1LJ2A

Recognition of eif4g by rotavirus nsp3 reveals a basis for mrna circularization
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
106
structure length
106
Chain Sequence
HSLQNVIPQQQAHIAELQVYNNKLERDLQNKIGSLTSSIEWYLRSMELDPEIKADIEQQINSIDAINPLHAFDDLESVIRNLISDYDKLFLMFKGLIQRSNYQYSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein/ translation
molecule keywords NONSTRUCTURAL RNA-BINDING PROTEIN 34
publication title Recognition of eIF4G by rotavirus NSP3 reveals a basis for mRNA circularization.
pubmed doi rcsb
source organism Simian rotavirus a/sa11
total genus 43
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.970 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Nonstructural RNA-binding protein 1lj2A00
1LJ2A
chains in the Genus database with same CATH superfamily
3M91A 5AVRB 1N73C 1KN7A 1YBKA 5B5EH 1H8AA 2HPCB 1AVYA 1PGOA 4WY4B 2IFNA 3MP7B 2M3EA 4WBAA 3O8ZA 1FJKA 1GU4A 3AE2C 2KB7P 4RKUJ 2QJKC 2K1AA 1YITP 4YXWH 1OVVA 1CSBA 3U1CA 3CCVP 4XE5B 1HF9A 1BCCE 4Y99B 1LTJC 2H7HA 2WSCH 5B66H 3PRJA 1VQ4P 3O6QA 3L72G 2BCCJ 2JJLA 1IZNB 3PHLA 4JBZA 1AV1A 2PFXA 5APSA 1S1CX 5TJHA 2E74B 2XNXA 1S3JA 3CPWO 1HVVA 2IYOA 1YIJP 1BGYJ 3WU2E 1WT6A 5APQA 3VMXA 3TGUG 3HE5A 2E42A 2LXCB 2C0XA 2QA4P 5AW9B 1NTMJ 1EQ7A 2R5BA 3C8VA 5AVXB 4GIFA 1IFDA 1PGJA 2IZ1A 2W27A 4HH2A 5CCGA 1VPCA 4ZKUA 3CCSP 1JMBA 1BDDA 1Q90D 1PGPA 5CCHA 1FZGA 5AW5B 1JM0A 2A06E 1LTGC 3AECC 1IC2A 2HFED 1NTKK 3VP9A 2KNCA 1SQQD 4BWNA 4WY4D 2RH0A 2N1TC 5KAIH 3V5BA 2AEFA 2HYNA 3TYYA 1G2CA 2QJPB 2A06D 2DW3A 2WSEH 1Q82Q 2C9LY 1SFCA 1GU5A 2WPVB 1L0LJ 1JOCA 2KZJA 5APUA 4RJTA 4K3AA 1NGMB 3TF5A 3CWBE 1HH0A 3CMEP 2RN0A 3A5TA 3AE8C 3KHUA 3NTNA 5AVQB 2JEEA 1SQBG 1IK9A 2GM4A 2E74D 3OA7A 3F89A 3A0HE 3NMDA 1NO4A 1DEBA 1ZN5A 3PLNA 4WB4A 1BE3E 3JSVC 3MTUE 2FBWC 3CWBD 2KIKA 3H1JJ 2L91A 1JY2O 3GHGB 1BGYE 3EWKA 3CMAP 3IN6A 3CD6P 1SQPK 2W6AA 1PV3A 1USEA 3H1IG 4OH8B 3S1KA 3L70G 4IL6E 1VL2A 2OYIA 1N73A 2E43A 3D70A 2KYVA 1JY2N 4KT0J 3W67A 3EQ2A 1NTKE 3H6PA 3M9QA 2YMYA 3RL0C 3B5NC 3A3YB 3TK1A 3OJAB 5KKZC 2B9BA 3L75G 2P58A 3BVHA 3AE3C 3CX5I 1FE6A 1NU1G 1NTKD 2Z4EA 4EIJA 2YIUB 1HGZA 4I2LC 2ZXXA 4IOIH 2KLUA 3V2PA 3BCCG 1IFPA 3HE4B 2B88A 1T3UA 1LT9C 4UB8H 3AEAC 2ZVNB 1N7SC 2IBZI 2LR2A 4M3LA 1M57D 3CX5E 2N9YB 1JO5A 1NVOA 4PV1C 1OVUA 4NPEA 3CXHH 3BRVB 1VF5C 3U1AA 1SQPE 1ZXGA 3P8MC 5CJ4A 3H1LG 1SQVG 1LTIC 4EYYQ 2V4HA 2D2CB 1AJYA 2K88A 3CX5D 4H13C 3H1HG 1FAVA 1SQXE 2P1JA 3WMM0 2KSJA 4ZMDA 3L72J 1SQPD 2B89A 3L74D 2QJYC 2YO3A 3GMAA 1GW3A 2OYOA 3IFMA 5APYA 1J2JB 5KLVK 3CCLP 1YQ3C 1HGVA 1SQXD 1KILC 2IBZD 2YNYA 1L4AC 1SP4A 1QL1A 3C9IA 1P84H 1FDIA 2PAJA 3TGUJ 4RO0A 3A0BH 2A45H 2AXTE 1U7MA 1TU3F 3R4YA 1JY3P 1NKZB 1VDFA 1W5CE 3O6QB 