3FWNA

Dimeric 6-phosphogluconate dehydrogenase complexed with 6-phosphogluconate and 2'-monophosphoadenosine-5'-diphosphate
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
467
structure length
467
Chain Sequence
SKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDAYAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQIGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEWLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 6-phosphogluconate dehydrogenase, decarboxylating
publication title Conformational changes associated with cofactor/substrate binding of 6-phosphogluconate dehydrogenase from Escherichia coli and Klebsiella pneumoniae: Implications for enzyme mechanism
pubmed doi rcsb
source organism Escherichia coli
total genus 171
structure length 467
sequence length 467
chains with identical sequence B
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3fwnA02
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 3fwnA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3fwnA01
1BW9B 3LF1A 4AJ1A 1BXKA 1NQTA 4EJ0A 4ZD6A 3ZN2A 1Y9AA 1I2CA 4WOKA 5FEUA 3T4EA 1U3VA 2YHUA 1AE1A 1QYCA 3FPLA 4CMKA 3IUSA 1I3NA 3LC1O 1YBAA 3EVTA 1N2SA 4TROA 1NAHA 1PTJA 2I9PA 1NHWA 5A03A 3INTA 1DOHA 3GN2A 5COQA 4E2YA 5T8KA 4PLFA 3WGYA 1I2ZA 1K6JA 3ON5A 1Y1PA 1GQ2A 3PHLA 1EBUA 1V3VA 3EVNA 1WMBA 1P1KA 1U1IA 1DLJA 5A9SB 3KB6A 3VZPA 4MOWA 4OQZA 1I24A 2EP7A 3KUXA 3VHRA 3ZNNA 4RF5A 1EUCA 4DYVA 4FC7A 5LDGA 2X58A 4E4YA 2P68A 4LSMA 4EUEA 2W4QA 1EE9A 3WX0A 4CM8A 2JD0A 3AI2A 4A10A 2D2IA 1N92A 3QVSA 1H6CA 4M49A 5F21A 2YDYA 5THQA 2P91A 4URFA 3RVDA 2POQX 2JHGA 3OHSX 3QWIA 4JJGA 4J43A 3KEQA 5G0VA 3TSCA 1I36A 3TL2A 4XQGA 2GF2A 4D3FA 2PGJA 3NAQA 3UAGA 2ZIZA 1E3LA 1V8BA 3V2HA 5AXBA 2AEJA 3JYOA 4ALJA 4CMAA 2JAPA 1KBZA 1PJSA 4L4XA 4LW8A 4BNVA 1BWSA 4J90A 3VDQA 1KIFA 3VOSA 4CR7A 3W1VA 5AOVA 3SXPA 1ZFNA 4TWRA 3IDSA 3HN7A 4RPHA 3SX2A 3ZV5A 3LSYA 3P2YA 2B36A 3CTMA 4O59O 3KTDA 4IINA 5ICSA 1ORRA 4R1NA 1YDEA 2HJRA 3ZWMA 5ER6A 4UEKA 3H5NA 4JBHA 2E49A 5JAIA 1PZGA 4WCFC 5CHEA 4DTIA 4N7RA 1BMDA 3PHJA 3WDSA 2VNSA 1ISFA 3UN1A 3IP3A 1JA9A 3VPHA 1H9AA 2P9CA 1K89A 4DLLA 4YAKA 3PEFA 1HYEA 1UAGA 1GZ4A 2YV2A 1F8GA 3ZW9A 2DBVO 3JV7A 3UOGA 5L4SA 1H94A 3W4IA 2NQTA 4RLHA 2DPGA 3GFGA 3ZNPA 1Z82A 2X9NA 3JQBC 3GC6A 4IM7A 3ZNOA 1A9ZA 1E0DA 2W2KB 2BFOA 1P1IA 3IQDB 1C1DB 2O3RA 1CQIA 4R3NA 5JCJD 1JQBA 1T2DA 5DCUA 3D3WB 5ES3A 4J0FA 4J0EA 4ZQGA 4BS9A 3I4FA 1EVYA 4BNTA 2G82A 3WYBA 4B3IA 1X7DA 2YUTA 2JD2A 4D44A 5L45A 3ASUA 4W6ZA 1N1EA 4IGFA 4LISA 3ZCXA 1R4MA 2XPCA 2GLXA 3I1JA 4FPXA 4PLYA 5DULA 5CPFA 4BHTA 2Y0EA 2EW2A 4MVJF 3BHMA 2JKVA 2O50A 2Y1FA 4E2ZA 3OMLA 5BR7A 5B37A 4JP2A 4B3JA 3CE6A 4KQXA 2FHSA 4MKRA 4RPJA 3MJTA 5K0ZA 2NU8A 1ZK2A 4FFRA 4IDBA 4HADA 6LDHA 4U5QA 2O3SA 4RDIA 3H4VA 1J5PA 4D42A 4HFNA 4KTTE 2I65A 2VN8A 1YBVA 1R15A 1PZFA 3NUGA 2BGLA 3WGTA 4CV3A 3JQGB 3O8QA 2O23A 2BI7A 4N5NA 5JDIC 4DYDA 4DMMA 2HUNA 4E31A 3FR8A 4DLBA 3K9QO 4J4TA 4JBGA 2CZCA 3L6EA 1IULA 2PV7A 4HP8A 4TZTA 4WCDA 4QUKA 1GZ3A 1K6XA 1TVEA 3R3JA 3WICA 4MKXA 2FZWA 1M67A 1G0OA 1BHSA 3E03A 2EEZA 1LU9A 3JD4A 2B37A 3FN4A 4K9DA 1D1TA 2CDBA 1EVZA 1GZ6A 5F5LA 1KEVA 4PG4A 2WD7B 2YQ5A 3GVIA 2GZ1A 4LCEA 3CINA 4RL6A 2CNBA 3WYCA 5CPBA 3KZVA 3DONA 1HDRA 3JQAB 2OBNA 2C59A 1U7TA 4E30A 3RD5A 3W8EA 1E5QA 4L75A 4IJKA 3WLEA 1SO8A 1Z73A 5FFFA 2Q1SA 5U9CA 3C7CB 3BA1A 1YVEI 1C0PA 3F5QA 3RCBA 5GZ3A 5BNFA 1VE9A 3M2PA 3L9WA 1OI7A 4RVHA 4GPD1 1KYQA 1OMOA 4RCVA 4QSMA 3JTMA 4UUOA 1GCOA 4II2A 2X8LA 4NMHA 1BXGA 1YJ8A 1JVBA 4WEOA 2E37A 4RVDA 4I5GA 1NAYA 1TXGA 4R9RA 3ZV3A 5A5EA 4G81A 4AJOA 1TT5B 2O3JA 3CMMA 1WMAA 3NDJA 3JD3A 4Q3BA 3HDQA 4D43A 4LN1A 2NWQA 4FFNA 4TKMA 1MP0A 4J7XA 3CZRA 4CM8B 4JIGA 4YQYA 3QY9A 3AOEA 1YQDA 3F1KA 3PYMA 1MFZA 4DPMA 1B8UA 1WAMA 2GGSA 2WE8A 1ULSA 3H3FA 5KIAA 1LDEA 4JK3A 2NM0A 3CPSA 1NYTA 1KVQA 3E1KA 4J49A 1U2DA 4Q3CA 1O6ZA 4YJDA 3DBHB 2X0RA 1M6HA 1WDKA 2VZ0A 2EW8A 1PS8A 3TZHA 4DC0A 3OQ1A 5HRUA 4WPGA 1GU7A 3VDRA 1H2BA 2IDZA 1PWXA 1HZZA 4FS3A 5H81A 1HE5A 1HE3A 1XYGA 2ZJ0A 2HKIA 3CKYA 4ZQEA 4NJMB 1AVYA 3O03A 1MUUA 5JBIA 1R0LA 4I08A 3RIHA 3BAZA 1FDUA 2VUUA 3T4XA 1E1MA 3C1AA 4C7KA 1PQUA 1YJQA 2ZTLA 4C4OA 3PPIA 2HJSA 2X0JA 2O2YA 2R2GA 3LT4A 4JP3A 4FD3A 3AK4A 2NU9A 3D5QA 4BB5A 2DUUA 3QWAA 5HA5A 1GUZA 3SLKA 4KUEA 3R3SA 4PG6A 2GN8A 1NR7A 4E3ZA 1SZJG 2X4GA 4B8ZA 4E6PA 4RVSA 1HZJA 4EUFA 2EP5A 4CMIA 4Y8VA 2GN9A 3SVTA 1LXCA 3PYXA 3LT2A 3K5PA 5G4LA 5LC1A 3I9KA 2ZTMA 4I8XA 4ZVVA 3NYWA 1UP7A 1JAXA 4YQZA 2I3AA 2QRKA 4YJHB 1PJ2A 3WGIA 4GKBA 3ROQA 4GKVA 1ARZA 1TLTA 3P2OA 1RM4A 3ABIA 1F06A 2VQ3A 1A72A 2PZJA 1EK5A 1MG0A 3H5RA 3RBXA 2RBEA 5JDCA 3AU8A 1YBMA 4NDNE 1ULUA 1YS4A 4ROSA 4OXYA 3IAHA 3RFXA 1SB9A 2NSDA 1SAYA 1QR6A 2JFHA 3HFGA 4UEJA 2C20A 5CG1A 1VLLA 1PR3A 2B0JA 2JAHA 1ISGA 3D4PA 5CG2A 1PZEA 1XGKA 2GN4A 3RUCA 3DMYA 1ZMTA 1E1LA 4L76A 1ZO8A 1ML3A 1DB3A 3JQ9C 3S2FA 3SC4A 3W4KA 1LSSA 1QORA 2GDZA 5KJEA 5BSHA 1QP8A 4IZIA 2VTEA 3Q6IA 3ZV6A 5L7TA 4JN6B 1L7DA 4U7WA 3TZKA 1WNTA 2X1HA 3GNTA 5B1YA 4DGSA 1XQ6A 3E9NA 1AHIA 4LVCA 4Z0HO 2QW8A 3VZSA 4J1SA 4U8GA 2D4AA 1CRWG 1O9BA 2DTXA 4BQRA 5AQ1A 