4PD4H

Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
93
structure length
93
Chain Sequence
GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/inhibitor
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
total genus 17
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 4pd4H00
1BCCG 1L0NG 2BCCG 2IBZG 4PD4H 3L71G 3CWBG 1SQPG 2A06G 1P84H 1BE3G 1NTZG 1SQQG 3L70G 1NTMG 1SQXG 1PPJG 1EZVG 3CXHH 3L75G 3L72G 5KLVG 1KB9H 1NTKG 3H1IG 3H1JG 3L73G 1PP9G 1SQVG 1SQBG 3H1LG 4D6TG 4U3FG 3H1KG 1NU1G 3L74G 2FYUG 3BCCG 1BGYG 3H1HG 1L0LG 3CX5H 3TGUG 1KYOH
chains in the Genus database with same CATH superfamily
4HJGH 5CHXA 3F89A 1KILA 3FWNA 3NTNA 1KD1Q 4XA4A 1EZVI 1S9KD 1R5SA 2E75C 3EFGA 3AE7C 3P8CD 1OW8A 3RK3B 1BDDA 2WZ7A 1RF0A 2I8DA 3E1RA 1KB9E 1SQQE 3M0DA 4N3YB 3V2QA 3II6A 1NO4A 1KFMA 2JKVA 3AEAC 1NU1D 5AVSB 3BASA 1VQMP 1PL5A 3RK3D 3S9OA 4GKGA 2E5YA 3HUSA 1FZAA 1LWUB 3L70E 3VOPA 3VTPC 4D6TJ 2GA1A 1LT9A 2B87A 2KSJA 2CPSA 2H89C 3R4YA 5APVA 2OARA 1YIJP 1T2KC 1NTKJ 1S3JA 2IZ1A 4JYCA 3L36A 1Q82Q 2CPBA 1L4AD 3H1KG 5H2FE 1S1CX 2PAJA 2BCCE 1QLED 1X9VA 2K88A 2HYNA 3P32A 4WY4D 4DOJA 1OXZA 2WT7A 2E43A 2K9YA 1ZMEC 3IR9A 1LTBC 5KKZC 1RY3A 2RH0A 2ZT9D 3VMXA 1OVRA 1GK6A 1SQQD 1WMKA 1YQ4C 4W7YA 1FZEA 1T6AA 5DJUB 2HLOA 5APTA 1YHQP 1NU1E 5KTBA 2P1JA 1URQB 2I1KA 3CWBG 3CWBD 1IC2A 1NAFA 2NPSB 5APUA 2K9JB 2FXOA 5CCGA 3Q2YA 4IFDK 4PV1B 2Q6QA 1BDCA 1BGYD 4AQRD 3BCCD 1FJKA 1VPCA 4PD4I 3H1IE 5AVXB 1PPJG 2R3SA 1FZCB 1N7SB 5GTHE 3L72J 5AW8B 3H1KD 1DEBA 1GZLA 1JTHB 2P58A 4WY4C 2WSSH 4JPZB 1FDOA 2RN0A 3KXDA 1SQVD 1K04A 1X0TA 1FBMA 3P7KA 3USSA 1GW3A 3O6QA 3LIDA 1EXIA 2W83C 1KZUB 3A0HH 4XE5B 3V2RA 2H43A 2WSFH 2QJKC 4OGQB 2QSIA 1ZP0C 5M1BA 1GL2B 1M57D 3BCCG 1J1DC 4RO0A 1BCCJ 1BGYG 2M0BA 4M3LA 1LT9C 5AW0B 1VQPP 1OIPA 1L0NG 2FYZA 3HUSC 3OAKA 4H44B 3RK2D 2POHA 3VMAA 4LLHA 4WVZA 1Z56A 1JY3P 2YMKA 3CL3D 2ZFCA 1VQ5P 3C1LA 3CC4P 1GU4A 1T3JA 1L0NK 3A0BE 4N6JA 3HE5A 1N73C 3CX5D 3TGUD 2GM4A 4KJMA 5BVZA 1NTMG 2QJKB 2J5UA 2YKPA 3L71E 4UB8E 5C39A 1VQOP 1AFOA 4RKUJ 1D7MA 1OWAA 2L5GB 1QEXA 1OMIA 1RH5B 1LTGC 1YITP 2OYHA 4HKZH 2WQYC 4HB1A 3O8ZA 4NPFX 3KQGA 3SFEC 1FDIA 1SQBG 4A7PA 3G4SP 3L74J 2WPSA 1EQ7A 3L4FA 2ZYAA 4U3FJ 3M9QA 1K9MQ 4KT0J 3D71A 2E42A 3EWKA 3RL0D 1NHLA 1RE4C 2HODA 1L0LG 2Q3IA 1IK7A 1YBKA 2N1TC 5APWA 1QGKB 1RQVA 3CCRP 3CX5E 3TGUE 4H13B 5AVQB 5AVTB 1NKNA 1AQTA 3L71D 1EXJA 4ASVA 1LJ2A 3NMDA 2E75B 3AE4C 3CWBJ 1QL2A 2KP8A 3B5NC 3GW6A 3CLQA 2GUSA 5KLIC 1N73A 3HTKB 1KQGB 3CX5I 4YXWH 3MP7B 2KS1A 1EZVG 4K35A 2RKLA 3PH0A 1MV8A 2Q7CA 4Z1MH 2YO3A 2JO1A 3RBXA 2OYHB 3SWKA 1L0NE 2YIUC 1NTKG 1NTKD 2AXTE 2NZ2A 2FFDC 1VDFA 1ZV8A 2OTLP 2QA4P 1SQBK 1CW5A 4D6TG 1Y9BA 5AW5B 1U57A 1PGOA 1NTZJ 2Y9YA 3D6ZA 4GOEA 4L76A 1KTMA 1S5LE 1L0LJ 2FY8A 3PTZA 2FYUG 4L73A 1HUCA 4L74A 2BEZF 3MZWB 3VP8A 1L2PA 5KLVJ 1W2EA 4GT1A 