3GHGA 2Q7CA 1EDJA 3L73G 4D6TE 5KJ7D 2JP3A 3TSIA 1L0LG 1EZVI 1IK7A 3MIWA 5APVA 1BSHA 1LP1B 5APWA 2YKOA 2YKPA 5BU8B 4DJGA 4YXDC 1VQ5P 2JR8A 1KYOE 3UIAA 4D6TD 2QIWA 3PJSK 2H43A 5CBOA 3CC7P 4H44C 2ZXEB 3VTPC 4EI2A 3AE7C 1FZAA 4A7PA 5AVYB 2IFMA 5GTIE 1YJNP 4DZOA 3L71E 2O01H 1OX3A 3MD0A 2ITAA 1EC5A 1VQ7P 2KZIA 5GTHH 3CL3D 1T2KD 1LTBC 2Q1KA 1KYOD 1VQ8P 5KLVE 1DH3A 2A45G 1OW7A 4OWFA 3RK3C 2XDJA 2NPSB 1CZQA 1DD3A 4LC1A 3L71D 1KFNA 2KXPB 1EZVD 2ZT9B 3V2RA 1SQBJ 5KLVD 1DIPA 3KZIE 2Q3IA 4AUWA 1OWAA 1RE4C 2CPBA 1ZW0A 1R8EA 2H88C 2JDIH 1G2CB 1HWTC 4ZNCA 3HUSC 3S9OA 3M9BA 3BASA 1FBMA 3CCQP 3Q3DA 1SFCB 4H0LB 5BU5A 5B5EE 1SS1A 3H1IJ 3RK2B 1M1JC 1LT9A 3KPEA 1SQBK 3L70J 4JPZB 3AEBC 3I55P 1VQOP 1HBWA 2WZ7A 3P8CE 2HG5D 3RGUA 1SLQA 3HD7A 1J1DB 5H2FE 1PPJG 1MFZA 5CBNA 3L75J 1BDCA 3AE9C 1NTZK 5M1BA 3LIDA 1L0NE 5B66E 2JKVA 3S4RA 2FYUD 3P32A 4B86A 1QEXA 4HYTB 1NH4A 1WRGA 3USSA 1Q81Q 5KAFE 1NU1J 3N7NA 4ZKPA 1MUUA 4HKZH 1M1KQ 3JCUE 3SWYA 3M9HA 4JQ0D 2OYIB 4OGQC 1N73B 1PP9G 2JWAA 3PH0A 3BCCJ 1JUNA 1L0ND 3PP5A 3LIEA 3ITKA 5CCGD 1LT1A 1KZUB 1RY3A 3TDKA 1UIXA 3MUDA 2QJKB 1NU1K 2FY8A 1W2EA 1L4AA 1KFMA 5CCHD 1GL2C 5AW0B 1ZLLA 1BCCD 1OMIA 3M0AA 3RBXA 3KQGA 1LP1A 2WWWA 1URQC 2K3RA 2ZT9D 1KB9H 1LTJB 3H1KG 1FZCC 1JY3O 3R2PA 4C46A 1EDKA 3H1LJ 1SQVJ 3M0DA 2OQQA 1Y47A 1SQBE 5AVUB 2R32A 1IFJA 2GA1A 3H1HJ 2R5DA 4AYCA 2RMZA 2Y0EA 1VQ6P 1JY3N 1SFCD 4H0LD 4I1LA 3AEEC 4NPDA 3RK2D 1CW5A 1RF0C 3VN0A 2E76B 3IF4A 5KAIE 3L70E 4O9BA 1NTZE 2H8PD 2NPSA 3GW6A 1NTMK 2AXCA 2KI7B 2OTJP 1Q7YQ 2QJPC 1RF1C 1ZV8A 3KYQA 5TISH 3H32A 1IO4A 3L75E 3FX0A 1Y8AA 1S9KE 3Q5RA 1XTGB 1LWUC 4U3FJ 1NTZD 1IFIA 1K73Q 1KV4A 1FDMA 1IJDB 3FXEA 4I6MC 2LXBA 1NU1E 3HTKA 3L73J 2IZ0A 2M0BA 1LTSC 1JEKA 1AQTA 1RH5B 2VRSA 1N7LA 2QG4A 3VP8A 1S9KD 2OGUA 2N1TB 4L75A 3WUTA 1VQPP 5AVTB 5AW6B 2BCCE 4IL6X 1FC2C 3AE5C 1GZLA 2KLVA 1RE3A 3HUSA 1OFCX 2BASA 1L0LK 1VQLP 2E75C 1ZOYC 2JO1A 1M1JA 3SSUA 1X22A 4I7ZC 1A02F 1PIXA 2BCCD 2WSFH 5AW1B 2KSEA 1VQNP 2FXPA 1H88A 2W6BA 4PD4H 4JYCA 3LW5J 1NTME 3H1HE 4EDFA 2Q6QA 1BE3D 1SQQG 3CCMP 1Y9BA 1VQKP 2OYHC 1BGYD 3E1RA 1QVFO 2E76D 2A06G 1X0TA 2QE7H 2YIUC 2O3JA 1NTMD 4GOEA 3W68A 1S2EA 4DOJA 1HTLC 1FZBA 1LTJA 4UB8E 4N78E 5KLIC 2HLOA 1X9VA 2FFDC 2L5GB 1E5WA 4KJMA 3Q1MA 1CI6B 3RL0B 3B5NB 1J1EB 5KKZB 2O01J 3L36A 3CXHE 1GL2A 1X79B 1L2PA 4GOFA 1JCDA 3I56P 2SPZA 2C0WA 2FKWB 1URQA 1L0LE 1T2KC 5BVZA 4GKGA 1FZCA 2W90A 2J59M 1NYHA 1MZ9A 2A45I 2Q9IA 3B8EB 2P67A 3IAOA 1MFTA 1T3JA 3AE4C 3B4SA 1LT9B 4K35A 1FOSF 2FYNC 1G1JA 1N7SB 1GMJA 1PP9J 1RQVA 3H1JE 1FZEA 1DD4A 3HD7B 4JYBA 2ZAEB 1E79H 2QSIA 4PV1B 2ZYGA 1ZR4A 1P84E 1RQUA 2LKMA 3AEDC 1VF5B 3A0BE 3GF3A 4YPCA 5L8RJ 1RF1A 4UB6H 1NTKG 2KK7A 2N1TA 1FDOA 3H1JD 4W80A 4H13B 4DCKA 3A7OA 