1U8FO 4YAGA 1X13A 4XIYA 4YDRA 4LMRA 3AJRA 3ASVA 4YRDA 3F6YA 5IJZA 5JY6A 3V2GA 1VC2A 4NZ9A 6ADHA 2UUOA 3AFMA 3KYCA 4DQVA 1VM6A 5JO9A 1CDOA 1A5ZA 1R0KA 1WWKA 4OHUA 4B7CA 1I10A 4PLTA 2ZYDA 3WGHA 2O4UX 2QZZA 5EPOA 4QTZA 3VZQA 2F00A 2DFVA 1MFPA 1K5HA 3IP1A 4BV9A 2NLOA 3ZHXA 1ZCJA 5A04A 1LDBA 5ICMA 4CL3A 2VYNA 1Q7GA 1K0UA 5C37A 5JNLA 3DO5A 1IHYA 1YB1A 4CLOA 1I30A 2BFAA 1R66A 2GO1A 3I5MA 1D3AA 3QVTA 4Y98A 5JFOA 3JQ7A 1Y7TA 1SB8A 3QQPA 1H6DA 1PR9A 5T57A 1WP4A 4AFNA 3UGKA 3DZHA 5DBIA 5FYDA 4CLXA 4CMEA 2NU6A 3C1OA 1LDMA 1T4BA 3ETEA 4PZEA 3ENKA 1LDGA 4BKUA 3VPFA 3I9JA 2YFQA 1XHLA 3K6JA 2EF1A 4J2HA 4MPDA 3H65A 3QLJA 3RUHA 2HRBA 3TOZA 3HDYA 4XB2A 4BVAA 3RJ5A 1UDCA 3ZU5A 4LK3A 2CVZA 4A5OA 1BRMA 3TL3A 1JAYA 1A4IA 1U8XX 3D64A 5G0WA 4L73A 3VC7A 4X54A 2QIOA 3WQRA 3WIDA 3V5NA 3ANLA 4R4JA 4R3WA 1E6EA 1PEDA 4JJFA 5KVQA 1UZMA 3RWBA 1PQWA 4KTVE 1A71A 3PRJA 1A9YA 3FSRA 3UVEA 5CDGA 3DHEA 1EBFA 4GSLA 2JD1A 4K6CA 3Q9UA 3ZHYA 4BV8A 2YHIA 2Q2VA 3GUCA 5L7WA 2C54A 1LNQA 3DTTA 5IN5A 2CVQA 4EITA 4L9RA 4ND1A 5HTOA 4D7AA 4TQGA 4W9NA 5G4KA 4XX0A 1GFSA 2CD9A 2OP0A 3FNEA 3PIIA 2Y1OA 1NVGA 4O5OA 4M55A 4CLRA 1I32A 1FMCA 1SPXA 4NPCA 1NQOA 3WIEA 1XLTA 4PCVA 2IZZA 4YT2A 1Q1NA 5G0TA 2Q4EA 1YDWA 3OH8A 3PLNA 3PQFA 3JQFA 1GYQA 2YW9A 3H9JA 1PZHA 1Y8QA 4QO7A 3NGLA 1KOLA 1SBYA 2FSVA 3MTJA 4RF2A 1X15A 3HHPA 5DN9A 3BMNB 3GEGA 3V1TC 4FFMA 1NHGA 2GZ2A 4CM6A 5IZ4A 1RM0A 4GWKA 1HE4A 3WSWA 5IZCA 2J3KA 2GASA 2Y1CA 4GX5A 5T5QA 5A9TA 1WZIA 2XOXA 3GDOA 4PLWA 3K2BA 4A27A 4CODB 1DPGA 1XG5A 3O4RA 3E8XA 3D4OA 2E4AA 3FTPA 3ZWVA 1VSUA 4DBVO 2AQKA 3HG7A 2FPGA 2HMWA 1Y8RA 2PNFA 2ET6A 3GGOA 1E92A 4L8VA 4IIUA 3U4DA 2WYWA 1UXKA 1RM5A 2BLLA 2JL1A 4FGWA 3GVPA 2NADA 3SC6A 1VL0A 3RJ9A 1SNYA 3ZH2A 4NBUA 4R1TA 3TZCA 4P4NA 1RWBA 1X0VA 4NU5A 2ZYAA 3OEYA 4ALNA 4B8WA 4EEZA 3LT0A 3O26A 1DAOA 1H5QA 4PZCA 1QYXA 2XF8A 3OBBA 1YB4A 3JD1A 1PJ3A 2CUKA 2RAFA 3QP9A 4YVFA 4RVGA 3ZDFA 4HV4A 1U5AA 3PHIA 4RZIA 4OQYA 4BNZA 3GVXA 2ZKLA 3DB2A 4AJ4A 3S2GA 1GPDG 5KJFA 4Y67A 3FTNA 4NG5A 1YWGO 2JCYA 3RC9A 1O94A 3W6UA 1W73A 4RF3A 3T7CA 2NTJA 1T2FA 2BHLA 3ICPA 2J5KA 3B6ZA 2NVUA 4PG7A 2Y93A 5DBGA 3C1TA 3FRJA 2Z1NA 4BO1A 5ENDA 4D46A 3PK0A 1QYVA 2X5OA 1E1KA 5H82A 3U62A 1OC2A 1ISIA 3OEWA 1TI7A 1X7HA 1I3MA 4RF4A 4D79A 4II3A 1DIGA 5J23A 1I3LA 4MVJP 1MC5A 1E3IA 1I01A 5F3RA 3WYEA 2Y0CA 4CQLA 3K2EA 3L4BC 1YXMA 2P2SA 4XGNA 3ONFA 4BO5A 3LLSA 5BNIA 3G49A 2YQ4A 3ZW8A 4IQ8A 3GVCA 3PDUA 1NPDA 4IS3A 1X14A 2BRUA 1HDCA 5C7IO 1RJWA 4AJEA 1F0YA 1QXSA 3KXDA 1VKOA 5I7SA 3W6ZA 3G79A 4A7PA 2D5CA 1LBEA 2VZ8A 4BGVA 1QYWA 5CEEA 2NU7A 1DXYA 2QRLA 3LC2O 4XDYA 4CPDA 4CMHA 3QE3A 3MTGA 4H7PA 3WB9A 2ZB7A 4AJJA 3RUAA 4Z3DA 1ADFA 4C7JA 5JCXA 4JJIA 1I0ZA 4JBIA 5JE8A 4YTEA 2YZ7A 3WOHA 3JQCA 4BNJA 1U3TA 1DC5A 5GZ1A 2J3JA 2E48A 4DA9A 3DL2A 1JWAB 3B1JA 3KO8A 1E7SA 1QLJA 3WFIA 1HLPA 2R6JA 2UDPA 3DDNA 3RUIA 1C1XA 2AQ8A 5KOIA 3FWZA 1FDVA 1ZK1A 3AI1A 4R1UA 2O4CA 1PJ4A 4U6SA 1ZXBA 3CZMA 3JCZA 4RPLA 3C24A 4BNIA 1P77A 3D0OA 3TZQA 4PZDA 5DBFA 1XA0A 4FOOA 4CM3A 4PLZA 4QT0A 4WCFA 1R37A 3H2ZA 4MVJE 4LCJA 1AA0A 4BGEA 5JCJA 3INGA 3F3SA 4M54A 2C7VA 3U49A 3PYLA 4CM7A 1GR0A 1T26A 2D5AA 1GCUA 3I6QA 4Y9DA 3S2EA 2Q3EA 4JQCA 5U4QA 2I3GA 1DBVO 3NTOA 1UP4A 3VTZA 3LDHA 3NGXA 3AY7A 4ZHSA 1NFRA 3PVZA 3B20A 3GZNA 1JDJA 2Q2QA 3KM0A 4BMVA 3O38A 3H6KA 3KLPX 1T2CA 5GY7A 1OAAA 2AMFA 3KSDO 2EG9A 2EIHA 2I66A 2CSUA 4F6CA 1SCUA 4P22A 3GEDA 2FR0A 4BO3A 3BMCA 4HFJA 4J3FA 3B70A 4O1MA 5B4UA 3GG2A 3BTSA 4QECA 2OXIA 4W82A 3MEQA 1LSOA 4GGOA 5TQVA 4GQAA 4CLEA 4IXWA 4E5NA 4CLRB 3S55A 2ZB3A 1PJTA 4BO4A 4S3MA 3NDIA 4QXMA 2VOJA 2B5VA 5EERA 2UUPA 3BYZA 3IMFA 3LVFO 4KP7A 4IQ0A 2X0IA 4OSOA 3NTQA 3GNQA 1L7EA 1FDWA 3M1LA 3ONEA 3FWNA 3DTYA 5DP2A 2VWGA 5JMWA 3L6OO 1KC3A 5TLSA 1NNUA 3RUDA 1J49A 3L77A 4JNKA 2PK3A 3ANNA 4W7HA 1ISMA 1VRWA 2PZKA 3F9IA 2WYUA 4J16A 3PHGA 1R6DA 4XQEA 3GY0A 3WQSB 2I5PO 4OKNA 3GLQA 4YWJA 1UZNA 3VKVA 3L07A 3GFBA 3ZGYA 2PKQO 4LRTB 2Q46A 3JSAA 3IJRA 2BFMA 2JCXA 3VH4A 3DBLB 2PA3A 3WJ7A 2AXQA 1ISJA 2IRWA 4ND3A 5KJCA 4PG8A 2FPIA 2NVWA 1EQUA 3B1KA 4NFYA 2Y1GA 4JX8A 5U1PA 2OUIA 3JQAD 2OMEA 1Y5MA 1UXJA 1Y8RB 2CF5A 2HU2A 5DP1A 3X2FA 1GUFA 4JGBA 1RYEA 1XDWA 5JDIA 3DMTC 4L0QA 1YONA 1NBOA 4ZQHA 1XR3A 4FFLA 4B4VA 2VZ9A 3MJ4A 1BGVA 1ZUD1 3B1FA 1OFGA 1U28A 2P9EA 4WLEA 4ZJUA 4R5MA 3HB4X 2NTNA 3RC1A 3D7LA 4R5HA 4IGEA 3KYDA 2SCUA 3PFFA 1Q0HA 2W98A 4BNGA 1J0XO 3M2TA 2QYSA 4IJVA 1LI4A 2B4QA 1N9GB 2NQ8A 5JYEA 1A7AA 2O3QA 3BMQA 4M1QA 1DIAA 4K1LA 2I99A 3GF4A 4XYMA 4CM4B 2H1SA 3UF0A 3BTOA 1MA0A 2Q1WA 2Y68A 3KHUA 2QHXA 3NJ8A 1NPYA 2CFCA 3GPDG 4YT8A 3FR7A 1P9LA 2R00A 5KVCA 3NT5A 3TDKA 5HS6A 1PU2A 4OAQA 4DPLA 3SLGA 5CDUA 3H8VA 1IOLA 3GH3A 3NJ4A 2W2LD 2CDAA 4CM5A 1ZJZA 2X86A 2C7GA 3GT0A 1D1SA 2DKNA 3ITDA 7MDHA 2WDZA 1DIHA 3NX4A 1U9JA 4NI5A 1WDLA 3ZWPA 5L4LA 1P3DA 3GAZA 4YPOA 1R16A 5JC1A 1DC4A 2OL4A 4NNJA 2EKLA 3ZHBA 3RFVA 4ZICA 3ZWBA 1T1SA 4MVJI 4XB1A 2VRCD 1KVTA 5JMPA 2O3TA 5DZSA 3INRA 3WMWA 1YB5A 1YL7A 1NFQA 2P4HX 3GNSA 5G0SA 5JS6A 4ILKA 2FP4A 4GVLA 1CEQA 2EGHA 1Q0QA 1P74A 3OA0A 4EEXA 3QVWA 5ITVA 3U4HA 1MGOA 1DFHA 5A9RA 4R54A 4Y6PA 4AICA 3UICA 3RKUA 1ZJYA 3TZ6A 3ZWYA 4BNWA 