4Y99C 2OYHC 5AW2B 4YXDC 3AE9C 2R3CA 3JC22 1DIPA 4OGQD 4ASWA 2LKMA 3CCQP 3T97B 1BSHA 3I5CA 1NTME 3L71G 2XZRA 1RF1B 1P84E 5CJ0A 1SP4A 2YIUB 1FZCA 2ZAEB 1DD4A 3PP5A 4KHXA 1QL1A 1SQPE 1FZFA 1NTMJ 1YYCA 1LTTC 1WT6A 3A7OA 3OW2O 1SS1A 1A02J 1JY2N 1RQUA 3IAOA 1KB9H 3CPWO 1KQSO 2YKQA 2KZJA 1PP9G 2E75D 2YMYA 2JP3A 4I1LA 3B5NA 3CCUP 3CXHI 1JTHA 5GTIH 1GK4A 1TU3F 1LWUC 1NTMD 2B89A 1VQLP 4HH2A 3SWYA 5CMZA 5CBNA 3H25A 2I1JA 3CX5H 3MGNA 4WWIA 1HJ0A 1BGYE 2WPQA 5AW9B 1IFNA 3V6IA 4YTPC 3F5HA 3PRJA 2XDJA 1BE3D 3MTUE 4LC1A 5APYA 3RL0g 2C9NY 3CD6P 1N2DC 3FXEA 1KN7A 1EDJA 1S9KE 1HWTC 1RHZB 2ZVOB 4IFMA 5AVVB 4AUWA 2IFMA 2YKOA 1LTJB 1SFCB 2C0WA 2W6AA 1NJIQ 2NPSC 1X8YA 1KQFB 3H1LD 1LTSC 1SQPK 3A3YB 3V2NA 1SQQK 2G3AA 3KHUA 4R4MA 2WPRA 1K73Q 3CC7P 1MFTA 3V5BA 3H1JG 5KAIH 1ZXGA 3CMAP 1MKMA 5KAFH 1LNQA 3M06A 1NTMK 3AE6C 1LWUA 3IF4A 3S1KA 3C9IA 1PPJD 3L75D 4WY4B 5KLIB 2PFXA 3L74G 4ZNCA 3Q3DA 1VF5C 5AVYB 4NPDA 1OFCX 3FGAD 3V4QA 1T8ZA 1SQVE 2KSEA 1MZ9A 3H1HG 4RJTA 4LGDE 1KQLA 5APQA 2JWAA 2IYPA 3CCJP 1EC5A 1ZOYC 3C8VA 3EQ2A 1P84I 1A02F 1FE6A 1W5CE 3CI9A 1Q86Q 1H0TA 2H88C 5CCGD 1ZR2A 2AEJA 3VYIA 4N78D 2IBZD 2R32A 2KK7A 5BU5A 3B8EB 1ZR4A 1H89A 1M1JC 3CXHD 3H6PA 3L73J 2PGDA 2K1AA 1UIIA 2XNXA 3JCUE 4H44C 2XNDH 3L70G 2RMZA 1R5LA 1NTZK 3WUTA 3VMZA 1NGMB 3M9HA 4I2LC 1DD3A 2N1TD 2O01H 2N1TA 3BVHA 3S4RA 1AJYA 3L75E 1VF5B 2MKVA 2QRXA 4OH8B 5E79E 2FBWC 3WU2E 1BCCE 5KLVG 3TNUB 2O01N 2AEFA 2BEQD 2KLUA 3L73G 3MUDA 1IFJA 2KXPB 1JO5A 2D2CB 2QIWA 1VF5D 1NU1G 2WSFJ 1SQXD 2NRGA 3AEBC 1BSNA 1KB9I 1M1JB 1ZRTE 2E76D 3AECC 3HE4B 4Y99B 3CMEP 3M0AA 2Q1KA 4C46A 2A45G 2XKMA 4H0LB 4DJGA 4PJ0H 1SLQA 4DCKA 4JYBA 1MFZA 1SQVJ 2QJPC 1CZQA 1USEA 3HD7B 4CPGA 2LR2A 2A06G 2YNYA 1RF1C 1P84H 2SPZA 3AEFC 2N1TB 2ZVNB 1YQ3C 1BCCD 2A45I 3I56P 4HYTB 3FWLA 3CCSP 4BRYB 1VL2A 3HTKA 4K3AA 3M9BA 1LP1A 2IDBA 3B5NB 3TDKA 4ZMDA 1W2BO 1GW4A 1FDMA 5KLVK 2YO2A 5H2FH 5AW6B 2AXCA 3TK1A 1PFIA 4W80A 2BCCJ 1X22A 1OW7A 1SQXK 4JF7A 1KYOD 1Q2NA 2OYIB 1M56D 2O1JA 3G9RA 2LXBA 3E1IA 5APXA 2B9BA 2ZT9C 2ZYGA 3SWFA 3V4WA 1Y8AA 2KB7P 2XU6A 3ZDMA 1FZBA 1UIXA 2HR3A 1JY2P 2FYUE 1PV3A 1L4AC 2DW3A 2E74C 4IL6E 3W68A 2IBZG 3GHGB 2NPSA 5AW1B 5CCHD 2OYOA 4IFFA 1GDTA 1LTAC 1URQA 2QJYC 3L73E 1VQ9P 2KZIA 2V4HA 3MD0A 2VRSA 2Z5IA 1LTJA 2W90A 3H1HD 2KYVA 2OTKE 4BWNA 3EFFK 1AVYA 2FFDA 3L75G 4L75A 4UB6H 3Q1MA 1AVOA 1P84D 1ZN5A 3BRTB 4NPEA 3TNUA 2K37A 3D70A 1ZW0A 3BCCE 4PV1D 2WVRA 2B87B 2JEEA 3H1ID 3W67A 5KJ7C 2E74B 5B66H 4U3FG 3L74E 2V7QH 4H44D 3H1HJ 4GOFA 1OX3A 1FAVA 1GL2A 1M1JA 2ZYDA 3N7NA 2M8RA 2QE7H 4PJ0E 3RBZA 1DH3A 4Y28J 1T2KD 2YXRB 3A5TA 2QM8A 1HBWA 3Q5SA 2C0XA 1CI6B 1HTLC 2KNCB 2O1KA 2M5AA 3A0BH 3JSVC 4GODA 3H1KJ 3AE5C 2LXCB 1N7SD 4PD4D 1URQC 1EDKA 2M3EA 4AYCA 1G2CA 3HRNA 5AW7B 1FZCC 1HF9A 4ZKUA 1NOHA 1YJNP 1Y47A 2JR8A 1JNMA 2E5TA 1OW6A 2KUBA 2Q3EA 1OVVA 1JMBA 3L72G 