3H1KJ 1LNQA 2ZYAA 5AW4B 2K9JA 1N8RQ 3EFFK 1U7JA 1KYOI 4U3FG 2QJYB 3LW5H 1PL5A 1KTMA 1K8AQ 5APTA 3V6IA 1AA0A 4RESB 3G71P 3G3ZA 1MKMA 1KILB 3L4FA 2Z5IA 1L4AB 1D7MA 3RL0D 3B5ND 2J5UA 4L76A 1ZR2A 5KTBA 2XV5A 1R5LA 4ASVA 1KORA 3GG2A 3VMYA 1S5LX 1N2DC 5AVSB 5GTHE 4C7NB 3WUUA 3CCUP 2WT7A 1WMKA 1EXJA 1HJ0A 1FJPA 1PPJE 1JTHA 3HRNA 1SQPG 3L74G 1NHLA 3K5BA 3OAKA 3CI9A 5APXA 1JMMA 2Z5HA 1K05A 2D2CD 5E79H 1KQGB 1Z56A 2NRGA 1SQXG 2FXMA 2OYHA 2YXQB 1CI6A 2IBZG 1S5LE 3B5NA 1QX8A 1PPJD 2FYZA 1N7SD 2YMKA 2O01N 5DJTB 2V7QJ 4H44B 3HD7D 3L72E 4PV1D 5CHXA 2BEZF 1MV8A 3L35A 3Q5PA 3H32B 2E5TA 2HODB 4N3YB 4BXLA 2FFDA 3N4XA 4PJ0H 4H13D 3SWKA 1GW4A 2R3CA 2YO2A 3RK3B 3L72D 3HTKB 1KILE 4EOTA 3A2AA 4L73A 3TGUE 4WY4C 1N7SA 4Y28J 2WQYC 4D6TG 2XKMA 4XA4A 3OW2O 2CK3H 3SFDC 1SQQJ 3L37A 2OARA 2O1JA 1L4AD 3HUSB 3RL0g 4HB1A 3TGUD 1KB9I 1M56D 4W7YA 2B87B 3E1IA 2WTYA 3JC22 1M1JB 1K04A 2OYIC 3MGNA 1FS0E 3P8CD 4Y99C 1SQQK 2RKLA 2QEXP 1OXZA 1QGKB 1ZP0C 3AE6C 3G9RA 3L71G 2KS1B 1JCCA 1HJBA 4WVZA 5CMZA 1EZVG 1A02J 2O1KA 3CCJP 2E74C 3TNUA 5KLVG 3PTZA 4R4MA 5H2FH 1KB9E 2WSFJ 4IFMA 1EXIA 2PGDA 1KILA 3CWBJ 1M8OB 2NPSD 3VYIA 1Q86Q 3QH9A 4WWIA 1RHZB 5KAFH 4H44D 3RK3E 2MKVA 4OGQB 4C7NA 3JCUH 1G1IA 2Y0CA 1KB9D 3CCEP 1N86A 2W6JH 3NXSA 1BE3J 2E76C 2KOGA 3II6A 4QMAA 2V7QH 1GL2B 3RK3D 4OVNF 3QWOC 1H0TA 3CC2P 2HR3A 3H1IE 1SQVK 3IR9A 1URQB 2FYUG 2WVRA 5TISE 2GUSA 1SQBD 1FZCB 1H89A 4W7ZA 3T97B 3WU2H 4GT1A 1NTKJ 2Q5UA 1W2BO 1SQQE 1T6AA 2IDBA 3ABVC 4TT3H 4KHXA 3E7KA 3H1ID 2BEQD 2OTLP 1L0NG 3MHVA 2R44A 2HODA 2PRRA 1DEEG 3L70D 1YHQP 1OW6A 1NAYA 3V2QA 2I1JA 4PD4I 1NWQA 1BCCG 4Z1MH 2M3BA 5AW8B 2W83C 3BRTB 2C9NY 1X8YA 1AQ5A 2QVAA 3L75D 1RF1B 2Y9YA 2WMMA 3BCCE 3MZWB 2QM8A 5K5GB 2ZFCA 1GD2E 4GDOA 1RE4A 1LWUB 2K9YA 3GHGC 1NU1D 2P7JA 3BATA 4C7RA 4CPGA 2K9JB 1HUCA 3KXDA 2B87A 4PD4E 1SQPJ 1KC8Q 1M7LA 3L74J 1OW8A 4L74A 3SWFA 3BCCD 4OGQD 2HPCA 4WY4A 2G8YA 2ZJSE 3H1LE 1SQVE 3CCRP 1AVOA 2KS1A 1SQXJ 5CJ0A 2G3AA 1NAFA 2P2UA 4PD4D 3V2NA 1KQSO 1GL2D 3G4SP 3GF7A 2PP6A 3U59A 3G6EP 2WPQA 3FWLA 3A0HH 2E75B 2WPSA 2XU6A 1NTZG 3VOPA 3CXHI 2Y0DA 3H1LD 1SQVD 1URQD 2ZYDA 4R4LA 2WT7B 4I7ZB 5KJ7C 5AW7B 4AQRD 1SQXK 1JTHB 1GDTA 2ZVOB 3H1HD 1EDLA 1T8ZA 3Q5SA 1J1EC 3SFEC 5AVZB 4IL6H 2CPSA 2M8RA 3NFQA 1GTWA 2M5AB 2OYHB 2AEMA 4ASWA 2IYPA 4U3FE 4D6TJ 3B71A 4YTPC 1FOSE 1OZHA 3L73E 4N78D 3CWBG 2QM7A 1QLED 1AFOA 2WPRA 2XZRA 2OTKE 4TLFA 3KDPB 2D2CC 1SVFA 1U57A 2BCCG 2Y9ZA 5KLIB 1P84I 3H25A 3T97A 1KQFB 1IFNA 2POHA 2N1TD 4U3FD 2FFDB 3V4WA 1S4XA 2IPPA 3CXHD 3CC4P 1IFMA 3Q2YA 1YYCA 2I1KA 2J58A 4XFJA 3C1LA 3L73D 3HD7C 1BE3G 2IX7C 1L0LD 5AW2B 1UIIA 3L71J 1BGYG 4UB6E 3VMAA 3EFGA 1RF0A 3L74E 4BRYB 1KMIZ 3CX5H 1NOHA 1LGHB 5KLVJ 1PFIA 2NZ2A 2W8ZA 1NTMG 1OVRA 2GUVA 