2R32A

Crystal structure of human gitrl variant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
158
structure length
140
Chain Sequence
RMKQIEDKIEEILSKIYHIENEIARIKKLPCMAKFGPLPSKWQMAPPCVNKVSDWKLEILQNGLYLIYGQVAPNAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Assembly and structural properties of glucocorticoid-induced TNF receptor ligand: Implications for function.
pubmed doi rcsb
source organism Saccharomyces cerevisiae, homo sapiens
molecule tags Immune system
molecule keywords GCN4-pII/Tumor necrosis factor ligand superfamily member 18
total genus 32
structure length 140
sequence length 158
ec nomenclature
pdb deposition date 2007-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2r32A01
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r32A02
2WPSA 1MUUA 1YYCA 5AW5B 3M0DA 2WTYA 2Z5WA 5AVVB 3LKJA 3MGNA 3T97A 4F3JA 2QM7A 2WNVA 1JUNA 1XU2A 2TUNA 3P32A 3VYIA 1HWTC 1IO4A 1OXZA 2KA3A 2Z5HA 1C3HA 1RJ7A 2VRSA 4HT1T 1U5YA 1TNFA 4AQRD 3M9HA 3OAKA 1S55A 1I9RA 1NAFA 4E4DX 2H7HA 5AVSB 3KQGA 4DZOA 4AUWA 2BASA 3VTPC 4MXWB 3M0AA 3M91A 4XE5B 2W6AA 3L36A 4OULA 3IR9A 4JYBA 5AW4B 2N9BA 1OQEA 3B9IA 1GU4A 5AVXB 1U5XA 2R5DA 2YNYA 3V4WA 4C46A 1FOSE 2YO3A 3NXSA 1G2CB 3P7KA 5AVUB 3HE5A 3L35A 4I6MC 1NWQA 3V56A 4GIQA 2Q3IA 5CIRA 4EN0A 2R30A 5AW7B 5AW8B 4QQPA 5BNQA 4JYCA 2ZPXA 3QD6A 4G3YC 3L9JT 4E4SA 2WPQA 5L36A 2JG8A 5APQA 2QM8A 1D0GA 1HBWA 1JTZX 4MXWA 5L19A 1A02J 2P7JA 1HUCA 1FOSF 1O91A 2WNUC 3M9BA 5AVWB 3TYYA 2E42A 3SWFA 5AW0B 4TWTA 5APTA 1CSBA 1X8YA 1GZLA 3TK1A 4C7NB 3V4QA 4KGGA 1CZQA 4G4FA 1T2KD 5KWRA 2E43A 1OQDA 4GT1A 5APYA 3NTNA 3HE5B 4GKGA 2C9NY 1C28A 1MFZA 2W27A 1CI6A 2E7AA 2QDNA 1MV8A 1GR3A 4QQLA 1GD2E 2R32A 4C7NA 4AYCA 5AVRB 4J6GA 2JG8B 1T2KC 3B94A 3QBQA 5HBAA 1CI6B 4I2LC 1S9KD 2O0OA 2RJLA 1S9KE 3ME2A 2Q8OA 2AZ5A 3TYJA 1D4VB 5APSA 5APUA 1A02F 1KD7A 1D2QA 4TSVA 2KP8A 1PK6A 2Z5IA 2Q5UA 4RESB 5APVA 3UIAA 1A8MA 1U5ZA 2JG8C 5AVZB 3A5TA 1WCKA 4MSVA 2JJLA 4NN0A 4DOUA 2TNFA 3URFA 3HTKA 4M3LA 2OIIA 3O8ZA 2R3CA 5APXA 3IT8A 2WPRA 3I5CA 5CMZA 3MI8A 4MXVA 5AW1B 4QQHA 1PK6C 1DH3A 3AB0A 2RJKA 3ALQA 3HE4B 3B93A 5TSWA 2JG9B 1OWAA 2QE3A 4QPYA 3NFQA 2X29A 2WNUB 2YO2A 3MD0A 2RE9A 4N90A 1H88A 3V5BA 1FAVA 1PK6B 2R5BA 3HE4A 3P8MC 2HEYF 3K48A 3B8EB 2JG9C 5AW2B 1H8AA 2HEVF 4HYTB 3KDPB 2ZFCA 3A7OA 3L37A 1SP4A 5AVTB 1JH5A 4QQ2A 4EOTA 1JNMA 4RSUA 2P67A 1ALYA 1GK4A 1TNRA 5KC6A 5AW9B 1KQLA 3VMZA 5AVQB 2WT7A 4OUMA 4DB5A 3TNUB 2XV5A 2C9LY 2XU6A 1KXGA 2JG9A 3VMYA 3VN0A 4D7YA 2P2UA 5AVYB 1DG6A 1GU5A 2Q7CA 1OSGA 1RJ8A 4QQOA 2WNUA 1IQAA 2WWWA 2R6QA 1J2JB 2ZXEB 3A3YB 3M06A 4B86A 1DU3D 3FC0A 3TNUA 3K51A 4KG8A 1GTWA 5APWA 2XZRA 1SLQA 2IPPA 4LC1A 3LIDA 5AW3B 3LIEA 1HJBA 4KGQA 2ZJCA 3WD5A 1XU1A 1GK6A 3NMDA 5AW6B 4KHXA 2Q1MA 2WT7B 3VMXA 1H89A 2WNVC 3TWIA 4OUSA 2WNVB 2HEWF 5KC5A 3A2AA
chains in the Genus database with same CATH superfamily
3AXDA 2XKMA 3M9QA 1ST8A 2NLRA 1SQXJ 2P1BA 2PTMA 2NRGA 1PM7A 1UO9A 3WP5A 2D97A 4N43C 1FMD1 3VBUC 4CEWA 5JDBA 4O65A 3ZXGA 4H44D 2SLIA 3TGUE 1EY2A 2LRPA 1IO4A 2QQWA 1POV0 1UU6A 3PJQA 1X9PA 4XZUG 1NTMK 5FZ7A 4A45A 1XYOA 5DZGA 1FJKA 1BQPA 2HWD3 1PVC1 3GJAA 2HFED 3GYDA 1QHDA 5FZ8A 4MLOA 4LLOA 4AUWA 5F5IA 3KZIH 5LY1A 3RL0g 5T5JA 5JPNB 1GLHA 2W6AA 3VBFC 2BFUL 4U7JA 1S0IA 4PI0A 4D3WA 2ARBA 3FJSA 2OX0A 1JI6A 5T5PA 1JOJA 1VBD2 2NPSB 5J98B 3T2TA 4COZA 2GN7A 5A33A 5FRAA 3RRDA 1NY71 5C3RA 4X6RB 4NIHA 5BNQA 2YY1A 4K35A 4JYCA 3LOIA 4OHYA 2HLEA 2I74A 3JZVA 1NH4A 1R1A2 1LU1A 2QCSB 3ACHA 2KIKA 1O6UA 1H4GA 1APNA 1LGHB 2A6XA 2Y6JA 4IDZA 1EUTA 1HUCA 5JR2A 3E1RA 2PHWA 4PBPA 3AX4A 4EIJA 1X8YA 2IVJA 2PA7A 4CU8A 2DCYA 1JZ5A 1WMXA 4R4ZA 1FPN1 4WVVA 3S1KA 2GH8A 3BOWA 4GT1A 2BNNA 5FJKA 1BE3J 3R2PA 3VLBB 3PJSK 4QHOA 4P9WA 1SDWA 5T52A 3U0ZA 1GD2E 3P5BA 4Q0VA 4QX3A 1WMFA 2IYOA 2ILMA 4FBFA 1T6AA 5KLVJ 3WMM0 3JCIA 4BZ4A 2QZ3A 3H25A 3CPWO 3SFEC 1XYNA 2A75A 1C4RA 2D6OX 2Q6QA 5CZKA 2XMLA 3RQ0A 2FDGA 1US2A 5JOXA 1UXXX 1UL9A 4A7YA 4YFZA 1L4AD 5CEHA 4WY4B 3IM0A 2HBTA 3L74G 5TJHA 1UY4A 5ABJC 2Q5UA 2ZKNA 1L0LK 2CTVA 1I5ZA 2LS6A 2WSFJ 4A6OA 5JI7A 4CCNA 1UIJA 4QKDA 4D6QA 4COUA 1EAH3 1XNAA 2VCMA 2XOMA 1OMIA 2ZT9C 4W80A 4E4ZA 2E5TA 1HJ0A 3L75J 3KT4A 3AK0A 1IKPA 5FY1A 3ZFFB 5ACA3 5AC91 3MI8A 1JY3O 5JXHA 1DYOA 1R1A3 1TMF1 5IATA 1EZVI 3AB0A 3VD7A 4Q27A 4BQ4A 1OWAA 1W6MA 2BTVC 2VD7A 1MPXA 2WN2A 4RS5B 3BCCD 2WNUB 2RE9A 1Z0HA 1LGCA 3W9AA 4BIFA 1OLQA 4XF9A 1D4M1 4XXPA 1XBFA 3P8MC 1OVPA 2HEYF 4COVA 1PO23 2KR2A 3K48A 1UKRA 2XVLA 4H3WA 4IV3B 5FZ1A 5IT6A 2D93A 4FO9A 1LNSA 4D6TJ 5F3IA 2D3SA 5L9BA 2YZ4A 4K21A 4DS0A 3ZYBA 1ZXGA 2A06E 3QACA 5F1RA 3H8RA 3BRVB 1H2KA 3N7JA 1H6XA 2QQPA 3JSVC 1QJX2 5FY8A 1MEC3 4XC9A 2D3RA 4XUPA 4OUMA 5LA0A 2FCTA 1CAVB 1C1LA 3CX5E 3T30A 3H1JE 1YUDA 3C7OA 2FYUJ 1CN1A 2R6QA 4K1ZA 1Y9QA 2FXPA 4LUKA 3TNUA 2IC1A 1NG0A 2IVIB 4MG2A 1NQDA 3PH0A 1MS5A 2ITAA 1JW6A 5A7WA 1PMJX 2J1TA 5FMOS 5LK5A 3RYKA 4M3CA 3WNPA 1X9TA 1W8OA 3VKMA 1W2UA 3V65A 4CDXA 2Q1MA 4XABA 1BK0A 3R05A 4EZ4A 3SCGA 4L76A 3KQ4B 5JXJA 4WV8A 3OEBA 1E79H 2Y6LA 1O8PA 2R7EB 4AFCA 1OA3A 1ZRFA 1DX7A 3ZXKA 1JO5A 5I93A 2LROA 2OXBA 3RZHA 4IL6H 1N47A 2JKBA 