1JY3O 1FS0E 3OJAB 2MJZA 4I6MC 4U3FD 3WU2H 1KV4A 3GMAA 1JY2O 3H1IG 4OGQC 2Y9ZA 2NPSD 3I55P 1HJBA 1CI6A 4PV1C 2HPCB 3RL0C 2M3BA 2WMMA 2WWWA 3PJSK 3RK2B 5B5EE 2K3RA 3L37A 1FZGA 4PD4E 4N78E 2H8PD 1QVGO 1NKZB 1HH0A 5CJ4A 1VQNP 1HGVA 3TGUJ 1GL2C 2HG5D 3L72E 1K8AQ 1PIXA 2J59M 2QJPB 2BCCG 3GF3A 1MUUA 3QH9A 3H1IJ 1SQPJ 2B88A 1SQPG 3HD7D 1EZVE 1IFPA 2V7QJ 1LGHB 1KYOI 1KILE 3HD7A 4OWFA 1JOCA 4H13D 1NTZG 3M91A 5BU8B 2G8YA 2KOGA 1DX7A 1OVUA 3ITKA 1HGZA 1SQXJ 3GF7A 2C9LY 1NU1J 1NYHA 3MIWA 4UB6E 1JY3N 3RL0B 4C7NA 2JDIH 4OVNF 5AVZB 1YI2P 3MHVA 1Q90D 3LW5H 1NTKK 3BATA 1S5LH 2W27A 4BXLA 1L0LE 1E5WA 4EI2A 1N7SA 3AE8C 1Q81Q 2HODB 1LT1A 1JB0J 2FYUK 1EZVD 1J2JB 3N4XA 1PGPA 1L0NJ 1SQBE 1FU1A 2GUVA 2Y0CA 3TSIA 1EDLA 2E74D 2KLVA 1BCCG 1BGYJ 1X79B 5KLVE 1L4AB 2OYIA 2KNCA 2YXQB 2A06D 4H13C 3RGUA 1L0LK 1Q7YQ 1FOSE 4C7NB 4JBZA 3VP9A 3D6YA 2ZJSE 2JJLA 3U59A 3WUUA 2W6JH 5AW3B 1YJWP 1GU5A 1GD2E 3G6EP 1L0LD 3HE5B 2PP6A 1GL2D 2IBZI 2UWJE 1M8OB 1U7MA 2IPPA 3BRVB 2Y0DA 4I7ZC 5CCHA 3U1AA 2FXPA 2CK3H 2J58A 4UB8H 2Z5HA 1KORA 3G3ZA 3PHLA 3LW5J 3GG2A 1SQBD 1KMIZ 3AE1C 3AEEC 3IFMA 4QMAA 2ZXXA 5GTIE 1VQ7P 5KLVD 5B66E 5B5EH 3SFDC 1LTIC 2L91A 3H32B 2XV5A 2FFDB 3Q5RA 1IZNB 3IN6A 3P8MC 1FC2C 1KC8Q 2WTYA 1AV1A 1JEKA 2O01J 2N9BA 1YJ9P 2IZ0A 3CCLP 2IFNA 4TLFA 2R44A 2BASA 2HFED 2Q5UA 4DT0A 1DEEG 3H32A 1NH4A 4WB4A 1KYOE 5TISE 2OGUA 4EYYQ 1URQD 3B4SA 1S4XA 4GDOA 1JM0A 3RK3E 1NWQA 1H8AA 4IOIH 1NTZE 1L0ND 5AVUB 1YTZI 1VQKP 2W8ZA 1G1IA 4IL6H 1M7LA 1SFCD 2AEMA 1SQXG 1VQ6P 3NFQA 3FXDA 2O3JA 2QJYB 3L74D 3KZIH 4EDFA 5L8RJ 3P8CE 5CCHC 1N7LA 3L73D 1AQ5A 2WT7B 2FYNB 1XTCC 3KDPB 2QG4A 3UIAA 2W6BA 3H1JD 1SQVG 3H1HE 3OA7A 2P2UA 5KJ7D 5KKZB 1H88A 1L4AA 1U7JA 3E7KA 1IFDA 2H7HA 3B71A 3CWBE 2ZXEB 3L70D 4WY4A 2QVAA 4DZOA 2A45H 1PP9E 1NTZD 1SQVK 1YTZT 2P7JA 2OTJP 4MN4C 1S2EA 1SQPD 2WSCJ 1PP9J 3PLNA 1J1EB 1IK9A 1PPJE 1USDA 2Y0EA 4B86A 2BCCD 3JCUH 2M5AB 5EFWB 4JQ0D 1N7SC 2WITA 4U3FE 1BE3G 1LTJC 1NAYA 1SQQG 1SFCC 1FJPA 1GTWA 3H1LJ 1NVOA 4TT3H 3H1JE 5E79H 3FX0A 1OZHA 4RESB 2FYUJ 4XFJA 4EIJA 2D2CD 3O6QB 4ZKPA 1E79H 3CXHE 2ITAA 1GMJA 3L71J 1PP9D 3NXSA 5KJ7A 5K5GB 1ZLLA 4EOTA 1PGQA 4W7ZA 1LT9B 2JWDA 3H1LG 3L72D 1J1EC 1BE3E 5AVRB 2Z4EA 1BE3J 1RE4A 3HUSB 4H0LD 1PZQA 3VN0A 4O9BA 1IFIA 1G2CB 3H1KE 4IL6X 2E76B 1G1JA 3AE2C 1VQ8P 3L35A 4D6TE 3WUVA 1T3UA 3KYQA 3L70J 2K9JA 1KYOH 5TISH 2IX7C 1S5LX 3RK2C 1M1KQ 3AEGC 2HPCA 1N73B 4PD4H 3ABVC 1SQXE 3H1JJ 1K05A 3MUDC 3TF5A 3H1LE 1EDIA 3LIEA 1JCCA 1LP1B 1RE3A 3CCMP 2OQQA 4BRYA 1JUNA 3KPEA 4I7ZB 2WSCH 1PGJA 5AVWB 5GTHH 1RF1A 1IFMA 2E76C 3U1CA 1NU1K 1KILD 3G71P 5AW4B 2Q9IA 2R5DA 3T97A 2D2CC 3AEDC 1QX8A 4WBAA 4GIFA 4D6TD 1QVFO 5DJTB 3CC2P 3A0HE 5CCGC 4YPCA 3HE4A 1RF0C 1SFCA 2P67A 2WSEJ 5KAIE 3M0DC 2KI7B 3CCEP 3K5BA 2IBZE 4H0LC 5KAFE 1J1DB 2QEXP 5APSA 5TJHA 2FXMA 3L75J 3TYYA 1SQBJ 1N86A 3GHGA 4C7RA 1KILC 2FKWB 3B5ND 2R5BA 3SSUA 1SVFA 3HD7C 1WRGA 2KIKA 1NTKE 5CBOA 3QWOC 2KS1B 3CCVP 2AXTH 2FYUD 1VQ4P 1RE3C 2IYOA 2A06E 3WMM0 3KZIE 3CXHH 1XTGB 1JMMA 2N9YB 2FYNC 1ZRTD 3AE3C 2PRRA 2WPVB 3RK3C 3VMYA 1H0TB 1KB9D 1SQQJ 4R4LA 4U7JA 3V2PA 2QM7A 1R8EA 1KILB 2ZT9B 3A2AA 1HVVA 3R2PA 1M90Q 1AA0A 3Q5PA 1JCDA 1KFNA 2WSEH 3BCCJ 3GLMA 1S72P 2OYIC 1CSBA 1N8RQ 1IO4A 1IJDB 3TGUG 1FOSF 3GHGC 2P10A