1X7GA 1PGPA 1NX6A 1Q2XA 5I7FA 4E5KA 2HO5A 1A7KA 2HK9A 3AM3A 3C7DB 4AJ2A 3JYNA 2HMUA 1EUDA 4OL9A 2W8ZA 5KKCA 3RSHA 1W6UA 1Z6ZA 2X9VA 2FR1A 4YACA 1IPEA 3GA0A 2X5KO 1HL3A 4I5FA 3WWZA 1ZBQA 4DC1A 4MP8A 4UVIA 2QRJA 1JKJA 3N7UA 1ZMOA 2AG8A 4P4GA 1S7CA 3SBOA 9LDBA 4IS2A 4E0BA 1BSVA 3GZNB 2B4RO 4A0SA 1B2LA 1TEHA 3HB5X 3OQBA 3P19A 1P44A 1I5RA 5TS3A 2UYYA 3NKLA 4FN4A 4YAJA 3BMCB 3VPSA 1YO6A 5T64A 1JKIA 5HWSA 4U0JA 2FSSA 4DWVA 1LLCA 1P1JA 3IUPA 3PJEA 5A3VA 3W8FA 3GVHA 1K3TA 1N7HA 4PFJA 1BVUA 1GTMA 1JW9B 1XU7A 3ZWCA 1E1NA 1E3JA 4CLHA 3STHA 1NAIA 4JCOA 5A5FA 4IPTA 3C3XA 3G17A 1C0LA 2WYVA 3OSUA 4WUVA 5EQFA 1L1FA 3H3JA 1A4UA 4WKGA 2Q45A 3DBRA 4W99A 1U5CA 3OJLA 5TC4A 4R01A 1Y6JA 5TNXA 5KVVA 4E13A 1DHRA 1OZAA 1TA4A 3ZWXA 1P1HA 1G6KA 4DL9A 4F3YA 3DOOA 3DC2A 3OJFA 4FJ0A 4RO0A 4B4WA 5KWEA 2Y1EA 2OP1A 1GPJA 4IQGA 3OA2A 4RVFA 3PIDA 4HXYA 5EL0A 2O2SA 5COBA 5ILGA 5TJ9A 2HAEA 1LTHR 4YJGA 3IJPA 1U3UA 3UKOA 4D3SA 1X1TA 2G1UA 3L6DA 1ENOA 1ENZA 1PX0A 5L4NA 1Q7BA 5L53A 3JQ9A 2I76A 2DM6A 1DDOA 1UP6A 3PP8A 1DFGA 4XZ3A 3AOEC 5A3JA 4EGFA 4CUKA 3VTFA 3PZRA 2EWMA 4XYGA 3WJAA 1HDGO 4Y6SA 1HXHA 1ENPA 2GRAA 2H6EA 3AY3A 4GX2A 3ROKA 1LA2A 4N54A 1Y9EA 2Y99A 4CQMD 4WJZA 1WW8A 4BO8A 1MC4A 3I9MA 4KZPA 1R4MB 3MJCA 4B4OA 5C3MA 4WNCA 2O48X 4D0RA 2G5CA 3AUSA 4NHEA 3UW3A 1R4NA 5JAMA 1Y5RA 2YV3A 2XXBA 5I7EA 2C5AA 1XIVA 4TZKA 4AVYA 3GN1A 5EIOA 1MXFA 1N1GA 3LYLA 2D3TA 1HT0A 2JFFA 3K30A 4QQRA 4XA8A 2GUGA 2VCYA 4BUCA 2RHRA 4XJTA 4NK4A 4BNHA 4RORA 1EVIA 1ONPA 4BMSA 3BMOA 1C3VA 4A2CA 4B7UA 4A26A 3P7MA 1MG5A 2OO5A 5L40A 2OHXA 2V6BA 4OH1A 1HLDA 4XGIA 4YBZA 2GR9A 3TN7A 1NP3A 2PD3A 3X2EA 2X7HA 4BNUA 1DJNA 3ZV4A 1ZK3A 2V65A 3O9ZA 3O8QB 1PJCA 4H16A 1Q7CA 3DAFA 1KEUA 1CWUA 1EDZA 2Z5LA 4CUJA 1DEHA 1PJQA 4WLOA 3KSZO 3TRIA 3RU7A 7ADHA 4P38A 5BSGA 4FSHA 4B7XA 3SJUA 3TPCA 4TRJA 3E48A 5HM8A 3UCFA 5JAZA 4BKPA 3S2IA 1R12A 1LLUA 5DDIP 4W7IA 4AL4A 4BMNA 1B8PA 3I6IA 3K73O 1XQ1A 2Y05A 4DQXA 4K26A 4R9SA 3ROMA 4AJLA 5BNTA 4TRNA 4KUGA 2V6GA 1ZSYA 4UUNA 1QKIA 4GMGA 1NASA 4XYEA 4AJHA 3ORFA 2EJWA 4DXHA 1P1FA 5JDCC 1LQTA 5EJ2A 4CLDA 3WQQA 3SEFA 1HYGA 1F17A 5KJ1A 2PD4A 4BNNA 4EJ6A 2IXBA 4BO0A 5EINA 4BNKA 1T2AA 3A9WA 1GQQA 1LC0A 1OOEA 3GG9A 2EKPA 2AQHA 2C0CA 1E5LA 5I8WA 1H2HA 3R0IA 3ZWNA 5CEJA 1EUZA 4GMFA 4NBWA 2VRBA 4E32A 1XWFA 4M89A 1BXGB 1HDYA 4QFDA 4G65A 4DREA 4FR5A 2IEBA 3OJEA 3GGGA 2AE2A 5JO0A 2E82A 3LC7O 4FQ8A 3RAJA 1GEEA 1NFFA 3AOGA 3HWRA 3MJSA 4O0LA 3GDGA 2H63A 3VZRA 1FXSA 1P1RA 4LGVA 1NWCA 2JCVA 3JQ8A 3KSUA 4WOJA 5T67A 2Q49A 1I2BA 1P45A 4AJKA 5C7OO 1VI2A 1UDBA 2Q2WA 1X0XA 2Y66A 3PJDA 3LLVA 4I9HA 2Z95A 5HBRA 3PGJA 4N18A 5B4VA 4Z6KA 5JW6A 1CYDA 2X6TA 1GUYA 2PD6A 3GZ4A 3IC5A 3AFNA 4ESOA 3DQPA 4UAGA 4Q3DA 5A9SA 2BGMA 3Q2KA 1FK8A 1WXDA 3F4LA 3U9LA 4RJTA 4FBGA 1OX3A 5A06A 2AEMA 2VUSA 3DZFA 2VTDA 1ZNQO 3RC2A 3WLFA 2C5EA 2VOEA 2NNLD 1C0KA 2FR8A 2ZTUA 1WDMA 1V3TA 4Z9FA 4PN3A 2PFGA 5A1TA 3TQHA 1U4OA 5IDYA 2OORA 1N5DA 1H93A 2J5QA 2PY6A 4LSWA 4PLHA 2DBRA 3A1NA 3I3OA 2GNAA 3GPIA 2C07A 1I33A 1P31A 3DR3A 2D1YA 1HRDA 4BKOA 2EKQA 2QQ5A 3OM9A 2VHWA 5AXAA 3A28A 4CMIB 2DC1A 5CEFA 1GDHA 3MCVA 1QV7A 3JD0A 5H83A 4YJGB 4DBZA 4PLGA 4JLWA 5L9AA 4QO8A 1DHTA 4Q3EA 4NJOA 5F1KA 1H6AA 5CP8A 3QWHA 5HS4A 3WMXA 2OZPA 5CAEA 3IKVA 3QWBA 4PVDA 4RV9A 1UXGA 2J6IA 2AA3A 1CJCA 2IYPA 4NK5A 4ZGWA 1EFLA 2I67A 4ALMA 3L4SO 3VPXA 5I7VA 1JN0A 1Z74A 3K96A 1B0AA 3QIVA 4XD2A 1ZKMA 3JYPA 2LDBA 2AHRA 8ADHA 2VWHA 1C0IA 2BGKA 1D8AA 2ZCUA 3U3XA 2GZ3A 4DIOA 2ZJ1A 2ZK7A 3RKRA 3TOXA 3UXYA 3DHNA 3OQ6A 2B35A 3OP4A 3GHYA 2CY0A 4XR4A 3EMKA 3BIOA 1B8VA 2WMDA 2NACA 4TVOA 5LDHA 2BH9A 2QZ9A 3L9XA 3F47A 1ADGA 3FPCA 4E5MA 4L4RA 2W2KA 3ICCA 1DC6A 4UREA 4BNYA 4J7UA 4EJMA 1C1DA 4WK6A 1VL8A 2Q1UA 3EAGA 1B26A 2UVDA 4G5HA 4ND5A 2IZ0A 4EDFA 1BVRA 2DFDA 2VHYA 4LMPA 3F5SA 1SOVA 1PL7A 2XXJA 3AM4A 1YKFA 3V1UA 3WWYA 1NVTA 4F6LA 1BDBA 2A4KA 3L0DA 3PWSA 1M75A 4AJPA 3RU9A 3OECA 4S1VA 3WR5A 1HYHA 1E7QA 4QEDA 1PSDA 3UFXA 2ZB8A 4WASA 1ZEJA 3DZJA 4ALIA 1DFIA 1T24A 3K92A 3WNVA 1SMKA 1RM3A 1WPQA 2OGUA 2PH3A 3N74A 4GAEA 4PRLA 2Y67A 5CDYA 4YYZA 3DOCA 1VSVA 2B69A 2HLPA 4ID9A 5DOVA 4XJSA 3KBOA 3WGQA 4A03A 1V3UA 4FFOA 5ITWA 3WG9A 1ADBA 3DFZA 4CV2A 4B4UA 4FIZA 3VH1A 2FPPA 8LDHA 4YAIA 1AXGA 1B14A 1EZ4A 3UCXA 4GLOA 4DMLA 3ZU3A 3KYCB 1G1AA 4J1NA 4BNLA 2W90A 2ZQZA 2OOSA 4DUPA 5TT0A 3KETA 5I9MA 3LU1A 4MIOA 1VPDA 3AUAA 3JYLA 5DF1A 2ZYGA 3JQGA 2H5LA 1NQAO 4BKRA 4UVEA 3ZWWA 5IN4A 1KC1A 4OXKA 5KKAA 3EZLA 1YQGA 1MLDA 3K8ZA 5TJHA 1PGQA 3Q11A 1W8DA 4U6QA 5JAQA 4BOYA 1AGNA 3GMDA 4PLPA 3F46A 2Y0DA 4CLOB 4FJ1A 2BI8A 3AWDA 3Q1LA 4I5DA 4CM9D 3PLRA 2OFPA 3JQ7B 5F5NA 4OO3A 4FJ2A 3FF4A 1DRUA 3EZYA 4BO7A 4IDGA 3AUTA 3GEMA 2Q1TA 4UUPA 9LDTA 5TIIA 4Q3NA 3WSVA 4U0KA 3FBGA 2WD7A 1UAYA 4J2OA 1HDZA 4ITUA 1DAPA 3HJAA 3RUEA 2BF7A 3JQ8B 3OFSA 1DIBA 3WGGA 2ZATA 3BHIA 3JQAA 1LQUA 4NBRA 3VKUA 3AY6A 1KETA 4YJFA 4R51A 2XAAA 1CQJA 1V6AA 5MDHA 4TRRA 2ZCVA 5COAA 5K6AC 2VHZA 4GGPA 4B79A 2GN6A 1VKNA 1KEWA 1I8TA 3EC7A 1Z7EA 4DQUA 4DRYA 1RPNA 2VYVD 1OBFO 1GEGA 3PI7A 3PHHA 4INAA 4R68A 4GL4A 1PQPA 2YHIB 5GZ6A 4BGIA 1TT5A 3JD2A 4EYEA 4DVJA 3JQBA 3QRWA 1CETA 1KS9A 1FJHA 4E2XA 4XYLA 2A9FA 