2R32A

Crystal structure of human gitrl variant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
158
structure length
140
Chain Sequence
RMKQIEDKIEEILSKIYHIENEIARIKKLPCMAKFGPLPSKWQMAPPCVNKVSDWKLEILQNGLYLIYGQVAPNAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Assembly and structural properties of glucocorticoid-induced TNF receptor ligand: Implications for function.
pubmed doi rcsb
source organism Saccharomyces cerevisiae, homo sapiens
molecule tags Immune system
molecule keywords GCN4-pII/Tumor necrosis factor ligand superfamily member 18
total genus 32
structure length 140
sequence length 158
ec nomenclature
pdb deposition date 2007-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2r32A01
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r32A02
1XU2A 5AVVB 4MXVA 2QDNA 5CIRA 5CMZA 5AVZB 4GKGA 1OQEA 4MXWA 4JYCA 1C28A 1CZQA 3LIEA 1DG6A 3LKJA 1MFZA 2JG8B 2JG8C 4NN0A 3I5CA 5APXA 2WNUC 1IQAA 4HT1T 1CI6A 1D4VB 1U5YA 1JUNA 1TNFA 4OULA 4EN0A 2WPRA 2TNFA 3NMDA 5BNQA 2P67A 4QQPA 5AVTB 3ME2A 3TNUB 2R5BA 1H89A 3IR9A 1JH5A 2WNVB 3QD6A 3V4QA 5AW0B 4QQLA 2JG9B 3TWIA 5AVQB 2Q7CA 1S9KE 3A5TA 3L9JT 4E4SA 2YO2A 1JTZX 2RE9A 3P7KA 2JG9C 2P7JA 3OAKA 1RJ7A 4HYTB 2WPQA 2WPSA 5AW3B 2E7AA 1XU1A 2Q8OA 2HEVF 1KD7A 2WNVC 4TWTA 3LIDA 4QQHA 4DOUA 4E4DX 1C3HA 2E42A 1HBWA 1HUCA 2C9NY 4G3YC 1SLQA 2Z5IA 1G2CB 2WT7A 3IT8A 1MV8A 5AW5B 4DZOA 1ALYA 5KC5A 1T2KD 3KDPB 3L37A 1OQDA 2WWWA 3B94A 5AW8B 1NWQA 5APUA 4RSUA 4F3JA 4AYCA 3B93A 1OSGA 3NTNA 2P2UA 2XV5A 1D0GA 5AW6B 2Z5WA 1MUUA 3VN0A 2WNVA 3A7OA 2OIIA 3K51A 1H88A 4MSVA 1H8AA 3HE5A 5APQA 2RJLA 4EOTA 3FC0A 1O91A 1OXZA 3NXSA 2KA3A 1OWAA 4I6MC 1A02J 3M0AA 3TYYA 2XZRA 3B9IA 1DH3A 1KQLA 2YO3A 2JJLA 4XE5B 4KGGA 3P32A 3HE4B 3MGNA 3T97A 5AW4B 4GT1A 2W6AA 4OUMA 1CSBA 2R5DA 2BASA 1J2JB 1S55A 2VRSA 3A3YB 4J6GA 1U5XA 3NFQA 5APTA 1A8MA 1GU5A 1FOSF 3V4WA 3L35A 2HEYF 4KGQA 5KC6A 5L36A 2JG8A 3V56A 3HTKA 1DU3D 1GD2E 5APYA 3WD5A 2ZPXA 3M9HA 3UIAA 1IO4A 2R32A 5L19A 3B8EB 2Q1MA 3VYIA 4AUWA 2WTYA 2YNYA 2H7HA 2KP8A 4LC1A 3VTPC 1PK6C 3URFA 2IPPA 3A2AA 1D2QA 1YYCA 2Z5HA 1HWTC 2QM8A 5AW1B 3AB0A 4KG8A 3HE5B 5AW7B 3M0DA 2WNUA 5TSWA 5AVRB 5APWA 2ZFCA 3K48A 5KWRA 3KQGA 1GTWA 2ZXEB 3TK1A 4M3LA 2TUNA 3MI8A 4QQOA 4I2LC 1GK4A 4RESB 4B86A 2RJKA 4OUSA 2QM7A 3VMZA 1HJBA 3HE4A 2XU6A 1RJ8A 2R30A 4D7YA 4DB5A 1KXGA 4KHXA 3SWFA 2C9LY 2ZJCA 2E43A 5APSA 3VMYA 5AVUB 1PK6B 3M9BA 4G4FA 1PK6A 4GIQA 5AVWB 1TNRA 4TSVA 5HBAA 2WT7B 4AQRD 4MXWB 1X8YA 3O8ZA 3QBQA 1I9RA 3MD0A 5AVYB 1GZLA 1CI6B 3VMXA 1JNMA 5AW2B 1GU4A 1T2KC 3TNUA 2X29A 2R6QA 4QQ2A 1WCKA 2O0OA 3P8MC 5AVSB 2WNUB 1U5ZA 3ALQA 3V5BA 3M91A 2JG9A 4QPYA 2Q3IA 2R3CA 5APVA 2N9BA 4C46A 3M06A 1NAFA 5AW9B 2HEWF 3L36A 2Q5UA 1SP4A 2W27A 1GR3A 2AZ5A 4C7NA 1A02F 2QE3A 5AVXB 1FOSE 4C7NB 1S9KD 1FAVA 1GK6A 3TYJA 4JYBA 4N90A
chains in the Genus database with same CATH superfamily