5AVVB 1S72P 3FWNA 2IBZE 1GK6A 2YKQA 1QVGO 2MJZA 1NKNA 2FYNB 2E75D 1LWUA 1YTZT 1YJWP 1FZFA 1P84D 2WSSH 3MUDC 4JF7A 3VMZA 3RBZA 5EFWB 3TNUB 1QL2A 3GLMA 4LGDE 2FXOA 2E5YA 1GK4A 1YJ9P 2FYUJ 3M0DC 2AEJA 3ZDMA 1NJIQ 4DT0A 2JWDA 1KD1Q 3D71A 1KQLA 1USDA 1JB0J 5AVWB 3CLQA 4HJGH 1PGQA 1OIPA 2R3SA 4IFDK 2AXTH 5E79E 1LTAC 4LLHA 5CCGC 1K9MQ 3D6YA 4MN4C 1L0NJ 2WSCJ 2FYUK 3M06A 3D6ZA 4NPFX 5CCHC 2UWJE 3V4QA 2NPSC 3HE5B 1H0TB 1BCCJ 1YTZI 2M5AA 3FXDA 2ZT9C 1VQMP 3P7KA 3H1JG 5DJUB 2KP8A 4N6JA 1YI2P 1EZVE 1L0NK 2XNDH 1PP9E 1KYOH 5KJ7A 2H89C 4PJ0E 1VQ9P 1Q2NA 2YXRB 1ZMEC 1VF5D 5GTIH 3AE1C 1PZQA 1LTTC 1SFCC 4H0LC 3HE4A 3RK2C 1BSNA 3AEGC 1PP9D 1XTCC 2KNCB 1DX7A 2P10A 1YQ4C 1S5LH 3H1KE 3I5CA 1ZRTE 2K37A 4U7JA 1J1DC 2I8DA 2QRXA 3AEFC 2KUBA 1RE3C 3FGAD 1JNMA 1M90Q 4GODA 2N9BA 5AW3B 5C39A 3F5HA 4BRYA 1FU1A 2Q3EA 4IFFA 1R5SA 3KZIH 1JY2P 1KILD 3H1KD 1NTZJ 1ZRTD 1EDIA 3WUVA 2WITA 2FYUE 2WSEJ 1LJ2A
chains in the Genus database with same CATH topology
1LJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LJ2 A; 
#chains in the Genus database with same CATH topology
 3M91 A;  5AVR B;  1N73 C;  1KN7 A;  1YBK A;  5B5E H;  1H8A A;  2HPC B;  1AVY A;  1PGO A;  4WY4 B;  2IFN A;  3MP7 B;  2M3E A;  4WBA A;  3O8Z A;  1FJK A;  1GU4 A;  3AE2 C;  2KB7 P;  4RKU J;  2QJK C;  2K1A A;  1YIT P;  4YXW H;  1OVV A;  1CSB A;  3U1C A;  3CCV P;  4XE5 B;  1HF9 A;  1BCC E;  4Y99 B;  1LTJ C;  2H7H A;  2WSC H;  5B66 H;  3PRJ A;  1VQ4 P;  3O6Q A;  3L72 G;  2BCC J;  2JJL A;  1IZN B;  3PHL A;  4JBZ A;  1AV1 A;  2PFX A;  5APS A;  1S1C X;  5TJH A;  2E74 B;  2XNX A;  1S3J A;  3CPW O;  1HVV A;  2IYO A;  1YIJ P;  1BGY J;  3WU2 E;  1WT6 A;  5APQ A;  3VMX A;  3TGU G;  3HE5 A;  2E42 A;  2LXC B;  2C0X A;  2QA4 P;  5AW9 B;  1NTM J;  1EQ7 A;  2R5B A;  3C8V A;  5AVX B;  4GIF A;  1IFD A;  1PGJ A;  2IZ1 A;  2W27 A;  4HH2 A;  5CCG A;  1VPC A;  4ZKU A;  3CCS P;  1JMB A;  1BDD A;  1Q90 D;  1PGP A;  5CCH A;  1FZG A;  5AW5 B;  1JM0 A;  2A06 E;  1LTG C;  3AEC C;  1IC2 A;  2HFE D;  1NTK K;  3VP9 A;  2KNC A;  1SQQ D;  4BWN A;  4WY4 D;  2RH0 A;  2N1T C;  5KAI H;  3V5B A;  2AEF A;  2HYN A;  3TYY A;  1G2C A;  2QJP B;  2A06 D;  2DW3 A;  2WSE H;  1Q82 Q;  2C9L Y;  1SFC A;  1GU5 A;  2WPV B;  1L0L J;  1JOC A;  2KZJ A;  5APU A;  4RJT A;  4K3A A;  1NGM B;  3TF5 A;  3CWB E;  1HH0 A;  3CME P;  2RN0 A;  3A5T A;  3AE8 C;  3KHU A;  3NTN A;  5AVQ B;  2JEE A;  1SQB G;  1IK9 A;  2GM4 A;  2E74 D;  3OA7 A;  3F89 A;  3A0H E;  3NMD A;  1NO4 A;  1DEB A;  1ZN5 A;  3PLN A;  4WB4 A;  1BE3 E;  3JSV C;  3MTU E;  2FBW C;  3CWB D;  2KIK A;  3H1J J;  2L91 A;  1JY2 O;  3GHG B;  1BGY E;  3EWK A;  3CMA P;  3IN6 A;  3CD6 P;  1SQP K;  2W6A A;  1PV3 A;  1USE A;  3H1I