5G4KB 5C7LO 3H9GA 3NDRA 1DJQA 1LC3A 4MJLA 2HQ1A 3LK7A 4GLLA 2DBZA 4OSPA 4GH5A 3BZUA 4J6FA 3HE3A 4NBVA 3DMTA 4GBJA 1ONNA 2PLAA 3TJRA 4MVJD 4IDEA 4WGGA 1XELA 2UV8A 1QSGA 4D3DA 4MVJG 2HK8A 1PJLA 3HNPA 3U0BA 1QYDA 1Y8QB 3DBHA 3ITKA 2VHVA 1JWBB 2W2LA 4JROA 4ZRMA 5FI5A 1DSSG 2GCGA 1UZLA 1AXEA 1PS0A 4CMJA 1GV0A 5T8KC 2DLDA 3IIEA 3ZI0A 4HBGA 1E3WA 1EEHA 3TFOA 4TMFA 4XRRA 1BTOA 5AXCA 3FNHA 4NJMA 5GMOA 5CFZA 3I83A 5L3ZA 5JC8A 3Q3CA 1UXIA 5AVOA 4EI2A 4IMPA 2WJPA 5FF9A 5L7YA 1HSZA 2VRCA 2DTEA 3NTRA 5KCZA 3PJFA 4R41A 1B16A 4WNIA 2FWMX 5JY1A 1KERA 5LCXA 4IMRA 1ZK0A 2HMTA 4XQ9A 3KEOA 1H0KA 3GHHA 1ZW1A 4MIEA 4ND2A 1UJMA 4LVUA 4BL5A 4IY1A 1C14A 2HMVA 5K9ZA 3EHEA 4BQPA 2WE7A 2PR2A 2Q99A 4K28A 2B5WA 4FW8A 2JHFA 3EDMA 3PTZA 4YXFA 2D59A 2HMSA 2PTGA 5JXWA 2PWZA 2PGLA 4WLNA 2VWPA 2GD1O 3FD8A 2RH4A 3CEAA 4I1IA 4PLVA 4ZN6A 2EJVA 1UR5A 1JVSA 2OBYA 4YJHA 1IYZA 3LQFA 2DTDA 4MINA 1I3KA 3PZBA 3CH6A 2C2YA 2C82A 3F1LA 4RPKA 1ZSNA 1M2WA 3EGOA 4XEHA 3V8BA 1E7RA 4CM1A 5C5IA 2VUTA 3E5MA 2NVUB 1NPTO 2VT3A 3KOUA 1LLQA 1V35A 3LZ6A 5G0UA 4ZQBA 4GI2A 3FNGA 4QX6A 3VH2A 4OJNA 1CERA 4HNGA 3QSGA 3RQSA 3A4VA 3NT4A 1N7GA 4PG5A 5A4DA 1O0SA 4ZU3A 3WGOA 4FB5A 4UUMA 1ZEMA 2GERA 2CVOA 2B83A 4EUHA 1DRVA 4OIMA 4CQLB 3DZBA 4BNXA 3PGXA 3CUKA 1F12A 4OOEA 1E3SA 3ADOA 4Q9NA 2DT5A 4CV1A 4WEQA 5F1PA 3TF5A 2V6FA 4OKIA 3ADPA 1FF9A 4CR6A 1E77A 4NFSA 4YEDA 1ZK4A 3CXRA 4CV0A 3AW9A 5L95A 2P4QA 3PXXA 4HUJA 4RDHA 3DZIA 4BO2A 2C29D 3OICA 4ZQFA 1AUPA 2YJZA 1HF3A 3HZZA 3TWOA 1JLLA 3Q0EA 1IHXA 3DXFA 1KVSA 1O5IA 1LLDA 1ZIDA 3G1TA 1TT7A 1D4FA 1HTBA 3ULKA 1NXQA 4ALLA 5FI3A 2B4TO 2Y1DA 2EV9A 3GOHA 2EHDA 2WM3A 3HN2A 2TMDA 5KTKA 3E18A 3KYBA 1GL3A 1E3EA 4IJWA 1HDOA 4MO2A 1WZEA 3BTUA 1C1XB 4HWKA 4GX0A 3RBVA 1G0NA 3EW7A 1SEPA 1LDNA 3EYWA 5IDWA 3ZHZA 5EN4A 3WFJA 3WS7A 2EGGA 2I6TA 3S8MA 5CDSA 2HK7A 1YRLA 4BKQA 4AG3A 1JU9A 1O89A 4YCAA 2DPHA 1IL0A 3DAGA 4WCFB 5AYVA 4KWIA 5B12A 5IDQA 2IODA 2R00C 3KV3O 3VH3A 5DCWA 4YJFB 3NRCA 1EDOA 1FDTA 1KVUA 1PWZA 3AM5A 3DZGA 3DZKA 3E9QA 3I9NA 4TKLA 1N8KA 2DAPA 1IPFA 3ZU4A 4CQMA 1Z45A 4F46A 1DO8A 4FDAA 1VJ1A 2J8ZA 4NBTA 4D0SA 4Z9YA 4DLAA 4OM8A 3TFQA 4L74A 5BQFA 3RROA 1HDXA 2CF6A 3U4CA 4BNMA 5ILOA 1IB6A 2DQ4A 3QWFA 4I9NA 2GYYA 3FI9A 1T1RA 5F1OA 2QG4A 2VWQA 1D7OA 1GADO 1BXZA 4IDFA 2QYTA 1KY5A 3GK3A 2HSDA 3AUUA 1F14A 1JKFA 1ZH8A 1E7WA 5DNAA 5JYDA 4AJIA 1QRRA 4CR8A 1Z75A 4NU6A 1SC6A 4E2WA 3NEPX 4J9VA 5JSFA 2V7PA 1VL6A 1LSUA 3C8MA 3ANMA 3WGZA 2X22A 1LX6A 2A94A 1HETA 4TRMA 2Z1MA 4D41A 4CJXA 3ENNA 1B3BA 1E6UA 2IEDA 4KWHA 3JQ6A 3PQDA 2AE1A 3MZ0A 4B3HA 2O7SA 4E5PA 4BNFA 1EQ2A 3TNLA 4GVXA 3PFWO 4HNHA 5B4TA 2YYYA 1E3WB 3KRTA 1ENYA 3I9OA 1J4AA 3BTVA 2X9GA 4W4TA 4XGKA 3ZU2A 3M1AA 1UDAA 4PIVA 1U4SA 3D3EA 3V1YA 4MDHA 2EERA 3VVBA 4BO9A 1H6BA 3I9LA 3IKTA 3W8DA 5TF4A 1BG6A 1WVGA 2AW5A 5IG2A 1U7HA 4R1SA 1EE2A 3ZWOA 1H9BA 5EMHA 1RKXA 1PL8A 4RLSA 1YGYA 3A06A 4I9UA 3C7AA 2H9IA 4UVHA 1CF2O 3JYQA 3ONDA 1GQYA 4G2NA 1B7GO 4IDCA 3H7AA 3LT1A 3N58A 4J1QA 3BMNA 1SEVA 1XU9A 5FWNA 2P5YA 4IBOA 3RUFA 4XDZA 3KYDB 4YT4A 2WWRA 3G1UA 1XEAA 4XR9A 1P33A 5IFLA 4IDDA 3GAFA 3I23A 3PWZA 3EK2A 3GMSA 4RVUA 1MV8A 1K6IA 3BMQB 3PJGA 1GD1O 1T4DA 5I9NA 3DBVO 4J9UE 2AG5A 4NQZA 3MJEA 4Q3AA 3HFSA 4DPKA 4Z3KA 1S6YA 3ZZNA 3RASA 4O6VA 3IL2A 2PZLA 4HFRA 2NTVA 3CMCO 2BELA 3GQVA 3WNQA 1AHHA 3RFTA 3HADA 1GY8A 5TGDA 3COSA 4N5LA 3DOJA 5EQDA 2RCYA 4JXKA 3SJ7A 4YRBA 3G3EA 3MOIA 4IXTA 4YA6A 2WEKA 4IJUA 4NIMA 4YT5A 3DAPA 1LSJA 1ZXLA 2CDCA 2X23A 4WLVA 4PVCA 2G76A 1R0SA 4TSKA 3RC7A 4HFMA 1GYPA 3VAZA 1NWHA 3PQEA 4R69A 1T25A 3HDJA 3FNFA 4QFCA 1KEPA 3I4CA 3OETA 4L4SA 5EESA 1YL6A 1LRKA 3AI3A 1PL6A 1HEUA 2PH5A 4CMBA 4M87A 2ZQYA 1IZ0A 3EUWA 3U4IA 4UEOA 5DCYA 3QJ5A 4H3VA 4IIVA 3I52A 3UH1A 1RYDA 3VPGA 3OIFA 4J91A 4CMCA 1U3WA 1EK6A 3GDFA 4PLCA 1LEHA 2V6MA 2C2XA 2CMDA 5I8ZA 1J6UA 1JTVA 2FRDA 4H15A 5ADHA 5IXSA 4Z0TA 4HKTA 4MVJH 4RQUA 2X5JO 4WECA 1VJTA 4KMSA 4ZRNA 3GRPA 3QV1A 5TRTA 1YOVA 4BB6A 2NUAA 2YV1A 4A73A 3QVXA 4XQCA 1B3RA 1BDMA 4NH4A 5BSEA 4RGBA 1B15A 1IUKA 2E6UX 4J4BA 1DLIA 4UVGA 4KUHA 4OYRA 2D8AA 2JJYA 2ZB4A 3D4NA 4NFHA 1M6WA 4I5EA 2O3UA 4J7CA 4GSKA 3OJ0A 2JFGA 2YY7A 5A02A 1FDSA 4FGSA 4WLFA 4YR9A 1A27A 5L51A 3U09A 1BW9A 2BFPA 3PWKA 1LJ8A 4CL8A 3FHLA 4GX1A 2HCTA 4XRGA 4IDAA 4J4HA 4DIBA 1O8CA 1HWYA 4MP3A 3DHYA 1QLHA 4YAEA 3PDJA 4CQMB 1XKQA 3C85A 3KVOA 1LRLA 4P8RA 2VNAA 3D5TA 3LF2A 5AXDA 2IXAA 2QX7A 3HQ4O 1W4ZA 4K6FA 3R6DA 1OC4A 4HX5A 3OIGA 3QW2A 2Q50A 1U2GA 2X0NA 4D45A 3GR6A 4PGFA 1NQ5A 3OIDA 3EY4A 2AEFA 1MB4A 1KVRA 3ETGA 4PRKA 1GYRA 1ID1A 1LDYA 1DC3A 4UULA 3MWEB 1E6WA 1HE2A 4KOAA 4M86A 3Q2IA 4IUYA 4GWGA 1GAEO 1QMGA 1PJBA 2YDXA 3K31A 3H2SA 3R1IA 4OMUA 3RBZA 1YE3A 1UH5A 1ZSVA 5BT9A 1E7MA 3A14A 3AU9A 4F45A 2FN7A 5TX7A 1EMDA 3WXBA 2FOIA 1HSOA 4FOSA 3DBRB 3ST7A 4RPGA 3M6IA 4BIIA 1O95A 4KDEA 4AJNA 1SOWA 2DUWA 2NV6A 2O7QA 1Y81A 2YFHA 3NT2A 1IZ9A 4FFPA 1NTOA 5IAAA 3V2UA 2NVBA 1PGNA 5IXYA 1Q0LA 1QG6A 3G0OA 3JQDA 1PS9A 1HKUA 5KNLA 1NVMB 3HSKA 1ZVMA 1NR1A 2Q4BA 3E6AA 4Q39A 4E33A 4CMEC 1ZZEA 2PGDA 2GSDA 4HY3A 4UVDA 3WBFA 5BSFA 1YL5A 2J3HA 4J1TA 1XSEA 2RH8A 2G0TA 3GGPA 4OXNA 3E82A 3VVCA 4R16A 3GUYA 3P5SA 1V0JA 