5CCHA 2VMFA 1LAJA 1RUF3 3CCRP 2XJPA 4JTNA 2KZIA 1T6AA 5C4WB 1ZRDA 1UY4A 3KB5A 5CMZA 1ZBE3 4H55A 4XQWA 1G8WA 4W80A 1NCRA 3FHAA 1O3TA 4IE5A 4N7IA 1QNWA 2YC2A 3M3IA 1T8ZA 4FT8A 4HT1T 3E6CC 4X6RB 1BGYE 3DPRB 4XXAA 2PP6A 4IV3A 3TNQA 3VGIA 2O14A 4FPCA 5KXDA 2W91A 4YVWC 5C7GA 1BSNA 1MZ6A 3Q8CA 5KLVJ 5GZGA 1OKQA 2FYUK 4I7ZC 4NPFX 4QX7A 4A4AA 1L0LG 1NTZG 4UB6E 1A6CA 1E5HA 3WV6A 4A45A 4A7KA 2Q7CA 1COV3 3K75B 3L9JT 5JR7B 2L9LA 2OUJA 2E33A 1QEXA 2Y6HA 4MGZE 2UY9A 3HJRA 3QLQA 1IPSA 2P4EA 4J25A 4MN4C 1KILD 2A45H 2WNVC 1YQ4C 1RHI1 2WZR2 4W6XA 1F8VA 2Y9ZA 2ORZA 1HBWA 1Y7BA 2RR13 4IE4A 5DQ0A 4UFJA 2HPCB 3CJIA 3DECA 5FWJA 5FZEA 1OF3A 1UIIA 3PVEA 3VBHA 5FYCA 4LBLA 5AC91 5HCHA 1BE3J 1R1ZA 3L37A 2IXJA 2WWWA 2EXJA 3QCWA 4GA9A 1NO4A 2WZ7A 2H88C 4Q4W3 3MUY1 5FYHA 3RK2D 4PF5A 2PAKA 5D8AA 1QQP2 2GNMA 3W67A 2VAUA 2W1UA 2VCCA 2VZVA 2E74B 2A3XA 4YG6A 5C9AC 2GH2A 2MKVA 2ZT9D 2HYKA 4QPGC 2YIUC 2ZX0A 1SQVK 1QQP1 3ZYGA 2E76B 4LEJA 4B8EA 1SQPD 4E4HA 3TEZA 2VD7A 2DBNA 1OMIA 2KNCB 4LO7A 3E1IA 4YXDC 1M1JB 3T97A 2WT1A 3H3LA 1L0NG 4OUMA 3POEA 1S0BA 4YWAA 3G71P 4I30A 1DLCA 4JKKA 5C4WC 4O7XA 3A3YB 1FMD1 2BGCA 1U5XA 1RUF1 1BHGA 3NFQA 5APTA 1TEIA 2UU8A 4JHTA 3N36A 4LMFA 3V4WA 1T6BX 3E6BA 4KGQA 5A3NA 5KHJA 1S0DA 2W1QA 2O8QA 3RNSA 2HWC1 4JV4A 1W2AX 3VBFC 1FMD2 1W8UA 2ZPXA 3ZSMA 3ELNA 1HRI1 2IYOA 4HKLA 4CEYC 2CWSA 1MPXA 3AVRA 4WV8A 2ZMLA 2RVAA 2P3JA 4AUWA 5L7OA 2BDRA 2XBO3 4ISQA 4QPWA 1APNA 1X9VA 1Q8OA 2HWC2 2YY1A 1WUVA 2XL7A 5D8AB 2D7FA 3MF9A 3OPWA 1R1A3 3C1LA 5AW1B 1CW5A 2PHDA 2D93A 2Y38A 3M0DA 4ASWA 3TEXA 4OHYA 2Z4FA 1X36A 1WD3A 1KV4A 4XW3A 1J58A 1E5SA 4A42A 1L4AA 1RIRA 2HWE1 2JJ6A 4W6WA 3OD4A 1EV13 4QPIA 1NY72 3CX5H 3RWKX 3AECC 2ZJCA 1ZRFA 2ORXA 5JIUA 5KJ7D 1WW5A 1PZQA 1FDMA 3D5OA 4CCEA 4JQ0D 3OEAA 3UNPA 5FY0A 1Q90D 2KD7A 5I0RA 1O3SA 2NZ9A 4O61A 1A78A 1BLZA 4DOJA 1FZCB 1EY2A 2OGUA 4I02A 4Q4Y3 4YM2A 1VPHA 2PHLA 2PLV3 5ANQA 3J7HA 4B1MA 3I59A 1SQBJ 4H13D 2OZ6A 2YXRB 3VMXA 3S9OA 1OPMA 2P1BA 3Q5PA 4GIFA 4RA0A 1PO21 5C33A 1GWMA 3V0AA 5F5CA 3NRUA 2D3PA 1JYWA 1K5JA 2RDSA 3IDAA 3RI8A 5C3SA 1ENQA 1ODMA 4TN7A 1QJX3 1Q8QA 1IPKA 4XABA 3V5BA 4UFIA 3WDYA 1OFSA 1PO13 2N9BA 1S1CX 3MUDC 1FJPA 1U7MA 1ZZBA 1QJEA 2OS2A 2WAOA 1A02F 2XLGA 3CJIC 1C4RA 4IUGA 5H9QA 2ZEYA 2A3YA 2WN2A 2D97A 1RF1C 3IFMA 2K0GA 3VB9A 2BWAA 2D98A 3JB8A 4W6YA 2LUWA 3NJZA 3FHIB 3NNLA 4XETA 4XE9A 2K88A 4GD4A 2QDNA 1BZWA 1J1LA 3OW2O 1NTKE 3SFEC 3KXDA 2NYYA 4CU8A 4D6TE 1NU1E 3WW1A 3LW5H 3I97A 1M4WA 3AEAC 3POBA 2NPSC 4L8QA 5DG1A 4ZXKA 3M7AA 5FO8B 5EYYA 5FMBA 1G9BA 2CGPA 1H0TA 3L2YA 2D6NA 5T5LA 2ZGRA 3AMHA 2ZEWA 1SS1A 4M0NA 2OYZA 4CYDA 1NYHA 3IR9A 1Z7S3 4A7ZA 4EWDA 4XJUA 4R52A 4DPNA 1V6NA 1LTBC 2YKQA 4LJHA 3KT7A 1KILA 1NA1C 2IXCA 4FOYA 5HXMA 3WW3A 3TDKA 5KAIH 2OPKA 2ZXXA 2JG9C 2IBZE 1Z0HA 2OYHC 1BE3E 4LR4A 4XUTA 2FDKA 5A3OA 3CXHD 4COZA 4GOFA 3CD6P 3IN9A 2KLUA 4XACA 4XFFA 4U3FE 2H43A 3WUUA 4M3CA 3INAA 1Q86Q 2XG3A 1D4M3 3FFZA 5C3PA 2WITA 4CDUA 2OYHB 3A21A 1QOSA 4D7TA 1OQDA 5F3IA 3NNJA 1JYVA 4OWFA 1W9FA 2GH8A 2RHPA 4UF0A 5APUA 4PD4E 1WT6A 4H13C 2ZHKA 3BGAA 1GICA 4CDWC 1BCCD 1EUTA 4TT3H 1SBDA 2EA7A 1DD3A 1TMF3 4PHZA 1M06G 3WQ7A 1RUNA 2XNXA 2YGMA 4GMP0 1Q43A 3HUSA 2VW0A 3HD7A 1NGMB 4LXLA 2H0BA 1P84I 2JO1A 2FY8A 1H9WA 2ET7A 4L92A 4NPRA 2ZEXA 3KV5A 4YM0A 5D1IA 3L73D 5FUNA 5T3NA 2GA1A 1B35B 1W03A 2VCMA 3IBMA 5F6KA 4OGQC 3E7KA 2Q8DA 2BASA 1D0HA 4CVUA 5BNPB 2VRSA 1ZXGA 2ZS6B 3D0SA 3DKWA 3KVAA 4Q8LA 1PM7A 4XOGA 3QH9A 1A8MA 2KXLA 5DAQA 5LATA 2NMNA 4E8CA 4O9BA 1RE3C 3WNKA 1M1KQ 2C26A 5FLIA 3IN6A 4ZU4A 1JY3O 2DTWA 2WO3A 4URAA 3AJYA 2BBVA 2VVDA 2R042 4Y3OA 4HBNA 3LEGA 5GLWA 4RR3C 1PP9E 1GL2D 1IZNB 1HB1A 2YNYA 2WQ8A 4Z82A 3O1OA 1RVF3 4IEZA 5A1LA 2IPPA 1PMIA 3A2AA 3J9SA 