1JYCA 2Z5WA 5G04L 3ZSEA 5EYYA 1SQPE 4F3JA 3L71D 2KD7A 1OOPC 3R4SA 2ZMNA 2Q8EA 1G9CA 3TGUJ 3ZYFA 1VR3A 2AREA 3P1IA 5GLUA 4EWAA 1FNYA 1SQPK 2HWD1 2VRSA 1MACA 4OHVA 5L73A 1FAYA 5K9YA 1L0NG 4N6JA 4XJWA 4XBNA 1GP5A 1OW7A 1O3RA 1WMEA 3G6EP 3AKTA 5FDBA 3CX5I 2YFUA 1RUH3 3AP5A 3UKTA 3NSTA 4WZCA 1GU4A 1U5XA 2D98A 1FZFA 4DEVA 4RL7A 4QKFA 4AVTA 3A0BH 5E79E 1X82A 5J96B 1SQXD 3HE5A 3RK2B 4BQXA 4EYUA 1OA4A 1SLIA 2YYOA 3AMPA 4TLGA 4Y24A 2PLV3 4OMDA 1VBA2 5CIRA 3H9AA 4AI0A 1XNCA 3I4IA 3QD6A 2WYSA 1BKZA 3P3PA 4TT3H 1NCQA 2WPQA 4MGZE 3V2QA 4ZS2A 5H9QA 3ZR5A 4Y4RA 5LY2A 3UGGA 1BGYE 2C6SA 3RL0D 2FMDA 2ZX1A 3C7GA 4IV1B 4RHV2 5FBZA 3BUCA 2W1UA 3MW3A 2XJSA 1J1EB 3O6QA 3TYYA 3BPZA 4PBOA 5DQ0A 2D5HA 1AYM1 4KGGA 1PZ9A 3ZXJA 1WCDJ 1SQVG 1LKNA 3WQ0A 3ZDVA 1OXCA 1PGL2 2WRAA 5KHJA 3B5NC 2QRXA 2VM9A 3LFIA 1ENSA 2UWJE 1SG3A 1ZVFA 2YPDA 2DVDA 4MO3M 4NRPA 3IF4A 3D4KA 3V6IA 3AE4C 5F9TA 3G3ZA 3A4UA 5SV8A 3PTRB 1ZOYC 1DDLA 4FPYA 2BCCG 3AE8C 2E63A 2WDBA 1F4AA 1WA4A 1WLWA 3ASIA 4Q0QA 2VZTA 5FZMA 3VP9A 1GQGA 3TYJA 2BGCA 2YKQA 3U11A 4CCLA 4M4PA 4MGSA 3RK3B 3WINE 4L92A 2VBBA 2ZX2A 1N1TA 4N78D 2P5BA 3VL9A 4JRLA 3I49A 1F31A 1HTLC 4CEYC 1RE4C 2PN5A 5FAXA 4Q1PA 2NPSD 2ERFA 3L2YA 2KUBA 3TNQA 3O8ZA 4BQYA 1W0PA 5FXWA 3CZUA 5F6LB 2BVBA 1GMMA 4XDOA 4LO4B 4YW6A 2X8KA 1H2MA 1Q3EA 2GP3A 4OLLA 4YVSA 5TSWA 4QPYA 3T4VA 1RUD2 1T6GC 1FZAA 1ZRRA 3RWNA 5LK7B 2A3YA 2OVUA 1TE1B 4S2FA 5KLIC 3FUQA 1V9U3 4HOOA 3RGBA 3LCPA 4CCOA 3KV9A 2OT7A 1KITA 4SBVA 2WUHA 4JAAA 1YIFA 1HN0A 4KG0A 4Y1UA 4EV0A 1ZV8A 5FZ4A 4AHZA 2Y0EA 2DYCA 2QJPC 1PZ8A 5CKQA 3THPA 3G4SP 4NJ4A 1RUF2 2DVAA 1BE3E 1BZWA 1AJKA 2A73B 4LOSA 3MIWA 2WNUA 4O9EA 5FMOL 5ABJB 1K05A 2EXJA 1YRZA 5CBLA 1S2KA 1VBD3 1L4AB 3H7YA 3NV1A 1UU5A 1W9TA 4LNVA 5CKMA 4BISA 2N1TB 3L73E 1SLQA 1BVVA 1RUI3 1PZQA 3B71A 4LC1A 2ORXA 2YU1A 3PU8A 1UOBA 3ZXEA 1TME1 2XJQA 2ZACA 4LBQB 3WOGA 5LRSA 2D6LX 3D3AA 3OA7A 1VBC3 4FPKA 4PIXA 4AW7A 1OC1A 1JZ4A 1ZBA3 4RHV3 4CXYA 3USUB 3ZYHA 1V6LA 2VCCA 3RK3E 4IXLA 4Z1MH 5FP4A 4PIZA 5FZDA 1IS3A 3U07A 4R4XA 5FOBB 2HEWF 1WLTA 5DAWA 4GB33 2WS93 1SCSA 3FMGA 3JCUH 2W87A 1XE0A 4B4PA 1E5WA 1Q90D 1R092 2YGLA 1V6NA 1VQMP 1SBFA 3LKJA 3WDXA 3AMNA 2E33A 2IBZD 2P58A 5SV5A 2Q9IA 3OW2O 2ADEA 3QCWA 1GP4A 1KEXA 1IC2A 1WD4A 3LF7A 3VZLA 3L70J 2XUEA 3VZNA 4GOFA 1R091 3A0KA 4C1XA 3UGFA 1VPHA 4ONUA 3POEA 3RWKX 4AQRD 2I2SA 1CZVA 2QZ2A 2VR4A 2OARA 2JDNA 1OVRA 3HN1A 3PP5A 3KD4A 2WSFH 3WUUA 2ZGRA 4N53B 1UZ0A 4W6XA 2BDRA 4YVWA 3WF1A 2XPJA 3BCCG 2FYUK 3HNMA 3PVOA 5AW4B 1QJU2 2N9BA 2XONA 3VB9A 4ZKTB 2J59M 1ZLLA 3H1KJ 1K5MB 4Q4Y2 4YW1A 5BNOC 1OUXA 5KJ7C 2ZGMA 1MZ9A 4KWJA 4ORFA 3MIFA 1N2DC 4IV3C 5B4NA 3H1KD 2XR4A 3CXHH 3JUUA 4IL7A 4QXBA 3OJAB 1H4HA 3J7LA 1NTKJ 1BSNA 1EUUA 5FZIA 1GL2D 3W58A 1NU1K 2QQNA 3H1ID 5DABA 1PGW1 4IUGA 2Y0CA 4AE2A 5F8PA 4E4SA 4Q8KA 3N7KA 4GWIA 5BNOA 3FXDA 2XNDH 4H0LD 1CAXA 2WWJA 1M57D 1OT5A 2B46X 3FBMA 3ZN5A 3H8XA 4YWAA 4HLTA 1BGYG 4LA2A 2G9GA 5K8SA 5GTHH 4TWTA 3NNJA 1GZLA 4C7NB 1F2NA 2AACA 2PGDA 2VNRA 1UF2C 2WLQA 3RK2D 4H7MA 2GMEA 5FMDA 2DVBA 3WF4A 5APYA 4AVBA 1OH3A 2JDAA 1J1LA 4AGGA 3WF0A 3ETQA 1EQ7A 2EICA 4FI9A 4HVRA 3WNXA 4FTBA 1PNFA 4DPNA 1YQ3C 2FBWC 2ZVNB 2VTXJ 3LDBA 4AK3A 4J25A 1H8VA 1R1ZA 4W6YA 4WM7B 3WDTA 2MKVA 3CMEP 1JZ7A 1JY3N 2RDSA 4K8FA 4QB1A 3RMYA 2POHA 5H9PA 2CL2A 2Z4EA 1W9SA 5FXVA 3SWKA 1L3JA 3G6JB 4KI5M 1Y8AA 1QNWA 2ZMKA 1H0TA 3LEGA 1DZTA 4YXDC 4FAGA 5BVZA 2K9JB 4G9SB 5GLWA 3B00A 5AVZB 1BJQA 1UMZA 1W8ZA 2QQUA 2JJLA 2VZ1A 4URAA 3VZKA 4FTSA 5APXA 1S72P 2JXAA 1FU1A 2R0FA 2RG4A 4LHLA 1SQBD 4PJ0H 1W6OB 1Z78A 5BU5A 1RMU2 2VNOA 5AW1B 2G8YA 3L75G 1PK6C 4QPIB 3PRJA 1K5MC 2Q1FA 4BQ5A 1SLAA 3L73G 1CX4A 1RUI2 1JXNA 3B93A 3FWNA 3BCWA 3RK3D 4I09A 2VU9A 4JZRA 1G86A 4RS5C 5FYVA 3V0BA 5TISE 3VHRA 5LBEA 2EIBA 1WMDA 3WHUA 1SS1A 1DQ5A 4UYBA 4HFSA 3W20A 2W94A 3IMNA 2WABA 3WSOA 1YQ4C 4CU6A 1HB3A 1UYXA 5JR7B 1BCCG 2J22A 4RO0A 2W0XA 5IVBA 1RHZB 2E75D 4HZFA 4LBKA 5T5OA 5KXCA 1XNBA 1MZEA 4XUNA 4FT8A 4N43A 2O01H 2G4IA 4FCAA 3D0JA 1BE3D 1KXGA 4LBMA 4AG4A 1KYOE 2HWC3 1AR92 3JD71 4EDFA 1POV3 1S0BA 1QX8A 1NCRC 3P3NA 4DXZA 2YC4A 1SQVD 5CISA 1DU3D 1ONAA 2VNVA 1KTMA 1GNZA 2ZEWA 1DGLA 2KI7B 4W7YA 3OEAA 3I3DA 5D8AB 1S5LH 1Y4WA 1QXRA 4W4ZA 1Q8SA 4DNYA 5C8WA 2AXTH 2ZT9D 1LOFA 1XSRA 2VMDA 2ZXQA 1K5JA 2OTLP 1JY3P 2GM4A 3M2MA 3G7DA 4QDSA 3UT0A 3WP3A 2X09A 1K3IA 5JMOA 1BXHA 1G9DA 1GICA 3FE5A 3BTAA 4MHUA 2XWJB 1V6IA 5JZGB 3S5AA 2WNVB 2IXIA 1SHWB 2ZAAA 3I2DA 2ZGOA 5ABJA 1L0NK 3BIWE 3EB7A 1AX1A 1ASJ2 3AYDA 2VL4A 3I3EA 4NROA 4QGMA 5LATA 1T3JA 1BGYD 5AVVB 1UXZA 1PGQA 3T97A 1CPMA 2K9ZA 2QM7A 3EFFK 2R061 2YROA 4OHWA 3DXUA 4AEDA 3H8OA 5E16A 1VF5D 3KV4A 2VNGA 4LBQA 1ASJ1 5FPLA 5L9RA 1VAKA 3WF2A 4C7RA 4A7ZA 5JOZA 5C39A 3ABVC 2C0ZA 3M1HA 3Q2YA 4YRDA 2HYKA 4B8EA 1RUD1 4XE9A 2FY8A 3OAKA 1QDCA 5M1BA 1WKYA 1UOFA 5AVSB 1YQCA 3AZYA 2KOGA 1SQPJ 2MEV1 1W39A 3RMXA 3ZM8A 3ZYPA 4CDWB 4B1LA 1RB8G 2PLV2 4KBZA 1KILB 2XB6C 4MYEA 2DBNA 5IVFA 1A3KA 1GYKA 4B7EA 1PP9J 4X8PA 1W2BO 2BGPA 4IE5A 4YNIA 5IHRA 5H2FE 1W05A 3L70D 1IPJA 1DZQA 1OKQA 2XHNA 3POSA 3Q8CA 3AEGC 2XBO2 4M00A 3E6BA 2R30A 4HKOA 4NWVA 2BCCE 3ILFA 3I2KA 1JYTA 2D2CD 