOB 3IKMB 3FOFC 1EKXA 1U7WA 3KZCA 1R15A 3SWFA 3GPIA 3IAAA 3TD6A 4LN1A 1S2LA 2NPSD 4R01A 2EKPA 4FN5A 1IRXA 2R66A 4BZZA 1YZVA 2V7QA 3KYJB 4P35A 5K0NA 1Y0BA 1WAMA 3BZUA 1TAGA 4URUR 2BMFA 1Q5PA 1MZVA 1IOLA 3MP7B 1CUUA 3B20A 2I1QA 1S6YA 4D6TD 4MI3A 3WISA 3RBZA 2V7XA 3MTAA 2VZLA 2A58A 2Q5HA 2UYCA 5JVDA 4M86A 4OYRA 4ZKPA 2EVWX 3D3KA 1NWQA 1B76A 3PR3A 2FXPA 1Y3IA 3RVJA 2F8MA 2YIJA 3U3MA 3IAHA 3E84A 3FROA 4HDCA 2FPGB 3LKBA 4FSXA 1GRNA 4ZYXA 1V5WA 1NOIA 4R54A 2VS1A 2IYWA 4PLFA 2AEJA 4K2AA 1ZVKA 5AUNB 5EWLB 2QIPA 1C9DB 1KY3A 5ALXA 4N8SA 3NBXX 1TF7A 1WB4A 4FONA 5K8VA 1ZM2A 3IBFA 4MVJH 1P60A 1YZGA 2ZZKA 4PZ9A 1BMFA 3D2BA 1J20A 3P2EA 5KTYA 4FS3A 4HKZH 2FN9A 2BGGA 3RBAA 3QLEA 1UIIA 5CYPA 2A0UA 1SQXE 5AW5A 1T2UA 1PG5A 4NYIR 5IKPA 3H0CA 3L4FA 2BM1A 4YJHA 1BA3A 4RVHA 3TSOA 2R7MA 2R5NA 3HB7A 2H08A 3Q5GA 1EE1A 3DMDA 3H1KG 1WUYA 1V5GA 4NMMA 3H05A 1KI2A 5BR8B 1ZM3A 3GMDA 3TGPA 1G16A 1FW8A 4DA0A 1OFIA 1GA1A 5FJIA 4FYKA 4KVFA 4MO2A 1OXKB 4JEHA 4U2FA 2X3FA 3MJFA 4PBSA 2WKWA 3B78A 3OIYA 2DOKA 3L84A 1L4AB 3T54A 2QL5A 3HKBB 3W2IA 4I81A 3AQ4A 4G1CA 4ZZ3A 1QIGA 1XL0A 1KYVA 4NENA 3G17A 4YDHB 1N7JA 4NL4H 3K32A 3OJEA 1YJQA 1RKUA 4D9HA 1EEHA 4ZFNA 4F4DA 2D5BA 1SD1A 2JGDB 3GLGE 1RZUA 3IEIA 2ZRPA 2ACWA 3BXEA 1UBCA 3IT1A 5DNCA 5K6RA 4QARA 3ENNA 2OY0A 1DAHA 4AG5A 5EMHA 1QL2A 1GSOA 3RU3A 3FUTA 3RFCA 1RZVA 4QTUB 4K6HA 3VKHA 3D8SA 4C08A 1ZOOA 2MJZA 3ET5A 5EPEA 5DRTA 5COBA 2ZYRA 3HP7A 1IM2A 3BF8A 5BMOA 2Z2IA 4ALIA 4KIFA 3DUFB 1PEYA 1EDDA 3OUUA 4J3FA 3PX2A 1Z17A 4QXPA 4MVCA 4FOLA 3FFWA 2G25A 5JFOA 1E77A 1J4AA 4ZEOA 4HDSB 1WPXA 1WVGA 3RS9A 2VYNA 4JJ6A 2CY0A 5HILA 4LFBB 4B4DA 3H8JA 5I7HA 3LBHA 4BFVA 1ODFA 3A58B 1ZZEA 4O1HA 2HPCB 5CA1F 3BSSA 2JGMA 4JELA 1KARA 5BSFA 5CJ0A 3RL0D 4XIJA 5KVAA 2WHQA 4POAA 5KAFE 2AJ8A 4LGVA 2P0AA 5JBNA 2ZB3A 3MSXA 1RQNA 1HT1E 4ZARA 4R69A 1J9ZA 3OZSA 2EW8A 2H48A 3QH9A 1B7GO 2I87A 3MS4A 4FZRA 2HDHA 1TCCA 1CCWA 1X1EA 3D6HA 1YJ8A 3ZC3A 2L5GB 1L0LJ 2PRYA 3COYA 1FZBA 4YRQA 4M4SA 1WB6A 2WF6A 2BHSA 1ZLYA 3JQBC 4PHGA 3II6A 3SMQA 2OTKE 5JRJA 1E9BA 2NO5A 1JH9A 1SJ9A 3UC9A 5HUJA 2QGFA 3SQLA 1I32A 3FPEA 3L74J 2VO1A 