4PD4H

Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
93
structure length
93
Chain Sequence
b'GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/inhibitor
total genus 17
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 4pd4H00
2BCCG 4U3FG 3L74G 3CWBG 1NTZG 1SQQG 1NTMG 3H1HG 1KYOH 1EZVG 3H1IG 1SQXG 2IBZG 1SQVG 4PD4H 3L73G 1BCCG 1NTKG 3TGUG 1SQPG 1BE3G 1KB9H 1L0LG 3L71G 1PP9G 2FYUG 3H1LG 3CXHH 2A06G 1L0NG 1PPJG 3BCCG 3L70G 3H1KG 1P84H 5KLVG 1BGYG 4D6TG 1SQBG 3CX5H 3H1JG 3L72G 3L75G 1NU1G
chains in the Genus database with same CATH superfamily
3KPEA 1KQLA 1ZR4A 1SQPK 3I5CA 5APXA 1W2BO 1SFCC 1SQPJ 1U7JA 1T3JA 2I1JA 4PV1B 2W90A 1KTMA 2QIWA 4GOEA 4OGQD 5APWA 1T2KC 4WBAA 1IK7A 3L74D 1ZP0C 3H1HE 3RL0D 1IFJA 3NMDA 4HJGH 3HRNA 1KORA 3V2PA 2K3RA 1L0LG 3CXHI 2CPBA 4UB6H 1FJKA 2FYUD 4H0LB 2KUBA 1HTLC 1FZBA 1M1KQ 3H1KG 4JF7A 1DH3A 3KQGA 3HD7A 2Y9YA 3V4QA 5AVXB 1SQQJ 1N73C 3IFMA 2OYHB 4I7ZC 1X79B 1KMIZ 2NZ2A 3V2NA 1VQOP 1GK4A 3M9BA 1CZQA 3H1JE 4HKZH 1URQA 2BCCJ 4WY4C 1VDFA 1HGZA 2KSJA 2QM7A 2WPSA 3CXHE 2JKVA 3K5BA 1X0TA 3LW5J 2CK3H 2SPZA 2WT7B 3RK3D 3TNUB 1PFIA 1LJ2A 1IZNB 1H0TA 1L4AB 1SQBK 3E1RA 5AW8B 2KS1A 3E7KA 1VQPP 5APUA 1QL1A 2H43A 4Z1MH 1SQXG 5KJ7D 1XTGB 4DZOA 2E5TA 5APYA 4ASVA 3CCJP 1L0LE 1Y9BA 1J1DC 4IL6H 3LW5H 5GTHH 1MUUA 3F5HA 1YTZI 2XNDH 3CWBJ 1RF1A 4PD4H 3L73J 3D6YA 3QH9A 3OJAB 3G9RA 3B5ND 3VYIA 2I1KA 3L70J 2O01J 2ZJSE 1BGYD 3U59A 4EOTA 1NTKK 2WMMA 4NPFX 5KLIC 1NTKJ 1HWTC 2NPSC 3OA7A 5AW0B 1BE3J 2P58A 2H8PD 3TGUD 1LWUC 2BEQD 1HUCA 1LTAC 3SWFA 1KQGB 3MUDA 1ZN5A 2E42A 1E79H 1NU1D 1M1JA 1FOSF 2N9BA 1R8EA 2O01H 1AQTA 5B5EH 1SQXE 1EQ7A 2YO3A 3PLNA 3O6QB 2LXBA 3ABVC 2C9NY 4DJGA 1NH4A 1N73B 2Z4EA 4I7ZB 4U3FG 2FYZA 3D71A 2K9YA 2K37A 1PZQA 5AVVB 1HH0A 2KZIA 2KIKA 3VN0A 3SFDC 1RE3C 4D6TE 4WY4B 3G6EP 5AW4B 3CX5H 2A45H 3L75J 1EDJA 3GHGC 3RL0g 3IF4A 4WVZA 3PH0A 3HD7C 1VL2A 2O3JA 1J1EC 3GF3A 1HJBA 1PP9D 1PPJG 2QJKC 5TISH 3IR9A 5DJTB 1SQBD 2Y9ZA 3AECC 2Y0CA 1J1DB 1KB9H 5AW5B 4RO0A 1URQC 1FS0E 1KYOD 3VMXA 3IAOA 5KJ7A 4UB6E 1OZHA 1VQMP 2FY8A 2AEFA 1SQPE 1RE4A 2FKWB 2A06E 3CI9A 1M57D 1HVVA 5AVRB 3NFQA 1VQLP 1JCCA 5KLVG 1LTJC 1NTMK 2KNCA 1EDLA 2QEXP 5KLIB 1NTZG 2NPSB 3B5NA 1UIIA 1SQVG 2WPQA 2PFXA 1BCCD 3O8ZA 1U57A 3A5TA 1PPJE 3A3YB 3HUSA 1G2CA 2C0XA 1W5CE 3GF7A 3PTZA 2M5AB 1SQQE 3SWYA 3M0AA 1HBWA 3L73G 1K05A 2IYOA 2QSIA 2DW3A 2B89A 2KYVA 2MKVA 3CMEP 2R3SA 4XE5B 1JTHB 3AEDC 3G4SP 3BCCD 2LR2A 1MV8A 2K1AA 4JYCA 5AW9B 3SFEC 5APQA 3EFGA 1MZ9A 2IYPA 1OVVA 2XKMA 4KT0J 1RQUA 3Q5PA 3H1LD 1M1JC 3BRTB 1KN7A 2D2CD 2Z5HA 1VQ6P 4B86A 5KLVE 4PD4E 3GHGB 1NTZE 3HD7B 2NRGA 1J1EB 3P7KA 2QJKB 2A45G 2M8RA 1P84I 2N9YB 4H13D 4GT1A 1NGMB 1GMJA 1N7LA 3L74J 3CWBE 2AXCA 2Q7CA 1S9KE 1SP4A 5B66H 3W67A 4C7RA 2FYUK 3L73E 1URQB 2C9LY 2FYUJ 3L71D 1KILA 1L0NG 4ASWA 3A0BH 3L70E 5B5EE 2A45I 