1YITP 4LBQD 4R9AA 3VBOB 3MIEA 2NYYA 4GMP3 1KDMA 4HXCA 4SLIA 3AJYA 2XBO1 1UWWA 3EBRA 5A32B 5C3PA 1PZ7A 2P2KA 3RK3C 3K4DA 4U2AA 4K3AA 1BHGA 2DDUA 1FOSF 1O91A 2IXLA 1QLED 3M9BA 1PFIA 3H1IE 2P4EA 2VBDA 4MGQA 1NCQB 2D2CC 2FYZA 1OQ1A 2TEPA 2PAMA 2ZKLA 4GWMA 2NP0A 1CWPA 2ZVOB 4ZKPA 1N1SA 2FYNB 1T2KD 2RR11 2XJRA 3DXTA 4BRYA 1MQTC 1MZFA 1RUH1 2W2IA 3NAPB 4FQZA 4YGCA 3VBRC 2FCUA 2E74B 2W27A 3HRNA 4AYUA 1OFSA 2R32A 1CIYA 1LT9C 2RVAA 1N1VA 3DEMA 4QX5A 1ACCA 3CJIC 3MW4A 1G6NA 4D69A 3LIGA 1S2BA 1TVGA 1CI6B 1PGJA 4KJMA 1LTAC 1KFUL 5LEKA 4JQ0D 2DURA 3O0WA 1KYOH 2PHDA 2DU1A 2Y8KA 3POGA 4UFIA 1D2QA 3T08A 4YG6A 3WUDA 2Z5IA 1OA2A 3RZJA 1RVF1 1WUVA 2SPZA 3VBSC 2HPCB 1XE8A 3IDBB 4F83A 1SQPG 4IV1C 1N3QA 2ZABA 3H1JG 1C8M1 3HTKA 1QF3A 3U78A 5GALA 4B29A 4DXSA 2FFDC 1DF0A 2AXTE 3JXSA 2RDQA 1UAIA 2QVAA 1XNDA 3N9MA 4FOVA 4Q4X2 5EIYB 2IZWA 4C8DA 2PQQA 2RJKA 5ANNA 3W5MA 3T2OA 1JTHB 3H1HD 1AR82 4XFCA 2E7TA 3HNBM 3E7KA 3J26N 3MO4A 3QH9A 2A45H 2QDRA 4P9LA 2VC9A 3VBOC 3PVEA 3ZDSA 2WT0A 4N90A 1L0LJ 4XMAA 5E8AA 2BBAA 2BZDA 1XOYA 3K46A 1XJAA 1S5LX 1GL2A 1AUYA 1UIKA 2VOXA 2XLGA 4M4RA 1HRI2 1L0LD 3LPGA 2V73A 4HK8A 3A7OA 5A7WB 1QJX3 3HMYA 2YKPA 2XKPA 4MGYE 4BJ0A 1JNMA 1HQLA 1W6QB 3KLSA 4W65A 3WUCA 4N78E 4E2QA 1W0NA 3WCRA 2OYHC 1KQLA 1QQP3 2M0BA 4J1XA 4QX8A 4XXAA 3AEAC 3JD73 4R4LA 1SVFA 2VMCA 4Z2WA 3JC22 2P2UA 3QH6A 2JE9A 3LWCA 1CX1A 1IQAA 5FXZA 5HV0A 4NWWA 3L72E 4Y28J 1UMHA 3L72J 1X79B 2OYHA 3WP4A 4Z07A 2ADDA 1Q8QA 3A7QA 1N8RQ 3WD5A 4V2WA 1VB2A 1QJEA 4NIAA 3HD7D 5C3SA 1IFIA 1N86A 1LHUA 1YFUA 1FATA 1ZZBA 1L4AA 2EIEA 2HYXA 2OW4A 3EQEA 3MLKA 4PHZA 5FIXA 4A7PA 5KKZC 1EZVE 1ZW0A 5CVRA 5JIAA 2ENRA 2RS53 3ZPYA 3C9IA 1MUUA 3NO8A 1W28A 4O9GA 2ZYDA 2VH9A 4YM1A 2W8ZA 2DTYA 1BMV2 5CBNA 2BQPA 5FYTA 4CYDA 4R8HA 4FVVA 1PVC2 4YZ4A 1HWTC 3OPTA 1RUI1 2CPSA 1TNFA 3K5BA 4QXHA 1I9RA 4LR4A 5IAVA 3H8UA 3KQGA 2JEMA 1LTJB 3OBZA 2RS52 3GF3A 2C26A 4Y1YA 3ZFGB 4IEZA 4OULA 2P34A 1V6OA 2DVGA 4XUTA 1GOGA 2VW1A 4XFAA 5DPNA 4AQSA 4AFDA 1LESA 2VBPA 4L75A 2GZWA 1M7LA 1W90A 1YCIA 2QQLA 3WVJA 5C5UA 1AVBA 2VMHA 1SFYA 4ZXEA 4FP2A 4I3GA 4KL1A 5C70A 4CUGA 3ZFFC 2XQXA 5FKCA 1DD4A 1SQPD 5KLIB 4LT5A 1WMKA 5APQA 2VMEA 2PHTA 4LK6A 4XF1A 4Y3OA 2WO2A 4CP0A 2E42A 1B35C 2NQYA 3MUY1 4QPGC 2GUVA 1UZVA 2Y34A 4WY4C 3IN9A 2BW8A 4I0BA 5DUWA 5FYZA 1DGRN 3EMRA 3PUQA 4OUEA 2Q4SA 1NOVA 2V72A 4RR3A 4A7KA 5KWRA 2FDIA 1JHNA 2ZEZA 1R64A 4FOYA 2O01N 5F3CA 3NJVA 4FPCA 3VDDC 3EXUA 3ZKYA 3GZAA 4C7NA 1RF0C 4CE8A 3F95A 2OPKA 3I8TA 1VALA 2KSJA 2WMMA 4WY4A 3WU2E 2WQ4A 5BYNA 3L73J 3B69A 1EV12 3CWBG 2ET7A 4EYYQ 1NKGA 5HBAA 4FFHA 3GNEA 5I91A 1O3TA 3NNMA 5HPOA 3ENRA 1H9WA 3HIFA 3FFZA 2WITA 1O5UA 5GTIE 1SDDB 2BOJA 4FPJA 4JCKA 4B4RA 1AJOA 3S6PA 1EV11 3WLUA 1YTZI 4CP1A 4TTGA 3OY8B 3NAPA 1I6XA 4AHWA 3KHCA 2VUJA 1IK9A 3BCCJ 1WCKA 3A22A 4UFMA 3L74J 2LALA 5FLJA 3BOPA 4Y26A 1AV1A 3POWA 2C24A 2MJZA 4JV4A 2BU9A 4LQRA 1YFXA 4MXVA 4A6SA 5A1LA 5BY5A 3LB9A 1D4M2 4WB4A 1YBKA 1Q86Q 2DUQA 1KV4A 4MGKE 4XFIA 3WEZA 5ISLA 5KJ7A 1D4M3 1WLCA 2ZMLA 5CAZA 4BQWA 1H88A 2R1BA 3HE4A 1QNYA 3D71A 2VQ0A 2AUYA 1GV9A 3NQHA 4XJ8A 1QJX1 4CCEA 1YTZT 2Y6KA 2R071 3CC2P 2B8MA 1NAEA 3LDKA 2E74D 4XZPA 1IKQA 2DCJA 2UY8A 2KM2A 3S7EA 4X8NA 5LW9A 4O61A 2W92A 2I1KA 3AL6A 3OGVA 2R041 4KMQA 1BBT1 5AW9B 2GNMA 4AI9A 3ZXAC 3AYCA 3H3UA 3TNUB 1SACA 1RUE1 2XU6A 4GB31 3J7NA 3VMYA 3FFQA 1LT1A 1ULOA 2WZR3 3JQWA 1KORA 1FC2C 4BMBA 1JUHA 3LD8A 1RHI3 2QQOA 3PMSA 4GB32 5KXEA 3KSCA 1L0NE 3ZMOA 3CZJA 4UXAA 1Q8OA 2ZGTA 2OKXA 1L7QA 2JB4A 4K1YA 3VBRA 5C9AC 5J09A 3CXHD 2ZAEB 5AW6B 3OGGA 3VDDA 3H6PA 3LZZA 3UGHA 5A1FA 5F7UA 3B5LB 1PX4A 4EWDA 5C4WC 3CL3D 4ASMB 5L7OC 2W1QA 3B5NB 1J1TA 2AR6A 1AXKA 1STMA 2N9YB 1RVF2 5GTIH 2WT2A 5FZBA 2D43A 3T0BA 4IQPA 4ZZ8A 5L9VA 4EWEA 4CXWA 1C8M2 4KWKA 2AC1A 2OYHB 3I3BA 4JHTA 4OQ9A 4FPGA 1VBB1 2TUNA 1NJIQ 1G9AA 5B4XA 1SPPB 3NAPC 1SFPA 1AL21 3TF5A 4MADA 1DFQA 4LHSA 2W91A 3WG4A 3KHBA 4DQAA 4AEDB 5CBOA 3WU2H 2IXJA 5BNOB 1TU3F 2UYAA 1AL22 2XJTA 4QXKA 4JGYB 3TB0A 3TRSB 5KXDA 5CFCB 4QAWA 1NTZD 3OG2A 3IR9A 4C91A 2ARAA 1UN1A 1IFNA 2GMPA 3JBG2 2EAAA 3Q8EA 5AFEA 1DGRA 1NLRA 2VO5A 3VHOA 4W50A 5FP9A 5I0DA 1RH5B 1R082 1Y3TA 1HLCA 4IV1A 3JBG1 1GZTA 1SLTA 4NRMA 4QDRA 1YI2P 4R9DA 4AFAA 1HRV3 3KGZA 3RZZA 2QIWA 2RMZA 5CFDC 1S4XA 2KZJA 1UY1A 4K20A 5I0UA 2VUCA 2WFPA 4Q4V1 5JMCA 3MF6A 3VUOA 4AQTA 1N73B 4GD4A 1PP9E 2PQSA 2PFXA 3SH5A 5FYBA 1NCRA 1YFYA 2QTWB 3LE0A 2R0HA 1VF5B 1HXS3 4GKYA 3AMMA 3VD4A 1YJ9P 2W1WA 4K8RB 3DCQA 2CK3H 3SNMA 3U14A 2E43A 1K45A 3ES4A 3HBKA 3AP4A 4YZ3A 4UB6H 1XXNA 1LT9B 2YXQB 4LORA 3DKQA 4QX1A 4LGDE 3O1MA 4HK9A 4AYCA 2YV8A 1QGKB 1OF4A 3BVCA 3HPNA 3LEMA 3VZOA 1L4AC 1GWMA 2JKXA 3FUOA 2RJLA 4QMAA 1NU1G 5GTHE 2Q8OA 5JWPA 1L0NJ 2VOVA 3P8CD 3H1MA 4O9BA 1S0DA 1ZX5A 2BGOA 2V09A 4YM0A 2OPWA 3MFCA 4H2AA 4YW3A 5FREA 2NZ2A 1RMU3 1DD3A 3TGUG 2BP6A 2CAVA 4PJ0E 2X5IC 1W2EA 5FTTC 2QG4A 5CHXA 1DQ6A 2W46A 1PPJD 3NJXA 1QJZA 1JS9A 2R3CA 3VOPA 4ZMDA 1U57A 2GNBA 2P1JA 4WWIA 5CMZA 1LEMA 2AEYA 5TISH 3OOXA 3T4HB 1POV1 2WZ8A 4FXKB 1V0AA 4HBNA 1DQ2A 2O1QA 1AR73 3LAGA 2FD8A 3E5XA 2ZOEB 1ULEA 4J1WA 2YGMA 5J7MA 2YO2A 4QB6A 2JDUA 5FZKA 1UCXA 4I7ZC 5B5EE 