1SQQE 1YYCA 3Q5SA 1HLCA 4YNIA 3UGGA 1LGCA 2ZKLA 3ON7A 3BU0A 5IVEA 3G6EP 2YXQB 5J98B 1UY2A 2DVFA 2J1EA 5FYVA 2AEJA 1RUC2 2CWMA 1W28A 1UIKA 1PGL1 3ENRA 2M5AA 3M3OA 4CRQA 1HJBA 2XU6A 4PLMA 4PLNA 3VDBA 4S2GA 3S5QA 1RF1A 5APSA 1VPCA 3KZIE 1AYM3 1PNGA 4J1WA 3APBA 4PD4H 1Y8AA 5CCHD 1HRV2 1LJ7A 2BFUS 2OARA 4PV1B 1UYYA 4JGZB 4LKDA 3MP7B 1N86A 1S0GA 2YIUB 2VNRA 4IEPA 1CI6B 1CAVA 1S1AA 1URQD 4LBMA 1PGW1 4NWVA 4F83A 1RE3A 4W50A 1JNMA 3CCSP 2BTVC 2C24A 2JR8A 4MVTA 5FYTA 5FXZA 5T55A 5JPMB 2KZJA 3OB8A 5F3GA 2CU5A 1NUKA 4XYXA 4LA3A 1QDOA 2QQUA 1U5ZA 2XONA 4MHRA 2A75A 2HKXA 2OA2A 4Y1VA 4QPYA 2KXPB 3MIWA 1KQSO 1CAUA 4RGKA 3B7MA 4LOTA 2B9BA 1QGLA 1GOGA 4NHKA 2VTXA 4UBGA 5DJTB 2AXTE 4RD7A 3KT1A 1VQ7P 3CXHH 1JI6A 1SQPG 2AACA 5CFDC 2Y0IA 4Q27A 4KI5M 4JYBA 1ULEA 4EN8B 4N78E 4RS5C 4AI8A 1QF3A 2Z69A 1ACCA 2VTFA 5L7OC 4GWNA 1YWKA 3HQXA 4K8RB 5AVZB 2E63A 3HVDA 5ACA1 1C28A 1H1AA 1ODNA 1RUJ3 4YVSA 4YYOA 1JB0J 2JEEA 3UKNA 1POV3 3MV11 4HN1A 1UAIA 4P9XA 1D4VB 1KJLA 2LXBA 1HW5A 1EDLA 5KXCA 1FNZA 3WCSA 4GZ9A 4FPOB 1H2NA 4QXCA 4QXHA 2XWJB 2A45G 1LB2A 1WGPA 3V4QA 4JKLA 3P8CE 3LPGA 3L73G 4QQLA 4XHBA 3VD4A 1KRIA 4IERA 4BWOA 1DQ4A 1IFPA 1JTZX 1CZVA 2RS12 3KZIH 2HFED 5B4XA 4CP1A 3PH0A 2VMDA 3CPWO 1H8TA 1J1DB 1JEKA 4N53C 2LXCB 2CDOA 5FZ3A 1GFF2 4LIUA 5E1RA 4KWUA 2B89A 2VOTA 4R9CA 1C3HA 5KLVG 2ZX4A 1BCCG 1LOFC 2MNGA 1UNBA 1YFUA 3H1YA 4QGLA 4MLOA 3VZNA 2MEV1 5CNAA 4JRLA 3MW3A 4YRDA 3UKVA 3DXTA 3EMRA 5EJ3A 1PGJA 3GBFA 4FVVA 4XPVA 5J09A 5IK7A 1RF0A 2VZSA 2W94A 3OGGA 5I93A 4XUOA 3WP4A 3EO6A 1H88A 1DEEG 2VPVA 4HXCA 4K21A 3WHUA 1H8AA 3S5AA 1UQXA 4Y33A 3S7EA 3H1LG 4RKUJ 3OGRA 5E79E 1OWAA 1A02J 3GMAA 5FYSA 3WUTA 2M8RA 2AH2A 2Y6LA 3QACA 1VQ9P 5AFEA 4UFLA 5I8TA 3VP8A 4QPIB 2W68A 2ZGTA 1DDLA 2HODA 3B01A 5BNPA 3CCJP 2ATFA 3WU2E 5ERLA 1SPPB 4EIJA 1VBA1 1YIFA 3VV1A 1GU3A 3GCWA 3AEEC 3P3NA 1NAYA 1CONA 4CPGA 5KLIB 3RL0B 4NIIA 4D0QA 3H8RA 1A8DA 4ZNCA 5LBBA 3WF0A 2BBAA 5FZDA 4TTGA 1NA1B 1XE7A 5J36A 4IW3A 4LK7A 1V0AA 5FYBA 3DPRA 2JE9A 2ZHLA 5FZAA 2HWD3 4IGPA 5LA0A 1X50A 1RXFA 1UW8A 4GH4B 3MLJA 2VO5A 1W2OA 2IYPA 2FYUG 3AP6A 4PI0A 5AW7B 4XILA 2J1AA 3AP5A 4H7LA 1BBT3 2ZFCA 5CVRA 4A6OA 1FYUA 1J1EC 4RN5A 3AL6A 3PLNA 3NJYA 2WSFH 4UFHA 3HR9A 2SLIA 1NLSA 1IS5A 1RJ8A 4E2GA 3G4SP 5KR7A 3VUOA 1BMV1 3D3AA 4P5YA 2B87A 2WIIB 4RS5A 1REFA 2ZT9C 2Q9IA 5A7NA 2WKKA 4HPKB 1LOFA 2FFDA 3ETPA 4IL6E 4K7JA 4AHYA 3B5ND 2NRGA 2ETEA 1X79B 4XUPA 3I55P 2BERA 1SQVD 3EFFK 3NV4A 3ZDVA 4KWLA 2GC2A 3BU7A 1DHKB 4FOQA 4LIVA 2ZMKA 2H8PD 4XEZA 1L4AD 2FQPA 3TGUD 1F2NA 2RS33 2B7YA 4AGVA 3NO8A 4OGQB 1C8M2 1FOD3 2C1FA 1REEA 4IGQA 1WA4A 1UO9A 2VE1A 3WX5A 3TN93 1AVYA 4E4SA 2VXJA 2WS91 2ZA9A 4XXPA 2D43A 5JVVA 3VHRA 4NUBA 1GR3A 4EYYQ 2V4VA 4P14A 3SWKA 5FQ0A 1QJY3 3HWJA 3N7LA 4Q4V3 2VC9A 1RINA 3H1IE 1H4GA 5A3MA 4XFIA 1UXXX 3T97B 2WS92 3O1UA 2PTMA 3VBUC 3TYJA 1AXKA 1ENSA 1C8NA 3D0JA 2C0WA 5GJ6A 3T2TA 3T2QA 1OW6A 3WEZA 2QFEA 1K12A 3Q8AA 3DXUA 5FZMA 1G7YA 4TLGA 4NHLA 4MXWA 2PQSA 5FOJB 1RVF2 5APXA 4CPBA 4QDQA 1U5YA 1GP5A 1UYPA 4I0BA 2MPFA 2ZMNA 3S7IA 5EWSA 1UZWA 3TNUB 3VHPA 4C91A 5C3OA 3PTRB 5F5QA 2R5BA 4AEKA 1HQNA 1JH5A 2F17A 3ZMOA 1HTLC 4Y20B 5JSPA 4IFDK 3I4IA 3VLBB 2WFF2 2WO7A 2D2CB 4BU2A 2GMEA 4CEWC 1ZOYC 5AVQB 5CEHA 4XQDA 3A0HE 3C7EA 1HDKA 2CL2A 5CBNA 2ZHMA 3O1RA 4FTSA 2WR9A 3BCWA 2PHRA 