2OYIA 3OZUA 3U5TA 3RG8A 3C1OA 1KZHA 1ULAA 2ON6A 4LJKA 2CJWB 1WSAA 3RFUA 3EPKA 1TYZA 4B5LA 4B4UA 2C2KA 2CVOA 3L77A 3RS3A 3R6GA 4KIGA 6REQA 3L4KA 3E3AA 3DNPA 3FCEA 2YYSA 1RF0A 4OOFA 2G09A 3WA7A 4B2LA 2QTCA 1OUMA 4RPHA 3SOPA 1E6CA 3HNPA 5CTAA 1DTEA 3RYIB 2ZWVA 3PNPA 4IIYA 4QTYA 4XWYA 5H4HA 1NWCA 3HR7A 3KJZA 1BXKA 1PE0A 1SXIA 2H5JA 1X86B 5F33A 2OMEA 2ZBVA 2PBFA 2WWTA 3UOGA 2ZB7A 4GZ6A 4KO3S 4CKBB 2OE2A 4HAWA 4LRXA 2IPNA 5ENVA 1Z0ZA 3K4PA 1ZRHA 1NBEA 1ISGA 2EJCA 3HS3A 4JUBA 2OCAA 2XF8A 3D54D 5C4MA 2SCUB 2CVPA 2H17A 3W6UA 1K75A 3N2GB 4KQWA 4OHMA 1F51E 3OZVA 4DADA 2GLXA 2FR8C 3RG2A 2UZ0A 2J08A 4C7KA 4PJ0H 2VAWA 2VBGA 1ZRNA 3L72E 4KTTE 1JH8A 1VL2A 4K8OA 4MVXA 2WPNA 3T1VA 3LV8A 4X54A 1EJ0A 2M6LA 2UWJE 3A6EA 2DQYA 2XQKA 3RC1A 3DJYA 1NYLA 1GGNA 2QLNA 3IV7A 3TNFA 1MX5A 4Z9XA 1NGMB 5AM1A 3IX7A 3HVUA 1T1JA 1Z5VA 3I37X 3A4IA 3C3PA 3HABA 5JU6A 2D06A 4OYLA 3QOXA 2AZXA 1Y4SA 3ADOA 3GMSA 1E0JA 2NRGA 1URQA 5E1OA 4F11A 1EUDB 3ZDQA 2HMTA 3NU1A 3QE4A 4I9UA 2IDKA 2WWWA 4F4IA 1YZNA 4Z8XA 1EVJA 4LBWA 4DJAA 4WWHA 2Q3EA 1I4WA 1NDUA 3DAYA 3P97A 3OFNA 1FL9A 2VG8A 4YJKA 1AC5A 1JR3A 4JQZA 3HJHA 1VQLP 2DWPA 1EVEA 2DPLA 3H5TA 4J1SA 3GLFE 4GC9A 3EXHA 3TTYA 5AR1A 2NU8B 2B87B 4GBED 1T5LA 4U2EA 4XOIA 4OHXA 2QG9A 5EP1A 4JUCA 2X7JA 2WYVA 1S0UA 4ZYUA 1YVUA 1XRNA 1FSPA 1RXCA 1JWAB 3QE0A 1MAWA 1YB5A 4OMUA 4LXQA 4WZZA 3HZZA 4Q05A 4U3FG 1OW6A 3ML1A 3UATA 2R6HA 2OFFA 3UIAA 2XNDH 3SLKA 4GXNA 4H1WA 1E1RA 5K0FA 1ZR4A 3RRNA 2WU3A 1TX4B 3G89A 4N6OA 1V9SA 2IEYA 2QTZA 1CI6A 2C7GA 2WT8A 1L4NA 1U0SY 2QVLA 4X41A 2DETA 1QG2A 4JLJA 4XLTA 3ST7A 1KKUA 1SUEA 4BMOB 1YT5A 5BSVA 4PR3A 2BFNA 3WLEA 3NJ4A 1XZGA 4P6VF 4KNVA 1FSSA 3K1ZA 3WLNA 5F2OA 3BRCA 4RMJA 1S2DA 3GDFA 2PQMA 5JAMA 4R9RA 5JYBA 1N2CA 1W2HA 3TSCA 3N8NA 3ET4A 5A7FA 3COZA 1TU4A 5L45A 4EJMA 3U7JA 3DLAA 4G5GA 2AOUB 1T9DA 1H66A 2HTFA 1DWPA 1YONA 2HMAA 4HQ0A 2WM2A 2W2LA 3EH1A 1RJ9A 4J7CA 4KMRA 1D4FA 1C1DB 2CNOA 2CMHA 3GZNA 1DQNA 3B8EB 1YD7A 4OI4A 3UTCA 5KZMB 2LCFA 3JWJA 1KJ9A 3ER6A 3U7RA 3LJKA 3ZHUA 5EP3A 4GBMA 1UFOA 4W7YA 1Q1BA 3DG9A 3SM3A 4IY1A 1RM0A 3ANLA 4E2ZA 1DHTA 2JB9A 2Y1XA 4HLUA 3FETA 