1LTSC 1GL2D 2Z5IA 3HTKA 1N7SD 3L36A 1CW5A 2KS1B 1NKZB 3H1ID 3FXDA 1BE3E 2WPRA 1P84E 2YMYA 4N78E 2FXPA 2ZT9D 1LTJB 4W7ZA 1MFTA 5TJHA 5KAFH 3MHVA 3CC7P 1FOSE 1YBKA 2E43A 2MJZA 3MP7B 4LGDE 1S72P 2ZFCA 4N3YB 1NTMD 2ZVOB 1EZVD 3P8CE 2W83C 3CCRP 3U1CA 1NJIQ 1QGKB 1PL5A 5CCHA 4YTPC 2ZYDA 1RE4C 2KOGA 4AYCA 2QE7H 5TISE 4RKUJ 2PRRA 1FZFA 1ZLLA 5CBOA 2HR3A 1L0NE 1YTZT 3L75E 3BRVB 1KB9E 2Y0EA 1M90Q 4UB8E 1S5LH 4ZMDA 3CXHD 4GOFA 3TDKA 1M1JB 4HYTB 1LTBC 2YKOA 2AEJA 5AW1B 3B4SA 2P1JA 1BGYJ 2WSEJ 3H1JG 1YQ4C 3RK2C 3PRJA 2H89C 3TYYA 1YJNP 1GU4A 3TGUJ 4C46A 1L0LD 2B87B 2KXPB 4XA4A 1NU1K 3H1KD 1NU1J 1K04A 2QJPB 1LP1B 2J58A 2WSEH 5KTBA 4IFFA 3S1KA 1N86A 2QM8A 1S5LX 1KQSO 1IO4A 1DIPA 3TF5A 5AW2B 2PP6A 3GMAA 3CL3D 3V5BA 3WUUA 4PV1D 4L75A 1N7SA 2XZRA 1LTIC 1VQ7P 2H88C 2YKPA 1S2EA 2Q9IA 1KZUB 1JB0J 4KHXA 1Z56A 1KILC 1LT1A 5CHXA 4L73A 2WPVB 1PP9J 1EDKA 3MD0A 1WMKA 2Q3EA 4H0LD 4JQ0D 1YIJP 1Q7YQ 4BWNA 1SQBJ 4TLFA 2E76B 5CCGD 1ZMEC 5L8RJ 2HODB 2OYIA 1IC2A 3H32A 2YKQA 1SQVK 2YIUC 3BASA 3A0BE 3AE6C 5BU5A 1JUNA 5CCHC 1U7MA 4GKGA 1L4AD 1S3JA 2QRXA 3RK2B 3B71A 4D6TG 2WWWA 2PAJA 2E76D 2N1TC 3L74E 2FFDA 1HF9A 1EC5A 1SFCB 2WQYC 3A0HH 4WB4A 1BCCJ 3HE4A 1OVUA 2FYUE 1M8OB 2XV5A 2HPCA 2QJYC 1LT9A 2WSFJ 1SS1A 2Q5UA 1GTWA 3WMM0 4U3FD 3C9IA 1K8AQ 2QA4P 5GTIE 3MZWB 3T97A 4IL6X 2E74C 4EI2A 2WZ7A 3FWLA 1DX7A 3RK2D 4N6JA 1OW6A 4JPZB 1H88A 1G1JA 3L72G 4R4LA 1JY2O 3AEBC 1SFCD 3VP9A 5H2FE 3Q1MA 2K9JB 3KYQA 2HFED 3RK3E 2WSFH 3TGUG 1SQPG 3CCLP 3H1LJ 4LLHA 1QX8A 4BXLA 2A06G 1T2KD 1YHQP 1S5LE 1PPJD 1KILB 1Q86Q 1AVOA 1JY3P 5CBNA 1L2PA 3Q3DA 3N4XA 4JYBA 2H7HA 3VOPA 4LC1A 2WVRA 4YXDC 2P7JA 1M56D 1DEBA 1RQVA 1SQQG 1UIXA 1IFIA 1Y8AA 1KFMA 4ZKUA 2AEMA 1W2EA 3AE8C 1FDMA 1Q2NA 2V7QJ 3ZDMA 3L71J 4AQRD 3V4WA 1WRGA 1VQ9P 4WY4D 2OYHA 2YIUB 5KLVD 1Y47A 3L72E 2BCCG 3H1IJ 1NTZD 1R5LA 1SQVD 3JCUH 2R5BA 3TGUE 1OW7A 2P2UA 1ZRTD 1VF5C 1FBMA 4L74A 2N1TB 1Q90D 1FDOA 3KZIH 2V7QH 3W68A 1SQBG 1FDIA 4W7YA 1NU1E 4WWIA 4ZNCA 1NTMJ 4I6MC 2HYNA 1L4AA 1A02J 2YO2A 4OH8B 2XU6A 1LWUB 4H44C 2IDBA 4BRYB 2QJYB 1KD1Q 1RF1C 3KHUA 1RF0A 3TSIA 2K88A 1CI6B 3CWBG 2W6AA 1HJ0A 4PD4I 3KDPB 2E74B 2IBZG 1R5SA 1FAVA 1P84D 3EFFK 1RY3A 2FFDC 2KP8A 1RHZB 2OTKE 3L70G 2WSCJ 2P67A 2BCCE 2NPSD 3Q5RA 2AXTH 1NTKG 3P8CD 4IL6E 1T8ZA 3AEGC 1BE3G 5GTHE 4A7PA 1PP9E 2IZ0A 1AV1A 2IBZI 3MUDC 1DD4A 2BASA 1LTTC 1KILE 1SQBE 5AVYB 2WITA 2PGDA 5AVTB 1L0LK 2WSCH 3RL0C 4I2LC 5DJUB 3CXHH 3AE9C 1T3UA 1L0ND 3Q2YA 3H1KJ 3A0HE 2ZYAA 2KLUA 3VP8A 3OAKA 2IBZE 2LKMA 5BU8B 3LIEA 1FZGA 4IFDK 1AVYA 1IJDB 2POHA 2KLVA 3CX5I 2WSSH 1VQ5P 3L75G 1H0TB 5APVA 3HD7D 1GDTA 1BCCE 3AE4C 1NTKE 1VQKP 4WY4A 3L4FA 1VF5B 1FU1A 4DOJA 1DEEG 3R4YA 1X22A 3RK3C 1K9MQ 3S4RA 1NAYA 1VQ4P 3GLMA 1SQXK 3QWOC 4TT3H 3HE5A 4H44B 1KV4A 1G1IA 1VQNP 1JY3O 3C1LA 3H1HD 3WU2H 1URQD 1KB9I 4M3LA 1OIPA 1RF1B 3CX5E 4C7NA 