chains in the Genus database with same CATH topology
1BCCG 1L0NG 2BCCG 2IBZG 4PD4H 3L71G 3CWBG 1SQPG 2A06G 1P84H 1BE3G 1NTZG 1SQQG 3L70G 1NTMG 1SQXG 1PPJG 1EZVG 3CXHH 3L75G 3L72G 5KLVG 1KB9H 1NTKG 3H1IG 3H1JG 3L73G 1PP9G 1SQVG 1SQBG 3H1LG 4D6TG 4U3FG 3H1KG 1NU1G 3L74G 2FYUG 3BCCG 1BGYG 3H1HG 1L0LG 3CX5H 3TGUG 1KYOH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BCC G;  1L0N G;  2BCC G;  2IBZ G;  4PD4 H;  3L71 G;  3CWB G;  1SQP G;  2A06 G;  1P84 H;  1BE3 G;  1NTZ G;  1SQQ G;  3L70 G;  1NTM G;  1SQX G;  1PPJ G;  1EZV G;  3CXH H;  3L75 G;  3L72 G;  5KLV G;  1KB9 H;  1NTK G;  3H1I G;  3H1J G;  3L73 G;  1PP9 G;  1SQV G;  1SQB G;  3H1L G;  4D6T G;  4U3F G;  3H1K G;  1NU1 G;  3L74 G;  2FYU G;  3BCC G;  1BGY G;  3H1H G;  1L0L G;  3CX5 H;  3TGU G;  1KYO H; 
#chains in the Genus database with same CATH topology
 4HJG H;  5CHX A;  3F89 A;  1KIL A;  3FWN A;  3NTN A;  1KD1 Q;  4XA4 A;  1EZV I;  1S9K D;  1R5S A;  2E75 C;  3EFG A;  3AE7 C;  3P8C D;  1OW8 A;  3RK3 B;  1BDD A;  2WZ7 A;  1RF0 A;  2I8D A;  3E1R A;  1KB9 E;  1SQQ E;  3M0D A;  4N3Y B;  3V2Q A;  3II6 A;  1NO4 A;  1KFM A;  2JKV A;  3AEA C;  1NU1 D;  5AVS B;  3BAS A;  1VQM P;  1PL5 A;  3RK3 D;  3S9O A;  4GKG A;  2E5Y A;  3HUS A;  1FZA A;  1LWU B;  3L70 E;  3VOP A;  3VTP C;  4D6T J;  2GA1 A;  1LT9 A;  2B87 A;  2KSJ A;  2CPS A;  2H89 C;  3R4Y A;  5APV A;  2OAR A;  1YIJ P;  1T2K C;  1NTK J;  1S3J A;  2IZ1 A;  4JYC A;  3L36 A;  1Q82 Q;  2CPB A;  1L4A D;  3H1K G;  5H2F E;  1S1C X;  2PAJ A;  2BCC E;  1QLE D;  1X9V A;  2K88 A;  2HYN A;  3P32 A;  4WY4 D;  4DOJ A;  1OXZ A;  2WT7 A;  2E43 A;  2K9Y A;  1ZME C;  3IR9 A;  1LTB C;  5KKZ C;  1RY3 A;  2RH0 A;  2ZT9 D;  3VMX A;  1OVR A;  1GK6 A;  1SQQ D;  1WMK A;  1YQ4 C;  4W7Y A;  1FZE A;  1T6A A;  5DJU B;  2HLO A;  5APT A;  1YHQ P;  1NU1 E;  5KTB A;  2P1J A;  1URQ B;  2I1K A;  3CWB G;  3CWB D;  1IC2 A;  1NAF A;  2NPS B;  5APU A;  2K9J B;  2FXO A;  5CCG A;  3Q2Y A;  4IFD K;  4PV1 B;  2Q6Q A;  1BDC A;  1BGY D;  4AQR D;  3BCC D;  1FJK A;  1VPC A;  4PD4 I;  3H1I E;  5AVX B;  1PPJ G;  2R3S A;  1FZC B;  1N7S B;  5GTH E;  3L72 J;  5AW8 B;  3H1K D;  1DEB A;  1GZL A;  1JTH B;  2P58 A;  4WY4 C;  2WSS H;  4JPZ B;  1FDO A;  2RN0 A;  3KXD A;  1SQV D;  1K04 A;  1X0T A;  1FBM A;  3P7K A;  3USS A;  1GW3 A;  3O6Q A;  3LID A;  1EXI A;  2W83 C;  1KZU B;  3A0H H;  4XE5 B;  3V2R A;  2H43 A;  2WSF H;  2QJK C;  4OGQ B;  