3IAM6 4KO2S 4ER3A 3U3JA 5K99A 3QKRA 3CJQA 3RIMA 1HEIA 3D6TB 4Q7QA 1EX6A 3GN2A 2IHBA 1EQ7A 3MOSA 1TJ3A 2UAGA 1XVLA 1MG0A 3GBSA 2CL5A 5G1NA 5IFLA 3SQOA 4DWWA 4H3VA 3C3WA 2H3EA 2I2FA 5AMXA 4EW1A 5D3MB 1EINA 1L7EA 4PX5A 2X3YA 3FDZB 3R8XA 2F6RA 1P9NA 3RBXA 5CT5A 3QPAA 4EVIA 2WT7A 7ADHA 3PXCX 1RHJA 3THOA 4D7AA 5L3RA 1IATA 2P6PA 4V0LA 3EVNA 1WCWA 4PLVA 3ESYA 3TO5A 5APQA 2DQ4A 4YUAA 5D7BA 1J2RA 1L8AA 3OQNA 3EVBA 1UWKA 4FFNA 1EFVB 3LCUA 3PDIA 3UZUA 4WKOA 2ERXA 2XMPA 3DWEX 2R5BA 3GIDA 4EHFA 1VHLA 4Z9YA 5ITWA 1U0OC 5CB4B 3KEOA 1RKVA 1OJLA 3VV3A 5HQJA 4H4CA 3O8DA 4UNIA 3CXRA 2FZGA 4OU5A 3K1YA 4C4YA 4W6QA 2IIQA 3W2GA 4R68A 2GN4A 2FW8A 3AK4A 4FS8A 3EEOA 5BN4A 1W1UA 1SFCA 1VHQA 2FN7A 2I4MA 4JI8B 1WCXA 3O82A 3FR7A 1UBLS 4ARAA 2QTWB 1IBCA 1ZGJA 4HZIA 4BMYA 4L4SA 1T3JA 1YQ4C 2CFTA 3DZ8A 3ZLTA 2IPPA 1SA0B 1STOA 5FPPA 1QHHB 3M70A 3P2KA 5BXYA 1HJ0A 5EKTA 4DG5A 1ZWKA 1QHNA 2VKTA 3AR8A 1KWGA 4M1ZA 2C54A 4ZK6A 3ZVMA 1V16A 1ZMRA 3GRAA 2A5DA 4IFIA 4TLDA 1XXHB 2R2GA 3AL2A 1YNOA 4PAWA 1T0PA 5T3UA 3PQFA 4CR7A 4MUYA 4AY3A 2RC6A 4MRPA 1X9VA 2PUEA 1RP7A 5TXGA 2DHCA 1JDJA 3V2GA 3MAAC 4QU0A 3OLCX 4E46A 5IAGA 4BFTA 2PUTA 5JW6A 1P5JA 1M90Q 4Y1GA 4AKHA 2QN7A 2FP3A 1MX3A 3DOCA 4WHMA 1M1YE 3PFGA 5K6AC 1TPYA 2NACA 3S0JA 4Y6QA 4MPDA 4QFDA 2CJXA 2XE8A 2GKGA 3KTOA 3O84A 5CXUA 4J16C 3L6UA 2HIMA 4ILEA 1PT8A 2AJDA 3ZCPA 4JYAB 2J5QA 3BASA 5FUYA 3L71G 4RTJA 4P4NA 4BNJA 5JSZB 3OMLA 3S5UA 2VBCA 1J2YA 1R6BX 1B8NA 2OLEA 2IZ7A 3HJCA 4NZPA 3LBYA 2MIIA 5FV4A 3T12A 1GQSA 4G5XA 1U7PA 1QIFA 1UXOA 1QTNA 3KB8A 5DYYA 4AM8A 5KNCA 1G55A 2ZBEA 1FU7A 3I34X 4D4IA 5HZMA 3EDOA 3D6VA 1NJGA 3K16A 2EX1A 4PINA 1Y7LA 3BERA 1D09A 2RH0A 2IL1A 3UJNA 4ZVPA 5LQSA 2WKSA 1T2FA 3OJ0A 1K98A 4IJ6A 3CKLA 1TIKA 3W68A 2DT5A 3UJCA 5FBVB 5AJWA 1F12A 5C5IA 1AUQA 1FYVA 4DSTA 5KLVG 5LKAA 4NX2A 3TOVA 3NLLA 5KAIE 2HWKA 3L8DA 1NKNA 2YOGA 4IDFA 5E7IA 3DCYA 1DEXA 1RM4A 3L7CA 3QFCA 3UK6A 4Q1FA 1XTRA 2FPIB 4RK0A 3HKEA 4MWDA 3Q4GA 5KTTA 1WDMA 1XL1A 5F9MA 2X0FA 3FCYA 4FDLA 3CX4A 4DT1B 1LVGA 3KC2A 3LX4A 1FLNA 2UUPA 4S04A 5JCOC 4GOFA 4CMJA 3LD9A 2YMPA 5F77A 4XB2A 3WK5A 3NCHA 3GJTA 1ADGA 