4NHMA 1LTBC 2M3EA 4NOTA 2RS32 1IS5A 3TN91 2OYIA 1NU1J 3JU9A 1URQA 1QQP2 2K0GA 2WWUA 5C7GA 3MFAA 3H1LD 1BBT3 3GCWA 1ALYA 2P67A 5AFBA 1ZR4A 5KC6A 4WBAA 3M3OA 3LSEA 1EPZA 1SLLA 5JZGA 3HJRA 3S9OA 1YQ6A 3II6A 5AVYB 1UZZA 2BNMA 1KFXL 1RHI1 4FAHA 4GZ9A 4AR2A 3I2FA 1TME2 2VXRA 2WA3A 1KDKA 3C3VA 5FZLA 5L7OA 1JZ8A 3VD9A 2X53S 4JKKA 1OIPA 1EXIA 1J58A 1FI2A 3KVBA 1C5IA 1VJ2A 5JZGC 3BYWA 4Z1VA 2A6WA 2ZJCA 2FZ1A 4IE4A 3S30A 4BQ3A 5BPXA 1D0HA 1TME3 2VTFA 4N7IA 4A44A 2FBEA 2MEV3 1L7LA 3FX3A 4Q26A 4B4QA 3B5ND 2NMOA 3GALA 4JQRA 4XFFA 3ROUA 4HH2A 1H1IA 4XDQA 1FNZA 4F7ZA 1AR63 1VF5C 1VAMA 2CDPA 2WPSA 3PVBB 3RYRA 4BPZA 3IB3A 1Q7YQ 1ZR2A 4N7UA 2C0WA 4YARA 2DBIA 1X50A 3KF5A 4UF0A 5BU8B 3BASA 2E5YA 3RL0C 4OI2A 4OYUA 1TMF2 5IAXA 2CYFA 4JKMA 5FYSA 2XBO3 4H13C 2VCAA 4I0WB 4CP9A 2D3PA 2UWBA 5DJTB 3NNLA 3CF6E 5JVVA 5LRRA 1R093 3D82A 1R8EA 2HJIA 4B7KA 2IUWA 4CUCA 3S0MA 4KU7A 3M91A 2JJ6A 1KYOI 4UW6A 3CJIA 4OVNF 1X36A 3E1F1 1VQPP 1HQWA 2FHRA 3VGIA 4EI2A 4AF9A 4C46A 1OZHA 2VZ3A 3WQ1A 1C5HA 4RGGA 1G2CB 1FXZA 2DW3A 4I6MC 2WZ7A 1BBT2 2VCBA 1AZDA 4L9BA 2QQIA 4CXXA 3HWJA 2AEZA 3PUAA 1K9MQ 4YGDA 3N7LA 1H0BA 3MIHA 1JOBA 4IEXA 5HXVA 5IFTA 2WFF1 4HVOA 1RL3A 3TAYA 2HWF1 4OZXA 3B9CA 1FPN2 2XJUA 1WW5A 3H1LE 3F2ZA 4XBQA 4XVHA 2J7MA 3CX5H 3MP7B 4QX0A 5AW0B 1KQGB 5APTA 1CSBA 1FX5A 1PNGA 1W8UA 3OD0A 4M3CE 3RYPA 4N3YB 5FYYA 3L72D 4BWNA 5A3NA 4XUQA 4CDUA 2JWAA 5IVEA 2BRTA 3CC7P 4KT0J 1SQQJ 3SMHA 1GKBA 1WCSA 5ACA1 2XHKA 5C33A 4Q1RA 2YIUB 1KRIA 1URQD 3W59A 3A0HH 1VQ7P 2JG8B 1T2KC 2LW8A 5FWJA 4URTA 2ZAHA 2VJXA 4U3FE 3TNPB 4EE2A 2G3AA 1PGOA 1QXJA 1UKGA 1X8EA 2VVFA 3C7FA 1RUOA 1L0LE 1NGMB 1NXMA 2XDJA 2P17A 1MFTA 2IFWA 2YG0A 1PO21 4PQ9A 1HRV2 3H1WA 4UB8H 4JDOA 4KU8A 4AFBA 4TSVA 1N1YA 3HUSB 5APVA 2E53A 5J37A 1HH0A 4YFWA 2O14A 5DUUA 2RM22 3GZUC 4L99A 2N1TC 1ENRA 1J83A 3WW3A 3WCSA 1QWRA 1LWUA 3MBWA 1WZXA 4BOWA 2EXKA 1B35B 3J7MA 4H7LA 1QXPA 2JENA 1EYBA 1DH3A 5BNNB 2Z4FA 2BCCJ 5A7QA 3PIGA 5FUPA 1PVXA 1QJFA 4MVTA 5C71A 5FO7B 1Y7BA 2AEMA 4CDXC 1K04A 5AC92 4LXLA 1SQBK 4Y1VA 3I2OA 2KLVA 5CCGA 3BRTB 2KNCA 2DU0A 3FLTA 2JX9A 1T3UA 5IVJA 4BXSV 1Q2NA 1VPCA 1VDFA 2HPCA 4QU1A 3UNPA 3U1XA 1SP4A 1JH5A 4RS5A 5FZ0A 5T3NA 1LGBA 3CCUP 1HKDA 2YMKA 4RFT0 4AVVA 1O5LA 2BVVA 2E6VA 2WJSA 4LO7A 5DAXA 1TEIA 2VOTA 1NAYA 1HJGA 4LIUA 1GK4A 1M06G 5FK8A 4QGNA 2OS2A 3ZFGC 2O8QA 3ZYJB 3N36A 1EDLA 3HQRA 2RDRA 4DY5A 1NYHA 3GHGC 4E8CA 3BTZA 1WBFA 3IZOA 2O1JA 4YTPC 2HG5D 4I1LA 2IYPA 1BVP1 5KJ7D 2OUHA 4Y33A 5DZFA 2LR2A 3PMEA 4LO8A 2BEOA 2ZGPA 1GL2B 4NPFX 4IGPA 2XZRA 3DECA 4JX0A 1IFMA 2VVEA 5FBJA 5GZDA 3KM5A 5AW3B 1VBA3 4HPKB 1SQVK 3NMDA 1YXWA 1W8WA 3L2HA 5EJ1B 2R073 4AQ2A 5I8TA 1NU1D 5A80A 1PMIA 3WDUA 3PURA 4LEJA 1AR61 2A6YA 2HWB2 2AH2A 5CYYA 3TWIA 3UV9A 3VBRB 2X29A 4BWOA 1GZ9A 5GZGA 4ZHNA 2V7QJ 1Q81Q 2H6BA 3IAQA 2C0XA 3U1CA 1FZEA 4A2UA 2CSGA 1IS4A 2HWB1 1AYN1 3H1IJ 2WZR1 5LZ6A 2E76B 3WG2A 4PQQA 2L9LA 4D6TD 3CXHI 4FFIA 3Q5PA 4COYA 4D6RA 5LWBA 5FYUA 4ARYA 4Z2AA 5DDJ2 1W9YA 2W6JH 2GA1A 1CVNA 4N9IA 3WF3A 2H7HA 2VG9A 4E4DX 1PMHX 3B7MA 1JYIA 4CEWC 3S57A 1YFWA 1PGPA 3RZLA 1NHLA 3PLNA 3B9IA 1KB9I 1Z7S3 3MICA 2YNYA 3HQUA 2AXCA 1GZCA 2B45X 3A0NA 1NTZE 5C6CA 4CEWB 3V56A 2AENA 3KCYA 5C3OA 4LO6B 4LBLA 3ILRA 4QQPA 1US3A 3IIIA 5IK5A 1REDA 1VBB3 3VBUB 3I54A 1NTMD 2RKLA 3KXDA 3BVHA 3NKTA 3PNAA 3BODA 1NA1B 1VQ5P 1W6PA 2I07B 2VZSA 2ZGQA 1UU4A 1ZMEC 2VOWA 3OTFA 1YHFA 3W67A 1EV13 2YBPA 5FY7A 3ZFGA 4CEYB 5AVWB 3LPFA 1OVVA 4IEVA 1H9PA 5DDJ3 1HGZA 3RJ2X 1MVEA 2XL9A 3ITQA 4OVEA 1LTGC 5CADA 1MEC2 1PGSA 1G2CA 3L71J 3NTNA 1FE6A 4GKGA 1NE4A 2WSEJ 1OD3A 2YXSA 3P6BA 2I45A 1LNQA 2VZRA 1X9VA 3IFMA 2J1RA 1RYYA 1WCUA 2BYVE 3H1HE 2VPVA 1IG0A 3QBQA 2GALA 2Q8DA 4DRVA 3CDZB 4FFGA 1W06A 1YHQP 1O4YA 1F4HA 4AI2A 4YGEA 1MZ5A 5LEJA 2H0BA 3VBFA 4HJGH 2A45I 5APSA 1C8NA 3ZXDA 3H1KG 3ZYGA 4RESB 1U5ZA 2LTNA 2A3XA 4YXWH 3HN3A 1M1JB 3H1IG 4WVZA 4ISRA 4XAEA 1JTHA 1VRH1 4KH9A 5FY4A 2OIIA 3OD4A 3T0DA 1ZBA2 1EAH1 5CFDB 4F8AA 3L75E 2ARXA 1SQBE 2J42A 1CAWB 4W8JA 4IFDK 5CA6A 2KS1B 4DJGA 1EXJA 1OPMA 1LP1A 1VRH2 4Q4Y1 5IFPA 4GMP0 1U7JA 2FYUE 3ECQA 1VBD1 1NA1C 4PLMA 4XHBA 5FP7A 3NFQA 1BSHA 5CG9A 2AYHA 2VGDA 3HD7B 4BH9A 1VQOP 1RC6A 1Q8PA 2R5BA 3BB6A 4AEDC 3VN4A 1SQXE 5FPVA 5KBFA 2DCZA 3ZVXA 1RUG2 5A1AA 2CGOA 1RUF3 4QKNA 2HWF2 1JN2P 2JP3A 3IIAA 4XW3A 2XL7A 1LJ7A 3VBSB 1RF1A 4ASLA 1SFCA 4O7XA 5T55A 3V2PA 4TYSA 5BNNA 3BTYA 3N9QA 5JI9A 5C8CB 1W6MB 4HMZA 4XJAA 1DG6A 1F35A 2Q7CA 1QVFO 2W3JA 4PT6A 4AVAA 4DFSA 2VUAA 3MHZA 4NPRA 1ND3B 3GF7A 2PRRA 1AR71 4AVSA 4ASWA 4HB1A 1NZCA 2OYZA 4N53C 1GTWA 4PJYA 2GC2A 4IL6E 3ZKUA 4DXTA 5A3UA 4YSFA 3LIDA 1SQBG 3LIEA 2WNOA 2NN8A 1SPPA 2OZ6A 4KGQA 1ZBE3 4LITA 1OLRA 3MLLA 4QB2A 3AXEA 1V6MA 4WM7C 2RJ2A 2GDFA 4P9GA 4LBOA 1HF9A 1CW5A 4BQ1A 2WR9A 5AVAA 3UL2A 3ELNA 2WNVC 4E4HA 5BV6A 3SWYA 3H1KE 1V00A 5LBBA 1Y9GA 4DO0A 3AM2A 4LIVA 1AXYA 1H6YA 1VBE3 1LHOA 1CZTA 3OBTA 2O1KA 2HWC1 4DOJA 4OI0A 3MGNA 4U3FJ 1UYYA 5CJ0A 1JY2P 2WYFA 4TN7A 3B4SA 5KLVE 3Q8AA 4L73A 4NPMA 3MV11 5F37A 1LTJA 4IFMA 1CONA 1RY3A 1OLME 1YEWA 2JE8A 1WW6A 2O8OA 2WINB 1IFDA 2IFMA 2M5AB 3H1JD 3L75D 3INAA 1H8TA 3OYWB 2AEJA 5DG2A 4ZU5A 4CZSA 