2QSI A;  1ZP0 C;  5M1B A;  1GL2 B;  1M57 D;  3BCC G;  1J1D C;  4RO0 A;  1BCC J;  1BGY G;  2M0B A;  4M3L A;  1LT9 C;  5AW0 B;  1VQP P;  1OIP A;  1L0N G;  2FYZ A;  3HUS C;  3OAK A;  4H44 B;  3RK2 D;  2POH A;  3VMA A;  4LLH A;  4WVZ A;  1Z56 A;  1JY3 P;  2YMK A;  3CL3 D;  2ZFC A;  1VQ5 P;  3C1L A;  3CC4 P;  1GU4 A;  1T3J A;  1L0N K;  3A0B E;  4N6J A;  3HE5 A;  1N73 C;  3CX5 D;  3TGU D;  2GM4 A;  4KJM A;  5BVZ A;  1NTM G;  2QJK B;  2J5U A;  2YKP A;  3L71 E;  4UB8 E;  5C39 A;  1VQO P;  1AFO A;  4RKU J;  1D7M A;  1OWA A;  2L5G B;  1QEX A;  1OMI A;  1RH5 B;  1LTG C;  1YIT P;  2OYH A;  4HKZ H;  2WQY C;  4HB1 A;  3O8Z A;  4NPF X;  3KQG A;  3SFE C;  1FDI A;  1SQB G;  4A7P A;  3G4S P;  3L74 J;  2WPS A;  1EQ7 A;  3L4F A;  2ZYA A;  4U3F J;  3M9Q A;  1K9M Q;  4KT0 J;  3D71 A;  2E42 A;  3EWK A;  3RL0 D;  1NHL A;  1RE4 C;  2HOD A;  1L0L G;  2Q3I A;  1IK7 A;  1YBK A;  2N1T C;  5APW A;  1QGK B;  1RQV A;  3CCR P;  3CX5 E;  3TGU E;  4H13 B;  5AVQ B;  5AVT B;  1NKN A;  1AQT A;  3L71 D;  1EXJ A;  4ASV A;  1LJ2 A;  3NMD A;  2E75 B;  3AE4 C;  3CWB J;  1QL2 A;  2KP8 A;  3B5N C;  3GW6 A;  3CLQ A;  2GUS A;  5KLI C;  1N73 A;  3HTK B;  1KQG B;  3CX5 I;  4YXW H;  3MP7 B;  2KS1 A;  1EZV G;  4K35 A;  2RKL A;  3PH0 A;  1MV8 A;  2Q7C A;  4Z1M H;  2YO3 A;  2JO1 A;  3RBX A;  2OYH B;  3SWK A;  1L0N E;  2YIU C;  1NTK G;  1NTK D;  2AXT E;  2NZ2 A;  2FFD C;  1VDF A;  1ZV8 A;  2OTL P;  2QA4 P;  1SQB K;  1CW5 A;  4D6T G;  1Y9B A;  5AW5 B;  1U57 A;  1PGO A;  1NTZ J;  2Y9Y A;  3D6Z A;  4GOE A;  4L76 A;  1KTM A;  1S5L E;  1L0L J;  2FY8 A;  3PTZ A;  2FYU G;  4L73 A;  1HUC A;  4L74 A;  2BEZ F;  3MZW B;  3VP8 A;  1L2P A;  5KLV J;  1W2E A;  4GT1 A;  4Y99 C;  2OYH C;  5AW2 B;  4YXD C;  3AE9 C;  2R3C A;  3JC2 2;  1DIP A;  4OGQ D;  4ASW A;  2LKM A;  3CCQ P;  3T97 B;  1BSH A;  3I5C A;  1NTM E;  3L71 G;  2XZR A;  1RF1 B;  1P84 E;  5CJ0 A;  1SP4 A;  2YIU B;  1FZC A;  2ZAE B;  1DD4 A;  3PP5 A;  4KHX A;  1QL1 A;  1SQP E;  1FZF A;  1NTM J;  1YYC A;  1LTT C;  1WT6 A;  3A7O A;  3OW2 O;  1SS1 A;  1A02 J;  1JY2 N;  1RQU A;  3IAO A;  1KB9 H;  3CPW O;  1KQS O;  2YKQ A;  2KZJ A;  1PP9 G;  2E75 D;  2YMY A;  2JP3 A;  4I1L A;  3B5N A;  3CCU P;  3CXH I;  1JTH A;  5GTI H;  1GK4 A;  1TU3 F;  1LWU C;  1NTM D;  2B89 A;  1VQL P;  4HH2 A;  3SWY A;  5CMZ A;  5CBN A;  3H25 A;  2I1J A;  3CX5 H;  3MGN A;  4WWI A;  1HJ0 A;  1BGY E;  2WPQ A;  5AW9 B;  1IFN A;  3V6I A;  4YTP C;  3F5H A;  3PRJ A;  2XDJ A;  1BE3 D;  3MTU E;  4LC1 A;  5APY A;  3RL0 g;  2C9N Y;  3CD6 P;  1N2D C;  3FXE A;  1KN7 A;  1EDJ A;  1S9K E;  1HWT C;  1RHZ B;  2ZVO B;  4IFM A;  5AVV B;  4AUW A;  2IFM A;  2YKO A;  1LTJ B;  1SFC B;  2C0W A;  2W6A A;  1NJI Q;  2NPS C;  1X8Y A;  1KQF B;  3H1L D;  1LTS C;  1SQP K;  3A3Y B;  3V2N A;  1SQQ K;  2G3A A;  3KHU A;  4R4M A;  2WPR