4YYEA 4NV1A 1W48A 4DWOA 2GKOA 1C7EA 3LHIA 3IOMA 4UE2A 4PLTA 3Q7QA 3VNBA 3VX3A 8ABPA 1IEQA 1Y4DE 2HN9A 2XRZA 5T64A 3X1ZA 4LGMA 3ZXYA 3UV7A 1EVLA 5C7YA 4A2PA 2ADOA 4ZOBA 3KDPA 2W4QA 2AMVA 2GLUA 2D3WA 1SFRA 1SBNE 3MHTA 1ZCAA 2QTAA 2NZXA 1UPBA 4WUTA 3RJ5A 1JBKA 3IEPA 3D6AA 4AJKA 4MPJA 3OT1B 1P61B 4H7IA 1YJWP 3NHRA 3HXPA 4P2BA 4K88A 2HSZA 3TDNA 3GPCA 1P1IA 1DJPA 5IANA 2Z8YA 1LF5A 2RKBA 1TZ2A 1JJFA 3WGGA 2IBZD 1JWLA 3HBMA 4DBVO 3MINB 2I2DA 2OORC 1MR3F 1XZJA 4RU1A 2A0WA 4TGLA 1CVLA 5HDBB 1UXIA 1YS4A 3GVHA 4B7CA 4BNNA 1ORVA 2JFUA 1PFIA 4F4CA 4Y2GA 1KKLA 2IH5A 4BV8A 1G21B 1RYFA 2EFYA 4TYPA 4FHGA 3O4GA 5G2OA 2E5WA 4P0PB 2RGEA 3QF4B 2DUMA 2CMDA 3FB1A 5LZ5A 1QGUA 5CA0F 3OMWA 1NQ5A 4KFRA 4QQRA 3KZNA 4OIMA 4QPCA 4ZOLA 4RM2A 2ZLBA 4RM3A 1QGED 1QRUA 1T4CA 3E2PA 3EZ2A 1S9DA 2CEAA 3N87A 3K5BA 5KOJB 3DOFA 4IZIA 4C1BA 1AKWA 2V7QD 2ST1A 2FN8A 1ONNA 1O5TA 5EHZA 3DVSX 3GJQA 3C7TA 4EF4A 1L0NK 3MPOA 1NW5A 2QM8A 3RS8A 2PSHA 4MWTA 3KYQA 4TROA 1LU9A 2C3MA 3UB3A 1IY0A 2H2DA 1E3MA 4OBXA 4ZTBA 2Q3HA 4JLDA 1SVKA 5L9AA 5JS1A 1VHWA 2OP1A 1S8OA 5CFZA 1IFDA 1I9CA 4XJSA 2C59A 3ZI4A 3GNTA 2YY7A 3V3KA 4A0FA 1VM6A 2GPSA 4D6YA 4LTMA 2OLKA 5KNDD 3AP3A 3P9RA 1X1BA 3K9BA 1W2EA 2WU1A 3O5AA 5CEJA 4IAOA 2HPVA 2ZKIA 2FEPA 4TZ6A 4KI7A 2BFBA 3A32A 4DLTA 1HDIA 2W90A 1KERA 3DYBA 3HM9A 3E05A 1YI8A 2PIDA 3RAGA 3BN3A 2FSUA 3GFOA 2G0TA 1KVUA 5EJ9A 3W5JA 1QVGO 3ONWA 3Q2KA 4ZD6A 4WW0A 4NBLA 3DLCA 1ULTA 2CV0A 4EYYQ 3WZMA 2EBHX 1C8KA 3JVVA 2FJPA 1EQUA 1V7CA 4Y9UA 3ZWXA 3VU3A 2ZB2A 3I58A 1R0CA 4E08A 3WZ2A 1P1RA 2PPVA 5F7JA 3BK7A 2C9ZA 5FIUA 5LOVF 4YP0A 4YCLA 2IPLA 2B78A 4AU1A 4BNKA 1ZXBA 4X8MA 2NYUA 3TSIA 3DOIA 1JKJB 4WBXC 1PNOA 1US8A 2FR1A 2RB5A 3KT8A 4Z4GA 2AN3A 2YJTD 2VJAA 1FNSA 3WHKA 5E9WA 1HFWA 4ZXFA 4EIWA 3VU0A 5AI9A 4RTPA 4YAFA 1QGAA 4KBYA 3Q8MA 4D4HA 1Y1PA 4ON9A 4TT8A 1RCFA 1KAGA 1SQSA 2XI4A 1SS1A 2ZI7A 1KJWA 5CB6A 3PEVA 1GPKA 3RQIA 3MCUA 2BF7A 3V4RA 3GYGA 3OCUA 1DWQA 3ZKAA 1M34B 1RXVA 3CSSA 5FUQA 1LW7A 3VYVA 3WFIA 4HDRA 3F6PA 3ZHRA 3QJYA 2JJ8A 1H4QA 2C4VA 5ALVA 3LRTA 3GRFA 2JGKA 1M33A 4G4GA 1U0HC 1TMKA 2A30A 5I6DA 1ZR2A 1Y9ZA 5AKXA 4J2TA 