5CJ0A 5KJ7C 3CLQA 3V6IA 3JC22 1OX3A 4OVNF 1QVFO 3AE7C 1QL2A 2FXMA 2W27A 5AVWB 1FZCA 1BDCA 3H1LE 4GDOA 5AW7B 2R44A 1S1CX 2V4HA 2O1JA 3SWKA 3B5NC 3H1JD 3BATA 3M06A 2JEEA 1JOCA 1EZVG 1JY2N 3HUSC 1RF0C 2JDIH 4JBZA 3AEEC 2IFNA 1OFCX 2M3BA 2NPSA 2WTYA 2RN0A 3JCUE 1OMIA 1PGOA 1QLED 3GW6A 3RL0B 2J5UA 3EQ2A 5AW6B 2BEZF 3KZIE 3G3ZA 3TK1A 1EZVI 3L71E 1WT6A 2M5AA 2ZXXA 2ZXEB 4U3FJ 1AQ5A 2RH0A 3VMZA 3H1IE 1JTHA 3IN6A 1K73Q 2JWDA 1IK9A 3NTNA 1YJ9P 3V2RA 5AW3B 1JEKA 1NTME 1RE3A 1EZVE 3BVHA 3AEAC 1MKMA 2E5YA 4R4MA 2KSEA 3RK3B 2W6BA 3GHGA 1GL2A 3USSA 2YNYA 2AXTE 1EXJA 1D7MA 1H89A 3A7OA 1SQQK 2P10A 4HB1A 1NAFA 2HLOA 5KKZC 3M0DA 2FBWC 3L74G 1JM0A 3U1AA 1SQXD 3I55P 1PGQA 4U7JA 2FYUG 3FX0A 2J59M 1E5WA 2Y0DA 1X8YA 2XNXA 2KNCB 4DCKA 1NHLA 1NKNA 3M9HA 5KLVK 3B5NB 1DD3A 1QVGO 4YXWH 5KLVJ 1IFPA 4Y99C 5B66E 1NTZK 1Q81Q 4D6TD 2ITAA 1NTZJ 3HUSB 2IFMA 4L76A 3AE3C 1LTJA 1G2CB 1SQVJ 5AVZB 1KC8Q 3CC4P 3H1KE 2YXQB 2GUSA 4EDFA 1NVOA 1FZCC 3CCVP 1KYOH 4K35A 3LIDA 3CCSP 2L5GB 5KAFE 3L35A 3AEFC 1H8AA 2G8YA 1IFNA 1PGJA 3WU2E 4DT0A 2FXOA 3L72D 2ZYGA 5CJ4A 1NOHA 3N7NA 2O1KA 2JP3A 1PIXA 2OQQA 1SQPD 4IOIH 2B88A 2A06D 5APTA 2KZJA 5AVQB 2KK7A 3BCCJ 1FE6A 1BGYG 2GM4A 2IZ1A 2D2CC 4NPDA 5KAIH 3CCQP 2JWAA 5C39A 3P32A 1LGHB 2G3AA 2M0BA 3ITKA 1OW8A 4MN4C 2OGUA 2GA1A 2B9BA 5KKZB 1P84H 2L91A 1NU1G 3JSVC 2B87A 4H13C 2HG5D 1SQQD 3CCUP 4K3AA 1L0NK 3HTKB 3OW2O 1Q82Q 1JY3N 1L0NJ 3AE2C 2UWJE 3PP5A 1ZV8A 2OYOA 1LP1A 1YYCA 4ZKPA 3F89A 1ZOYC 2BCCD 5AVUB 4EYYQ 1GL2C 1N7SC 1J2JB 3PHLA 4RJTA 3HE5B 1JCDA 4GODA 3M0DC 4Y99B 2I8DA 1USEA 1M7LA 5BVZA 5CCGA 5E79H 1BGYE 2ZT9C 1KILD 4C7NB 4PD4D 3FGAD 1SVFA 3WUVA 1AFOA 3D70A 4PJ0H 4UB8H 1PP9G 1FZCB 2Q3IA 2JO1A 1EDIA 2E75C 4U3FE 1IFMA 4GIFA 1OVRA 2WT7A 3CWBD 3TNUA 3H1HJ 1S9KD 3B8EB 2IBZD 3L73D 2C0WA 2OYIC 1N8RQ 2M3EA 2R3CA 1A02F 3PJSK 3L70D 5AVSB 1SLQA 1JMBA 4O9BA 5CCHD 1NYHA 1USDA 2HODA 1NTKD 1BE3D 4XFJA 3RBZA 4N78D 3H25A 2N1TD 2O01N 2Q1KA 2D2CB 3H1JJ 1KYOI 2YXRB 2FYNC 3UIAA 3L37A 1BCCG 2Q6QA 1IFDA 2KB7P 3G71P 2KI7B 1LT9C 3CX5D 1GW3A 1SFCA 3NXSA 1NWQA 4H13B 1GU5A 4NPEA 2E74D 4OGQC 3E1IA 3VMAA 1BSNA 1TU3F 1L0LJ 2CPSA 1YITP 2QG4A 1KYOE 2ZVNB 3BCCG 3VMYA 4CPGA 1X9VA 1GL2B 1ZR2A 4OWFA 3L75D 1N7SB 1KB9D 1VQ8P 3O6QA 1SQVE 3MIWA 3C8VA 1QEXA 1ZRTE 3H1LG 2LXCB 1N73A 3CMAP 1LNQA 5CMZA 2ZT9B 1VPCA 1FZEA 2K9JA 4PV1C 3VTPC 3MGNA 3CC2P 3RBXA 2OTLP 2QJPC 3SSUA 2OTJP 3R2PA 3GG2A 3EWKA 1JNMA 5KAIE 2YMKA 1KQFB 1OXZA 4EIJA 2E75B 1YI2P 3RGUA 2W8ZA 4H0LC 2IX7C 2RMZA 1GK6A 1GW4A 2JR8A 3Q5SA 1FJPA 1PGPA 1SQXJ 2OYIB 3H32B 2R5DA 5EFWB 5CCGC 3MTUE 2OYHC 1EXIA 1BSHA 2OARA 3L71G 1KFNA 1LTGC 3M91A 2GUVA 2IPPA 1YJWP 3CCEP 3BCCE 3FXEA 3II6A 1GZLA 1ZXGA 3FWNA 3A2AA 1XTCC 3S9OA 1FC2C 1AJYA 3WUTA 3P8MC 3CD6P 1AA0A 3H1IG 1HGVA 1VF5D 2FFDB 1RH5B 5GTIH 2E75D 2R32A 1ZW0A 1T6AA 5K5GB 3HE4B 1L4AC 4D6TJ 2FYNB 2RKLA 4HH2A 1BDDA 2VRSA 5APSA 4AUWA 4H44D 4KJMA 1NO4A 1MFZA 1NTMG 3H1HG 1GD2E 2E76C 2HPCB 2N1TA 1LT9B 5E79E 3CPWO 4I1LA 3D6ZA 1PV3A 5H2FH 3M9QA 1YQ3C 2JJLA 3T97B 1JY2P 4Y28J 3I56P 1LWUA 1OWAA 3V2QA 4PJ0E 4OGQB 2XDJA 3KXDA 2W6JH 4W80A 4YPCA 4BRYA 2ZAEB 2QVAA 1JO5A 5M1BA 3H6PA 1CI6A 1CSBA 4QMAA 4RESB 1S4XA 1JMMA 3AE1C 3CCMP 4IFMA 1FZAA 3AE5C 3L72J 1N2DC