A;  1K73 Q;  3CC7 P;  1MFT A;  3V5B A;  3H1J G;  5KAI H;  1ZXG A;  3CMA P;  1MKM A;  5KAF H;  1LNQ A;  3M06 A;  1NTM K;  3AE6 C;  1LWU A;  3IF4 A;  3S1K A;  3C9I A;  1PPJ D;  3L75 D;  4WY4 B;  5KLI B;  2PFX A;  3L74 G;  4ZNC A;  3Q3D A;  1VF5 C;  5AVY B;  4NPD A;  1OFC X;  3FGA D;  3V4Q A;  1T8Z A;  1SQV E;  2KSE A;  1MZ9 A;  3H1H G;  4RJT A;  4LGD E;  1KQL A;  5APQ A;  2JWA A;  2IYP A;  3CCJ P;  1EC5 A;  1ZOY C;  3C8V A;  3EQ2 A;  1P84 I;  1A02 F;  1FE6 A;  1W5C E;  3CI9 A;  1Q86 Q;  1H0T A;  2H88 C;  5CCG D;  1ZR2 A;  2AEJ A;  3VYI A;  4N78 D;  2IBZ D;  2R32 A;  2KK7 A;  5BU5 A;  3B8E B;  1ZR4 A;  1H89 A;  1M1J C;  3CXH D;  3H6P A;  3L73 J;  2PGD A;  2K1A A;  1UII A;  2XNX A;  3JCU E;  4H44 C;  2XND H;  3L70 G;  2RMZ A;  1R5L A;  1NTZ K;  3WUT A;  3VMZ A;  1NGM B;  3M9H A;  4I2L C;  1DD3 A;  2N1T D;  2O01 H;  2N1T A;  3BVH A;  3S4R A;  1AJY A;  3L75 E;  1VF5 B;  2MKV A;  2QRX A;  4OH8 B;  5E79 E;  2FBW C;  3WU2 E;  1BCC E;  5KLV G;  3TNU B;  2O01 N;  2AEF A;  2BEQ D;  2KLU A;  3L73 G;  3MUD A;  1IFJ A;  2KXP B;  1JO5 A;  2D2C B;  2QIW A;  1VF5 D;  1NU1 G;  2WSF J;  1SQX D;  2NRG A;  3AEB C;  1BSN A;  1KB9 I;  1M1J B;  1ZRT E;  2E76 D;  3AEC C;  3HE4 B;  4Y99 B;  3CME P;  3M0A A;  2Q1K A;  4C46 A;  2A45 G;  2XKM A;  4H0L B;  4DJG A;  4PJ0 H;  1SLQ A;  4DCK A;  4JYB A;  1MFZ A;  1SQV J;  2QJP C;  1CZQ A;  1USE A;  3HD7 B;  4CPG A;  2LR2 A;  2A06 G;  2YNY A;  1RF1 C;  1P84 H;  2SPZ A;  3AEF C;  2N1T B;  2ZVN B;  1YQ3 C;  1BCC D;  2A45 I;  3I56 P;  4HYT B;  3FWL A;  3CCS P;  4BRY B;  1VL2 A;  3HTK A;  4K3A A;  3M9B A;  1LP1 A;  2IDB A;  3B5N B;  3TDK A;  4ZMD A;  1W2B O;  1GW4 A;  1FDM A;  5KLV K;  2YO2 A;  5H2F H;  5AW6 B;  2AXC A;  3TK1 A;  1PFI A;  4W80 A;  2BCC J;  1X22 A;  1OW7 A;  1SQX K;  4JF7 A;  1KYO D;  1Q2N A;  2OYI B;  1M56 D;  2O1J A;  3G9R A;  2LXB A;  3E1I A;  5APX A;  2B9B A;  2ZT9 C;  2ZYG A;  3SWF A;  3V4W A;  1Y8A A;  2KB7 P;  2XU6 A;  3ZDM A;  1FZB A;  1UIX A;  2HR3 A;  1JY2 P;  2FYU E;  1PV3 A;  1L4A C;  2DW3 A;  2E74 C;  4IL6 E;  3W68 A;  2IBZ G;  3GHG B;  2NPS A;  5AW1 B;  5CCH D;  2OYO A;  4IFF A;  1GDT A;  1LTA C;  1URQ A;  2QJY C;  3L73 E;  1VQ9 P;  2KZI A;  2V4H A;  3MD0 A;  2VRS A;  2Z5I A;  1LTJ A;  2W90 A;  3H1H D;  2KYV A;  2OTK E;  4BWN A;  3EFF K;  1AVY A;  2FFD A;  3L75 G;  4L75 A;  4UB6 H;  3Q1M A;  1AVO A;  1P84 D;  1ZN5 A;  3BRT B;  4NPE A;  3TNU A;  2K37 A;  3D70 A;  1ZW0 A;  3BCC E;  4PV1 D;  2WVR A;  2B87 B;  2JEE A;  3H1I D;  3W67 A;  5KJ7 C;  2E74 B;  5B66 H;  4U3F G;  3L74 E;  2V7Q H;  4H44 D;  3H1H J;  4GOF A;  1OX3 A;  1FAV A;  1GL2 A;  1M1J A;  2ZYD A;  3N7N A;  2M8R A;  2QE7 H;  4PJ0 E;  3RBZ A;  1DH3 A;  4Y28 J;  1T2K D;  2YXR B;  3A5T A;  2QM8 A;  1HBW A;  3Q5S A;  2C0X A;  1CI6 B;  1HTL C;  2KNC B;  2O1K A;  