1XE3A 1JAYA 1QZUA 2ZM6B 4LJ9A 2Q2WA 4UC0A 1FP4A 2R1ZA 3V6IA 1L0ND 4O2BB 4WK2B 3ZV3A 3AR5A 4O2AA 5JNRA 1YB7A 4ID3A 3GRYA 2OXIA 1MKYA 3OJLA 2CXTA 3WNDA 2A7QA 4ITUA 2F48A 3ESZA 4MWSA 2C2BA 1L9XA 4RGYA 2H5EA 2FZEA 4XCQA 2HU7A 4BP3A 4GU5A 5MFPA 4YI3A 2JIQA 3OUZA 4NCAA 3OQJA 3WMWA 4XFKA 3BMCB 1R12A 3JATB 4R3NA 1QIEA 3UK7A 4UXHA 5ICEA 3WKEA 1C9JA 1PT6A 3ANNA 1R27A 4LV6A 5DNVA 3GJ8A 1N2XA 1IZ9A 3H4VA 1A3CA 1E3WA 3GZTB 3VAZA 1SOMA 1YC5A 2HO4A 3RTBA 4WXHA 2IYXA 2W6NA 1XAJA 1VPCA 3VHXA 1CK4A 2JCBA 1TECE 1SRRA 2IGTA 1JSCA 1N86A 4G84A 4BX3A 3EZNA 4WGGA 1EFKA 4IW3B 2OO5A 4MGEA 2Z43A 4OH1A 2PLRA 3HN2A 1OBCA 5FBRB 4AMYA 2C2HA 1NFQA 4Q47A 4MGHA 1YQ3C 4PBTA 3VXKA 1WABA 1URPA 1VLMA 1AMNA 5GVSA 4FU0A 1KMQA 3OE1A 1YR1A 1A7AA 1GR0A 4FXOA 4DC9A 4UNSA 4IRMA 2ZE6A 3G2OA 4AO6A 1K6EA 5F7XA 4HLDA 3I5CA 1MV5A 5B66E 2JZOA 2NM0A 5DLPA 1YGYA 5FTKA 2R8OA 1H4VB 4P33A 5CHEA 3ETHA 3U7IA 1PJCA 2P3LA 4YV0A 3ZGNA 3M06A 1KQFA 5AVYA 1IMJA 1S8AA 1MJGA 1SO8A 5DCLA 5DCYA 3ZPXA 3CCUP 5IBQA 2YMKA 4PPYA 3DD5A 2KS1B 1YITP 2QRXA 1G59A 2CD9A 4IJVA 4QTTB 5LYYA 2M1ZA 5L4SA 1VP9A 4BO3A 1QYCA 1XCPA 2YYYA 4O59O 1ZVJA 5A9SA 3SJBA 2EKZA 2XOXA 1SVUA 4X45A 3F9IA 1IK4A 3M9QA 1TU3F 1GXSB 3K9FC 4MVJF 1FFBA 1FP1D 3O83A 2FPUA 1PWXA 1XRMA 4UNRA 3UENA 1XEXA 5JWHA 3I8OA 3NBUA 4OJKA 1U5BB 1M57D 2ILVA 1RXUA 5FNVF 2BM9A 2PL9A 3SY8A 2OXRA 2HK8A 4QSMA 2ZDGA 3EFFK 2RGAA 2JASA 9MHTA 4FE4A 2RSLA 3MQ2A 3VR5A 1ZHHA 4ZDWA 2X22A 3ROMA 3N58A 5HE8A 4ABYA 1Z3IX 3OE7A 1ZO8A 1Z6QA 4BV9A 4RJIA 4DR1B 1K9SA 2JAQA 3VYSB 3HUEA 5HX7A 2H16A 1M8KA 1EXWA 2VZ8A 1TJPB 5IDYA 1DAEA 1MW9X 4I55A 1V11A 4IXMA 4G0NA 2P4HX 1G8YA 1EA5A 1CY0A 2CVFA 1QEXA 2BTOA 3GJRA 4WERA 2LZ0A 1RWPA 1RRMA 3CWBE 3CX5I 1T2VA 2BR5A 3EJWA 3JQ8B 4I9HA 4CNQA 2VH1A 2X86A 4FCTA 1QG0A 3QLUA 3OFND 4TM8A 1P2BA 1X7HA 1KB9D 1P72A 3B9QA 5GZ1A 5B58T 1KVSA 3AKYA 2XUIA 4Q4AB 1I7NA 4RD3A 2C2YA 3TIFA 4OXNA 2RHMA 1J0CA 1GKYA 2PS9A 3DCJA 2QTTA 3U19A 3VDMA 4Y8VA 3W6NA 4Y2PA 4QFCA 1JN0A 3AKCA 1G6OA 3KFXA 1SCNE 4GHWA 1A9QA 3ESBA 2HFED 5CM9C 2J0QA 1MNQA 2IW1A 1IZYA 4G89A 2HADA 3TRIA 2WG1A 4JYZA 3HHPA 2N1MA 1USIA 3NBFA 4MDHA 