chains in the Genus database with same CATH topology
2BCCG 4U3FG 3L74G 3CWBG 1NTZG 1SQQG 1NTMG 3H1HG 1KYOH 1EZVG 3H1IG 1SQXG 2IBZG 1SQVG 4PD4H 3L73G 1BCCG 1NTKG 3TGUG 1SQPG 1BE3G 1KB9H 1L0LG 3L71G 1PP9G 2FYUG 3H1LG 3CXHH 2A06G 1L0NG 1PPJG 3BCCG 3L70G 3H1KG 1P84H 5KLVG 1BGYG 4D6TG 1SQBG 3CX5H 3H1JG 3L72G 3L75G 1NU1G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCC G;  4U3F G;  3L74 G;  3CWB G;  1NTZ G;  1SQQ G;  1NTM G;  3H1H G;  1KYO H;  1EZV G;  3H1I G;  1SQX G;  2IBZ G;  1SQV G;  4PD4 H;  3L73 G;  1BCC G;  1NTK G;  3TGU G;  1SQP G;  1BE3 G;  1KB9 H;  1L0L G;  3L71 G;  1PP9 G;  2FYU G;  3H1L G;  3CXH H;  2A06 G;  1L0N G;  1PPJ G;  3BCC G;  3L70 G;  3H1K G;  1P84 H;  5KLV G;  1BGY G;  4D6T G;  1SQB G;  3CX5 H;  3H1J G;  3L72 G;  3L75 G;  1NU1 G; 
#chains in the Genus database with same CATH topology
 3KPE A;  1KQL A;  1ZR4 A;  1SQP K;  3I5C A;  5APX A;  1W2B O;  1SFC C;  1SQP J;  1U7J A;  1T3J A;  2I1J A;  4PV1 B;  2W90 A;  1KTM A;  2QIW A;  4GOE A;  4OGQ D;  5APW A;  1T2K C;  4WBA A;  1IK7 A;  3L74 D;  1ZP0 C;  3H1H E;  3RL0 D;  1IFJ A;  3NMD A;  4HJG H;  3HRN A;  1KOR A;  3V2P A;  2K3R A;  1L0L G;  3CXH I;  2CPB A;  4UB6 H;  1FJK A;  2FYU D;  4H0L B;  2KUB A;  1HTL C;  1FZB A;  1M1K Q;  3H1K G;  4JF7 A;  1DH3 A;  3KQG A;  3HD7 A;  2Y9Y A;  3V4Q A;  5AVX B;  1SQQ J;  1N73 C;  3IFM A;  2OYH B;  4I7Z C;  1X79 B;  1KMI Z;  2NZ2 A;  3V2N A;  1VQO P;  1GK4 A;  3M9B A;  1CZQ A;  3H1J E;  4HKZ H;  1URQ A;  2BCC J;  4WY4 C;  1VDF A;  1HGZ A;  2KSJ A;  2QM7 A;  2WPS A;  3CXH E;  2JKV A;  3K5B A;  1X0T A;  3LW5 J;  2CK3 H;  2SPZ A;  2WT7 B;  3RK3 D;  3TNU B;  1PFI A;  1LJ2 A;  1IZN B;  1H0T A;  1L4A B;  1SQB K;  3E1R A;  5AW8 B;  2KS1 A;  3E7K A;  1VQP P;  5APU A;  1QL1 A;  2H43 A;  4Z1M H;  1SQX G;  5KJ7 D;  1XTG B;  4DZO A;  2E5T A;  5APY A;  4ASV A;  3CCJ P;  1L0L E;  1Y9B A;  1J1D C;  4IL6 H;  3LW5 H;  5GTH H;  1MUU A;  3F5H A;  1YTZ I;  2XND H;  3CWB J;  1RF1 A;  4PD4 H;  3L73 J;  3D6Y A;  3QH9 A;  3OJA B;  3G9R A;  3B5N D;  3VYI A;  2I1K A;  3L70 J;  2O01 J;  2ZJS E;  1BGY D;  3U59 A;  4EOT A;  1NTK K;  2WMM A;  4NPF X;  5KLI C;  1NTK J;  1HWT C;  2NPS C;  3OA7 A;  5AW0 B;  1BE3 J;  2P58 A;  2H8P D;  3TGU D;  1LWU C;  2BEQ D;  1HUC A;  1LTA C;  3SWF A;  1KQG B;  3MUD A;  1ZN5 A;  2E42 A;  1E79 H;  1NU1 D;  1M1J A;  1FOS F;  2N9B A;  1R8E A;  2O01 H;  1AQT A;  5B5E H;  1SQX E;  1EQ7 A;  2YO3 A;  3PLN A;  