4ASKA 5J3UA 3AZWA 3GHGB 3DF0A 4WM8A 5B66H 1AA0A 4PV1B 1YNAA 2NPSA 3MV01 4MXWB 5A7OA 1Z7S1 3NWKA 2G9ZA 4JYBA 3NJYA 3CD6P 1OQEA 1VLNA 2SBAA 4GH4A 4QM8A 4LHKA 4OQ8A 2QJKC 4S2DA 5CCHC 3WXPA 2WIIB 3NXSA 3CJXA 2XKOA 1WT6A 2XJVA 5AVUB 2RMU1 4M0NA 4XFGA 3O1RA 2NPSC 4K7JA 1GQHA 4UFKA 1UY2A 3CWBJ 5F2WA 3KT1A 1NX9A 4BK5A 2ZPXA 1HRI3 1PO11 3V64A 2RMU2 2GC0A 3AZZA 5CNAA 5EZWA 1NKNA 4DEQA 1E5HA 1ENQA 1W9WA 3OBRA 4HONA 4XILA 1T2XA 3RS6A 3SLIA 5BNNC 2BUKA 1DLLA 1NTZK 3U59A 2D6NA 1Y47A 1CAUB 1SBEA 3MUDC 4HKLA 3EFGA 3J8F1 3FHQA 1OQDA 1CD3G 3C2UA 3K3NA 3KV6A 2HR3A 4Q4X3 4Q4W1 5FV3A 2EIDA 3LSDA 4NIIA 3V2RA 2E7AA 2ETEA 4P02B 2XH6A 4YVWC 5AVRB 3AE2C 3C8XA 5FY0A 1IK7A 1LTSC 2JB8A 3KT7A 4J6GA 3AP7A 1N3OA 3U4XA 3AE3C 1AFOA 3KF3A 1SFCD 4EZHA 4I2LC 2WSVA 3O14A 4LMFA 4XA4A 3AZXA 5CU1A 3TEZA 1NCRB 2QNKA 4UW4A 5FYCA 1RUJ3 4IE0A 4LKEA 1RF0A 4H13D 1PHMA 1W2AX 1NYWA 4QPGB 3IAOA 5C3QA 2KP8A 3AP9A 4EQVA 3BKZA 4DT0A 3N4MA 1JBCA 4GOEA 5C5TA 1S1CX 3AE6C 4JKLA 5JIUA 1NTMG 1AVYA 2OTJP 2BFUS 1KB9D 2TNFA 4XCBA 3NV4A 5JOWA 3RZMA 1X7NA 2EVXA 1KJRA 2H0VA 4R9CA 5FZOA 2K9JA 4BE3A 4OFGA 3LW5J 5GZCA 4LKFA 4M01A 2QJKB 2OQ6A 2CWMA 1GMJA 1E5IA 4ET7A 3AEDC 3AKRA 4RD7A 1OI6A 2Z79A 3CQOA 3U10A 1BEV3 5EJ3A 3VBFB 2K1AA 2R072 5FCCA 4ZY9A 1DIWA 4DUXA 3WDWA 1ZRCA 5FYHA 5JXGA 1MKMA 2OGUA 3CCJP 1QH7A 4P00B 1GDTA 2B87A 5K5GB 2V5YA 1SLCA 1H8AA 2R042 2VMIA 1ZZ8A 3ZIXA 1VQ4P 3FX0A 4QQ2A 5A7PA 5JSPA 1NU1E 1JY2O 1LGNA 4AHYA 5IK7A 3LIHA 2Y0DA 1ENXA 1VBE2 5BUVA 2CGPA 4FSJA 3PVNA 1RUE3 4JTNA 1LHNA 5AVQB 2FQPA 1GNYA 2RR12 2ATFA 4FPHA 5KAIH 3IAPA 3I59A 3VBHA 4YZ2A 1DIPA 1VAVA 3BALA 4P5YA 4C0HA 5B5EH 2A1XA 2WWWA 2WA4A 4Y1XA 5J48A 3PTYA 5CCHD 3N7MA 3QLQA 4ZZ5A 3Q5RA 1QL1A 5CJ4A 2B7YA 4JQTA 4NO4A 1M1JC 1YQ8A 1Y9BA 3NL1A 1SEFA 4IGQA 3WX5A 1SZBA 1HGVA 3C7EA 5GKAC 1URQB 4I30A 3MGUA 2WWSA 3CXHE 1T8ZA 1Y43B 1BYHA 3RI8A 3ZN4A 1OVSA 1AXZA 2IWGB 4UI9L 1IPSA 1JU4A 3QH7A 3Q9OA 4AEJA 3IDAA 4COWA 1MS9A 1QJY2 2BJSA 2V4AA 3IMMA 1ZBE2 3HR9A 4HG6B 5IK4A 5KC5A 1N7SD 1FZCC 3HD8B 3CJIB 2B89A 4XETA 2J1VA 1YYCA 2CGNA 5C8CC 1V6JA 1L0LG 2E75B 3CCVP 1WGPA 3OBAA 1W8HA 2N1TA 3WV6A 1FOD2 2JICA 3IN6A 3MHVA 1OBNA 3VYIA 2V7QH 2LUWA 5F2SA 3AE1C 2VVDA 3VD5A 3PHMA 3ZX7A 4R9BA 2KA3A 3KMHA 2BPA2 1C3HA 1GBGA 1JM0A 1MS8A 2R062 1PVC3 3RVHA 4FXGB 2W95A 2LXCB 2IXHA 4RQPA 2OTKE 4WBBA 1X33A 2JDZA 1COV1 2BEZF 1FV2A 1W8TA 2Y6HA 4MOAA 4A3XA 4B1MA 3O1TA 4NMIA 3M0AA 4UOJA 4ZU4A 3R6SA 4Y99C 1AR93 4DRRA 4JF7A 2E9QA 3M8LA 1SQQE 4L2NA 5AVXB 5HCHA 2DCTA 3IDCB 5A32A 1GW4A 2YFZA 2DFCA 5CB7A 4CP2A 3P7KA 1KFMA 2QVSB 4KWUA 1VMFA 4GIQA 2ZEYA 5FUIA 2GSYA 2WSUA 2QSIA 3POYA 2B9VA 4D7SA 3RNSA 3SC7X 3ZSLA 1G1JA 4CPGA 3CC4P 2JG8A 5I8SA 3SITA 3GHGA 1D0GA 4WM8B 2KLUA 1RUNA 2P37A 1PIXA 5F5QA 1JTZX 4MXWA 3ACGA 1OOPB 1DQ0A 2EF6A 1Q5OA 4IEYA 4DIQA 3VBUA 3SWFA 2MHFA 3AP6A 3VBOA 4Z92B 2FYUD 5HI0A 4K6BA 1OD5A 5FJHA 1HXS1 1K5MA 4IEUA 3VZJA 3O1OA 3SSUA 1FZCB 1YQ2A 2RDNA 5KLVK 5D1IA 5FPAA 4NR1A 3OGJA 3WG3A 4C1WA 3KQRA 1RE3A 4LUMA 3MW2A 4QQLA 2ZT9B 5K0UC 3HAGA 4UBGA 3H1LJ 2P3KA 5FMCA 5GJ6A 1OH4A 1NOHA 3D6ZA 4MHRA 1J1DC 3Q8FA 5LB6A 3ME2A 1WW7A 1O7FA 2ZBJA 5EV7A 1RE3C 3AC0A 1YQ5A 1PL5A 2Q1ZB 1D4VB 1ZRIA 3NNGA 3SQOA 4QM9A 2PELA 1QGLA 3X29B 2XDVA 3HVDA 3RZGA 1HW5A 1Q56A 1OF3A 3E1IA 4JDMA 3UIAA 3N9OA 4JBZA 1TG7A 3D8CA 4A41A 5GZEA 3A5TA 1KYOD 4IV3A 4MSVA 3ZOIA 4Q0UA 3N35A 3S5QA 3M4FA 3O7OA 3DV8A 4YGBA 3ZSMA 4LPLA 2ZHMA 4PD4E 1QJU3 2Y0IA 1JZ6A 1Z7S2 4BYYA 4RJTA 3O0VA 4TLFA 4GALA 4D6TE 3A21A 3MIGA 4KQ7A 1YJNP 3ZIWA 3D70A 1J3QA 2ORZA 4WM8C 3VL8A 2AGSA 4HKZH 3ZYIB 1NXD1 1W04A 4UW5A 4BM8A 1XQNA 4DXRA 1VL2A 1LP1B 2HLOA 3KCXA 3AYEA 4GJZA 1X8MA 4NVPA 3ZSKA 5BNPB 2JG9C 4AOCA 2F6BA 1F5JA 4HYTB 4GKXA 4HKWA 2Q30A 4OI4A 1VP6A 3ACFA 4EOTA 1S5LE 1IZ3A 3SXWA 3CKHA 4AI8A 1NVOA 1UY3A 1TNRA 2A6ZA 4CDXB 5JSOA 2QQMA 2YB7A 2V4VA 3OSDA 3ZN6A 2XV5A 1FZGA 1RXFA 2JG9A 2VZQA 3B3QE 1SQBJ 2IZ1A 2HWB3 2B9UA 3DYMA 3FL7A 1UX7A 4QPIC 1W6QA 3LDRA 4Q4V2 1QDOA 3WHTA 3TOJA 1ULGA 1REFA 1D7MA 2B42B 2G1MA 1J2JB 4UFHA 4YG0A 3CBNA 2QJYC 4LKSA 3R4DB 4PDWA 2E76D 3C8VA 4IESA 2K2SA 3KCCA 2ZYGA 1T6BX 1NTZJ 3HT2A 3RZKA 2JWPA 2JDIH 2ZGNA 1ZNPA 2YMYA 3ZDMA 1ZZ6A 4N43B 3USSA 3I2GA 3HUSC 4UT5A 4QHBA 2J1AA 3HQXA 2PHFA 2XWBB 1Q82Q 1MS4A 3I59B 2YKOA 1EDJA 3IWZA 3WNKA 1BMV1 1GL2C 5FPUA 1SMVA 3J9SA 4CCCA 4ZS3A 3Q1MA 3ZMNA 3USUA 1PP9G 2WTYA 2TBVA 3WY6A 1YJWP 5APAA 1UIXA 2KXPB 2OA2A 1NLSA 4NHLA 4S2HA 3R4UA 3CIHA 3CO2A 2A45G 1Z56A 1F8VA 4INDA 3BTXA 5LA1A 1E5RA 1SBDA 3CCLP 1VB4A 3WP6A 1NQJA 1GUIA 3HEIA 4Q0PA 4IERA 3SCFA 1A6CA 2YUEA 2FDKA 1NA1A 1PPJE 2ZXXA 4GWNA 2PAJA 1AX0A 4XJUA 3VKNA 1LOGA 1NUKA 4RKUJ 1QOTA 5A6XA 3RI9A 2R1DA 3D0SA 4EN7B 3VP8A 1H8TB 3OYWA 2XLFA 3EJKA 4PI2A 4MGIE 1S0JA 5JCTA 4QD2A 5FZ9A 2CPBA 4W7ZA 1VBE1 2QQJA 1RE4A 4FOQA 5FZEA 5A7SA 1VQKP 3EQ2A 4OCTA 5GM0A 4WY4D 3DGTA 1DYKA 2ZHLA 4QHZA 3TSIA 3OCPA 3NV2A 3H1LG 3IKWA 4CDUB 1IOAA 2UU8A 2JO1A 2JD4A 1A02J 5FY9A 4CDWA 2IBZE 2H88C 4AAXA 1IS6A 3D5OA 3M70A 2JDKA 2Y60A 4CTEA 1E57A 4QT6A 2JDMA 2LM3A 1XC6A 5DUXA 4LBJA 5ANQA 5A3WA 1D2SA 1O4TA 2P6HA 4ZONA 4WM7A 3LA7A 4Q0SA 3T09A 2OZJA 1M1JA 3ACIA 2WNEA 3QWOC 3GJBA 1JMMA 1PM4A 