3TZEA 4D6TJ 3ASYA 1N8SA 1E1RD 1NAIA 4TTPA 2VHWA 4XRGA 1YOVA 5CNJA 3CD6P 3IUQA 5J4YA 2ZR8A 2W48A 5EC8A 1T6XA 3E48A 1RI2A 3C4JA 1DB3A 3W7BA 2X58A 1RE0A 4EFKA 3EA4A 2PRIA 3EJ6A 4BN4A 2CBZA 2Q7DA 3F3KA 1CB7A 5LP6B 3IMFA 1J0AA 4KXFB 4DCTA 1LQUA 4U2CA 4JF7A 4IDBA 3G8BA 3T7SA 3WNQA 4ROSA 3PX7A 2HNAA 5BN1A 1F6WA 1CULC 5EZYB 4PGHA 3DEAA 4DILA 2W2LD 3W5IA 3B38A 5DMXA 1FMCA 5ENZA 3UF0A 3P2JA 4DDWA 2AE2A 4YAWA 1O94C 2V4HA 3BE5A 1EFAA 4Z7OB 1Y3FE 2W6ZA 1IVNA 2ZCUA 2NV0A 5A4AA 4IX1A 2CE7A 4P4GA 5EGNA 2LRHA 1KP2A 5LDGA 5DE3A 4IHKA 5DTEA 2ZYGA 1A5TA 1QL1A 1YFJA 2XVXA 5EJMA 4F71A 4OQZA 2FEWB 1PGPA 1VL1A 3HYRA 4PYLA 3ONFA 2ZANA 1MFPA 2K4MA 1KBOA 1SHZA 3HNOA 4RZUA 3KEMA 3FMIA 5KQLA 4B31A 1M5RA 1TQ8A 1SC6A 1XFDA 3GZ4A 3LX8A 1UQRA 4OP2A 1ODKA 1OB2A 1P0IA 2BELA 3LHSA 5FWXB 3R5KA 4KE9A 5DH9A 5EINA 3H9EO 3IHLA 2YINC 4OGFA 3QBJA 2R7LA 4XEUA 3MQ4A 3WNBA 2K88A 2WPVB 1GOTA 4JR0A 1XZKA 5JMOA 3WLIA 1GFZA 3KXKA 2QZJA 2IWHA 4HJRA 4D9GA 2XA9A 4I9GA 1EXIA 2Q4RA 4V0MA 1IK9A 3V5NA 3NVAA 1GZHB 2E87A 3ABRB 1KN7A 4KDFA 3WGQA 3HTXA 2LTAA 2RGYA 2J45A 4M55A 3KPJA 2X2FA 4ZVUA 1Y6JA 3ROFA 3L4EA 3IIIA 3QVGB 4Y67A 1ORIA 1K3UB 3WGJA 2OZVA 3ROEA 3HDVA 4IEFB 3BJZA 1UZMA 3H5AA 3WB1A 3AY6A 3UAZA 1MFZA 3NWPA 4U0JA 3HUFA 4DA8A 2XTJA 5CHXA 4K6FA 3TIVA 1ZH4A 2VDKB 1NMSA 1F14A 2R8PA 1KK0A 2VT3A 4XVQA 2R8EA 4C4SA 2BTQA 1F48A 3RSOA 5TPWA 4D6TE 3I2GA 1V6CA 2AC4A 2VNJA 3OU2A 2IBMA 3MTDA 1AH2A 1DIHA 3QVVA 2BI4A 2P6NA 3A1TA 1XU4A 2VDVE 2AK3A 1OZGA 1NN1A 4MR7B 4XB1A 4UU1A 3DM9B 4C7MA 5TQ0B 1R8SA 3HVJA 1Y7TA 3GB9A 1L4EA 1W59A 4YJ2B 1G8PA 4TMYA 2JWAA 3A8TA 1WZNA 3VGJA 4BAGA 3QU9A 1H1LB 3LUJA 2KSEA 3UOWA 3SQXA 2R6ZA 3F3YA 3GH3A 2B1GA 1YIOA 1SFCD 4K2HA 4B6PA 4ZMDA 4KO4S 4ISCA 1SC3A 5IAJA 5BR1A 3EG9A 2ZFUA 2GBIA 2ZVOB 1NATA 1NF3A 1ZNYA 3PNSA 5DO9A 4HVAA 3CIFA 4ZANA 3LQQA 4XXHA 2OBBA 2ATVA 1ULUA 4BC1A 3MTQA 1RI1A 1ARZA 2NZWA 4UMFA 5DGHA 1P3DA 4TYMA 4LDAA 4KTVE 5L7TA 1FSFA 5FPQA 2W2KB 1PR5A 3ZHYA 2AFIA 1LNQA 1G1JA 4X1IB 5B37A 1XTVA 2PMDA 5IAKA 5LL6P 1JJVA 3SJZA 1PR6A 3QMVA 5IAEA 2HJGA 1PJBA 4JBXA 3LHDA 4DXHA 4F8EA 3BTSA 1U3FA 5JG7A 2IU6A 5FD8A 5EZ5A 1A76A 