3O6Q B;  2LXB A;  3ABV C;  2C9N Y;  4DJG A;  1NH4 A;  1N73 B;  2Z4E A;  4I7Z B;  4U3F G;  2FYZ A;  3D71 A;  2K9Y A;  2K37 A;  1PZQ A;  5AVV B;  1HH0 A;  2KZI A;  2KIK A;  3VN0 A;  3SFD C;  1RE3 C;  4D6T E;  4WY4 B;  3G6E P;  5AW4 B;  3CX5 H;  2A45 H;  3L75 J;  1EDJ A;  3GHG C;  3RL0 g;  3IF4 A;  4WVZ A;  3PH0 A;  3HD7 C;  1VL2 A;  2O3J A;  1J1E C;  3GF3 A;  1HJB A;  1PP9 D;  1PPJ G;  2QJK C;  5TIS H;  3IR9 A;  5DJT B;  1SQB D;  2Y9Z A;  3AEC C;  2Y0C A;  1J1D B;  1KB9 H;  5AW5 B;  4RO0 A;  1URQ C;  1FS0 E;  1KYO D;  3VMX A;  3IAO A;  5KJ7 A;  4UB6 E;  1OZH A;  1VQM P;  2FY8 A;  2AEF A;  1SQP E;  1RE4 A;  2FKW B;  2A06 E;  3CI9 A;  1M57 D;  1HVV A;  5AVR B;  3NFQ A;  1VQL P;  1JCC A;  5KLV G;  1LTJ C;  1NTM K;  2KNC A;  1EDL A;  2QEX P;  5KLI B;  1NTZ G;  2NPS B;  3B5N A;  1UII A;  1SQV G;  2WPQ A;  2PFX A;  1BCC D;  3O8Z A;  1U57 A;  3A5T A;  1PPJ E;  3A3Y B;  3HUS A;  1G2C A;  2C0X A;  1W5C E;  3GF7 A;  3PTZ A;  2M5A B;  1SQQ E;  3SWY A;  3M0A A;  1HBW A;  3L73 G;  1K05 A;  2IYO A;  2QSI A;  2DW3 A;  2B89 A;  2KYV A;  2MKV A;  3CME P;  2R3S A;  4XE5 B;  1JTH B;  3AED C;  3G4S P;  3BCC D;  2LR2 A;  1MV8 A;  2K1A A;  4JYC A;  5AW9 B;  3SFE C;  5APQ A;  3EFG A;  1MZ9 A;  2IYP A;  1OVV A;  2XKM A;  4KT0 J;  1RQU A;  3Q5P A;  3H1L D;  1M1J C;  3BRT B;  1KN7 A;  2D2C D;  2Z5H A;  1VQ6 P;  4B86 A;  5KLV E;  4PD4 E;  3GHG B;  1NTZ E;  3HD7 B;  2NRG A;  1J1E B;  3P7K A;  2QJK B;  2A45 G;  2M8R A;  1P84 I;  2N9Y B;  4H13 D;  4GT1 A;  1NGM B;  1GMJ A;  1N7L A;  3L74 J;  3CWB E;  2AXC A;  2Q7C A;  1S9K E;  1SP4 A;  5B66 H;  3W67 A;  4C7R A;  2FYU K;  3L73 E;  1URQ B;  2C9L Y;  2FYU J;  3L71 D;  1KIL A;  1L0N G;  4ASW A;  3A0B H;  3L70 E;  5B5E E;  2A45 I;  1LTS C;  1GL2 D;  2Z5I A;  3HTK A;  1N7S D;  3L36 A;  1CW5 A;  2KS1 B;  1NKZ B;  3H1I D;  3FXD A;  1BE3 E;  2WPR A;  1P84 E;  2YMY A;  4N78 E;  2FXP A;  2ZT9 D;  1LTJ B;  4W7Z A;  1MFT A;  5TJH A;  5KAF H;  3MHV A;  3CC7 P;  1FOS E;  1YBK A;  2E43 A;  2MJZ A;  3MP7 B;  4LGD E;  1S72 P;  2ZFC A;  4N3Y B;  1NTM D;  2ZVO B;  1EZV D;  3P8C E;  2W83 C;  3CCR P;  3U1C A;  1NJI Q;  1QGK B;  1PL5 A;  5CCH A;  4YTP C;  2ZYD A;  1RE4 C;  2KOG A;  4AYC A;  2QE7 H;  5TIS E;  4RKU J;  2PRR A;  1FZF A;  1ZLL A;  5CBO A;  2HR3 A;  1L0N E;  1YTZ T;  3L75 E;  3BRV B;  1KB9 E;  2Y0E A;  1M90 Q;  4UB8 E;  1S5L H;  4ZMD A;  3CXH D;  4GOF A;  3TDK A;  1M1J B;  4HYT B;  1LTB C;  2YKO A;  2AEJ A;  5AW1 B;  3B4S A;  2P1J A;  1BGY J;  2WSE J;  3H1J G;  1YQ4 C;  3RK2 C;  3PRJ A;  2H89 C;  3TYY A;  1YJN P;  1GU4 A;  3TGU J;  4C46 A;  1L0L D;  2B87 B;  2KXP B;  4XA4 A;  1NU1 K;  3H1K D;  1NU1 J;  1K04 A;  2QJP B;  1LP1 B;  2J58 A;  2WSE H;  5KTB A;  4IFF A;  3S1K A;  1N86 A;  2QM8 A;  1S5L X;  1KQS O;  1IO4 A;  1DIP A;  3TF5 A;  5AW2 