4KDFA 1WLYA 2BMAA 4BGUA 3QVOA 1F8FA 2IZ1A 4KQWA 3GRKA 3QHAA 5G2OA 4Z0PA 2PKQP 2VYND 2RIRA 1EFKA 1GV1A 5KVSA 4ND4A 4E12A 1CIVA 1KY4A 2VHXA 4XIJA 5TT1A 2HRZA 3ETDA 5T6BA 3RI3A 5ENVA 1PGJA 1IY8A 1R4NB 3KLMX 4P4LA 3MOGA 3E9MA 3L4BA 4CM9A 1E7YA 5TSDA 4MVJM 3DBLA 4IZHA 3BHJA 3UHAA 1X1EA 3ZNQA 2EXXA 4YB8A 4FC6A 4W9NC 4MP6A 4XWYA 3MJVA 3NV9A 2DVMA 4M8SA 1UXHA 3JQEA 3D3WA 3BMOB 2A92A 3U5TA 2AQIA 1EVJA 1V9LA 2LDXA 4RZHA 3FCOA 1PIWA 4LRSB 4EZBA 3H9QA 2FZEA 4N5MA 3JQFC 4E21A 4NR0A 4XKJA 2IE0A 3UUWA 4ONEA 4EBFA 4MKZA 1Z7BA 1NM5A 4O63O 4ALKA 3CTVA 3FBTA 2WD8A 1M66A 3WTCA 4FCCA 5A05A 5JPIA 2PZMA 3S1LA 5THKA 2VYVA 3DEYX 1N9GA 3MWDB 5DT9A 2RHCA 2BD0A 2ZTVA 5IZCC 4ZA2A 5KJ6A 1YH3A 4WE3A 2ILTA 1K2WA 3OJOA 2D0IA 1YQXA 4CM4A 4MIYA 2IYOA 1MXHA 1ISHA 5DOZA 1LUAA 4OGWA 4OOFA 3E5RA 4RQTA 1ADCA 1T2EA 4TVBA 1AN9A 2GPTA 3ROPA 2PKRA 2A35A 2BKAA 1W0CA 5IF3A 1DIRA 5K6AA 4WLUA 3CIFA 2P9GA 1TB4A 1VJ0A 3IS3A 2J5RA 4BO6A 1LRJA 4MVJA 4E5YA 3W4JA 5IDXA 3Q9NA 1MX3A 3DWFA 3HDHA 2TMGA 3H5AA 1UUFA 3QA9A 5ER9A 5JLAA 2J3IA 1IE3A 4XCVA 1PGOA 1YOVB 2DBQA 1P0FA 2WTBA 3H9UA 1DRWA 5MGBA 3WBBA 5CDTA 3CSDA 4EW6A 3UCEA 2DU8A 1QV6A 3HUDA 2WSBA 1ONOA 2G17A 3D1LA 2UAGA 4Z9XA 3WTBA 3H9EO 4YRAA 4DIFA 2FY8A 4Y6RA 2VT2A 3F4BA 1XCBA 2HDHA 3DFUA 2F1KA 3OF2A 3IOYA 4CUZA 2FMUA 5I9LA 1M76A 4CMGA 3BXXA 3T7EA 4XYBA 3ZWAA 1P0CA 2P5UA
chains in the Genus database with same CATH superfamily
2PBZA 1T1IA 2NXCA 4K9QA 1ECPA 2J59A 1ODLA 5M3BA 3EVTA 3T54A 3QG5A 4BFZA 3TEJA 3Q8MA 1VB3A 1XDDA 2A0UA 4N49A 1I24A 1FZQA 4KREA 1NVBA 4E4YA 4BMPB 5CIWA 3WX0A 3Q9LA 1NTKE 4P83A 3AUYA 3OHSX 1WCIA 2YFYA 4YAFA 1Z34A 2OXEA 3KU1A 4BX2A 3FPAA 1SCIA 4OUKX 1REQA 4AYCA 2R2AA 3LFTA 3LSYA 3QVKA 5FBHA 4ZK2A 2HQRA 5ICSA 1U2TA 4N7MA 2QW0X 4ZGGA 2E49A 4WBSA 1SQXD 3PHJA 3QTLA 1NY6A 1SXHA 1H9AA 3ZW9A 1F8GA 1LV7A 4Z4HA 1UPAA 1Y4AE 2WWIA 4AUNA 3O8CA 3AFHA 1ZITA 4L1KA 4PTZA 3RGWS 3N8DA 4X7BA 1JQBA 3L0CA 4J0FA 1U0LA 2Q8NA 5BMVA 3BJRA 5F98A 3ZCXA 1R4MA 2CXNA 2JVJA 4PZ9A 4FPXA 5JALA 2X8BA 3EG5A 1IONA 5EZYB 3BHMA 1HWTC 2O50A 3CIOA 2XAUA 4L8LA 4AWBA 1K2VN 1HUCA 2HF2A 2G88A 1PP9D 1KILD 1YBVA 1Z2DA 4OYHA 1OREA 3ZEAA 1D2RA 5FOSA 3WBKA 4NABA 4MAAA 2Z5GA 3K9QO 3MSCA 5HKLA 4TZTA 4ZEVA 4WCDA 4DV1B 2R0QC 5KPJA 2C9CA 3WICA 4DRZA 2CHEA 1H9CA 1EVZA 3V4FA 3KZVA 4O4LF 1RF1B 3JQAB 4EUKA 3FYUC 4WZ6A 2I4NA 1PPJE 3PPXA 3RODA 1R0YA 1M1YE 3S2YA 1JVBA 4RVDA 5IK2A 3UHFA 3V2QA 2OO3A 1GQOA 3JD3A 1OW7A 5FUBA 3NU1A 4UJ5A 1AVOA 2P90A 2XU6A 4JVLA 1I6WA 3PYMA 1HRKA 4QBGB 4DEVA 1ULSA 1Z28A 3AR4A 5ANRB 2FXOA 3BK7A 3HCNA 3IEIA 2EW8A 2FFJA 2GS9A 1NMEA 1X7ZA 1KKMA 1TOAA 1RPZA 2HJSA 2QRVA 3KWFA 3R3WA 4DXAA 2B3DA 3DMNA 3QWAA 3K7EA 3CWBG 1HGVA 1AC5A 4ER6A 4OWFA 3TOVA 5IC6A 2FX2A 2JCBA 4J76A 3AKEA 1ZD4A 3UG7A 3VZCA 1BH6A 3ABIA 1HORA 3EVZA 2GH1A 4LYGA 1JFVA 3P94A 1N0WA 4HLQB 1DAIA 1USVA 4XWAA 3PQ8A 5INTA 3MTAA 2C7RA 3M5WA 2FEAA 3PT5A 2VI5A 3VHXB 1ADJA 3L0ZA 4L76A 2A57A 1CLEA 3B51X 2FEMA 4D0NA 4LOLA 1LT9B 4LVCA 4OHKA 5KOJB 2XWPA 1OBHA 5KAFE 1GPLA 1Z2OX 3BK2A 4Q7JB 1IJBA 2RBGA 4YDRA 2R47A 3AJRA 4ZKUA 3ASVA 4FYYA 4YRDA 1F1JA 1V3QE 3RTCA 5BVGA 4NZ9A 4IVNA 5LYYA 2MMCA 3O93A 4R2HA 4R1PA 2QZZA 1RTTA 1IJFA 4IJ6A 4MUNA 2G1PA 4KR9A 3I5MA 3E9RA 3M3HA 1JU3A 3P4UA 4C2UA 4EYQA 3UGKA 3QF7A 1Q17A 4GZ6A 3Q5GA 3VTAA 1W5AA 3MW8A 2YFQA 3SEAA 4HLDA 2GAJA 3E3LA 1OXBB 1Q83A 3KB1A 1KK3A 2PZEA 3QH9A 2QV7A 4PHFA 2Q4TA 2FB9A 1WQ3A 3L8DA 2CLKB 1NY5A 1Q7EA 2PS9A 4YRNA 3LHFA 3T4PA 3NFYA 1QWSA 1GFSA 3E2IA 2ZRAA 2B1RA 1G5TA 3PL1A 3FPFA 4O2AF 1JE1A 2YW9A 4ZYWA 5HJ2A 4K8RB 1LTJB 1GKKA 3RS0A 3WJ2A 3ZGOA 1O03A 2JRCA 1KXZA 4GX5A 4X60A 3BERA 2YVKA 1XHEA 2MR6A 4MQ5A 4A27A 4WBAA 3SF8A 1JSLA 1IXRC 3BGDA 4GMKA 3PE4A 4GYYA 3GGOA 4L8VA 5BSUA 1O4WA 4HQNA 1FS5A 5CK5A 1WPXA 4XAQA 1RWMA 4R84A 3G0CA 1U8YA 1F51E 5K0EA 5CFMA 1YWGO 3RC9A 1O94A 4IJMA 1W73A 1TVMA 3ICPA 2ZRJA 1E1KA 5H82A 5F33A 1OC2A 3UXEA 4X8HA 1ZH2A 4LECA 3BWBA 1I3LA 2FUG6 2ATCA 4U2EA 2C8KA 3QNWA 3LLSA 4G5SA 5LKAA 1XCGB 1DTSA 1JDSA 1QF6A 4IIFA 4JYAB 4IG4A 1D5WA 4HD8A 2VH1A 3GCDA 4NCIA 5JAHA 4ICIA 3C7KA 2ZB7A 5BV8A 2DJIA 4OGGA 3MA0A 4C29A 3CX8A 4HSEA 1E7SA 1DP4A 1COWA 4FK8A 1VBNA 1UWKA 3GBVA 4U6SA 3BCCJ 4RPLA 2VYCA 1ZN8A 2Q7CA 1ZPDA 2VJYA 4PLZA 1GPUA 5ELLA 5IYZA 1LB1B 4A6PA 1PZQA 3IYLW 3S7ZA 1T26A 4Q9AA 1H8HD 2Z3ZA 2VPZA 3HYTA 3G0IA 3NTOA 4H0FA 3NGXA 3D6HA 5FI0B 1FZBA 1SVKA 2Q2QA 2ETVA 3DFKA 2EG9A 3SR4A 4BO3A 3BMCA 3GG2A 3AR9A 1J2RA 1SKUA 2G4CA 3KTFA 3FGPA 2GETA 1WETA 2PRIA 3AGQA 1JMBA 3FTDA 4KH1A 2B5VA 4OU5A 2GTHA 4Q01A 3P0HA 1FDWA 4EZEA 1OXMA 2Y77A 4JWKA 4C2BA 3ZQ4A 1DBRA 3IAM6 1ISMA 2WYUA 1OVGA 4RY9A 2HA7A 4AYWA 4P0QB 1S2IA 2PA3A 1GGHA 1JHDA 1J22A 3MCAA 3C8VA 4MJ7A 1I4OA 3FPJA 4WAUA 2WP0A 5F78A 1WZNA 5IAGA 3P45A 1PFUA 4LX0A 1J0XO 2ZULA 1A7AA 1T9CA 4M1QA 1CJTC 3COYA 1OGIA 2Q3DA 4JYZA 1DEXA 1ZVQA 3KHUA 3AR5A 2Q4DA 1OVMA 2C94A 3QWOC 2IUYA 4OAQA 5IM5A 3L7MA 1NVWQ 1G5HA 1GGMA 5K8CA 3LDGA 5KAIE 1H1TA 2H2IA 4NI5A 4CKCA 2QMZA 2ZRBA 1R16A 2HBRA 1E18A 4DQKA 3O84A 1QO0A 1Q77A 1ZICA 2H9YA 4EEXA 4E14A 4OA8A 2H1VA 2GYWA 1Q2XA 2FYUJ 3AINA 3V8MA 1QB7A 1OX4B 2HMUA 1UBGA 2E1PA 4DC1A 3AF2A 1FZEA 1Y7HA 3O8DA 4XASA 1V41E 3O91A 