2FQQA 5FFMA 4LG1A 1VKHA 2GPNA 3PC6A 1YZYA 4NCNA 1XZIA 1I4DD 1WSWA 2ZI9A 2ZATA 2Y68A 4AO8A 5K3EA 3K9NA 4I4LA 3ZD9A 2FRDC 2Q0XA 5IC6A 4LUCA 3LX5A 5TGZA 4C20A 4ARZB 4YRNA 3R3ZA 2QD4A 3GH1A 2YMMA 3H84A 4G86A 5AVXA 4E2FA 3L0SA 4JA2A 4JDUA 4FFDA 1CHDA 4OVNF 1GADO 2ZPTX 3HU3A 4CMEC 3PWSA 1IJEA 1I2CA 2DUUA 5CCGC 3E61A 3M9WA 3SK0A 2AWOA 4L4YA 1KIMA 1N36B 3WUUA 1V8ZA 3FBWA 1FB5A 4I9FA 5CCBA 3NFRA 2DQZA 2O8FB 3N8IA 1K63A 1R0ZA 3QTLA 4Q9HA 1X2EA 4MLCA 1TM1E 3GEDA 1W4CA 3I9V1 3D71A 4TTAA 2G8YA 4CQMB 4L6AA 3DMNA 2PZKA 1X70A 1JNMA 2P9GA 3FGAD 9GPBA 4N03A 1RHUA 2O2CA 1ZITA 2ZRCA 1WXXA 2X4IA 1N5OX 1OAAA 2JK0A 3DL7A 3UXEA 3NM6B 1H0HA 4CTNA 2WWRA 1PT7A 1JDTA 3BWMA 2WQ6A 1ACJA 3VU9A 3EQ6A 2VTKA 3P96A 3RLFA 1DIOB 4QL3A 4GAEA 3IRUA 3N6RA 3IELA 1PNQA 4UB8H 5KC9A 2GT1A 1Q1EA 3PNVA 4EP1A 3B5NB 1TMOA 2OVBA 1IBRA 3V4ZA 4EG8A 4PG4A 5B3LA 1P0FA 1KDTA 1FFWA 1JS1X 3GEPA 3G88A 5I9LA 5HXAA 3OCVA 3AL0C 1UK6A 2IEZA 4UCWA 1LLFA 1Z6GA 3MWLA 2QUIA 4B6QA 4MRMA 3PXXA 5F51A 3ZBUA 4IIJF 5CTJA 2ZYSA 3GHGB 3U09A 4MRSA 5I47A 1AQIA 2JDIA 2HUNA 1B1CA 3AESA 4OH7A 2Q2OA 1DKNA 3G71P 3VKUA 4UULA 2A9RA 3QOYA 2OAGA 2HCFA 1MCZA 1LSJA 1TZBA 3QBVA 4Q3KA 2ZXEA 2BR3A 3WIOA 2QI9F 4CLXA 5DM2A 1B3BA 2FMFA 3HI6A 2NU9B 1Q0PA 4MUFA 4HNTA 2WIAA 1THMA 4MIYA 5BU5A 2KWIA 4Y9TA 4EY7A 2W2PA 3AHCA 4IFDK 4JFRA 2PSSA 3TINA 2XJ4A 1SQFA 5JTUA 4C7NA 2Q9AA 3TNUB 4YRLA 4IHJA 1HZZC 2A1TS 4BP8A 3DC2A 5BT9A 5JYEA 4XA4A 1UR5A 2J5XA 4FMDB 4BCCA 4FZJA 5ALEA 4Q3DA 1VKJA 3IVRA 4FBGA 3SJUA 3C4QA 2KBFA 3QV2A 1YS9A 2IUEA 1CV2A 1QZZA 3IEUA 4F86A 3TTUA 3EAGA 3NMUF 5ECYA 3TEMA 1C2TA 2J9FB 4NU6A 4TRMA 2OQVA 1DDIA 4V39A 2Q1SA 5DV9A 3MTBA 3BXFA 2LP4Y 3JCUH 4RVFA 5KJ7D 2AXTE 1J2UA 1Y7HA 2X9NA 1M2GA 2XYQA 3T5PA 4HDOB 3PXDA 1TZJA 1MABB 1P7PA 1C7RA 3K70D 3TRKA 3CR3C 2ZSKA 1G64A 5K4HA 4QQNA 2CDNA 2D2CB 2CXXA 4NNOA 2NG1A 2QU8A 2I1WA 5CG2A 3K4HA 3JVEA 1VPVA 2EZ4A 1NUHA 5HGXA 4YIHA 3CNQS 4IJ5A 5A3QA 4WACA 3R9WA 3BWYA 5KUTA 1J0XO 1K9MQ 3RJZA 3OLVA 4ZJUA 5JANA 2ZUWA 2W6JA 2EJWA 2VK4A 4RHTA 2P1RA 4HK4A 4B4OA 1R3UA 3FSRA 1J09A 4CCAA 5B7GA 4QGHA 3OP1A 1NZJA 5AKHA 5LQMA 1XLTC 1XYGA 1IHYA 3I0NA 