2M5A A;  3A0B H;  3JSV C;  4GOD A;  3H1K J;  3AE5 C;  2LXC B;  1N7S D;  4PD4 D;  1URQ C;  1EDK A;  2M3E A;  4AYC A;  1G2C A;  3HRN A;  5AW7 B;  1FZC C;  1HF9 A;  4ZKU A;  1NOH A;  1YJN P;  1Y47 A;  2JR8 A;  1JNM A;  2E5T A;  1OW6 A;  2KUB A;  2Q3E A;  1OVV A;  1JMB A;  3L72 G;  1JY3 O;  1FS0 E;  3OJA B;  2MJZ A;  4I6M C;  4U3F D;  3WU2 H;  1KV4 A;  3GMA A;  1JY2 O;  3H1I G;  4OGQ C;  2Y9Z A;  2NPS D;  3I55 P;  1HJB A;  1CI6 A;  4PV1 C;  2HPC B;  3RL0 C;  2M3B A;  2WMM A;  2WWW A;  3PJS K;  3RK2 B;  5B5E E;  2K3R A;  3L37 A;  1FZG A;  4PD4 E;  4N78 E;  2H8P D;  1QVG O;  1NKZ B;  1HH0 A;  5CJ4 A;  1VQN P;  1HGV A;  3TGU J;  1GL2 C;  2HG5 D;  3L72 E;  1K8A Q;  1PIX A;  2J59 M;  2QJP B;  2BCC G;  3GF3 A;  1MUU A;  3QH9 A;  3H1I J;  1SQP J;  2B88 A;  1SQP G;  3HD7 D;  1EZV E;  1IFP A;  2V7Q J;  1LGH B;  1KYO I;  1KIL E;  3HD7 A;  4OWF A;  1JOC A;  4H13 D;  1NTZ G;  3M91 A;  5BU8 B;  2G8Y A;  2KOG A;  1DX7 A;  1OVU A;  3ITK A;  1HGZ A;  1SQX J;  3GF7 A;  2C9L Y;  1NU1 J;  1NYH A;  3MIW A;  4UB6 E;  1JY3 N;  3RL0 B;  4C7N A;  2JDI H;  4OVN F;  5AVZ B;  1YI2 P;  3MHV A;  1Q90 D;  3LW5 H;  1NTK K;  3BAT A;  1S5L H;  2W27 A;  4BXL A;  1L0L E;  1E5W A;  4EI2 A;  1N7S A;  3AE8 C;  1Q81 Q;  2HOD B;  1LT1 A;  1JB0 J;  2FYU K;  1EZV D;  1J2J B;  3N4X A;  1PGP A;  1L0N J;  1SQB E;  1FU1 A;  2GUV A;  2Y0C A;  3TSI A;  1EDL A;  2E74 D;  2KLV A;  1BCC G;  1BGY J;  1X79 B;  5KLV E;  1L4A B;  2OYI A;  2KNC A;  2YXQ B;  2A06 D;  4H13 C;  3RGU A;  1L0L K;  1Q7Y Q;  1FOS E;  4C7N B;  4JBZ A;  3VP9 A;  3D6Y A;  2ZJS E;  2JJL A;  3U59 A;  3WUU A;  2W6J H;  5AW3 B;  1YJW P;  1GU5 A;  1GD2 E;  3G6E P;  1L0L D;  3HE5 B;  2PP6 A;  1GL2 D;  2IBZ I;  2UWJ E;  1M8O B;  1U7M A;  2IPP A;  3BRV B;  2Y0D A;  4I7Z C;  5CCH A;  3U1A A;  2FXP A;  2CK3 H;  2J58 A;  4UB8 H;  2Z5H A;  1KOR A;  3G3Z A;  3PHL A;  3LW5 J;  3GG2 A;  1SQB D;  1KMI Z;  3AE1 C;  3AEE C;  3IFM A;  4QMA A;  2ZXX A;  5GTI E;  1VQ7 P;  5KLV D;  5B66 E;  5B5E H;  3SFD C;  1LTI C;  2L91 A;  3H32 B;  2XV5 A;  2FFD B;  3Q5R A;  1IZN B;  3IN6 A;  3P8M C;  1FC2 C;  1KC8 Q;  2WTY A;  1AV1 A;  1JEK A;  2O01 J;  2N9B A;  1YJ9 P;  2IZ0 A;  3CCL P;  2IFN A;  4TLF A;  2R44 A;  2BAS A;  2HFE D;  2Q5U A;  4DT0 A;  1DEE G;  3H32 A;  1NH4 A;  4WB4 A;  1KYO E;  5TIS E;  2OGU A;  4EYY Q;  1URQ D;  3B4S A;  1S4X A;  4GDO A;  1JM0 A;  3RK3 E;  1NWQ A;  1H8A A;  4IOI H;  1NTZ E;  1L0N D;  5AVU B;  1YTZ I;  1VQK P;  2W8Z A;  1G1I A;  4IL6 H;  1M7L A;  1SFC D;  2AEM A;  1SQX G;  1VQ6 P;  3NFQ A;  3FXD A;  2O3J A;  2QJY B;  3L74 D;  3KZI H;  4EDF A;  5L8R J;  3P8C E;  5CCH C;  1N7L A;  3L73 D;  1AQ5 A;  2WT7 B;  2FYN B;  1XTC C;  3KDP B;  2QG4 A;  3UIA A;  2W6B A;  3H1J D;  1SQV G;  3H1H E;  3OA7 A;  2P2U A;  5KJ7 D;  5KKZ B;  1H88 A;  1L4A A;  1U7J