G;  4OH8 B;  3S1K A;  3L70 G;  4IL6 E;  1VL2 A;  2OYI A;  1N73 A;  2E43 A;  3D70 A;  2KYV A;  1JY2 N;  4KT0 J;  3W67 A;  3EQ2 A;  1NTK E;  3H6P A;  3M9Q A;  2YMY A;  3RL0 C;  3B5N C;  3A3Y B;  3TK1 A;  3OJA B;  5KKZ C;  2B9B A;  3L75 G;  2P58 A;  3BVH A;  3AE3 C;  3CX5 I;  1FE6 A;  1NU1 G;  1NTK D;  2Z4E A;  4EIJ A;  2YIU B;  1HGZ A;  4I2L C;  2ZXX A;  4IOI H;  2KLU A;  3V2P A;  3BCC G;  1IFP A;  3HE4 B;  2B88 A;  1T3U A;  1LT9 C;  4UB8 H;  3AEA C;  2ZVN B;  1N7S C;  2IBZ I;  2LR2 A;  4M3L A;  1M57 D;  3CX5 E;  2N9Y B;  1JO5 A;  1NVO A;  4PV1 C;  1OVU A;  4NPE A;  3CXH H;  3BRV B;  1VF5 C;  3U1A A;  1SQP E;  1ZXG A;  3P8M C;  5CJ4 A;  3H1L G;  1SQV G;  1LTI C;  4EYY Q;  2V4H A;  2D2C B;  1AJY A;  2K88 A;  3CX5 D;  4H13 C;  3H1H G;  1FAV A;  1SQX E;  2P1J A;  3WMM 0;  2KSJ A;  4ZMD A;  3L72 J;  1SQP D;  2B89 A;  3L74 D;  2QJY C;  2YO3 A;  3GMA A;  1GW3 A;  2OYO A;  3IFM A;  5APY A;  1J2J B;  5KLV K;  3CCL P;  1YQ3 C;  1HGV A;  1SQX D;  1KIL C;  2IBZ D;  2YNY A;  1L4A C;  1SP4 A;  1QL1 A;  3C9I A;  1P84 H;  1FDI A;  2PAJ A;  3TGU J;  4RO0 A;  3A0B H;  2A45 H;  2AXT E;  1U7M A;  1TU3 F;  3R4Y A;  1JY3 P;  1NKZ B;  1VDF A;  1W5C E;  3O6Q B;  3GHG A;  2Q7C A;  1EDJ A;  3L73 G;  4D6T E;  5KJ7 D;  2JP3 A;  3TSI A;  1L0L G;  1EZV I;  1IK7 A;  3MIW A;  5APV A;  1BSH A;  1LP1 B;  5APW A;  2YKO A;  2YKP A;  5BU8 B;  4DJG A;  4YXD C;  1VQ5 P;  2JR8 A;  1KYO E;  3UIA A;  4D6T D;  2QIW A;  3PJS K;  2H43 A;  5CBO A;  3CC7 P;  4H44 C;  2ZXE B;  3VTP C;  4EI2 A;  3AE7 C;  1FZA A;  4A7P A;  5AVY B;  2IFM A;  5GTI E;  1YJN P;  4DZO A;  3L71 E;  2O01 H;  1OX3 A;  3MD0 A;  2ITA A;  1EC5 A;  1VQ7 P;  2KZI A;  5GTH H;  3CL3 D;  1T2K D;  1LTB C;  2Q1K A;  1KYO D;  1VQ8 P;  5KLV E;  1DH3 A;  2A45 G;  1OW7 A;  4OWF A;  3RK3 C;  2XDJ A;  2NPS B;  1CZQ A;  1DD3 A;  4LC1 A;  3L71 D;  1KFN A;  2KXP B;  1EZV D;  2ZT9 B;  3V2R A;  1SQB J;  5KLV D;  1DIP A;  3KZI E;  2Q3I A;  4AUW A;  1OWA A;  1RE4 C;  2CPB A;  1ZW0 A;  1R8E A;  2H88 C;  2JDI H;  1G2C B;  1HWT C;  4ZNC A;  3HUS C;  3S9O A;  3M9B A;  3BAS A;  1FBM A;  3CCQ P;  3Q3D A;  1SFC B;  4H0L B;  5BU5 A;  5B5E E;  1SS1 A;  3H1I J;  3RK2 B;  1M1J C;  1LT9 A;  3KPE A;  1SQB K;  3L70 J;  4JPZ B;  3AEB C;  3I55 P;  1VQO P;  1HBW A;  2WZ7 A;  3P8C E;  2HG5 D;  3RGU A;  1SLQ A;  3HD7 A;  1J1D B;  5H2F E;  1PPJ G;  1MFZ A;  5CBN A;  3L75 J;  1BDC A;  3AE9 C;  1NTZ K;  5M1B A;  3LID A;  1L0N E;  5B66 E;  2JKV A;  3S4R A;  2FYU D;  3P32 A;  4B86 A;  1QEX A;  4HYT B;  1NH4 A;  1WRG A;  3USS A;  1Q81 Q;  5KAF E;  1NU1 J;  3N7N A;  4ZKP A;  1MUU A;  4HKZ H;  1M1K Q;  3JCU E;  3SWY A;  3M9H A;  4JQ0 D;  2OYI B;  4OGQ C;  1N73 B;  1PP9 G;  