5ABJC 4XFGA 3ZFEA 2N1TC 2J1UA 3CC2P 4ISRA 1SEFA 1H8TB 2AGSA 4EI2A 1RY3A 2HEVF 3AK0A 3KF5A 3KVBA 1EUUA 4OCTA 3BRTB 2OYOA 1JOJA 3K4AA 4QQHA 5L9VA 1VMHA 1I5PA 4JTOA 1US3A 3H1JJ 3VBUA 5FY4A 5LK7B 4QGNA 2Z5IA 3CQOA 3MW4A 5T52A 2FCUA 5GZEA 3MGUA 5ABJB 1KZUB 1F15A 1R8EA 1PIV1 1U12A 3AEGC 1AX0A 3IIAA 3P6BA 4NRMA 4P00B 5A7PA 1FV3A 1URQC 1G6NA 1NZCA 1O7FA 2HWB3 1RXGA 1PIV2 4HSJA 4XAAA 2FYNB 1W6PB 3WSOA 1RUD1 1N7SC 2QVAA 1J3PA 1K5MA 5CCHC 3E5QA 1MS3A 5KAFH 3USUA 1MR5A 5LASA 4DCKA 2ZZQA 3TN91 2ZGLA 1W6OB 4K9SA 3MF6A 4KGGA 1NX9A 4ZS2A 2FYNC 1SQXE 4ZKUA 2G9ZA 3PMSA 5E8AA 3PVNA 2R5DA 1JUIA 5DMYA 5I0TA 5JLVA 2WSEJ 1PZ8A 3JCUH 1UZYA 1KB9I 2YGLA 2V5DA 1JOCA 2ZGKA 5L36A 4JGZA 1DBNA 2K9YA 1PGSA 2KLVA 4GULA 4C90A 3I7DA 4WZCA 1KITA 4L9BA 2ZOEB 1FZEA 2JE8A 3L74D 4GMP3 4ASLA 4AVVA 1NA1A 5CFDB 2BNMA 2VBPA 1P84H 2QG4A 2K46A 1JY2P 2KS1B 1OVSA 3URFA 3L72E 5FY5A 1HV1A 4NIDA 2QM8A 3WDUA 3ZR5A 1FDIA 2D2CC 3HD7B 3L74J 3A22A 4BJ0A 1JYCA 2JIJA 4D6TD 4B86A 3NNMA 4LKFA 5DAVA 3VD7A 1E79H 3OYWB 3RMXA 3WG4A 1EC5A 3VMZA 1BEV3 1L0NE 3UV9A 3WT3A 1URXA 4AEDB 4BM8A 2WLPA 1IG0A 3IPVA 2ZGMA 1DGWX 2LKMA 5D8AC 2FKWB 2N9YB 4RO0A 5CCGC 2QTWB 4EROA 4D6TJ 1OW8A 1DYPA 3OBAA 4TSVA 4YARA 5BY5A 1X8YA 4PV1C 4JGZC 2M3EA 2W8ZA 3TGUG 4DT0A 4ATFA 2G1MA 5IVBA 2VZRA 1NTMJ 4Q8KA 2QQPA 2P1JA 2O01H 4L97A 3ZSJA 4JRAA 1DYKA 3M70A 1ST8A 4C0HA 3E1RA 1VRH3 1CIYA 5B2GB 2YB7A 2B46X 2OXBA 3A0KA 2C0XA 5FO7B 5HCBA 3B5LB 2BCCG 3AMNA 5TISH 1BCXA 1LT9B 1GDTA 2WZR1 1KFNA 3C7OA 4WZFA 2AUYA 2Y34A 2AEMA 1GMMA 2UWBA 4DINB 5CJ4A 3O7OA 2XJSA 2A1XA 1VBD3 1Y9QA 1JYXA 4CU7A 1N73C 1SQXG 3LFIA 1LP1B 4RGAA 4ZY9A 2IZ0A 3KHUA 5AVVB 4RQPC 1SHWB 4DXRA 1RE4C 3FGAD 5IW0A 5JOXA 1L7RA 4XF4A 4ZZ8A 3BTAA 3ZYHA 2HWD2 4HANA 3W5MA 3PRJA 1F31A 2DWRA 2WNUC 4MZUA 4D69A 3KMHA 4FAGA 1XYNA 5GKAC 1PM4A 2BOIA 5BYNA 4JDOA 2QKDA 4CCMA 1UMZA 4QB6A 1UKRA 3LCPA 1AR71 4L0PA 2YPDA 4QXBA 5E88A 4WY4A 1PV3A 1CAUB 3CBNA 3C3VA 3UESA 1JTHB 1W2UA 3WG3A 3H1LJ 4ARXA 3H1JE 2P5BA 3BB6A 4K1ZA 2ZT9B 3T0BA 2RE9A 2VG9A 2IVJA 1N7LA 1Y9GA 3O1PA 1REDA 3CL3D 1LEMA 4CCLA 1MEC1 3BCCG 1UU5A 2IXHA 3OD0A 1RYYA 1AFOA 4C7RA 3MO4A 3H1LD 1I5ZA 3LDBA 4IGOA 5C4WA 4FQZA 3DYOA 4XBNA 1GOFA 1LGBA 3FLPA 4META 3KQRA 2RM22 1NCRB 4N43B 5KXBA 1J84A 4U7JA 3MIGA 5SV5A 3O6QA 3H1MA 3VBOB 1VRH2 3RMYA 1OSGA 4P9IA 1UWWA 2FDJA 3I3DA 1KTMA 2RM21 5AW6B 1PO23 2ZABA 3BCCJ 3L75J 2LW8A 4QT6A 2C0ZA 1OVRA 3AE6C 2Z2SB 3D6ZA 3M2MA 3WINE 1CX1A 1W6NA 3I2FA 4AI9A 3ZFGA 1LGHB 4EOTA 4KMQA 3ITQA 4W4ZA 2K9ZA 4FFIA 3I54A 4MGTA 5J7MA 2CHHA 3P32A 4GKYA 4OZXA 4GT1A 1ND2C 1UIJA 2TBVA 4NR1A 4BQ5A 1W5CE 3L4FA 5KHIA 3DYPA 1X8EA 2FDFA 2VUJA 4ARYA 1PVC3 1V9U3 3R2PA 4U3FG 2D2CD 5B5EE 3X29B 1NTMD 3FE5A 4BCUA 1NZIA 1LHOA 3PIJA 4N8MA 3ZVXA 4ZKPA 3CEWA 2YMZA 3LIHA 3VDAA 1EZVG 3RZJA 2VUCA 4Q4X1 2B8MA 4YW6A 1U0AA 1RMU3 4CUCA 3OA7A 5FP8A 2OYIA 3HD8B 5T54A 3VBHC 4A6SA 1K42A 3VBSA 5LA1A 4LHKA 2OUHA 2WSSH 1PP9D 2RMU3 4JHZA 5LWBA 3RPQA 1XYPA 2DUPA 2E53A 3ZXAC 5H2FE 2O01J 1OD3A 3WUVA 2DV9A 2ILMA 3ZFGB 5BNOA 1ZLLA 1YHQP 3AE2C 3MIEA 2W46A 2WJSA 1AYN1 1GL2A 4ITCA 2QM7A 2RS11 4WM8A 2FZ2A 1NTME 1DGRA 1AYM1 1Q8SA 4E2SA 3I2GA 5K8SA 1LODA 3KGZA 5AVUB 3LA3A 4QU2A 3C8VA 4ASKA 1LHWA 1LOCA 2ZTNA 2ZJSE 4IV3C 2ADDA 4E9KA 5ABJA 2OKXA 5LY1A 3V6IA 3U10A 1MQTC 3PP5A 2XB6C 5C70A 3OTFA 3FX0A 2XMLA 