4N65A 5EEHA 1C81A 2W58A 5EJ7A 3TNJA 3PUHA 3SP1A 3L72J 1Q57A 2B35A 3BICA 3NANA 2AX3A 5LD2C 3OUTA 2OECA 3U56A 4JXKA 4KK4A 2F3SA 3UT6A 1ADCA 4XDGA 1JFRA 3LPNA 5BO5A 3QEOA 1FFEA 3QXXA 3CYFA 4BQSA 5F12A 1PJTA 2X6TA 3KQVA 5IRCD 1E6EA 3EWSA 2Z2ZA 1X7WA 1JF8A 4LXXA 5EP4A 1N2GA 2Q27A 5CFLA 4NBRA 2K7ZA 5HRAA 4TMKA 1R0YA 1FFHA 3CCFA 3JU3A 3BE6A 4YDRA 4QWMA 2OXEA 3ZDMA 2XKBA 1QE3A 3MS7A 4QUEA 3FCSB 1MFTA 2C2XA 1QH9A 4MW5A 1JBEA 2D5LA 3ZDEA 4DAOA 2AOTB 3VJRA 1M5TA 1O97D 3GXBA 3R24A 2AEFA 4TRNA 1D4AA 3T5AA 2XCLA 2BPOA 3UYKA 1K04A 4ZDIA 1EZVI 3ZCTA 1NVEA 4A8JA 4XQEA 4FGJA 4O4HB 2GZ2A 1XJWA 3AZPA 2QV0A 4MHTA 2E37A 2ZE7A 4B4WA 5FOWA 1CIVA 3FLBA 2FWMX 1U3VA 1M7HA 4L4ZA 1GZ7A 5BP7A 4PV1D 2CC2A 2ZBPA 4DNPA 3KQKA 2QJRA 1Y4UA 2AQIA 2A1UB 1HLGA 2FRVA 3MAJA 4IMIB 1QANA 2DLDA 1GD1O 4A1OA 3VNUA 3U4QB 3HDYA 1C30A 3HWSA 1YFLA 2XMSA 1M1JA 4LOAA 4N0EA 3WOHA 3CL3D 4CM8A 4N48A 2GO7A 5FLXA 4WNCA 3FHJA 3RFTA 2EZ9A 3PFKA 5FTJA 2EJBA 1II0A 1R8EA 1G0NA 2FFHA 5JQGB 4AURA 2Q2QA 3ZE9A 1EHIA 4TQUS 3ZZ1A 1E1MA 2UXBB 1KH2A 3FPJA 4JR2A 4BVGA 3LC1O 1WVMA 3V2RA 1GFWA 5G0UA 4HUQA 4IXDA 3LT1A 4W63A 3DE0X 3B71A 2KOGA 4KPUA 4BMVA 3O6QB 3EZLA 2BSQA 5B3JC 4PHTA 2VIIA 3AUYA 2X0JA 5IFKA 4GDFA 3V1YA 2FPRA 4BHTA 4MEAA 4WADA 1RR6A 2V6GA 4OHRA 1T8PA 5GOZA 1UFQA 4E70A 3L73D 1NVWQ 2I7XA 3AKEA 4AJJA 3ZS8A 2XF2A 1EIWA 3S3TA 4CF3A 2FZ4A 1AFOA 4JL6A 4LZZA 4YAIA 1NM5A 1P4SA 2WWXA 3WIBA 2X1LA 4DIOA 1P4HA 4H59A 2SICE 3UJ8A 5LBUA 2ECQA 2H4YA 2B2XA 3SD7A 2QU7A 2ZB8A 1VECA 3O92A 5IT5A 4D9KA 2VT2A 1P4AA 4A36A 1KSJA 1AK1A 3ETDA 1RAGA 4BLRA 3U1CA 2XEDA 4ND3A 3ORHA 1E5LA 2IIBA 3HR8A 4FHEA 5FHQA 4AJ1A 3W9SA 1WU8A 2Q6LA 1R6VA 3QITA 4TTRA 5CCXA 4GOOD 4LJRA 3EVDA 4ASWA 1O95A 1SXJA 3AE1C 1QZ3A 1PGNA 4C5AA 2HYDA 3PI6A 3K0FB 3IT3A 3KJIA 2DTXA 5FPTA 2C9BA 3ZGLA 5E1MA 1YXMA 2OBYA 1KD1Q 3IDZA 4CQJA 1Z38A 4QDKA 4KLZA 1C3VA 3OIWA 3PUYA 4EGJA 5IKXA 1E1CA 1M0TA 3N2NA 2CLMB 5TEVA 1Y5MA 4LXUA 2Q9CA 2I4LA 3F67A 2JD2A 4MP6A 1ZD3A 3BRVB 1RHRA 3MMPA 4CEHB 4L5JA 1T10A 4GOXA 4N0DA 2C29D 3X0DA 3IOCA 4FQ8A 4WV3A 2CLSA 4Y1RB 4Z7NB 5H9WA 1IFJA 2EATA 4Y9RA 3HJGA 3KOWA 1UPXA 3IB3A 3PHLA