2JWA A;  3PH0 A;  3BCC J;  1JUN A;  1L0N D;  3PP5 A;  3LIE A;  3ITK A;  5CCG D;  1LT1 A;  1KZU B;  1RY3 A;  3TDK A;  1UIX A;  3MUD A;  2QJK B;  1NU1 K;  2FY8 A;  1W2E A;  1L4A A;  1KFM A;  5CCH D;  1GL2 C;  5AW0 B;  1ZLL A;  1BCC D;  1OMI A;  3M0A A;  3RBX A;  3KQG A;  1LP1 A;  2WWW A;  1URQ C;  2K3R A;  2ZT9 D;  1KB9 H;  1LTJ B;  3H1K G;  1FZC C;  1JY3 O;  3R2P A;  4C46 A;  1EDK A;  3H1L J;  1SQV J;  3M0D A;  2OQQ A;  1Y47 A;  1SQB E;  5AVU B;  2R32 A;  1IFJ A;  2GA1 A;  3H1H J;  2R5D A;  4AYC A;  2RMZ A;  2Y0E A;  1VQ6 P;  1JY3 N;  1SFC D;  4H0L D;  4I1L A;  3AEE C;  4NPD A;  3RK2 D;  1CW5 A;  1RF0 C;  3VN0 A;  2E76 B;  3IF4 A;  5KAI E;  3L70 E;  4O9B A;  1NTZ E;  2H8P D;  2NPS A;  3GW6 A;  1NTM K;  2AXC A;  2KI7 B;  2OTJ P;  1Q7Y Q;  2QJP C;  1RF1 C;  1ZV8 A;  3KYQ A;  5TIS H;  3H32 A;  1IO4 A;  3L75 E;  3FX0 A;  1Y8A A;  1S9K E;  3Q5R A;  1XTG B;  1LWU C;  4U3F J;  1NTZ D;  1IFI A;  1K73 Q;  1KV4 A;  1FDM A;  1IJD B;  3FXE A;  4I6M C;  2LXB A;  1NU1 E;  3HTK A;  3L73 J;  2IZ0 A;  2M0B A;  1LTS C;  1JEK A;  1AQT A;  1RH5 B;  2VRS A;  1N7L A;  2QG4 A;  3VP8 A;  1S9K D;  2OGU A;  2N1T B;  4L75 A;  3WUT A;  1VQP P;  5AVT B;  5AW6 B;  2BCC E;  4IL6 X;  1FC2 C;  3AE5 C;  1GZL A;  2KLV A;  1RE3 A;  3HUS A;  1OFC X;  2BAS A;  1L0L K;  1VQL P;  2E75 C;  1ZOY C;  2JO1 A;  1M1J A;  3SSU A;  1X22 A;  4I7Z C;  1A02 F;  1PIX A;  2BCC D;  2WSF H;  5AW1 B;  2KSE A;  1VQN P;  2FXP A;  1H88 A;  2W6B A;  4PD4 H;  4JYC A;  3LW5 J;  1NTM E;  3H1H E;  4EDF A;  2Q6Q A;  1BE3 D;  1SQQ G;  3CCM P;  1Y9B A;  1VQK P;  2OYH C;  1BGY D;  3E1R A;  1QVF O;  2E76 D;  2A06 G;  1X0T A;  2QE7 H;  2YIU C;  2O3J A;  1NTM D;  4GOE A;  3W68 A;  1S2E A;  4DOJ A;  1HTL C;  1FZB A;  1LTJ A;  4UB8 E;  4N78 E;  5KLI C;  2HLO A;  1X9V A;  2FFD C;  2L5G B;  1E5W A;  4KJM A;  3Q1M A;  1CI6 B;  3RL0 B;  3B5N B;  1J1E B;  5KKZ B;  2O01 J;  3L36 A;  3CXH E;  1GL2 A;  1X79 B;  1L2P A;  4GOF A;  1JCD A;  3I56 P;  2SPZ A;  2C0W A;  2FKW B;  1URQ A;  1L0L E;  1T2K C;  5BVZ A;  4GKG A;  1FZC A;  2W90 A;  2J59 M;  1NYH A;  1MZ9 A;  2A45 I;  2Q9I A;  3B8E B;  2P67 A;  3IAO A;  1MFT A;  1T3J A;  3AE4 C;  3B4S A;  1LT9 B;  4K35 A;  1FOS F;  2FYN C;  1G1J A;  1N7S B;  1GMJ A;  1PP9 J;  1RQV A;  3H1J E;  1FZE A;  1DD4 A;  3HD7 B;  4JYB A;  2ZAE B;  1E79 H;  2QSI A;  4PV1 B;  2ZYG A;  1ZR4 A;  1P84 E;  1RQU A;  2LKM A;  3AED C;  1VF5 B;  3A0B E;  3GF3 A;  4YPC A;  5L8R J;  1RF1 A;  4UB6 H;  1NTK G;  2KK7 A;  2N1T A;  1FDO A;  3H1J D;  4W80 A;  4H13 B;  4DCK A;  3A7O A;  3H1K J;  1LNQ A;  2ZYA A;  5AW4 B;  2K9J A;  1N8R Q;  3EFF K;  1U7J A;  1KYO I;  4U3F G;  2QJY B;  3LW5 H;  1PL5 A;  1KTM A;  1K8A Q;  5APT