4O65A 1GMJA 3OUJA 1OF4A 2CGOA 1P8JA 3JSVC 1BSHA 1Z78A 3AKTA 4OMDA 1O3QA 2I07B 2E75D 2EXHA 3UGHA 3WUCA 4MO3M 4YXWH 4HKZH 2VJXA 2X29A 4HOOA 1TMF1 3D71A 5CKMA 3R4UA 2IFNA 3E1F1 3CX5D 4CXXA 4IEXA 4DEVA 2HR3A 3B93A 2L91A 3RK3E 4C7NA 3JCUE 2BFUL 1PVC2 1DIPA 1RUH1 1V9U2 2J1SA 3B3QE 4D7YA 4I7ZB 2E74D 1WLTA 3MDPA 4XVHA 1J59A 4NOTA 2N1TB 5JMCA 3U4SA 5CISA 1JY2N 3RFRA 3GZUC 1SPPA 2XUEA 4EDFA 3J8F1 4Y4RA 2B88A 3WNMA 4QX8A 3KV6A 4UWDA 3ZYJB 2JG8C 4XQ4A 4EJRA 5LEJA 3OY8B 3VKMA 3ZYPA 1POV0 5F2WA 4LE4A 1ZBE2 4OVEA 3OPTA 2EAAA 2RV9A 3CIHA 1SQPJ 1QIQA 3H0OA 2GAUA 4YGCA 1GQGA 3SKJE 1QX8A 1NU1K 2DCYA 1SQQK 2DYCA 2ZVOB 1ZBE1 3LAGA 3FXDA 2M3BA 4MGYE 3ZIXA 5A3TA 3O1MA 3MFCA 3H1KJ 3HAGA 3HNBM 2E75B 1X9PA 4L75A 2E74C 4N78D 3P7KA 1FZFA 1YI9A 1HQLA 1UYXA 2BGOA 2ZGNA 4LNVA 4CDWA 3R05A 4AHXA 2RS13 1NLRA 1YBKA 5CA6A 3J4UH 2W1SA 3HBKA 1BK0A 3JBG3 1COV2 4SBVA 4UW6A 4M3CE 5FBZA 3H1KD 2E42A 1ASJ1 1HUCA 1DIWA 1O4ZA 1UMIA 2D44A 1EPZA 2MEV3 3L72J 3L2HA 1W8FA 4G3YC 4IDZA 4LBQB 1MV8A 4DZOA 1DP0A 4HPKA 1WW6A 3WP3A 5JPNB 1O59A 1ASJ2 5FP3A 2E75C 4CA9A 1SFCC 3ZIWA 2AEYA 4A2UA 1OURA 5JZGC 2K9JB 3EQEA 5KJ7A 5CFDA 1RUC1 3NQHA 4Y22B 3BIEA 3A7OA 1IKQA 3P3PA 1RUI3 2V09A 2YKOA 2ENRA 2ZGUA 3UGFA 1NQDA 1UOGA 3JBG2 2WYFA 4GXLA 4B4QA 5JIAA 1ND3A 2X09A 1V6LA 1KS4A 4BWNA 3B9IA 1RTVA 3N7KA 3OBRA 2Y0CA 2YO3A 4QPGA 2JB8A 2WLQA 3DGTA 2EXKA 1JCDA 1GZWB 4CU6A 5FXVA 4AVBA 3LSEA 1QJU1 3Q3DA 1WMEA 1QKQA 1LECA 1HN1A 3AC0A 5FZ4A 4QB1A 4UB6H 2QA4P 2BYVE 2PXJA 3N3HA 4YFZA 2V7QJ 3WQBA 1GU5A 1AR81 1VJ2A 4U2AA 1AX1A 1QJU2 3VDDB 5ACA3 2IXKA 4QKDA 4H2AA 3SH4A 2FDGA 2FYUD 3SSUA 1IO4A 1FZCC 4BPZA 4LHLA 4UF0B 4XURA 2YBSA 5JAXA 5K0UC 1USEA 1VAVA 2ZCWA 3AMQA 1G9AA 1IK7A 4NPMA 5FY8A 4ZONA 1FMD3 3MIFA 3PU8A 4KWKA 3SH5A 4MV2A 3SNMA 5A6XA 2BJSA 4JX0A 3U11A 5APWA 2YUEA 1JOBA 1V6KA 2GNDA 4XBQA 3AE5C 2JE7A 4M01A 2JDAA 4I3PA 4CEYA 1XNCA 1QOOA 1RC6A 4C1XA 3L73E 1YFYA 4RR3A 3SWFA 4KL1A 4MGSA 1AV1A 2LROA 3I2JA 1OUSA 1KFXL 2PA7A 4AL9A 1EP0A 4MUVA 5FZHA 5M1BA 4CP9B 3VBHB 4DXTA 4D94A 1UY3A 1WMDA 4FAHA 3TBDA 2QQJA 2EALA 4LKSA 1K9MQ 1QJZA 1W9WA 1NE4A 2HBTA 5FK7A 4AI0A 4AW7A 4NIAA 1VBE3 2VOWA 3ACIA 3NNFA 1UOBA 3H1WA 2GU9A 1GU4A 3AZWA 3N9LA 4RHV2 1X8MA 3C7FA 4HN0A 3L71G 1JM0A 5IVYA 4CSWA 3IAPA 5KHKA 3I2OA 1LU1A 1ZN5A 2NPIA 4QKNA 1SMVA 4GB33 3NV1A 1UL9A 2P17A 4LA2A 1XYOA 4XTMA 1L0ND 2B42B 3L36A 2W27A 4Y28J 2R6QA 2WC2A 4JDNA 3HPNA 5EQUA 1JY3N 1VAMA 3VBFB 2ZAEB 1DLLA 1PVXA 3LB9A 2KOGA 2KSJA 1V70A 5FFOC 1ND2A 1UU6A 1HWTC 1TE1B 3WF4A 2RS53 4BDVB 1WLWA 5B66E 1MVQA 1LTEA 5HV0A 2BQPA 2XBO1 2QZ2A 2OX0A 3L75E 2Y33A 3CCMP 3V0BA 4GODA 2FXMA 2DUQA 4P9JA 3S4RA 2QUOA 3ZXFA 3LIEA 4CP9A 1AQTA 1AZDA 1KMIZ 1MFZA 1C8M3 3TNPB 4Y26A 1QY4A 4Q1RA 2JD4A 1CI6A 1CAVB 5GLVA 4DRRA 1DQ0A 1SBFA 2DW3A 3L71J 2VOKA 3BYWA 3GF3A 3CKHA 4MYEA 5AVTB 2HWE3 2W95A 4MGKE 4XIKA 2IFRA 4OQ9A 4Y1XA 1OQ1A 1S5LX 2XJQA 3H7YA 4P08A 1HGZA 1PGPA 2Q4SA 1OXCA 2W1WA 4HKWA 5FMDA 5FZOB 3ZFEC 2WSCH 1S9KE 3NSTA 1M8OB 1AR63 1W39A 2RH0A 2VBBA 3QH7A 5FZOA 3O1SA 4M00A 1O4TA 4Q4Y1 1VMJA 3OUHA 3OYWA 1EZVE 3RG0A 4CTEA 3GXUA 2Q8OA 4AYUA 5IJRA 1OX3A 1CZSA 4RR3B 2BVBA 2FYUJ 5KKZC 1NAEA 2P34A 4M3CB 2RN0A 1HXS2 1VB4A 1B35C 2HBUA 3JUUA 3NMBA 5A6YA 1G9CA 4YZ1A 5C8CC 2VNGA 5IVJA 3HD7D 2R043 4HH2A 2XJUA 1CESA 4CU9A 2C6SA 5HV4A 2IFMA 1R64A 3WY6A 3NTNA 