1G20A 1VL2A 2J9FA 3NH9A 2XZLA 4MVYA 5C7YA 2HYIC 1R74A 2ZSHA 1WB5A 1J0AA 3CUSA 1O96B 4BZWA 2J09A 5HJ7A 2H5EA 3T7AA 6CHYA 1QJ4A 5CA1F 1OLUA 4K35A 5J4HA 1HBWA 3MJRA 3THRA 5B5EE 4IQGA 1KDYA 1EVLA 2OMKA 1OXVA 4IUBS 3H8JA 1ENOA 3NBYC 3W78A 1DFGA 2BKVA 3UJHA 2XUJA 4CUKA 2ZM6B 1JX6A 1NW7A 4NDAA 1MC4A 1LY1A 3HLTA 1ZH0A 5I4KA 1HT0A 5IU6A 1X9HA 2P6UA 1UKCA 5REQB 5F12A 1EVIA 4QFMA 3N9IA 4LJKA 2WSEH 1W52X 3CNLA 4UCWA 3EFOB 1IHPA 2V6BA 3U9TA 1T4MA 5KJ7D 1UOOA 4M0KA 2ZSBA 5EC8A 2PXAA 3ZGZA 3QIAA 1PJCA 2RMKA 1KK2A 3TRIA 3F6CA 3SFTA 3TPCA 2X3UA 1FPQA 5KYWB 5JV5A 1JPJA 2ZRPA 4OQDA 1ZQ9A 4AS2A 4R9SA 2BUAA 3WWDA 4ASVA 2C2WA 1E6LA 3OO0A 2V6GA 4Q1DA 5C8YF 4ER7A 4N7BA 2EJWA 4DLSA 3T5BA 3WGJA 4BO0A 1T2AA 1WHSA 4M7PA 1GQQA 4UUBA 4RESB 1U2RA 2WZ7A 3MFQA 1L0NK 1JI0A 1QZXA 3LZDA 4F9TA 1XJWA 4TUYA 2NPSB 3ZDAA 1HYBA 2F7SA 5FTWA 4D4JA 3MJSA 2I4OA 2JCVA 3KZXA 5L3QB 16PKA 2HLDA 2WAYA 3BE4A 4JLMA 5FTJA 4L9SA 3FJOA 5F2NA 1UDBA 3DD5A 4OQPA 2Z95A 3NP9A 4HH0A 4EA6A 3SSUA 3N8KA 3ZX5A 3T9DA 1L7OA 2E74D 3U9LA 4RJTA 4CEIA 3T95A 1SIBE 2IKSA 1UFQA 4GLJA 4YYEA 3A6HA 3AEGC 4FOTA 1R3DA 3HRKA 4G5GA 4BU1A 4CIYA 3WK9A 3RIYA 3A1NA 3UT5A 1R9NA 1P9RA 2FPUA 2DC1A 4UU0A 4X9XA 3R24A 3A7OA 1OFTA 3ZQKA 1AUQA 3KR2A 3QX8A 2NYVA 2P3OA 3L6CA 1NJIQ 3UB4A 3QBTA 1Z0KA 2ECPA 4N39A 1FQJA 3NHLA 4HGPA 1Z74A 4F71A 4P7JA 3EFFK 1D8AA 3O9MA 1YZQA 2HLHA 1GCAA 2WQ6A 3K4HA 1BGYD 2J0UA 3EMKA 1XRNA 4ZOLA 2GEDA 1TJ4A 4K3AA 2W2KA 1MCZA 2AXNA 2ZJ7A 4DBLE 3RVRA 1PL5A 2P9HA 4KIWA 3STYA 3V1UA 2UYCA 5IM4A 4S1VA 3WR5A 3K92A 2OGUA 4PRLA 5GJCA 3H3XA 1J7JA 1V3UA 2J3QA 3GARA 3W0LB 3CNEA 2HIAA 3C15C 2C04A 1EZ4A 2RKBA 3PHBE 3P2JA 5TEWA 2O8EB 1TO1E 2GILA 2ZYGA 4KXUA 3BCCE 5HHTA 1N2XA 1JJVA 3Q11A 2W42A 2Y0DA 3PSHA 3BF8A 1LZKA 4DIUA 1A9PA 3Q41A 4IDGA 9LDTA 3L7NA 4AXBA 3URMA 1EU1A 4D74A 3BDAA 1Z4IA 5JCZA 1ZHFA 1QIEA 1CZOA 3BCCG 3LKBA 4GT1A 1ZYUA 3PHHA 2V7GA 5GZ6A 5HW0A 4NU8X 3TQCA 2BEVB 3KKMA 1KZHA 3PSAA 2X2OA 2J31A 4ZEWA 2PP6A 4H1UA 4NYMQ 4GH5A 4J6FA 4LX8A 1EC5A 2TECE 4GPBA 3DKRA 3KZIE 3PEEA 1VLJA 3WL7A 1XQXA 5DGTA 1PJLA 4KQHA 4BEWA 2ZI7A 2VHVA 4N9WA 3M0EA 2FMTA 3TRHA 4K0KB 1UZLA 1PS0A 2OB1A 2WYOA 4LXHA 4TYQA 3EAFA 3ZI0A 1N1DA 4NJMA 5JC8A 1SHZA 2KMLA 3PENA 1W30A 1DJOA 3TEFA 1NVUQ 1I5EA 6Q21A 4OBBA 5KWJA 1KERA 2XWBF 5LCXA 2BFEB 1Y1SA 4LVUA 1MEJA 1K7CA 4J0HA 1QIDA 2AF3C 3ETNA 3LMKA 4GQIA 3C3DA 4V3CA 3EWAA 1RQRA 2YIDA 4KE8A 4MPTA 4Y2SA 5ALHA 2X15A 2AIRA 3NTXA 1J5XA 1K98A 4GNKA 4MYSA 4DM7A 1YMUA 3RVKA 3D1JA 1VRVA 4MR7B 4LV5B 4W1PA 4FB5A 4Z7NB 1BCCD 1DRVA 2QVXX 4FFBB 4Y2XA 5ES4B 2ZJOA 1ULBA 1G1IA 5F1PA 4ENRA 1J8VA 4CV0A 4WKCA 1NBWB 4FYIA 2UZ0A 4P7BA 4NZMA 4O08A 1HTBA 3GD5A 3HN2A 5KTKA 1J56A 1L8QA 3QKTA 2GESA 3WZMA 1IIBA 1VFPA 4WCFB 3QEAZ 1I7PA 1HNZB 2O1SA 3FJYA 1L5ZA 2WHRA 3ET4A 3IFMA 4NQRA 3DZGA 2FYUG 1IPFA 1K66A 3PNYA 3T5TA 5IKMA 2Z0MA 4YGXB 1IAVA 1JHZA 4IOLA 3PNSA 1ZUNB 5J47A 2YKGA 3BJMA 5DNAA 1DWPA 1MQAA 1SC6A 3HRIA 4D9BA 1VL6A 3TSIA 3ENNA 4AKEA 1G98A 4FT2A 2AE1A 3OFKA 2O7SA 4JL5A 3ZJYA 3T12A 1YU6A 3IT1A 1FBNA 2OBBA 3H1LJ 3WWCA 2YIUC 1H6BA 4BO9A 3SBXA 4Y2QA 5CFPA 1L4YA 1TJNA 1ELOA 4HDOB 4F9GA 3MB5A 1XU4A 3I37X 1B7GO 3X44A 1NTKK 4WGFA 5FWNA 3ZHQA 1E96A 5HCIA 4P3KA 4XR9A 4IDDA 4MWSA 2ZWPA 3L73E 3OFNA 1RKUA 1VGQA 2BIFA 3DMDA 2G67A 3MJEA 4Q3AA 3ZZNA 3SHTA 5H7XA 4HFRA 2I55A 3HADA 3BZBA 3VTKA 1Z6PA 5DEIA 2BE9A 2FLVA 2CYAA 3L5KA 5JD3A 4YT5A 1JEDA 1XEFA 3L8FA 4D9JA 4J0QA 1GYPA 3I2IA 3PQEA 3QBJA 1RI3A 1KKLA 2QP4A 2B21A 4L2IB 5F2KA 1NTMG 3LY5A 4YQEA 3AL3A 4MV4A 2OD2A 3U4IA 2JS7A 2B8TA 4L50A 4C5AA 2BZGA 2V6MA 5IXSA 2ZUEA 4RQUA 3O2SB 2PGOA 3P0JA 4ZDWA 2G80A 3SYTA 4CBVA 3PVSA 1IUKA 3L6BA 2HH9A 4MMYB 5DTQA 4NFHA 4I5EA 1O8BA 3EEOA 5A02A 2WV7A 2BFPA 4CL8A 3FG9A 3KR9A 4EJ2A 1XKQA 1GA4A 3HQ4O 2Z43A 3T5MA 4KYIB 1E5TA 4OJMX 2OV4A 3PC4A 1Q19A 3W05A 1PJBA 1POWA 1SUAA 2YDXA 3AESB 3EZFA 1ZSVA 2XQFA 1C7JA 2FOIA 3RWMB 1J23A 2OYHA 1T10A 5IAAA 2Z2JA 4L5YA 2HOQA 4YHBA 2BSAA 4YI5A 2VJAA 4Q39A 1H0TA 3KD3A 4CMEC 3L7IA 1TAUA 4KXXA 1W35A 3TI7A 3E82A 3U7FB 1DEOA 2JIPA 3CBGA 1Q11A 2M2IA 5CFNA 1EFKA 4ND4A 3W6PA 3H6GA 2OGZA 1KY4A 2QVZX 4JLAA 3RK0A 3SIPA 5LMZA 5IT4A 3IN6A 4MULA 4RBNA 2VL7A 2GCEA 3P8CE 4NULA 1G42A 2VSOA 1OXZA 3H9QA 2PMBA 2Z6UA 4ARZB 4NR0A 4G9GA 3WGLA 3VR6A 4HUQB 4DUGA 2BD0A 1H4TA 2WFLB 1YH3A 3C6XA 1MXHA 3EEFA 3SD7A 2WPVB 3ITEA 2Z4SA 4PZYA 4QOEA 3ESAA 3R20A 1TB4A 4Y2GA 1IVYA 3L4JA 3HDHA 1UUFA 5JLAA 2GUVA 3BB3A 3CLRD 3AX6A 1VKZA 1T8TA 3WLQA 3L5OA 3ZIAD 5CCBA 4M60A 4K9PA 4V0SA 2LXCB 1F2UA 3VPBA 3T7EA 3ZWAA 2Y6VA 2PCLA 1ODCA 1DBWA 2WVRA 1IBSA 3VU9A 3VISA 3ZDCA 2WK1A 1F3LA 3HUEA 5T8KA 2Q5JA 1Y1PA 2R8EA 2BGNA 1EBUA 1G6HA 1SQVK 1U1IA 3H0KA 4FC7A 4N6NA 1DOZA 4AZ0A 4CM8A 4CV2A 4LXUA 4Z4FA 5B7NA 1Y3HA 1NJ6A 1LX7A 3BHNA 4NENA 4PGGA 3RR2A 3CWZA 1Q86Q 1V8BA 4L4XA 4JOSA 1S4XA 3MGKA 2AJDA 4TVSA 3MT9A 4RPHA 4IILA 4DIKA 4WOPA 3WDLA 2X4LA 4HNUA 1AY0A 2B4AA 3BDIA 1EK1A 2ZI9A 1BFKA 3I53A 4DN6A 1WDTA 3P9XA 1O97D 3FCSB 1IJKA 3WUUA 3UJBA 5JNVA 3ZZMA 3W4IA 3LUCA 2GEKA 4AWAA 2F9LA 1EXIA 1JDBC 1AKWA 2HEGA 2YN4A 5JT1A 1VPWA 2PGAA 5DCLA 3E5NA 1SCDA 2XE7A 5DCUA 4BNTA 4DMCA 1GAQA 4EBBA 1L5GB 1V8FA 2IWRA 3HCOA 1JDVA 3QMWA 