A;  3V6I A;  1AA0 A;  4RES B;  3G71 P;  3G3Z A;  1MKM A;  1KIL B;  3L4F A;  2Z5I A;  1L4A B;  1D7M A;  3RL0 D;  3B5N D;  2J5U A;  4L76 A;  1ZR2 A;  5KTB A;  2XV5 A;  1R5L A;  4ASV A;  1KOR A;  3GG2 A;  3VMY A;  1S5L X;  1N2D C;  5AVS B;  5GTH E;  4C7N B;  3WUU A;  3CCU P;  2WT7 A;  1WMK A;  1EXJ A;  1HJ0 A;  1FJP A;  1PPJ E;  1JTH A;  3HRN A;  1SQP G;  3L74 G;  1NHL A;  3K5B A;  3OAK A;  3CI9 A;  5APX A;  1JMM A;  2Z5H A;  1K05 A;  2D2C D;  5E79 H;  1KQG B;  1Z56 A;  2NRG A;  1SQX G;  2FXM A;  2OYH A;  2YXQ B;  1CI6 A;  2IBZ G;  1S5L E;  3B5N A;  1QX8 A;  1PPJ D;  2FYZ A;  1N7S D;  2YMK A;  2O01 N;  5DJT B;  2V7Q J;  4H44 B;  3HD7 D;  3L72 E;  4PV1 D;  5CHX A;  2BEZ F;  1MV8 A;  3L35 A;  3Q5P A;  3H32 B;  2E5T A;  2HOD B;  4N3Y B;  4BXL A;  2FFD A;  3N4X A;  4PJ0 H;  4H13 D;  3SWK A;  1GW4 A;  2R3C A;  2YO2 A;  3RK3 B;  3L72 D;  3HTK B;  1KIL E;  4EOT A;  3A2A A;  4L73 A;  3TGU E;  4WY4 C;  1N7S A;  4Y28 J;  2WQY C;  4D6T G;  2XKM A;  4XA4 A;  3OW2 O;  2CK3 H;  3SFD C;  1SQQ J;  3L37 A;  2OAR A;  2O1J A;  1L4A D;  3HUS B;  3RL0 g;  4HB1 A;  3TGU D;  1KB9 I;  1M56 D;  4W7Y A;  2B87 B;  3E1I A;  2WTY A;  3JC2 2;  1M1J B;  1K04 A;  2OYI C;  3MGN A;  1FS0 E;  3P8C D;  4Y99 C;  1SQQ K;  2RKL A;  2QEX P;  1OXZ A;  1QGK B;  1ZP0 C;  3AE6 C;  3G9R A;  3L71 G;  2KS1 B;  1JCC A;  1HJB A;  4WVZ A;  5CMZ A;  1EZV G;  1A02 J;  2O1K A;  3CCJ P;  2E74 C;  3TNU A;  5KLV G;  3PTZ A;  4R4M A;  5H2F H;  1KB9 E;  2WSF J;  4IFM A;  1EXI A;  2PGD A;  1KIL A;  3CWB J;  1M8O B;  2NPS D;  3VYI A;  1Q86 Q;  3QH9 A;  4WWI A;  1RHZ B;  5KAF H;  4H44 D;  3RK3 E;  2MKV A;  4OGQ B;  4C7N A;  3JCU H;  1G1I A;  2Y0C A;  1KB9 D;  3CCE P;  1N86 A;  2W6J H;  3NXS A;  1BE3 J;  2E76 C;  2KOG A;  3II6 A;  4QMA A;  2V7Q H;  1GL2 B;  3RK3 D;  4OVN F;  3QWO C;  1H0T A;  3CC2 P;  2HR3 A;  3H1I E;  1SQV K;  3IR9 A;  1URQ B;  2FYU G;  2WVR A;  5TIS E;  2GUS A;  1SQB D;  1FZC B;  1H89 A;  4W7Z A;  3T97 B;  3WU2 H;  4GT1 A;  1NTK J;  2Q5U A;  1W2B O;  1SQQ E;  1T6A A;  2IDB A;  3ABV C;  4TT3 H;  4KHX A;  3E7K A;  3H1I D;  2BEQ D;  2OTL P;  1L0N G;  3MHV A;  2R44 A;  2HOD A;  2PRR A;  1DEE G;  3L70 D;  1YHQ P;  1OW6 A;  1NAY A;  3V2Q A;  2I1J A;  4PD4 I;  1NWQ A;  1BCC G;  4Z1M H;  2M3B A;  5AW8 B;  2W83 C;  3BRT B;  2C9N Y;  1X8Y A;  1AQ5 A;  2QVA A;  3L75 D;  1RF1 B;  2Y9Y A;  2WMM A;  3BCC E;  3MZW B;  2QM8 A;  5K5G B;  2ZFC A;  1GD2 E;  4GDO A;  1RE4 A;  1LWU B;  2K9Y A;  3GHG C;  1NU1 D;  2P7J A;  3BAT A;  4C7R A;  4CPG A;  2K9J B;  1HUC A;  3KXD A;  2B87 A;  4PD4 E;  1SQP J;  1KC8 Q;  1M7L A;  3L74 J;  1OW8 A;  4L74 A;  3SWF A;  3BCC D;  4OGQ D;  2HPC A;  4WY4 A;  2G8Y A;  2ZJS E;  3H1L E;  