2E5YA 4AFDA 3VBSB 1W9YA 4PV1D 3HOBA 1NU1G 4BE3A 1YJWP 4CDXA 2VW2A 1DD4A 2PFXA 1J83A 2LM3A 2NLRA 5FZBA 5F37A 3NXSA 4YW4A 5CG8A 4YFWA 1Q56A 4PQQA 4XFJA 4YVWA 2DU1A 4LHNA 5A3UA 5EIYB 4AZZA 5C3QA 3V2PA 3T1LA 3ZYRA 3RZLA 4ZMDA 1OLMA 4PI2A 3WW2A 5CAZA 1PPJD 1C5IA 1W2TA 2JDUA 1D2SA 2RS51 1I6XA 4LBNA 4PDWB 2Y0EA 3POJA 4S2DA 5EJZB 4A41A 4XDOA 4DY3A 2B4KA 2W6JH 1ENXA 5CFCB 2C4XA 2RJ2A 2R32A 3CLQA 3M3CA 1WW7A 3BODA 5DZGA 2EXIA 2A6XA 4HZFA 2J42A 4LC1A 5EZWA 1SFCA 1L7QA 1NT0A 4W65A 2VH9A 1D4M2 4IE7A 1RUF2 3LA7A 3SHRA 4JPZB 4B4RA 1JHJA 2W92A 4YVSC 1LOGA 1FT9A 3MYXA 2JDZA 3FLRA 1KGYA 4XF9A 4Z1MH 2E76C 2BNOA 1BQPA 3W21A 1HRI2 2OQ7A 2M5AB 3KCCA 4UAPA 3RYRA 1LJ2A 1VF5C 4DY5A 3DV8A 4JGYA 3A0BH 3H32A 1K05A 4G4FA 5GM0A 3I2HA 1WW4A 1EYBA 4C0BA 3H8OA 2XPJA 1Q8VA 1YIJP 2H6BA 5BU5A 1BMV2 1AUYA 4OH8B 2O3JA 2OYHA 3QBQA 4AGRA 3PNAA 1W90A 2VBDA 3K5BA 5EHDA 5A7SA 3JD71 1PIV3 3G6JB 4LK6A 3MIDA 1Q5OA 5FZIA 3WNXA 3H1KE 3GHGC 3ABVC 2QEXP 1KYOI 4Y99C 1VRH1 1XNTA 2Y0DA 2QQMA 2VMCA 2X5IB 2QJKC 3MPPG 4OHWA 3WNNA 5C9AA 4WY4D 3JD72 1NOHA 5LBCA 4FPYA 3LD8A 2Y6GA 2WZR3 3H1LE 1R082 1SBEA 3H3ZA 4NE9A 5BNPC 2P3KA 4YM1A 1AHSA 3KPEA 1CR7A 2PHXA 2B9VA 1VQKP 5AW9B 1UMHA 3HQUA 2BW8A 2AZ5A 3RZGA 1W2BO 1NCQB 1NXMA 3B69A 4KQ7A 2QE3A 2V5YA 4RGGA 3N9PA 4RYDA 2JP3A 4XFAA 4CDQC 3AYEA 3GYDA 1ZW0A 3KZ4C 4A3ZA 4BISA 3OGJA 2CAVA 3ZYFA 3RRDA 1KFMA 1OPOA 1N1YA 2KUBA 4GWMA 3BTZA 5IK4A 1BKZA 1IFMA 3AP7A 3UYJA 3VZOA 1LT9C 1DG6A 2RDRA 2JICA 1Y4WA 2RG4A 4E2QA 4ONUA 5LEKA 4JBZA 4L74A 2JKXA 2ZGQA 4MGQA 4GMP1 1BGYD 1K73Q 4V1PA 4QQPA 1NH4A 4BQ2A 1V6MA 3AZVA 3CI9A 3KD4A 3ME2A 1XTGB 3O1TA 1G86A 1RF0C 1DCSA 1OC1A 3A4UA 2H89C 3L72G 4CCOA 3ZPYA 1AX2A 1LWUC 2BZDA 3TB0A 2FXPA 3ZFFA 2Q3EA 3B71A 1BGYJ 1OT5A 1PX4A 5JI9A 1POV1 1MS5A 1YQ2A 1L4AB 2VOVA 4FFFA 4IOIH 1AYN2 4PF1A 5AW3B 3F95A 5KHHA 3KSCA 4DUXA 3H1ID 1ZR2A 2POHA 5FOBB 4AEMA 3K4ZA 3H1HG 4G9SB 4L11A 3VZMA 1AVOA 1IC2A 2HPCA 3CJIB 3SITA 4E4DX 4N53A 2DURA 5FMOL 4YZ5A 4XJZA 4QPIC 3WG2A 5AW5B 2GN7A 1YHFA 4FPKA 4CP2A 1KC8Q 2ID4A 2QE7H 3B94A 4YZ2A 3JD73 1NWQA 2A6WA 4WM7C 4F3JA 2FDHA 2XKMA 3SXWA 4E8DA 3PDQA 4AI2A 2X5IC 1KFUL 2A6VA 4UW3A 3WDXA 1BYHA 2IVIB 2XQXA 3NJVA 3UK9A 4ES9A 5JXHA 4YW3A 2P2KA 3ZXDA 5IYYA 2YU1A 4OYUA 3HRNA 4AI3A 4DFSA 1FZAA 1GZCA 2A71A 3T09A 1OXZA 2KA3A 5B66H 2J1RA 1NCQC 3KYQA 1YJNP 1YJLA 5T50A 3VBOC 5APAA 5JZGA 2IZ1A 3HE4B 1PVC1 1V9U1 2Z42A 2ZX3A 3JXSA 3NAPC 1CQ9A 2D6LX 4Q0SA 5CZKA 5IWFA 1UIXA 2OPWA 4QB2A 3JZVA 1Z7S2 1EPWA 2WWSA 5CKQA 4FTEA 1AJKA 3CZUA 3RL0D 2KR2A 1YTZI 1PFIA 3O0WA 4LBQA 4FTBA 4N9IA 4PQ9A 2JG8A 1DU3D 1KDKA 1MZEA 2D5FA 5SV8A 1IQDC 3TGUJ 1GWLA 1HH0A 2CK3H 1N8RQ 1N1TA 2A70A 2GDFA 3D4KA 3HT2A 4X6QB 5DUVA 2EIEA 2QJPB 1LKNA 3MZWB 3ZDSA 4EYUA 2YYOA 4ZHNA 2WVRA 4H13B 1E5IA 2EVXA 3H3UA 3MTUE 1UPIA 1IPJA 4IEQA 4JKMA 5C5UA 5HI0A 1F4HA 1H1IA 3VKFC 5DPNA 4QM9A 4HVOA 1LWUB 1M56D 5AVRB 3MFAA 5C6CA 1HKDA 1CWPA 2ZXEB 2VU9A 3OF1A 1LTIC 1YQ8A 3C7GA 1RUE2 4IETA 4RESB 4Q4V2 5FRAA 3V65A 5I8YA 5IAXA 1B35A 1IS3A 4KWJA 2ERFA 1KYOE 1ZM1A 3R4DB 1JUHA 1L0LE 1NTZE 3JCIA 1HV0A 2VMIA 3E6DA 1KXGA 4QHOA 4WM7A 2C9LY 1ND2B 2E43A 1RUE1 2YFZA 3KWVA 1NQJA 1COV1 3QOPA 3B5NB 4GIQA 4BH9A 1JU4A 2B87B 3FBYA 3JQXA 5JI7A 1VL2A 3MUDA 4QGMA 1XSRA 3NNGA 4QKBA 5FMOS 3SH3A 4GJZA 1A34A 3ZPOA 4FPGA 1RHI3 4ASVA 4BA6A 5KHGA 1CAWB 