B;  2PP6 A;  3GMA A;  3CL3 D;  3V5B A;  3WUU A;  4PV1 D;  4L75 A;  1N7S A;  2XZR A;  1LTI C;  1VQ7 P;  2H88 C;  2YKP A;  1S2E A;  2Q9I A;  1KZU B;  1JB0 J;  4KHX A;  1Z56 A;  1KIL C;  1LT1 A;  5CHX A;  4L73 A;  2WPV B;  1PP9 J;  1EDK A;  3MD0 A;  1WMK A;  2Q3E A;  4H0L D;  4JQ0 D;  1YIJ P;  1Q7Y Q;  4BWN A;  1SQB J;  4TLF A;  2E76 B;  5CCG D;  1ZME C;  5L8R J;  2HOD B;  2OYI A;  1IC2 A;  3H32 A;  2YKQ A;  1SQV K;  2YIU C;  3BAS A;  3A0B E;  3AE6 C;  5BU5 A;  1JUN A;  5CCH C;  1U7M A;  4GKG A;  1L4A D;  1S3J A;  2QRX A;  3RK2 B;  3B71 A;  4D6T G;  2WWW A;  2PAJ A;  2E76 D;  2N1T C;  3L74 E;  2FFD A;  1HF9 A;  1EC5 A;  1SFC B;  2WQY C;  3A0H H;  4WB4 A;  1BCC J;  3HE4 A;  1OVU A;  2FYU E;  1M8O B;  2XV5 A;  2HPC A;  2QJY C;  1LT9 A;  2WSF J;  1SS1 A;  2Q5U A;  1GTW A;  3WMM 0;  4U3F D;  3C9I A;  1K8A Q;  2QA4 P;  5GTI E;  3MZW B;  3T97 A;  4IL6 X;  2E74 C;  4EI2 A;  2WZ7 A;  3FWL A;  1DX7 A;  3RK2 D;  4N6J A;  1OW6 A;  4JPZ B;  1H88 A;  1G1J A;  3L72 G;  4R4L A;  1JY2 O;  3AEB C;  1SFC D;  3VP9 A;  5H2F E;  3Q1M A;  2K9J B;  3KYQ A;  2HFE D;  3RK3 E;  2WSF H;  3TGU G;  1SQP G;  3CCL P;  3H1L J;  4LLH A;  1QX8 A;  4BXL A;  2A06 G;  1T2K D;  1YHQ P;  1S5L E;  1PPJ D;  1KIL B;  1Q86 Q;  1AVO A;  1JY3 P;  5CBN A;  1L2P A;  3Q3D A;  3N4X A;  4JYB A;  2H7H A;  3VOP A;  4LC1 A;  2WVR A;  4YXD C;  2P7J A;  1M56 D;  1DEB A;  1RQV A;  1SQQ G;  1UIX A;  1IFI A;  1Y8A A;  1KFM A;  4ZKU A;  2AEM A;  1W2E A;  3AE8 C;  1FDM A;  1Q2N A;  2V7Q J;  3ZDM A;  3L71 J;  4AQR D;  3V4W A;  1WRG A;  1VQ9 P;  4WY4 D;  2OYH A;  2YIU B;  5KLV D;  1Y47 A;  3L72 E;  2BCC G;  3H1I J;  1NTZ D;  1R5L A;  1SQV D;  3JCU H;  2R5B A;  3TGU E;  1OW7 A;  2P2U A;  1ZRT D;  1VF5 C;  1FBM A;  4L74 A;  2N1T B;  1Q90 D;  1FDO A;  3KZI H;  2V7Q H;  3W68 A;  1SQB G;  1FDI A;  4W7Y A;  1NU1 E;  4WWI A;  4ZNC A;  1NTM J;  4I6M C;  2HYN A;  1L4A A;  1A02 J;  2YO2 A;  4OH8 B;  2XU6 A;  1LWU B;  4H44 C;  2IDB A;  4BRY B;  2QJY B;  1KD1 Q;  1RF1 C;  3KHU A;  1RF0 A;  3TSI A;  2K88 A;  1CI6 B;  3CWB G;  2W6A A;  1HJ0 A;  4PD4 I;  3KDP B;  2E74 B;  2IBZ G;  1R5S A;  1FAV A;  1P84 D;  3EFF K;  1RY3 A;  2FFD C;  2KP8 A;  1RHZ B;  2OTK E;  3L70 G;  2WSC J;  2P67 A;  2BCC E;  2NPS D;  3Q5R A;  2AXT H;  1NTK G;  3P8C D;  4IL6 E;  1T8Z A;  3AEG C;  1BE3 G;  5GTH E;  4A7P A;  1PP9 E;  2IZ0 A;  1AV1 A;  2IBZ I;  3MUD C;  1DD4 A;  2BAS A;  1LTT C;  1KIL E;  1SQB E;  5AVY B;  2WIT A;  2PGD A;  5AVT B;  1L0L K;  2WSC H;  3RL0 C;  4I2L C;  5DJU B;  3CXH H;  3AE9 C;  1T3U A;  1L0N D;  3Q2Y A;  3H1K J;  3A0H E;  2ZYA A;  2KLU A;  3VP8 A;  3OAK A;  2IBZ E;  2LKM A;  5BU8 B;  3LIE A;  1FZG A;  4IFD K;  1AVY A;  1IJD B;  2POH A;  2KLV A;  3CX5 I;  2WSS H;  1VQ5 P;  3L75 G;  1H0T B;  5APV A;  3HD7 D;  1GDT A;  1BCC E;  3AE4 