A;  3E7K A;  1IFD A;  2H7H A;  3B71 A;  3CWB E;  2ZXE B;  3L70 D;  4WY4 A;  2QVA A;  4DZO A;  2A45 H;  1PP9 E;  1NTZ D;  1SQV K;  1YTZ T;  2P7J A;  2OTJ P;  4MN4 C;  1S2E A;  1SQP D;  2WSC J;  1PP9 J;  3PLN A;  1J1E B;  1IK9 A;  1PPJ E;  1USD A;  2Y0E A;  4B86 A;  2BCC D;  3JCU H;  2M5A B;  5EFW B;  4JQ0 D;  1N7S C;  2WIT A;  4U3F E;  1BE3 G;  1LTJ C;  1NAY A;  1SQQ G;  1SFC C;  1FJP A;  1GTW A;  3H1L J;  1NVO A;  4TT3 H;  3H1J E;  5E79 H;  3FX0 A;  1OZH A;  4RES B;  2FYU J;  4XFJ A;  4EIJ A;  2D2C D;  3O6Q B;  4ZKP A;  1E79 H;  3CXH E;  2ITA A;  1GMJ A;  3L71 J;  1PP9 D;  3NXS A;  5KJ7 A;  5K5G B;  1ZLL A;  4EOT A;  1PGQ A;  4W7Z A;  1LT9 B;  2JWD A;  3H1L G;  3L72 D;  1J1E C;  1BE3 E;  5AVR B;  2Z4E A;  1BE3 J;  1RE4 A;  3HUS B;  4H0L D;  1PZQ A;  3VN0 A;  4O9B A;  1IFI A;  1G2C B;  3H1K E;  4IL6 X;  2E76 B;  1G1J A;  3AE2 C;  1VQ8 P;  3L35 A;  4D6T E;  3WUV A;  1T3U A;  3KYQ A;  3L70 J;  2K9J A;  1KYO H;  5TIS H;  2IX7 C;  1S5L X;  3RK2 C;  1M1K Q;  3AEG C;  2HPC A;  1N73 B;  4PD4 H;  3ABV C;  1SQX E;  3H1J J;  1K05 A;  3MUD C;  3TF5 A;  3H1L E;  1EDI A;  3LIE A;  1JCC A;  1LP1 B;  1RE3 A;  3CCM P;  2OQQ A;  4BRY A;  1JUN A;  3KPE A;  4I7Z B;  2WSC H;  1PGJ A;  5AVW B;  5GTH H;  1RF1 A;  1IFM A;  2E76 C;  3U1C A;  1NU1 K;  1KIL D;  3G71 P;  5AW4 B;  2Q9I A;  2R5D A;  3T97 A;  2D2C C;  3AED C;  1QX8 A;  4WBA A;  4GIF A;  4D6T D;  1QVF O;  5DJT B;  3CC2 P;  3A0H E;  5CCG C;  4YPC A;  3HE4 A;  1RF0 C;  1SFC A;  2P67 A;  2WSE J;  5KAI E;  3M0D C;  2KI7 B;  3CCE P;  3K5B A;  2IBZ E;  4H0L C;  5KAF E;  1J1D B;  2QEX P;  5APS A;  5TJH A;  2FXM A;  3L75 J;  3TYY A;  1SQB J;  1N86 A;  3GHG A;  4C7R A;  1KIL C;  2FKW B;  3B5N D;  2R5B A;  3SSU A;  1SVF A;  3HD7 C;  1WRG A;  2KIK A;  1NTK E;  5CBO A;  3QWO C;  2KS1 B;  3CCV P;  2AXT H;  2FYU D;  1VQ4 P;  1RE3 C;  2IYO A;  2A06 E;  3WMM 0;  3KZI E;  3CXH H;  1XTG B;  1JMM A;  2N9Y B;  2FYN C;  1ZRT D;  3AE3 C;  2PRR A;  2WPV B;  3RK3 C;  3VMY A;  1H0T B;  1KB9 D;  1SQQ J;  4R4L A;  4U7J A;  3V2P A;  2QM7 A;  1R8E A;  1KIL B;  2ZT9 B;  3A2A A;  1HVV A;  3R2P A;  1M90 Q;  1AA0 A;  3Q5P A;  1JCD A;  1KFN A;  2WSE H;  3BCC J;  3GLM A;  1S72 P;  2OYI C;  1CSB A;  1N8R Q;  1IO4 A;  1IJD B;  3TGU G;  1FOS F;  3GHG C;  2P10 A; 
#chains in the Genus database with same CATH homology
 1BCC G;  1L0N G;  2BCC G;  2IBZ G;  4PD4 H;  3L71 G;  3CWB G;  1SQP G;  2A06 G;  1P84 H;  1BE3 G;  1NTZ G;  1SQQ G;  3L70 G;  1NTM G;  1SQX G;  1PPJ G;  1EZV G;  3CXH H;  3L75 G;  3L72 G;  5KLV G;  1KB9 H;  1NTK G;  3H1I G;  3H1J G;  3L73 G;  1PP9 G;  1SQV G;  1SQB G;  3H1L G;  4D6T G;  4U3F G;  3H1K G;  1NU1 G;  3L74 G;  2FYU G;  3BCC G;  1BGY G;  3H1H G;  1L0L G;  3CX5 H;  3TGU G;  1KYO H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...