1M56D 2HODB 3B94A 3JBG3 1H0TB 4CCJA 1HRV1 2J1EA 1DQ4A 1S9KE 1HV0A 3HUSA 3MEPA 3PUHA 2LXBA 5FR3A 1O8SA 3SH3A 2N1TD 1J84A 1QVGO 1FOD1 4IL6X 4DUWA 4CCKA 1LRHA 1W3VA 5A3MA 1LAJA 2NZ9A 3M3CA 2VY0A 1LWUB 4GULA 5FKBA 1FZCA 5DMYA 5EYXA 4BRYB 5E79H 2QEXP 1RUC2 3GXUA 3SCHA 3ZFFA 3VDBA 1AQTA 1NTKE 3O5SA 5FP3A 1AVOA 4NN0A 4Q5OA 4QWNA 1WBLA 1GQPA 1U12A 1URXA 1C8M3 2E74C 2O3JA 1HVVA 3EHKA 5FK7A 5IVVA 2WSCH 2FMYA 3GHMA 4BCUA 2JWDA 2K46A 5GLVA 3SEEA 4D6SA 4FOWA 4YZ1A 1VQLP 1R081 4ITCA 5FZOB 4NHKA 1W2NA 1W6OA 4DMIA 4RYDA 3DYPA 4ATEA 1RUJ1 1UZWA 3AKQA 3THTA 1DBNA 3LQCA 4CA9A 5CKNA 3W21A 1KZUB 3B8EB 3NRUA 3W68A 2HEVF 3OGRA 3H50A 5JOYA 3KDPB 2LKMA 3AECC 1UYZA 4P9IA 2R49A 5F3EA 1RUJ2 3ST7A 3WT3A 3L4FA 2W9XA 3DPRB 4UFLA 4AI3A 4RSUA 2C9AA 4LLHA 4UW3A 1CAWA 2YDEA 4AEKA 5LA9A 2KS1A 1NY72 2E26A 1CJPA 2IDBA 1ZN5A 3AFKA 1AR83 3BPSA 4CRQA 2PHXA 2C9LY 2DCKA 3MYXA 2GC1A 1RUH2 1CZSA 1VMJA 5D8AA 1R1A1 1TMF3 4HN0A 4NPLA 5AVPA 4H14A 2WFF2 5DG1A 3MPPG 4CDWC 4NIDA 1LHVA 2ZXEB 2EXHA 2QUOA 5APWA 2D5FA 2ZCWA 5DUVA 2GH2A 2UYBA 3FLPA 4HN1A 3T1LA 4UB6E 3POFA 1ND2A 4NUBA 4XDPA 4H0LB 4XOGA 4CDQC 1AR62 3C1LA 1B09A 1Q8VA 2GNDA 2M5AA 1SFCB 3EWKA 3VMXA 1HJFA 1DZRA 2DV9A 2UWCA 4XIOA 4N53A 4S2GA 3WNMA 4I0AA 2ZZJA 5FZAA 3T0AA 5LA2A 2WS91 1J1DB 3ZO0B 5FO9B 2M3BA 4PV1D 4AI1A 2JR8A 3FWEA 2CV6A 3I3QA 3CCSP 3TGUD 3LFMA 1NT0A 3F5HA 1Y9MA 4A42A 4MUVA 4EN6B 1NTKD 2WNVA 1JUNA 3WW4A 4PDWB 1JCCA 1PO22 3U37A 1JMBA 1KD1Q 3KHUA 2B4KA 2EA7A 2Z5HA 5K0UB 1JOPA 1H1AA 5FZ3A 1G7YA 2QQVA 1JYVA 2RM21 4LOTA 3BU0A 4UWDA 4IEOA 4BXFA 4CPBA 3CNAA 1EDKA 1J3RA 1XNKA 3VTPC 2A7AA 3B02A 3THCA 3I3MA 5KAFE 3L36A 4I7ZB 4NAMA 1J1EC 1OX3A 1N7SA 1EP0A 3RPQA 1ZA7A 2D6KA 2N7GA 2PHUA 4L97A 4RN5A 5B2GB 3AMHA 1OW6A 1CGPA 4OGQC 4JGYA 1ZZCA 2Y38A 5FUNA 5CFCA 1AJYA 5HCFA 3L35A 5L8RJ 3IBMA 1H1MA 1RITA 2Q8CA 4EN0A 1KILA 1TQ5A 2CU5A 1N7SC 1BCCD 5B66E 5KLVG 4JVAA 1GP6A 2X5IA 1SQ4A 5CFCC 4XTMA 2DVFA 1FBMA 2P7JA 1BE3G 4QGLA 1W8FA 1SQVJ 5CCGC 1V70A 2DWRA 2VQAA 4G4FA 5FZGA 4M0HA 1ODNA 3DUIA 4YVSC 5FYIA 3RFRA 4FQ4A 1AR91 4XQWA 4XPVA 1N3PA 5DN2A 5GLZA 1CI6A 4CCMA 4GJYA 5AC93 2OYOA 2VMGA 3KGLA 5DJUB 1UPIA 2BNOA 2K9YA 1SCRA 4XYXA 4AQ6A 3I97A 4H44B 1NKZB 3VDCA 2O0OA 1FOD3 2Q3EA 1KJLA 4M3CF 4NAOA 4JPZB 2C5DA 4OMCA 1NO4A 3P8CE 5IYYA 1QH6A 3MTUE 2C4XA 3SFDC 2HWF3 3OUHA 3HTKB 1A02F 4BMEA 5KXBA 1DEEG 2Y6FA 1PK6A 3K75B 1NLQA 5CFDA 3FHAA 3EYPA 1KQSO 2XG3A 1U0AA 2ET1A 4XFJA 3E97A 3URFA 3FGAD 1CIWA 2XNXA 3IT8A 1LOFC 2Q5TA 3RK2C 3PIJA 2HODA 2XVKA 3AFGA 5FYMA 3SH4A 3DPRC 1NCQC 4AWDA 2KK7A 3U75A 5A6YA 3OGSA 5F5CA 5C9AA 1JEKA 2VQUA 1R5SA 5KAFH 2HWD2 3PDQA 4JGZB 4OWFA 4YYOA 1JMUB 1O59A 1S4CA 2P3JA 2V5DA 4JDNA 4MV2A 4OH8B 4LLFA 4QPGA 5I8YA 3WUVA 2J58A 3OY8A 3TEWA 1FDOA 2CDOA 3RG0A 1SQQG 2GP5A 2XVGA 4AGRA 4CVUA 3PLQA 4JGYC 1KGYA 2I8DA 3CLQA 4BU2A 5C8CA 1OW8A 3LA3A 1BEV2 1RUF1 4H55A 2F4LA 4P9JA 1S0EA 2YBSA 3GLMA 2DTWA 1FT9A 3AVRA 3FZ3A 5I0SA 5T5LA 2R043 4GWJA 3O1UA 3ZFEB 1L0ND 1OSGA 4YM3A 4RQPC 2Y6GA 1DLCA 1YC61 3A23A 3NJZA 1GZWB 3A3YB 3RGUA 2FZ2A 2YPJA 1PIV3 2RS11 5FZCA 2BV4A 1PV3A 3ZN6B 3POBA 3H7JA 3WZ1A 2IPPA 1AQ5A 4C90A 4L0PA 1I3HA 2PXJA 4IOIH 3AKPA 3GHNA 3ITKA 2F17A 3J4UH 2Y33A 4XAAA 3T1MA 4BQ2A 1PGL1 4N9HA 4KHXA 3KVAA 3WNNA 1CQ9A 1IZNB 4FPLA 2H8PD 2NM1A 3UESA 5LBFA 2VMFA 3KV5A 4ZU7A 3N9PA 4N8MA 4YLZA 4QX2A 3WNLA 5CCGD 3R0RA 2B9BA 4I3PA 5AW5B 3CHXA 4Y5TA 1QEXA 5FWEA 3U4SA 5HV4A 1EZVD 4L74A 2XQRA 1FMD3 3KS7A 2Y9YA 4LE3A 5H9SA 1J3PA 3ZXLA 1USEA 1O3QA 3P32A 2W83C 2OQQA 1ND2B 3VDAA 4YVWB 3BU7A 1OXZA 5IK8A 3VDDB 2ZGUA 4NPEA 1RGSA 1U5YA 4BB3A 3FXEA 1FMD2 1ZA4A 2K88A 2MPFA 2GC3A 3K4AA 3GDBA 3OB8A 4AVCA 2X05A 1AYM3 3POJA 4CCDA 1NTMJ 1JZ2A 4OGQD 3U1AA 1ZBA1 1NE6A 3H1HG 1KC8Q 2YMZA 4XMIA 1H2NA 1P84I 2ZA9A 2ZJSE 1OVUA 3DN7A 1UIIA 1A78A 1I1EA 2YO3A 4YG3A 1RIRA 1O4ZA 2W90A 1KQRA 2CWSA 4D8MA 3UKVA 1GWKA 2Q3IA 1AYN3 3C7HA 2RMU3 3I2JA 4G3YC 5EJZB 5T50A 2VULA 1DGWA 5L36A 5CCHA 1HRI1 1CAUA 1MQTA 4HANA 1HBWA 1BDDA 2W39A 4RR3B 3K3OA 2QBXA 3ZYRA 4IEWA 3ETPA 3CCRP 5DAPA 3L71G 2E31A 1NTKG 4LO5B 4PV1C 1CZQA 2Z42A 1BK1A 4D6TG 5EWSA 2ZEXA 1IGOA 3SKVA 3SEPA 1ULCA 1P84H 4Q4W3 2ID4A 4IFFA 4Y20A 5C4WA 4H0LC 4XF0A 4NHYA 1AR72 3JB4C 1AL0G 1SQQD 3PJYA 4CDQB 1ND2C 2GMMA 5BXXA 1ZRTD 3H1HJ 1LOBA 2VZVA 2WS92 2X5IB 4OHXA 4OHZA 4AEMA 4QXCA 3B01A 2ZYAA 3N9LA 4JRAA 4XEZA 5JSRA 1LULA 2D40A 2A6VA 5FPZA 5A7NA 4P9YA 2FFDA 4MN4C 4BK4A 4XIKA 2YIUC 5H2FH 1VQNP 1W0OA 5DAVA 3ZSJA 2VECA 5A3LA 1A8MA 5DDJ1 4BXLA 3LGRA 1RMU1 4QKBA 3L74E 5KLVD 4QPIA 3UKNA 4DUVA 4P5HA 4PCRA 3K77A 1OHFA 2IBZG 2PFWA 4M3LA 3Q8BA 1W9FA 3MZWB 1VRBA 2WAAA 1W8NA 2WLPA 3G71P 2KYVA 2VZUA 1QY4A 2HYNA 4V1PA 3AMQA 3DL3A 4Y5Z0 1UMIA 3LW5H 1MS0A 3GBWA 4CDUC 2JG9B 1RTVA 4PD4H 3AEBC 2YXRB 3K2OA 1UZYA 3GCXA 4Q2FA 3BIEA 3AE5C 2D7FA 4U3FG 4ATFA 4BLIA 4Y5SA 2WSCJ 1RUG3 1VBA1 1PK6B 1SQXG 2GUSA 1CESA 1QIQA 1TZOA 2DFBA 2FKWB 1QJY3 2W52A 4GH4C 4LA3A 2JDHA 5E89A 1U7MA 4ES9A 1EZVG 2ZFCA 2JKVA 1GOHA 3I7DA 3NW4A 4RHV1 1D7PM 2BCCD 4IE7A 1U5IA 5KTBA 1KS5A 2DUOA 3GBGA 1H8TC 1VRH3 2HWE2 3VMZA 1FZBA 5ERLA 3L71E 4QX7A 1KQFB 1MEC1 1DYPA 4P9XA 2CNAA 4META 1RJ8A 2JE7A 3CEWA 1ZZ9A 1JCDA 1QL2A 