C;  1NTK E;  1VQK P;  4WY4 A;  3L4F A;  1VF5 B;  1FU1 A;  4DOJ A;  1DEE G;  3R4Y A;  1X22 A;  3RK3 C;  1K9M Q;  3S4R A;  1NAY A;  1VQ4 P;  3GLM A;  1SQX K;  3QWO C;  4TT3 H;  3HE5 A;  4H44 B;  1KV4 A;  1G1I A;  1VQN P;  1JY3 O;  3C1L A;  3H1H D;  3WU2 H;  1URQ D;  1KB9 I;  4M3L A;  1OIP A;  1RF1 B;  3CX5 E;  4C7N A;  5CJ0 A;  5KJ7 C;  3CLQ A;  3V6I A;  3JC2 2;  1OX3 A;  4OVN F;  1QVF O;  3AE7 C;  1QL2 A;  2FXM A;  2W27 A;  5AVW B;  1FZC A;  1BDC A;  3H1L E;  4GDO A;  5AW7 B;  2R44 A;  1S1C X;  2V4H A;  2O1J A;  3SWK A;  3B5N C;  3H1J D;  3BAT A;  3M06 A;  2JEE A;  1JOC A;  1EZV G;  1JY2 N;  3HUS C;  1RF0 C;  2JDI H;  4JBZ A;  3AEE C;  2IFN A;  1OFC X;  2M3B A;  2NPS A;  2WTY A;  2RN0 A;  3JCU E;  1OMI A;  1PGO A;  1QLE D;  3GW6 A;  3RL0 B;  2J5U A;  3EQ2 A;  5AW6 B;  2BEZ F;  3KZI E;  3G3Z A;  3TK1 A;  1EZV I;  3L71 E;  1WT6 A;  2M5A A;  2ZXX A;  2ZXE B;  4U3F J;  1AQ5 A;  2RH0 A;  3VMZ A;  3H1I E;  1JTH A;  3IN6 A;  1K73 Q;  2JWD A;  1IK9 A;  3NTN A;  1YJ9 P;  3V2R A;  5AW3 B;  1JEK A;  1NTM E;  1RE3 A;  1EZV E;  3BVH A;  3AEA C;  1MKM A;  2E5Y A;  4R4M A;  2KSE A;  3RK3 B;  2W6B A;  3GHG A;  1GL2 A;  3USS A;  2YNY A;  2AXT E;  1EXJ A;  1D7M A;  1H89 A;  3A7O A;  1SQQ K;  2P10 A;  4HB1 A;  1NAF A;  2HLO A;  5KKZ C;  3M0D A;  2FBW C;  3L74 G;  1JM0 A;  3U1A A;  1SQX D;  3I55 P;  1PGQ A;  4U7J A;  2FYU G;  3FX0 A;  2J59 M;  1E5W A;  2Y0D A;  1X8Y A;  2XNX A;  2KNC B;  4DCK A;  1NHL A;  1NKN A;  3M9H A;  5KLV K;  3B5N B;  1DD3 A;  1QVG O;  4YXW H;  5KLV J;  1IFP A;  4Y99 C;  5B66 E;  1NTZ K;  1Q81 Q;  4D6T D;  2ITA A;  1NTZ J;  3HUS B;  2IFM A;  4L76 A;  3AE3 C;  1LTJ A;  1G2C B;  1SQV J;  5AVZ B;  1KC8 Q;  3CC4 P;  3H1K E;  2YXQ B;  2GUS A;  4EDF A;  1NVO A;  1FZC C;  3CCV P;  1KYO H;  4K35 A;  3LID A;  3CCS P;  2L5G B;  5KAF E;  3L35 A;  3AEF C;  1H8A A;  2G8Y A;  1IFN A;  1PGJ A;  3WU2 E;  4DT0 A;  2FXO A;  3L72 D;  2ZYG A;  5CJ4 A;  1NOH A;  3N7N A;  2O1K A;  2JP3 A;  1PIX A;  2OQQ A;  1SQP D;  4IOI H;  2B88 A;  2A06 D;  5APT A;  2KZJ A;  5AVQ B;  2KK7 A;  3BCC J;  1FE6 A;  1BGY G;  2GM4 A;  2IZ1 A;  2D2C C;  4NPD A;  5KAI H;  3CCQ P;  2JWA A;  5C39 A;  3P32 A;  1LGH B;  2G3A A;  2M0B A;  3ITK A;  1OW8 A;  4MN4 C;  2OGU A;  2GA1 A;  2B9B A;  5KKZ B;  1P84 H;  2L91 A;  1NU1 G;  3JSV C;  2B87 A;  4H13 C;  2HG5 D;  1SQQ D;  3CCU P;  4K3A A;  1L0N K;  3HTK B;  3OW2 O;  1Q82 Q;  1JY3 N;  1L0N J;  3AE2 C;  2UWJ E;  3PP5 A;  1ZV8 A;  2OYO A;  1LP1 A;  1YYC A;  4ZKP A;  3F89 A;  1ZOY C;  2BCC D;  5AVU B;  4EYY Q;  1GL2 C;  1N7S C;  1J2J B;  3PHL A;  4RJT A;  3HE5 B;  1JCD A;  4GOD A;  3M0D C;  4Y99 B;  2I8D A;  1USE A;  1M7L A;  5BVZ A;  5CCG A;  5E79 H;  1BGY E;  2ZT9 C;  1KIL D;  4C7N B;  4PD4 D;  3FGA D;  1SVF A;  3WUV A;  1AFO A;  3D70 A;  4PJ0 H;  