2KYVA 2OTJP 4NVPA 2VUAA 1QGKB 3RBXA 4AVTA 1T2KC 2Y8KA 3MLKA 4K1YA 3IAQA 1LTSC 4N6JA 1IZ3A 3CDZB 4CDXB 3BUCA 2J5UA 1UOFA 2Q8EA 3GNEA 4EE2A 1HRV1 1PZ9A 3M3EA 1XJAA 3U78A 1K8AQ 4MH0E 1NAFA 1W8OA 2ITAA 2K1AA 1GNZA 1SP4A 2A5ZA 2R0HA 2IFWA 4FQ4A 4FXGB 4LKEA 1QOTA 2R44A 3POSA 4IEOA 5FREA 1VQNP 1SLTA 3Q1MA 1S9KD 1PGW2 3FUQA 3PTZA 3KQ4B 2HODB 2DF7A 2WA4A 1GK6A 1UU4A 5FBJA 1FDOA 2PN5A 4XJ9A 3VBUB 3J8F3 3VBSC 3CXHE 2R49A 1NKNA 2ZX1A 3AJZA 4LO8A 4AFBA 2IBZD 1BBT2 3F2ZA 4CCCA 2R3SA 1AR82 2VW1A 3VBOA 3C2UA 4AFCA 2I2SA 4HETA 4CXWA 1W3XA 5JSOA 1ZZ8A 1S0EA 4XZPA 1F35A 1JUNA 1JMUB 1XPWA 4HMZA 1VF5B 3EBRA 4ATEA 3K2OA 5ANNA 5A1FA 3EB7A 4EN6B 1IKPA 1D7PM 3SEPA 1NTKJ 3CXHI 3ECQA 1LEDA 2NN8A 4CE8A 4B29A 4CDQB 3GLMA 2VMHA 4UW4A 3CWBG 1ZZ7A 3L70E 1VQMP 5G05L 4AFMA 2X53S 1N7SB 2DFCA 5FXWA 1VBB2 1NTKD 3EWKA 2CPSA 2FMYA 2FXOA 3H32B 3EYPA 2VGDA 1VQPP 4XJAA 1SDDB 3AYAA 3JQWA 1O5UA 3DYMA 4L2NA 4XHXA 5FJHA 5FUPA 1AVBA 2FZ1A 4D8MA 2C9NY 1VP6A 1BDCA 4PCRA 1NTKG 1SLQA 1S0IA 3DPRC 4NO4A 1STMA 1EV11 1QQP3 1F5FA 4YVSB 1PNFA 3TOJA 1TQ5A 3EQ2A 2NPSA 4AQ6A 2H0VA 1JZ8A 2DBIA 2RKLA 3THDA 3FXEA 4HVRA 1IJDB 2XV5A 4LBKA 4U3FJ 2NMOA 5BPXA 1NKZB 3L75G 4GOEA 1WD4A 2BU9A 1ZNPA 2ES3A 2OIIA 2RR11 3ACFA 3GHNA 4WVWA 2D6KA 4IL7A 3OPZA 2AC1A 2WT0A 3S57A 3HE5A 1AYM2 2RJLA 4Q0UA 1SQ4A 3J7LA 3NWKA 1HRV3 4AAXA 1J1TA 4QPGB 4UYBA 2X10A 3WNLA 3WNOA 4IE0A 1KQLA 1T3UA 1HRI3 2JJLA 1ZZ6A 2R073 4V2VA 1W8TA 4RJTA 1UCXA 2R061 2W5FA 2J58A 3SCGA 2JWAA 5FO9B 4AEDC 1LENA 5A3WA 1SFPA 2P37A 4CXYA 1H9PA 4D6TG 2P3IA 2QQVA 2GMMA 2XBO2 2LR2A 3A0HH 3L35A 1DGRN 3E5UA 3KHBA 4AQTA 5JWPA 1AJYA 4A7YA 2RDQA 1GD2E 4Y24A 2JDHA 5DDJ1 3PJQA 5GLTA 1VBC1 2J1TA 3ZXKA 2Q1MA 3MV01 2ARAA 1JN2P 2VM9A 2A7AA 4BQ1A 4XUNA 5DDJ2 1XQNA 4AXOA 1VBC2 3RJ2X 4AFAA 3L70G 2YMKA 1BJQA 1WCDJ 5IATA 3BATA 2J7MA 5JUVA 3TWIA 1MACA 3TK1A 4Q29A 4Z8BA 5B4NA 3KCYA 5JR2A 4OUEA 1GK4A 4EWAA 5HPOA 1FATA 2GP3A 2LRPA 1LOAA 1UX6A 1M1JA 1OA4A 3ILRA 2VQUA 4AEDA 2N1TA 2P3YA 2ZGOA 1JS9A 3ZN6B 4BMBA 4RQPA 4D7SA 3U59A 4AK3A 5FXXA 3TEYA 3U0ZA 5AVWB 1DYOA 1TNRA 5K9YA 2SBAA 1WCQA 4I0WB 5K7PA 3OJBA 2CAUA 4B7EA 1XB9A 2AENA 2Q30A 4B7KA 3MD0A 4D6SA 1LTGC 1X82A 4Y5TA 3VDDC 3GM8A 2MJZA 3LEIA 4M0HA 4GJYA 1FX5A 1HB2A 4DS0A 1FOD1 2AEFA 1XOYA 2NP0A 4H14A 4INDA 5FKCA 1R5LA 5FPBA 2UURA 2O0OA 2DCKA 2F6BA 2JD9A 2WNUB 2YC4A 4OVNF 2ZGSA 4QM8A 3ZSEA 5LBEA 1SQVJ 4EZ4A 1IFJA 5JMOA 3VBFA 4BK5A 5AVXB 4FPEA 1YJ9P 2I8DA 3VD9A 1AR92 4XJ8A 4TLFA 1OBNA 4H0LB 5LRSA 3U14A 1PMJX 1C8M1 1DZTA 3HUSC 2FFDB 5FWEA 1T3JA 3RYPA 1KB9D 3PTYA 5FKBA 4C1WA 4COYA 5F1RA 1CZQA 3LKJA 2ARBA 4IEWA 5L73A 3L75D 4YW2A 3HN3A 1L0NK 5JXGA 2K9JA 3BOPA 1WA6X 4EN0A 1BXHA 2FCVA 3M1HA 1W3VA 2WPRA 4IFFA 3NMDA 2TNFA 3FWLA 1W9TA 3GHMA 4QD2A 1UF2C 3WZ1A 4IL6H 2Q0AA 4LT5A 1IK9A 3S0MA 1VMFA 5FZ6A 3BOWA 2F4PA 4I01A 1D4M1 1GYKA 1USDA 2JG9B 3IDBB 5F7UA 4PIZA 2WZEA 2BEZF 1RVF1 1VB2A 4FPFA 3W5NA 2XKOA 2DCJA 1AJOA 1DX7A 3TGUE 3RJRA 5T5PA 1EDJA 3OJAB 1GLHA 2G19A 1IOAA 3POFA 1WBLA 4TWTA 5DG2A 5GLZA 1UZZA 2E26A 5FR3A 2GUSA 3MPBA 1PO12 1RQUA 1VBE2 3U07A 5KC5A 2HWF3 3H1IJ 3MHZA 4JVAA 2EF6A 4XDPA 3RVHA 2PELA 4A7PA 1RMU2 2IBZI 2WSCJ 5DXDA 5IT6A 1MEC3 1D0GA 1VBE1 1MKMA 3RGBA 3AFKA 3PLQA 3T0DA 2DDUA 2QJPC 3ZYBA 2B9UA 4LO4B 1SQVG 1L0LJ 1NTZJ 4MGIE 3ZN5A 3MZHA 2VY0A 1VBD1 1X33A 5FY1A 5CG9A 