1PGW2 4XUOA 3WQBA 3DKWA 2K37A 1XPWA 5JPMB 3T3YA 1SQVE 1QKQA 1R083 5FZ6A 2PYTA 3UYJA 1JYNA 4LTAA 2WSSH 3AVSA 1BDCA 2YC2A 3M7AA 4YW4A 3VBHC 2YU2A 4A3ZA 4GAZA 4Q4W2 4FTEA 3BGAA 4LK7A 1DEBA 4FFFA 5KHIA 5LASA 3VKFC 3J7HA 3WNOA 1GWLA 1YIJP 3UJOA 3ZFEA 1X22A 4EN9B 5CG8A 4XBLA 4M3CB 5F39A 3A2AA 4C0BA 5IJRA 2K3RA 2Y0OA 1SFNA 3KZIE 3APBA 3CX5D 3H3LA 4RFRB 1IJDB 1KB9E 2PP6A 1GANA 1IPKA 4RGKA 4XQ4A 4RQPB 5DAQA 5IWFA 1LTIC 2V4HA 1XU2A 3ZFEC 4E2SA 5A33B 2FXMA 3CU7A 3CCMP 1COV2 3TEYA 3SKJE 1CJDA 3ABZA 1URQC 1AYN2 1UW8A 1RJ7A 2P3IA 1YLLA 1XYPA 4Z82A 3H32B 5J1XA 2JEEA 4IW3A 1M90Q 2VW2A 1NAFA 4MGTA 4GA9A 3HD7C 4DZOA 2VE1A 3D6YA 1XNTA 4K3UA 5F5AA 5F6KA 3WW2A 4XE5B 2A5ZA 3PTZA 3GGLA 4JGZC 3BCCE 3AEFC 2WQZC 1POQA 2RS31 1MS3A 5GZFA 2YBKA 2BBVA 4YW2A 3LEIA 4LULA 4ZXKA 5E6HA 2H43A 1GNHA 1GOFA 2WO7A 5EQUA 4FPFA 5LCWL 2PLV1 2C1FA 2RV9A 4CU9A 3R4YA 1L7RA 2OQ7A 2G9FA 5AW8B 1J59A 4CP9B 4IE6A 1W99A 3CI9A 4ES8A 3CMGA 3FN9A 4ISQA 5DZEA 1UY0A 2PMWB 2M8RA 3LOBA 1S3JA 2WFF3 2RS12 2WNUC 4DCKA 1DGWX 2XJPA 3GBFA 5H9RA 4UAPA 3I55P 4NE9A 4K9SA 3AYAA 4AXOA 1SLBA 1R5LA 3AL5A 1HB4A 4Y22B 3BI3A 1LCLA 2PHRA 4DINB 4I2OA 4Y1ZA 2QDNA 3HNYM 1UNBA 1MV8A 2WQYC 1AYM2 4YZ5A 1GSLA 1VE0A 2R44A 5FP8A 3I2IA 3VHNA 1WCQA 3OF1A 4Q4Y3 5I0RA 1HB2A 4UBHA 3GF6A 4XACA 1MQTB 1FDIA 2E76C 4TXWA 4U36A 1LENA 5KHGA 2D6PA 2A06G 3ACLA 1UD1A 3L70E 3E5QA 4XFHA 3VD3A 4GMP1 1HQNA 1XE7A 2AZ5A 1LTTC 3M0DC 5FPBA 5EFWB 1SFCC 1MVQA 2ZS6B 3IDEA 4XURA 1KB9H 2WKKA 3CCQP 4ASVA 5FXXA 4ZKUA 5E1RA 2QJPB 4PF5A 2ZHNA 2GAUA 5D8AC 1YIPA 2HBUA 3KPEA 3J8F3 4DOUA 2VAUA 1AR81 1W2OA 1ZREA 4R4MA 5BNPC 4XFBA 2WPRA 3I5CA 4AHXA 2JDPA 1QJU1 3ZR6A 3ALQA 1RQUA 3GM8A 3HOBA 5A3OA 3E6DA 3N9NA 4JC1A 4KWLA 4BA6A 2VZOA 1RUG1 2BWCA 4EN8B 3MD0A 2A71A 1AHSA 1OLMA 1VBC2 1FAVA 2CAUA 4LE4A 5FPXA 2WAOA 4IETA 5M0TA 1PO12 3FLRA 3GMAA 4D7TA 2JIJA 2ZHKA 3ON7A 5AVTB 1V9U1 3L37A 2D44A 5FFOC 4NIGA 3AZVA 1OPOA 4PF1A 5T54A 4LKDA 4GODA 2Z69A 1ZP0C 2GU9A 4YPCA 1JB0J 1LOCA 2WT7A 1K8AQ 1VQ9P 3ORJA 2VOKA 5EXOA 2HH9A 1VQ6P 2WO1A 2WPVB 2OYIB 4DB5A 4PLOA 5HXMA 1HN1A 2C9KA 3CCEP 2MNGA 4HL0A 3VBSA 3NMBA 5ACA2 3L72G 5FO8B 1W5CE 1SQQK 4D0QA 2FYUG 2WSEH 1OURA 5KHKA 5A6ZA 4P08A 2QQKA 4YW7A 2QFEA 3AJZA 2A3WA 5F32A 1HXS2 2P3YA 1GZWA 1C1FA 1S0GA 1LWUC 1H2LA 3NKGA 3OPZA 5K0UA 3WW1A 2CY6A 5L7OB 4PD4I 1YJKA 4AZZA 4R52A 3THDA 5F3GA 1BCCE 4D94A 1W03A 5E88A 2NPIA 4RA0A 1N7LA 2ZGSA 1K42A 3WDYA 5EFUA 4CUBA 3SISA 1LOEA 5EPAA 2OUJA 3MUDA 4IGOA 1LECA 5KKZB 1NTME 1FV3A 1SQXK 4UFJA 1HV1A 2AEFA 2KSEA 2Y9ZA 1PO13 3E5UA 3HT1A 4HPKA 4WVMB 2A70A 4XF3A 3A0BE 1ZYBA 2HWC2 3ES1A 2WZPP 3UJQA 2QE7H 1PPJG 1EPWA 1W6NA 3H0OA 3M9HA 4GXLA 1E5SA 3L73D 2ZX4A 2ZTNA 3H1JJ 3H3ZA 3W5NA 2RH0A 4U3FD 1W3XA 2JD9A 2GNTA 3IPVA 3AE9C 3I56P 4Q4X1 1FJPA 1KILE 2BEQD 3S4RA 3I2HA 1KILD 1FOSE 2BOIA 2Y64A 2RS51 2ES3A 2PAKA 2IX7C 1KS4A 1OUSA 3ZXFA 1UPSA 2HWE1 1NTKK 1GW3A 3PUIA 5FLHA 4E27A 2L91A 4GH4B 1MZ6A 1XRUA 2J1SA 1RQVA 2IZ0A 1AF9A 2WO3A 2O01J 2ARCA 3LEKA 3JD72 1CPNA 3L9JT 3N3HA 1BGYJ 2HKXA 2VQTA 1BCXA 3HBZA 3VV1A 3GZEA 2QM8A 4NHXA 2E75C 2JECA 3PHLA 2XXZA 5L19A 4AAPA 1LEDA 2UURA 5KAIE 1P84D 4MH0E 1X0TA 1GFF2 3MUZ1 1BLZA 4JHZA 1EDIA 2ZX0A 1RINA 2J5UA 4YM2A 2KZIA 2C9NY 3HE5B 3KYQA 2JDYA 1RHI2 1QU0A 3BATA 1GR3A 4H13B 1OFCX 2EAKA 1ZRDA 3J8F2 3PL0A 3V0AA 1ULDA 2B88A 1HB1A 3M3IA 4XHXA 1S9KD 3O0XA 3VKOA 3KB5A 2H6CA 3WDVA 3RSJA 4ZPIA 3WQ7A 4CEYA 4E9KA 1HX6A 3CL1A 3ATGA 5FZHA 3RDIA 3L70G 5APUA 3N7NA 4BLJA 1YYNA 2P6CA 4H44C 3MLJA 4Y22A 5A6QA 2Z2SB 1K12A 4WZFA 1H30A 3ZPOA 3GG2A 4OI1A 2QJYB 3G9RA 1M4WA 5D21A 4DZGA 1O3SA 2WC2A 2ZZQA 4KNCA 2MEV2 1XTGB 2FXOA 2VUDA 3O12A 1S2EA 1VMHA 4JTOA 1UQXA 2QA4P 4B3NA 4E2GA 3F89A 4I02A 4QQHA 1YWKA 1RXGA 1PX3A 4CUAA 1K73Q 3HE4B 1A8DA 4RR3C 5BNPA 2BWAA 1G9FA 2D2CB 1W2TA 2QE3A 4Q8LA 2IBZI 1LOAA 5JXIA 1B35A 4XJ9A 2WT1A 1IFPA 4YW5A 3V5BA 1DQ1A 2E32A 2R3SA 2FDJA 2W68A 1XB9A 3DPRA 4K40A 4XF4A 3ILNA 4GQ7A 5J36A 3H1YA 1YI9A 3E6CC 2GN3A 1REEA 5A3PA 2DF7A 4FP3A 5C4WB 3JQXA 1ODMA 2PHLA 1YJLA 2WN3A 1F9KA 4PIYA 3AE7C 2DUPA 5IW0A 4OGQB 4QPWA 1LTJC 2RN0A 3RL0B 3N4XA 4P14A 1LHWA 1UOJA 4JGZA 1GU5A 4QQOA 3SHRA 1LB2A 3H42B 3FBYA 4RGAA 5KHHA 4E8DA 1BCCJ 3UK9A 4B86A 3M06A 1JHJA 3FC0A 4LJHA 1IQDC 5EP9A 3VHPA 1CR7A 4A4AA 3JCUE 1LU2A 1JUIA 1G9BA 3O1PA 3MIBA 1HJBA 1OFNA 3B5NA 2R16A 1XU1A 1GK6A 1COV3 1QJY1 1LTEA 2QJVA 2NMNA 1ZBE1 2ZGLA 3Q3DA 1JODA 2D6MA 3RBXA 4KBBA 5DXDA 2WT7B 5HCAA 4CPBD 2A06D 3LA2A 2EXIA 4L11A 4XQDA 2FDHA 4WVWA 4V2VA 4OUSA 4LHNA 1EC5A 2Y26A 1DP0A 1WA6X 4Y4YA 5K7PA 2VZPA 4ZNCA 1RUC3 4LBNA 2WBKA 3MPBA 1ND3A 2VW0A 2YC0A 2OYIC 4W6WA 3M0DA 1JYWA 3DYOA 1EAH2 1DHKB 1UX6A 1ASJ3 2R063 3PU3A 5IUQA 3TEXA 5A3TA 3VKLA 5D2AA 3M3QA 1Q43A 5I0TA 3TDKA 1YI7A 4FPOB 1ND3C 1UYPA 4HT1T 4YPJA 1N7SB 1RF1C 1S55A 3UETA 3VZMA 4CU7A 4Z8BA 2ZX3A 1USDA 1FYUA 1RUD3 4I01A 1VBC1 2RM23 4HETA 2BASA 2W6BA 1N73C 1NZIA 2B5HA 3TBDA 1GU3A 2YHJA 2W1SA 4AFMA 1UOGA 3RJRA 1VQ8P 5FOJB 1V9U2 3OUJA 2R5DA 3FWLA 3V4WA 2QKDA 4MZUA 4AGVA 2XUMA 1KFNA 2HWE3 2UY9A 5FY5A 5KR7A 1MR5A 4WVMA 1NWQA 4HSJA 4BHPA 2P10A 1N73A 3GZTB 4NPDA 2XLAA 3NVCA 5AW7B 1VIWB 2W47A 4Y20B 5IVYA 2IXKA 3KZ4C 3O6QB 