4UB8 H;  1PP9 G;  1FZC B;  2Q3I A;  2JO1 A;  1EDI A;  2E75 C;  4U3F E;  1IFM A;  4GIF A;  1OVR A;  2WT7 A;  3CWB D;  3TNU A;  3H1H J;  1S9K D;  3B8E B;  2IBZ D;  3L73 D;  2C0W A;  2OYI C;  1N8R Q;  2M3E A;  2R3C A;  1A02 F;  3PJS K;  3L70 D;  5AVS B;  1SLQ A;  1JMB A;  4O9B A;  5CCH D;  1NYH A;  1USD A;  2HOD A;  1NTK D;  1BE3 D;  4XFJ A;  3RBZ A;  4N78 D;  3H25 A;  2N1T D;  2O01 N;  2Q1K A;  2D2C B;  3H1J J;  1KYO I;  2YXR B;  2FYN C;  3UIA A;  3L37 A;  1BCC G;  2Q6Q A;  1IFD A;  2KB7 P;  3G71 P;  2KI7 B;  1LT9 C;  3CX5 D;  1GW3 A;  1SFC A;  3NXS A;  1NWQ A;  4H13 B;  1GU5 A;  4NPE A;  2E74 D;  4OGQ C;  3E1I A;  3VMA A;  1BSN A;  1TU3 F;  1L0L J;  2CPS A;  1YIT P;  2QG4 A;  1KYO E;  2ZVN B;  3BCC G;  3VMY A;  4CPG A;  1X9V A;  1GL2 B;  1ZR2 A;  4OWF A;  3L75 D;  1N7S B;  1KB9 D;  1VQ8 P;  3O6Q A;  1SQV E;  3MIW A;  3C8V A;  1QEX A;  1ZRT E;  3H1L G;  2LXC B;  1N73 A;  3CMA P;  1LNQ A;  5CMZ A;  2ZT9 B;  1VPC A;  1FZE A;  2K9J A;  4PV1 C;  3VTP C;  3MGN A;  3CC2 P;  3RBX A;  2OTL P;  2QJP C;  3SSU A;  2OTJ P;  3R2P A;  3GG2 A;  3EWK A;  1JNM A;  5KAI E;  2YMK A;  1KQF B;  1OXZ A;  4EIJ A;  2E75 B;  1YI2 P;  3RGU A;  2W8Z A;  4H0L C;  2IX7 C;  2RMZ A;  1GK6 A;  1GW4 A;  2JR8 A;  3Q5S A;  1FJP A;  1PGP A;  1SQX J;  2OYI B;  3H32 B;  2R5D A;  5EFW B;  5CCG C;  3MTU E;  2OYH C;  1EXI A;  1BSH A;  2OAR A;  3L71 G;  1KFN A;  1LTG C;  3M91 A;  2GUV A;  2IPP A;  1YJW P;  3CCE P;  3BCC E;  3FXE A;  3II6 A;  1GZL A;  1ZXG A;  3FWN A;  3A2A A;  1XTC C;  3S9O A;  1FC2 C;  1AJY A;  3WUT A;  3P8M C;  3CD6 P;  1AA0 A;  3H1I G;  1HGV A;  1VF5 D;  2FFD B;  1RH5 B;  5GTI H;  2E75 D;  2R32 A;  1ZW0 A;  1T6A A;  5K5G B;  3HE4 B;  1L4A C;  4D6T J;  2FYN B;  2RKL A;  4HH2 A;  1BDD A;  2VRS A;  5APS A;  4AUW A;  4H44 D;  4KJM A;  1NO4 A;  1MFZ A;  1NTM G;  3H1H G;  1GD2 E;  2E76 C;  2HPC B;  2N1T A;  1LT9 B;  5E79 E;  3CPW O;  4I1L A;  3D6Z A;  1PV3 A;  5H2F H;  3M9Q A;  1YQ3 C;  2JJL A;  3T97 B;  1JY2 P;  4Y28 J;  3I56 P;  1LWU A;  1OWA A;  3V2Q A;  4PJ0 E;  4OGQ B;  2XDJ A;  3KXD A;  2W6J H;  4W80 A;  4YPC A;  4BRY A;  2ZAE B;  2QVA A;  1JO5 A;  5M1B A;  3H6P A;  1CI6 A;  1CSB A;  4QMA A;  4RES B;  1S4X A;  1JMM A;  3AE1 C;  3CCM P;  4IFM A;  1FZA A;  3AE5 C;  3L72 J;  1N2D C; 
#chains in the Genus database with same CATH homology
 2BCC G;  4U3F G;  3L74 G;  3CWB G;  1NTZ G;  1SQQ G;  1NTM G;  3H1H G;  1KYO H;  1EZV G;  3H1I G;  1SQX G;  2IBZ G;  1SQV G;  4PD4 H;  3L73 G;  1BCC G;  1NTK G;  3TGU G;  1SQP G;  1BE3 G;  1KB9 H;  1L0L G;  3L71 G;  1PP9 G;  2FYU G;  3H1L G;  3CXH H;  2A06 G;  1L0N G;  1PPJ G;  3BCC G;  3L70 G;  3H1K G;  1P84 H;  5KLV G;  1BGY G;  4D6T G;  1SQB G;  3CX5 H;  3H1J G;  3L72 G;  3L75 G;  1NU1 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...