3RRZA 1UM8A 3MGCA 4RJKA 2ACWA 3D02A 3MERA 2B4YA 3MC1A 3MXTA 2CNWA 1NH4A 2WF8A 2WIDA 6LDHA 1AMOA 4PSKA 4CF7A 3G5UA 4EJSB 1IN4A 2ZIAA 4TV8B 2J58A 3KKZA 1MZ9A 3NYIA 4N5NA 1Z3CA 2PA0A 1U28C 2PV7A 3L7BA 2I7TA 5BPFA 3JYHA 3T9AA 5I9SA 2PFKA 3AJAA 2ZIGA 4MWEA 2E5LB 4ON9A 3CCJP 1RYBA 1ST3A 4RSMA 1GZ6A 1KEVA 2EBWA 1G7RA 2FUCA 3EG9B 3QXCA 4LJ5A 3CXHH 1CT9A 4NCBA 2Q1SA 5U9CA 1V1MB 1CB7A 5BNFA 4QULA 4FINA 1JSCA 2AFIB 4LFCB 1RSZA 3B5ND 1WMAA 1DX4A 3L8GA 4Y9UA 1ZJ5A 1TU4A 4DPMA 2GGSA 3OZTA 3CCMP 1OBOA 5BYAA 2V7QD 1TCCA 2WHXA 4XIFA 1NTZK 4K1XA 3GUHA 3LDAA 3QKRB 2EX0A 3U1CA 1QV9A 3VDRA 2HKIA 4HDRB 1AVYA 1WMKA 3O03A 1Q44A 1R0LA 3EZ9A 2FTKE 3RS2A 2PSEA 2VUUA 1OB5A 1PT8A 1CKEA 4KX3A 4FE4A 4R40A 3B3QA 5HA5A 4UM7A 1TM5E 3VR5A 4E6PA 1IH8A 3H1LG 2X4GA 4RVSA 4QUAA 4Y8VA 2ZTHA 2B7LA 1F8UA 1XZAA 4OLHA 2IX7C 1MAWA 3WKAA 2BFNA 1QQ5A 2YMKA 1T9AA 1T3ZA 3D31A 3WU2E 1JHXA 5EIHA 2PUBA 1S3SA 3UWPA 4CT5A 2PSSA 3RUCA 3DMYA 3NBUA 1R5NA 3ZHCA 1DKRA 3SC4A 1U94A 1WXXA 4FHDA 3UK1A 4MV3A 3GNTA 3N8IA 2AN3A 3E9NA 3COWA 3BORA 3KJQA 2N1TA 4YAGA 1VJDA 3AE2C 3GUUA 1R0ZA 1VM6A 4KQIA 4J0JA 4DZOA 1N1MA 4N3YB 3IP1A 5AWFC 1AHPA 3R0VA 2NXNA 1GO2A 1LDBA 1VFNA 4KE6A 2JNWA 4UM9B 1SUWA 3DO5A 3O3CA 5JFOA 4QATA 2NZ2A 3K9WA 2XUFA 1BE6A 1TZJA 4YXWD 4J2HA 4M46A 4DCNA 1K27A 4R2WA 3ROZA 1IO4A 2KLVA 4CW7A 1PIXA 2FRVA 3H2HA 2YOHA 1VIMA 1E6EA 1ODKA 3JARB 1CW2B 1OVRA 1CIJA 3P27A 2XDQA 5KU1A 2XRMA 2EIXA 2QZ4A 2YHAA 1FRFS 3MUOA 2JJ8A 1SPXA 4J2TA 2WF6A 5DT2A 3HVHA 4XQ0A 4YT2A 4DDUA 5G0TA 1NVKA 2QGZA 1HDEA 1E2KA 4J0CA 3NCHA 4LY6A 3GLHA 5CLHA 5CVUA 1FUKA 2PN1A 2HU7A 1BMFA 4DDHA 2Y1CA 4JR2A 1AK1A 1E4EB 3O4RA 4M99A 3G2HA 2OC4A 3HG7A 3MS7A 4RSRA 2OORC 3ZE1B 3E61A 4NBUA 3TZCA 3WGMA 1Y6RA 2R9VA 2CUKA 2FCRA 2B78A 2WJ4A 4QU0A 1S4QA 2ATVA 1FX0A 2C7OA 2W83A 2GJSA 4KZKA 1U3FA 3OEWA 4QZVA 4B86A 1DV2A 3LQYA 1E5XA 5F3WB 2V7BA 4RJLA 5FPPA 1RJEA 3IV9A 1YXMA 2O2DA 4XB6B 3TLMA 1J39A 4L22A 3UA4A 3BVHA 1QF9A 3H2KA 5CNKA 2HBQA 2V8OA 1M0EA 4GICA 4PAWA 3B1JA 2UDPA 3A6EA 3VR0A 4G8DA 3C24A 5KU7A 1A1VA 4MW0A 2C4VA 1P81A 3RT1A 4CQNA 4YJ2B 3NW9A 2JJ1D 2AWOA 9MHTA 2WI8A 1FZAA 2Y2UA 2D3WA 4LF4B 1P0IA 4BMVA 5J2TB 4L5CA 4UOZA 3EH2A 4HDSB 2FR0A 3B70A 3LZCA 1D2MA 4IXWA 5E7QA 5AVZB 1KJ8A 4P1ZA 4ZYZA 1KYIA 1KMHA 5LJIA 2UUPA 3F3KA 5IF9A 3LVFO 2BUCA 4EF6A 5TLSA 3CJRA 4JNKA 3ANNA 3WA7A 4QNRA 3GY0A 1RFLA 4Q9HA 5DJTB 4NE2A 2PGIA 4JITA 2AXQA 1RQUA 4I55B 3RK2B 1NVDA 2FPIA 3B1KA 4TMWA 4PNPA 1DEEG 1YQUA 4JJZA 1EFPB 2YXQB 1L0BA 4FFLA 2GAOA 2CKDA 4HJXA 1P2BA 3KPUA 3ONWA 1U9IA 1US8A 2IYWA 3IVMA 5DIFA 2UYHA 2AUTA 2ZU0C 3NKFA 4C7XA 3SHVA 3LP6A 4N03A 5HZMA 4BNGA 3FMFA 5ELMA 2GAFA 4OHZA 5BN3B 2HDWA 3G8BA 3D6ZA 2JGDA 1MA0A 3BRCA 1D1QA 3CGGA 3M3PA 1UM9A 3NM6B 1NJ5A 1RC1A 3EZGA 3FCEA 1P9LA 3EXIB 3M7IA 3PUZA 2CXRA 3GP8A 2CMGA 5HS6A 5HZHA 1H4SA 3GH3A 1G6Q1 2W2LD 2VSYA 1V96A 4CM5A 2OTKE 2D2FA 3BC1A 5BV1A 1MRNA 1QGUB 1USKA 1QU3A 3D6TB 7MDHA 2HCFA 3I62A 4MYTA 3ZHBA 2P0EA 3EISA 4R9UC 4U9UA 1YL7A 3GNSA 4U2KA 4IFDK 4QDJA 1P74A 1P75A 1LPNA 4GZLA 4GUDA 1G3UA 1WSDA 5IRCD 4BLRA 4E5KA 3HWSA 4AJ2A 3W1WA 3FCCA 1X39A 3OEHD 3N2KB 2C58A 1CBUA 5BVHA 4OLBA 3U37A 3GA0A 4PE5B 4ZOEA 5KZMB 4F6RA 2QY9A 1L0LK 2BV3A 4CIWA 1BEZA 4HZUA 5ARDA 3L74J 1FUYB 4PYIA 3GZNB 4CF5A 4U02A 2VK1A 4KT0J 1CE8B 1Z62A 3PJEA 3V33A 3GZTB 2O8CA 3HVUA 4JCOA 2AD1A 5EQFA 1U1EA 4BFSA 3DE5X 5ILQA 4EUNA 4RYLA 2R6DA 1QTQA 3WLAA 2LTAA 1FBMA 1JJBA 3CWBJ 3LPAA 5ILGA 2YMLA 1W44A 1JJAA 2MYTA 3U44A 4OMFG 4MA0A 2IYEA 3NUQA 3VZDA 4E08A 2CL7X 1LVGA 2IP1A 3HJRA 2NP7A 4WJZA 3PQ5A 5TQ0A 1EAYA 2JLSA 1QDLB 5E7IA 1UF9A 1L4NA 3OT4A 3TCXB 4FN5A 5GV7A 1GKLA 4JD5A 1WM1A 4HWSA 5B1HA 2RHRA 3IAS1 3ET5A 3U48A 3UKDA 4FBLA 3N2NA 3HXQA 3BMOA 3EZ6A 4YPFA 4LF9B 4C7VA 2HQBA 1H89A 4AN4A 2Y4NA 5EXDA 2LP4Y 4MMZB 3ZHVA 3T97A 5D6NA 4ZIRA 2JK1A 4CUJA 7ADHA 1O3YA 2PS1A 1G4UR 3O95A 3MGAA 3L37A 3UCFA 1KO7A 4RTNA 1ORVA 4KXNA 1SQFA 1KNXA 3ROMA 1RRFA 4ZO6A 3Q3EA 4HDQB 2E4ZA 4UUNA 1UBFA 1WPGA 4HH1A 1JXMA 5KJ1A 3QLEA 3KKOA 2Q9AA 2EKPA 2AQHA 3ZI4A 3ZUPA 3EFGA 3CG4A 4E32A 3SXUB 5EJ4A 4I19A 4QFDA 3RIMA 4B9EA 3OJEA 1CVLA 1CUYA 2N42A 4O0LA 2XTJA 3GDGA 2Z58A 3KSUA 5T67A 3HFRA 3AF6A 4Y1RB 1EG7A 5C7OO 1X0XA 3IMKA 1HH0A 3KL4A 2WWTA 4K9LA 3NB0A 3DPIA 4O4HB 2QAGA 2K2QB 4MV0A 2C57A 3Q2KA 3VVMA 2Q5HA 3GCZA 3RSSA 1JO5A 2VUSA 2A5YB 2QT0A 1L5KA 2ZT6A 2VOEA 2ZTUA 2XXAB 1WDMA 4Z53A 3SSOA 4C20A 4M7WA 2QAIA 1XP5A 2FPKA 3VVLA 2DBRA 3GPIA 5LN1A 3OM9A 2DT8A 5FBZA 5AXAA 4B82A 1GDHA 3OUZA 1RLJA 2OK8A 1E2DA 1QV7A 3KJXA 4PLGA 4MYUA 4DKJA 1TD1A 5CAEA 5KHOC 1YULA 2RGUA 3EA0A 2YRXA 3EMDA 1N2CB 4NCKA 1QHFA 1GUBA 4RHTA 4Z3OA 1C0IA 3AV0B 3RKRA 5J4VA 3OQ6A 1K04A 2ZYSA 5LDHA 1OXSC 2BZ0A 4DDWA 3FPCA 3WGKA 1ZMEC 1VJRA 1DC6A 4WK6A 4Y2VA 1P2TA 3TUJC 4TM8A 2IZ0A 1ZHOA 3U7RA 1NVTA 4PU0A 1U57A 1M75A 4MYHA 3DFIA 3UOWA 4C21A 1L5FA 3JRXA 3AONB 2JLRA 3L4FA 3N2YA 5D01A 1U9YA 1K1EA 1QH1B 2VTVA 1YBHA 3K5BA 1N8RQ 2YC2C 4GLOA 1L4GA 4UPDA 1CZRA 3GDHA 5K8UA 1BNCA 2XTAA 1V1RA 1EYZA 5C1BA 5A3QA 5ECDA 3H5VA 3AWDA 3Q1LA 3UXHA 1XRRA 4D5GA 1IFDA 4Q3NA 2SPZA 5L3SB 1NW6A 4HTFB 1LQUA 4KV7A 4RV4A 4TTSA 4XGQA 2GN6A 4YFYA 3PNPA 1Z7EA 3SQOA 4TTJA 2GK4A 2IIVA 4QU9A 