1QOOA 1W6NB 1JOCA 5K4LA 3ZLIA 5FQ0A 1JZ3A 4HSLA 4TZDA 3MF9A 1AL23 1LODA 5FQ0B 1WLDA 3MIDA 1S0CA 1PP9D 3Q5SA 3EO6A 3NV3A 1ZZ7A 4Y99B 3IPVB 3OUIA 5GLTA 2G19A 1LT9A 5JLVA 5FMBA 4PD4D 3TK1A 2E51A 2RR13 2FFDB 1XSQA 3OPWA 3V4QA 4DY3A 3GW6A 1W6PB 1RUE2 3T2PA 4EROA 1A34A 1C28A 1FPN3 1OOPA 2XGXA 1MFZA 4NRQA 4XTPA 3O1SA 2Q1KA 1LR5A 3VMAA 3D6EA 3NNFA 1JU3A 1P8JA 3CMAP 2WQ8A 2B39A 3OJBA 1S0FA 2W5FA 1FDMA 1C57A 1YO8A 4CSWA 3WUTA 1CAXB 1ULPA 5G05L 4Q4V3 2WZEA 3KWVA 5JAXA 2X10A 3V0BB 4GDOA 1KD7A 2VTXA 1P84E 1ZM1A 2BERA 4HVQA 2WVRA 2KNCB 1RVF3 1M8OB 4AL9A 3O1VA 3PUSA 2PAEA 2JG8C 4FPEA 5A70A 2H89C 1F5FA 2VXJA 4CDQA 5JUVA 2IFNA 1KN7A 4YVSB 5C9AB 2WZR2 3AKSA 4BIOA 3V0AB 1ULFA 1QOSA 1VBB2 3HD7A 2JIGA 1WD3A 2EIGA 3MZHA 2IFRA 5IVCA 4ARXA 2IXCA 2J1UA 4PLNA 2L5GB 2E7QA 4UB8E 1LJ2A 1CAVA 4QU2A 4GIFA 2ZGKA 1FS0E 3FHIB 2KB7P 3T2QA 3TN92 1NTZG 3POIA 1JYXA 1BEV1 4MX3A 3MDPA 1XTCC 1IFJA 1OKOA 5AW2B 4Q29A 4QDQA 3A0HE 2WL1A 3CWBD 4XCAA 1IHMA 5LBCA 1KILC 4BDVB 3RBZA 1IG3A 2FCVA 3BN6A 1WW4A 4EJRA 1HDKA 1G8WA 1G1IA 3AEEC 1QQP1 2I1JA 4D7YA 3VN0A 3L74D 3QOPA 3JB8A 4XJZA 2EALA 1QMJA 4X6QB 5FLIA 1RF1B 1PIV1 1I5PA 2RS13 5EHDA 3K51A 1L2PA 3WG1A 2F4PA 4KG8A 2B87B 3T97B 1DCSA 3V2NA 3M3EA 1MS1A 2RHPA 4IEPA 4L8QA 3CLPA 4PDWC 1PIV2 1F15A 1WWYA 4IEQA 4OZOA 3WR0A 2CHHA 2Q0AA 1KMIZ 2KXLA 1M1KQ 5HCBA 2UWAA 1ZRTE 3H32A 2W08A 3K4ZA 1JY2N 3CWBE 5FZFA 3TN93 2FYNC 1H89A 1AX2A 3S7IA 2RS33 3VBHB 1HIXA 4UF0B 1S1AA 1RUC1 1WRGA 2FDFA 1V6KA
chains in the Genus database with same CATH topology
3AXDA 2XKMA 3M9QA 2NLRA 2PTMA 1PM7A 3WP5A 2D97A 4N43C 1FMD1 3VBUC 4CEWA 5JDBA 3ZXGA 2SLIA 1EY2A 1IO4A 1POV0 1UU6A 3PJQA 1NTMK 1XYOA 5DZGA 1FJKA 1BQPA 2HWD3 1PVC1 2HFED 3GYDA 1QHDA 4MLOA 4LLOA 4AUWA 5T5JA 5JPNB 1GLHA 2W6AA 3VBFC 2BFUL 1S0IA 4D3WA 2ARBA 3FJSA 5T5PA 1JOJA 1VBD2 2NPSB 5J98B 3T2TA 2GN7A 5A33A 5FRAA 3RRDA 1NY71 4X6RB 5BNQA 2YY1A 4JYCA 3LOIA 4OHYA 2I74A 3JZVA 1NH4A 1R1A2 1LU1A 2QCSB 2A6XA 1H4GA 1APNA 1LGHB 1HUCA 4PBPA 2PHWA 3AX4A 4EIJA 1X8YA 2PA7A 2DCYA 4R4ZA 4WVVA 1FPN1 2GH8A 3BOWA 4GT1A 2BNNA 3R2PA 3VLBB 3U0ZA 4P9WA 1SDWA 5T52A 1GD2E 4Q0VA 1WMFA 2ILMA 3JCIA 3WMM0 4BZ4A 2QZ3A 1XYNA 2A75A 2D6OX 1C4RA 3RQ0A 5JOXA 1UL9A 4A7YA 4YFZA 1L4AD 4WY4B 3IM0A 5ABJC 2Q5UA 2ZKNA 1L0LK 2CTVA 1I5ZA 5JI7A 1UIJA 4COUA 1EAH3 4E4ZA 1OMIA 4W80A 5LEKA 5CG8A 3KT4A 3AK0A 1IKPA 3ZFFB 5ACA3 5AC91 3MI8A 1JY3O 1R1A3 1TMF1 3AB0A 4Q27A 1OWAA 1W6MA 2BTVC 4RS5B 2WNUB 2RE9A 1Z0HA 1LGCA 3W9AA 4BIFA 1OLQA 4XF9A 1D4M1 4XXPA 3P8MC 2HEYF 4COVA 1PO23 4H3WA 3K48A 1UKRA 2XVLA 4IV3B 5IT6A 2D93A 4FO9A 2D3SA 2YZ4A 4K21A 4DS0A 5F1RA 3QACA 3BRVB 1H2KA 3N7JA 2QQPA 1QJX2 1MEC3 2D3RA 4OUMA 1CAVB 1C1LA 1YUDA 1CN1A 2R6QA 4K1ZA 1Y9QA 4LUKA 3TNUA 2IC1A 1NG0A 1NQDA 1MS5A 1JW6A 5FMOS 5LK5A 3RYKA 4M3CA 3VKMA 1W2UA 3V65A 4CDXA 2Q1MA 3R05A 3SCGA 4WV8A 4AFCA 1OA3A 1ZRFA 1DX7A 3ZXKA 1JO5A 5I93A 1N47A 3ZSEA 2JKBA 1JYCA 2Z5WA 5EYYA 4F3JA 1OOPC 3R4SA 2ZMNA 1G9CA 1VR3A 2AREA 5GLUA 4EWAA 1FNYA 1SQPK 2HWD1 2VRSA 1MACA 4OHVA 5L73A 1FAYA 5K9YA 4N6JA 4XJWA 4XBNA 1WMEA 3AKTA 5FDBA 1RUH3 3AP5A 3UKTA 3NSTA 4WZCA 1GU4A 1U5XA 2D98A 1FZFA 4RL7A 4AVTA 1X82A 5J96B 3HE5A 3RK2B 1OA4A 1SLIA 2YYOA 3AMPA 4Y24A 5CIRA 2PLV3 1VBA2 3H9AA 4AI0A 1XNCA 3I4IA 3QD6A 3P3PA 1BKZA 4MGZE 1NCQA 2WPQA 3V2QA 5H9QA 2ZX1A 3RL0D 2FMDA 4IV1B 4RHV2 5FBZA 3MW3A 2XJSA 1J1EB 3TYYA 4PBOA 3BPZA 2D5HA 1AYM1 4KGGA 1PZ9A 3ZXJA 1WCDJ 1LKNA 3WQ0A 1PGL2 5KHJA 3B5NC 1ENSA 1ZVFA 2DVDA 3D4KA 5F9TA 3G3ZA 3A4UA 5SV8A 1DDLA 4FPYA 2E63A 3ASIA 1WLWA 1WA4A 4Q0QA 3VP9A 1GQGA 3TYJA 2BGCA 2YKQA 3U11A 3RK3B 3WINE 4L92A 2ZX2A 1N1TA 4N78D 3VL9A 4JRLA 1F31A 1HTLC 4CEYC 1RE4C 2PN5A 5FAXA 4Q1PA 2NPSD 2ERFA 3L2YA 3TNQA 3O8ZA 1W0PA 5F6LB 2BVBA 4LO4B 2X8KA 1H2MA 1Q3EA 4OLLA 4YVSA 5TSWA 4QPYA 1RUD2 1T6GC 1FZAA 1ZRRA 3RWNA 5LK7B 2A3YA 2OVUA 1TE1B 4S2FA 3FUQA 1V9U3 3LCPA 4SBVA 1KITA 4JAAA 1YIFA 4KG0A 4Y1UA 4EV0A 1ZV8A 4AHZA 2DYCA 1PZ8A 3THPA 1RUF2 2DVAA 1BZWA 2A73B 1AJKA 3MIWA 2WNUA 4O9EA 5FMOL 5ABJB 2EXJA 1YRZA 5CBLA 1S2KA 1VBD3 1L4AB 3H7YA 3NV1A 1UU5A 4LNVA 2N1TB 1BVVA 1SLQA 1RUI3 3H1MA 4LC1A 3ZXEA 5LRSA 1TME1 2XJQA 2ZACA 4LBQB 3WOGA 2D6LX 3OA7A 1VBC3 4FPKA 4PIXA 4AW7A 1ZBA3 4RHV3 3USUB 1V6LA 4IXLA 3U07A 4PIZA 1IS3A 4R4XA 2HEWF 1WLTA 4GB33 2WS93 1SCSA 3FMGA 4B4PA 1E5WA 1R092 3LKJA 2YGLA 1V6NA 1SBFA 3WDXA 3AMNA 5SV5A 2Q9IA 3QCWA 1IC2A 1WD4A 3VZLA 4C1XA 1R091 3A0KA 5JIUA 4ONUA 4AQRD 2I2SA 2QZ2A 3HN1A 3KD4A 2OARA 4N53B 4XMIA 4DRRA 3PP5A 4W6XA 2WSFH 2ZGRA 5FQ0A 2XPJA 4YVWA 2FYUK 3PVOA 5AW4B 1QJU2 2N9BA 4ZKTB 2J59M 1ZLLA 4Q4Y2 1K5MB 4YW1A 5BNOC 5KJ7C 2ZGMA 1MZ9A 4KWJA 4ORFA 3MIFA 1N2DC 4IV3C 3JUUA 4IL7A 3OJAB 1H4HA 1GL2D 3W58A 1NU1K 4E4SA 1PGW1 4AE2A 5BNOA 4Q8KA 3N7KA 5JOWA 3FBMA 1CAXA 2B46X 3ZN5A 4HLTA 4LA2A 2G9GA 5K8SA 4TWTA 1GZLA 4C7NB 1F2NA 2VNRA 1UF2C 2WLQA 3RK2D 4H7MA 2GMEA 4AVBA 2DVBA 5APYA 1J1LA 4AGGA 3ETQA 1EQ7A 3WNXA 4HVRA 4FTBA 1PNFA 4DPNA 1H8VA 1R1ZA 4W6YA 4WM7B 3WDTA 1JY3N 4K8FA 3RMYA 2POHA 5H9PA 2CL2A 2Z4EA 1L3JA 3G6JB 1QNWA 2ZMKA 1DZTA 4FAGA 5BVZA 4G9SB 5GLWA 3B00A 5AVZB 1BJQA 1UMZA 2JJLA 3VZKA 4FTSA 5APXA 2JXAA 1FU1A 2R0FA 4LHLA 1Z78A 1W6OB 2VNOA 5BU5A