1SQV E;  3CCR P;  1AVO A;  2KS1 A;  1SQX J;  5CJ0 A;  2G3A A;  1NAF A;  2P2U A;  4PD4 D;  3V2N A;  1KQS O;  1GL2 D;  3G4S P;  3GF7 A;  2PP6 A;  3U59 A;  3G6E P;  2WPQ A;  3FWL A;  3A0H H;  2E75 B;  2WPS A;  2XU6 A;  1NTZ G;  3VOP A;  3CXH I;  2Y0D A;  3H1L D;  1SQV D;  1URQ D;  2ZYD A;  4R4L A;  2WT7 B;  4I7Z B;  5KJ7 C;  5AW7 B;  4AQR D;  1SQX K;  1JTH B;  1GDT A;  2ZVO B;  3H1H D;  1EDL A;  1T8Z A;  3Q5S A;  1J1E C;  3SFE C;  5AVZ B;  4IL6 H;  2CPS A;  2M8R A;  3NFQ A;  1GTW A;  2M5A B;  2OYH B;  2AEM A;  4ASW A;  2IYP A;  4U3F E;  4D6T J;  3B71 A;  4YTP C;  1FOS E;  1OZH A;  3L73 E;  4N78 D;  3CWB G;  2QM7 A;  1QLE D;  1AFO A;  2WPR A;  2XZR A;  2OTK E;  4TLF A;  3KDP B;  2D2C C;  1SVF A;  1U57 A;  2BCC G;  2Y9Z A;  5KLI B;  1P84 I;  3H25 A;  3T97 A;  1KQF B;  1IFN A;  2POH A;  2N1T D;  4U3F D;  2FFD B;  3V4W A;  1S4X A;  2IPP A;  3CXH D;  3CC4 P;  1IFM A;  3Q2Y A;  1YYC A;  2I1K A;  2J58 A;  4XFJ A;  3C1L A;  3L73 D;  3HD7 C;  1BE3 G;  2IX7 C;  1L0L D;  5AW2 B;  1UII A;  3L71 J;  1BGY G;  4UB6 E;  3VMA A;  3EFG A;  1RF0 A;  3L74 E;  4BRY B;  1KMI Z;  3CX5 H;  1NOH A;  1LGH B;  5KLV J;  1PFI A;  2NZ2 A;  2W8Z A;  1NTM G;  1OVR A;  2GUV A;  5AVV B;  1S72 P;  3FWN A;  2IBZ E;  1GK6 A;  2YKQ A;  1QVG O;  2MJZ A;  1NKN A;  2FYN B;  2E75 D;  1LWU A;  1YTZ T;  1YJW P;  1FZF A;  1P84 D;  2WSS H;  3MUD C;  4JF7 A;  3VMZ A;  3RBZ A;  5EFW B;  3TNU B;  1QL2 A;  3GLM A;  4LGD E;  2FXO A;  2E5Y A;  1GK4 A;  1YJ9 P;  2FYU J;  3M0D C;  2AEJ A;  3ZDM A;  1NJI Q;  4DT0 A;  2JWD A;  1KD1 Q;  3D71 A;  1KQL A;  1USD A;  1JB0 J;  5AVW B;  3CLQ A;  4HJG H;  1PGQ A;  1OIP A;  2R3S A;  4IFD K;  2AXT H;  5E79 E;  1LTA C;  4LLH A;  5CCG C;  1K9M Q;  3D6Y A;  4MN4 C;  1L0N J;  2WSC J;  2FYU K;  3M06 A;  3D6Z A;  4NPF X;  5CCH C;  2UWJ E;  3V4Q A;  2NPS C;  3HE5 B;  1H0T B;  1BCC J;  1YTZ I;  2M5A A;  3FXD A;  2ZT9 C;  1VQM P;  3P7K A;  3H1J G;  5DJU B;  2KP8 A;  4N6J A;  1YI2 P;  1EZV E;  1L0N K;  2XND H;  1PP9 E;  1KYO H;  5KJ7 A;  2H89 C;  4PJ0 E;  1VQ9 P;  1Q2N A;  2YXR B;  1ZME C;  1VF5 D;  5GTI H;  3AE1 C;  1PZQ A;  1LTT C;  1SFC C;  4H0L C;  3HE4 A;  3RK2 C;  1BSN A;  3AEG C;  1PP9 D;  1XTC C;  2KNC B;  1DX7 A;  2P10 A;  1YQ4 C;  1S5L H;  3H1K E;  3I5C A;  1ZRT E;  2K37 A;  4U7J A;  1J1D C;  2I8D A;  2QRX A;  3AEF C;  2KUB A;  1RE3 C;  3FGA D;  1JNM A;  1M90 Q;  4GOD A;  2N9B A;  5AW3 B;  5C39 A;  3F5H A;  4BRY A;  1FU1 A;  2Q3E A;  4IFF A;  1R5S A;  3KZI H;  1JY2 P;  1KIL D;  3H1K D;  1NTZ J;  1ZRT D;  1EDI A;  3WUV A;  2WIT A;  2FYU E;  2WSE J;  1LJ2 A; 
#chains in the Genus database with same CATH homology
 1LJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...