3JD2A 1EJ2A 3ONVA 2BC9A 2DBZA 1FE6A 4GBJA 5M04A 4UDYX 5EJ9A 1G59A 2QQGA 5AW5B 2DEUA 3AEAC 4D3DA 2XZPA 4YJKA 3WY9A 1DRKA 2Z2XA 5CA0A 1EEHA 5C1PA 4OQLA 5FF9A 3KEGA 4OP1A 3Q7EA 4MMXB 4DV7B 2NSYA 2FPGB 1J1EC 4QGAA 2CB9A 2GRUA 2KWIA 2WFZA 3PCTA 3NWBA 3NC1C 4B2IA 2VJNA 3FGAD 2WSFH 4ZN6A 4C0LA 2GJKA 2ZVDA 1N6HA 1FYVA 4FSDA 2WZBA 1SOAA 3GV0A 1SD2A 1U7UA 3FNGA 4JXXA 4W5JA 2GFIA 2I4IA 4L4UA 3ELUA 1R8XA 1H5NA 2UZ1B 3O8OB 2DE0X 1ZLYA 3PGXA 1OTYA 2ZSJA 5APYA 4OKIA 2QD3A 1QG0A 4MV1A 3FDZA 2ICAA 5AW1B 4CPGA 3EXEB 3V9AA 4B73A 3OAKA 2BBWA 2HLOA 3FXAA 2Y1DA 3D1VA 2TMDA 2MYUA 1TYZA 2O05A 1D4ZA 3FVRA 4D4HA 2E87A 4UB8E 5I3CA 5JQWA 2H7XA 3WFJA 4BKQA 5JISA 1KEEA 2RH5A 4D26A 1DO8A 4Q9DA 3BL5A 1VJ1A 2C2GA 2BZSA 2QX4A 4BNMA 5ILOA 2G9VA 1GP2A 2DQ4A 1RMQA 2GYYA 5A7GA 4BFWA 4IDFA 4JLBA 3CWBE 4J0IA 3AUUA 1LI5A 1E7WA 3GYBA 3L74G 5IHXA 1KILB 2H11A 1NDHA 1SLQA 5FJIA 1OLSA 4UD2A 1IOWA 3HXOA 4KQ6A 2VP9A 1G63A 4DLTA 4GVXA 3PFWO 3A9RA 4JXJA 3BWMA 3CN7A 3FDJA 3ZU2A 3WVNA 5AVTB 2VBFA 1F1BA 1LNZA 4LVOA 1QRSA 2QJYB 3C7AA 4OHVA 3ONDA 5BV2P 3QXJA 1Q50A 1QZZA 3G1UA 3DEFA 1M34B 1YQEA 4Z4QA 3KQTA 3VTPC 5LD2B 2R11A 2SKCA 2QD1A 3FYSA 1YHYA 4A0FA 1IM2A 3HFSA 3ZE6A 4RD4A 3VSEA 3WNQA 1GY8A 1FNMA 1U99A 4RSHA 1W47A 2ZI4A 3SJ7A 3EIUA 4LOHA 1BVHA 2J5UA 4F84A 3QQ5A 1NF3A 4GMDA 1VPVA 4HFMA 4ZT5A 1FXWA 4EPVA 3JZAA 2QL9A 1SQBJ 1E2HA 2RK6A 4UEOA 4KFSA 4H3VA 5B53A 1G291 3H9CA 5ENZA 1SULA 4FDTA 3TNDA 4L8WB 3A1UA 3GLKA 3QV1A 5B66H 3L1KA 2P1JA 4IKEA 1B15A 1FYFA 2W6CX 3F8WA 3DAHA 3GGDA 5G3ZA 2QTNA 1Z0AA 2IU4A 3OX1A 5ARBA 2FEOA 4FGSA 2OE2A 4NE7A 1Y9JA 4J4HA 4DIBA 2PMDA 4MP3A 3DHYA 4YAEA 3HUUA 1MKMA 2N9YB 1H69A 1U02A 1WUYA 4X1YB 1OXTA 1EZZA 1TVCA 1VBKA 4PX5A 2OPHA 1RCFA 1N33B 1W85A 1KIAA 4ZYUA 3MWEB 1T6AA 5FHQA 4LDNA 2GDJA 4B09A 1JLSA 3AU9A 4ER5A 4ZANA 4G5YA 4ANFA 4AJNA 2DUWA 2BW0A 4C03A 2V55B 3B6IA 3Q5PA 1A82A 2C5BA 1ZM7A 3VFDA 1ZVMA 1NR1A 3CZ4A 4X6LA 5FA5A 4AQRD 2Z6VA 5CBKA 2RBKA 1L4HA 2NW6A 3PFCA 3U16A 3E3OA 1IY2A 1V16B 4IQ4A 1YRYE 1U7MA 1W5SA 4FB4A 1KZ4A 3WGNA 3KT0A 1YVRA 3UHAA 1HGXA 4MP6A 3AE1C 4DSZA 1FZCB 2BT4A 2V4ZA 3KFLA 4QUDA 1FS0E 3AEUB 3JALB 5AHRA 1O57A 4NYJQ 4IKOA 2LGJA 2J0SA 3IR6A 4RULA 2WM9B 3IQGX 5I7RA 1ITZA 1QGZA 3DF9A 3MBKA 1SWVA 2K1AA 4P3OA 4IIJA 3HD7C 4A1FA 2G8LA 4OGWA 4LNUA 3BE6A 3GI1A 2BKAA 1C7EA 3HK2A 1R8SA 4K2AA 4E5YA 1BA3A 4LJLA 1MIHA 2PM8A 2OYOA 1DDGA 1F9AA 3TTXA 3LECA 1DRWA 1JMYA 2IHVA 4DCJA 1WBDA 1R5JA 3HB1A 1PG5A 2CFIA 1TM4E 1X9GA 2ZEJA 4EJ0A 1GUDA 1G21A 4Q21A 3I2KA 3CLQA 2FSIA 4M1ZA 4F8YA 4JP8A 5DJ5A 3MQFA 3LIDA 5J5CA 1QS0B 2P9FA 3AJ8A 1V3VA 1KPIA 5JH7F 3GJ0A 1SBCA 4K46A 4GRAA 5AD1A 3NUZA 1NWQA 3BVPA 2C88A 5E1OA 4ER0A 2QRPA 1XTSA 1I36A 3GGJA 2WB4A 4ALJA 1GL2A 2R5DA 2BUBA 3QUCA 2YNMA 1U7ZA 3ZV5A 3CY6A 2PAJA 1YDEA 3E81A 4BYGA 2VNSA 3TXAA 3UN1A 3A3YB 4PGAA 5LYJF 3KR0A 2ZWMA 5FUVA 1N6RA 1MPXA 4OYYA 1F8XA 1KQSO 1SG9A 2YV2A 5KQLA 4B3FX 3D8HA 1T3JA 2V7EA 2KJQA 3FPSA 5D86A 1JYFA 1YR7A 1P1IA 4PANA 1C1DB 4MW7A 4Q24A 4BS9A 1NU1J 3WYBA 1ZN5A 2GZRA 3HJCA 3EPLA 1N1EA 4MKGA 3EVDA 2NO5A 2P6PA 3R5XA 4NYIR 4E2ZA 4FGZA 2N1MA 4JP2A 1B00A 3HSYA 2R6GA 3U9SA 2EZUA 4US1R 3WKEA 4MR9B 1YK1A 3IULA 3A05A 5E8RA 1T3GA 4FWTA 3O8QA 4MS1A 4OTZA 4DYDA 5B36A 4KQ1A 2CPBA 1UMDB 1HL7A 1GDDA 2R8XA 4UNSA 4B81A 1SD1A 2RGWA 4K9DA 2RGRA 1UKZA 4ZAWA 5CPBA 3DONA 5D00A 3LY7A 1Z73A 3W9BA 1I0IA 3E9DA 3ETCA 3WB1A 3RCBA 4KR0A 5I4CA 4DR5B 3JTMA 1XAIA 4G5FA 1C3EA 5TF0A 4U3FD 2O3JA 1JXOA 3VJLA 1TZKA 3LX6A 2G0NA 4E6EA 4YP5A 4JZKA 1MFZA 5DV9A 3E53A 1OH6A 5A4KA 1HH4A 3LL7A 2P6OA 1BWPA 1N4AA 3W5JA 1H2BA 3T1QA 1PWXA 4I3FA 3JRNA 1Y6FA 1KQPA 1XZMA 1B42A 3RIHA 4NOKA 4M9UA 5MN6A 1VBMA 1W2EA 2O2YA 1X3SA 4PC7A 4IDHA 5CMLA 1ILWA 4EJFA 2V7WA 2VJDA 4N78D 1U8ZA 6YASA 1N78A 3I9KA 4I8XA 3L7LA 3ZDBA 4YQZA 4IW3B 3WGIA 3L49A 2CJYA 1ND6A 2WIAA 4NJEB 3EUAA 4RH1A 3H4TA 3OE7A 2NOGA 5K2MA 4JMPA 3E15A 3RFXA 1R9JA 2PRSA 2FX3A 4P35A 3EXG2 1HJ0A 3WKBA 2IF2A 4DEYA 1X80A 3G82C 4MV5A 2OYSA 4PHTA 3C5WP 1ZO8A 1ML3A 3FOWA 1GTJ1 4HXGA 3I32A 1QORA 2C7QA 1NTMJ 4BLTA 1TM3E 1SELA 1XQ6A 2D5LA 4MZXA 2D4AA 1HEYA 4JWTA 2JGEA 3K0FB 2HNBA 3ICOA 4IFIA 1SQBG 5ALWA 1J0DA 4PXSA 1M90Q 2UUOA 2H92A 4B7CA 4TZ6A 3M1YA 1M54A 1K5HA 2YWFA 1QCYA 4K05A 5ICMA 2VYNA 3SFEC 4HAXA 3AP2A 4WNYA 2BFAA 4POAA 5AKXA 4XUGB 1T35A 3HS3A 1Q0PA 1A2OA 1M3SA 5HF8A 4I50A 2J30A 4RMHA 4HQRA 1QVRA 4ISBA 4CDGA 4M4SA 5GV8A 1W93A 2NXEA 1SUCA 4D0LB 4JC8A 1E9FA 1UBNA 4GPAA 3RF6A 4I1PA 4W80A 1W8IA 2Q6VA 4RMGA 1NV8A 3IMGA 3DHEA 1EBFA 4D4LA 1LBIA 1T5LA 3CH4B 1KGSA 2F1JA 1C3JA 1C50A 3ZXSA 5IHPA 4L0DA 1M8PA 4K7JA 1D7MA 1Z18A 5CVTA 4O5OA 4LI3X 1DMRA 4E7PA 4US2R 1FMCA 2DKFA 4PCVA 4INOA 5IMSA 1KA9H 1GYQA 3O94A 1NJGA 1PZHA 3HKEB 2XNJA 3WSWA 1E9DA 1R0RE 2XOXA 3BCSA 2CV2A 2O2ZA 2YNYA 4DBVO 2HCBA 1FA9A 1IDN1 2CUNA 4GL2A 1UXKA 2Z6AA 3MHPA 5K8JB 3HABA 4KQKA 3QP9A 4IWYA 4RVGA 3O4IA 1LW6E 4DSAA 1PNOA 3DB2A 1KRHA 2PKYX 3E1GA 3WE7A 1ND5A 3C5EA 4L8GA 4S1OA 1X7HA 2QM7A 5EP4A 4YDSA 1W0JA 4YCMA 1L4UA 1XFAA 2RN0A 1II8B 3OD1A 3USSA 1P5ZB 4K6OA 1EQAA 4IS3A 1X14A 1A69A 2EC5A 5LA6B 4KE7A 4QXAA 5B1IA 1QYWA 3CLHA 3FFBA 5TMDA 2D7DA 1ZMRA 4BNJA 2J87A 2J3JA 2E48A 5ALLA 1X77A 4XIGS