1JOPA 2LTNA 1O91A 3VBRC 4AQSA 5JCTA 1IS4A 2R7EB 2V7QH 3KLSA 2AXCA 1KYOH 1VF5D 3WMM0 2Y0OA 2XOMA 2Z79A 5FQ0B 1R092 2QNKA 1U5IA 5C8CB 4PD4I 1VALA 4DO0A 1A3KA 3LOIA 5F6LB 1ULOA 2VZUA 4YGBA 4KNCA 3MLLA 1EAH1 3WXPA 4LULA 4ZXEA 2UWCA 1HGVA 2XH6A 4BHPA 1L2PA 1XXNA 3GZEA 5BNNA 2WN3A 1C1FA 4W7YA 4RHV1 1RUG2 5APYA 4GQ7A 3WD5A 2VMEA 4R9BA 2E5TA 2KI7B 3CCLP 5FYMA 1KS5A 2QQOA 1CAWA 3ACHA 4IV3B 4CDUC 3POYA 1D7MA 1ZRTD 1RUG1 3VTPC 2UY8A 3VN4A 1ZBA2 1N3OA 4K3UA 1JXNA 2X8KA 5KXEA 3IB3A 1V6IA 5M0TA 3GZAA 1GV9A 4Y20A 4UOJA 2XVGA 3K48A 1LTJA 3V2NA 1E57A 1W6QA 2D5HA 2RMZA 4OGQD 3LF7A 4I09A 4LBQD 3AP4A 1S4XA 1QVGO 3ZFGC 5AFBA 3PUIA 2IWGB 2WRAA 5BUVA 3UT0A 2Q5TA 5E89A 2PHTA 2WUHA 4FP2A 3VZKA 3WF2A 2PYTA 4O9EA 4Y5Z0 2P10A 4K40A 1FE6A 4RFT0 3I3MA 2W0XA 3C7HA 3W58A 3W9AA 5KLVE 1Y43B 1ZBA3 4IV1B 3WR0A 4JQRA 3NKTA 4AWDA 4N7UA 1SQVE 1GZLA 1MZ5A 1NTMK 3OOXA 3ZYIB 2YBKA 2ZZJA 4LO5B 1QJFA 4AVSA 3MIBA 3ZXLA 2XR4A 4QQ2A 1QWRA 1LHNA 4XJWA 4CDXC 3CCQP 4ES8A 3ZSLA 2D40A 2HH9A 5CU1A 3ALQA 3M91A 4S2FA 5LB6A 5APVA 1MVEA 3A0BE 2HEWF 2D6PA 3FWEA 3LGRA 3VMAA 3LSDA 4BLIA 5A6ZA 1W0PA 3P8CD 1WMKA 2N1TD 5EFWB 4C7NB 1N7SA 1DFQA 1K5MC 1VIWB 3H1JD 2Q1FA 2WFPA 2CY6A 3L72D 4QAWA 3WP6A 1I1EA 2W87A 3CMGA 3D6EA 1AL0G 2B45X 3HNYM 5GLUA 5H2FH 4PDWC 3ES1A 3L74E 4LOSA 5CFCA 3LEKA 2D3SA 5FTTC 2W52A 3I3BA 3GW6A 1HJ0A 1S2EA 2BGPA 3Q9OA 4V2WA 1JZ5A 1G1IA 1R083 2JG8B 3IAOA 3H8UA 3CU7A 4HSLA 1IFDA 4RL7A 1GOHA 3PHLA 2VXRA 3H42B 3Q2YA 2Y6KA 3OBZA 3VHOA 1NU1D 4HVQA 1YIPA 4XFBA 3H8XA 3ORJA 1BVVA 4B4PA 1OOPC 3C9IA 4KU7A 2WNVB 3ZXEA 2E6VA 2JKVA 2YV8A 5AC92 1SVFA 3RK3D 2WO1A 4FI9A 5IFTA 4GDOA 2GM4A 4B3NA 3A5TA 2QSIA 1GL2B 2HWD1 2R072 4WM8B 1JMBA 5A70A 3G9RA 4DXSA 5FYUA 2WPSA 2VQTA 3KT4A 4PLOA 3M0DC 4QX5A 3J7MA 4XUQA 1URQB 2G9GA 2ZYDA 1QJX2 5TISE 3IPVB 1OOPB 1KN7A 1NKGA 3CO2A 5FIXA 4BQXA 5A33B 4DXZA 3S30A 1YUDA 5C5TA 5BU8B 5I8SA 1YI2P 3RZKA 1J1EB 2JEMA 4K8FA 2K3RA 2WT7A 1GZTA 1PX3A 1PIXA 4FPLA 3WCRA 1OFNA 4IEUA 2RM23 4HK9A 2ZHNA 3O12A 3P5BA 5F32A 5JXIA 1ZV8A 5CBOA 2DVBA 4GH4A 1RITA 3VN0A 1X9TA 1EZVD 2Q1ZB 1QLED 1SLCA 4K20A 1SQQG 4Q1PA 4S2HA 5FZ7A 4WVZA 1AQ5A 1BK1A 3FC0A 4WB4A 3TF5A 5BNOB 3USSA 3IMNA 4U3FD 4I1LA 3WNPA 1LTJC 2XZRA 1AL22 1GWKA 4ZPIA 5AVAA 2QZ3A 5HXVA 5L9BA 3U37A 1SQQD 2VL4A 1IGOA 2E7QA 1CZTA 3ILNA 1KQGB 2J22A 4NPLA 1OZHA 1AL21 1HJGA 3M8LA 1ZYBA 4DUVA 5K5GB 4BIFA 3ACLA 1FAYA 3H1JG 1QHDA 1G2CA 1N73B 4IEYA 4CPBD 3HIFA 1SQQJ 1BBT1 4AR2A 3V56A 5EXOA 1BE3G 3GBWA 1HIXA 2OQQA 2QRXA 1OVVA 3M9HA 1HJFA 1SQPK 2E7TA 2HWE2 2IXIA 3H6PA 4JF7A 3OGVA 4H3WA 2PHWA 5FZGA 2WQYC 4YPJA 1NY71 3R6SA 4OLLA 3VZJA 4DNYA 3IKWA 1VLNA 2EICA 3U1XA 2XDVA 5J3UA 1W8WA 1W8NA 1O6UA 1L0LK 1NTZK 2WSFJ 2Z5HA 1FXZA 1HX6A 4JCKA 3M4FA 3OCPA 4QU1A 5K0UA 5IFPA 2P6HA 4WY4B 1AYN3 1F4AA 1LU2A 4YZ3A 5LA2A 1SQXD 1W06A 2O1JA 4UT5A 3WQ1A 1ZP0C 1VBB1 5A6QA 3LWCA 5FPLA 3ATGA 3O1VA 4TXWA 1BCCE 3AE4C 2JWDA 3ITKA 5LK5A 3VMYA 2X05A 3WQ0A 4NIHA 1ULFA 3L74G 5FYYA 4H0LC 4PDWA 4AOCA 1TG7A 4LHSA 4XMIA 1U7JA 1EDKA 3OBTA 1WLCA 4R4ZA 5D2AA 4CDUB 1LCLA 5AVPA 1YO8A 1T2XA 5IK8A 3CCVP 3H1HE 5AVYB 2WMMA 4YZ4A 5LRRA 3GG2A 2XGXA 3MEPA 3O6QB 1DZQA 2GNTA 1FU1A 1UY0A 5AW2B 3K3NA 2E32A 2DTYA 5F5AA 3TNUA 2BP6A 3AX4A 4LORA 1K3IA 3LZZA 1GBGA 2IXLA 2IDBA 4J1XA 3MUZ1 3T3YA 3W20A 2RR12 4AVAA 4FOVA 1OLRA 1LT9A 2EAKA 2H6CA 5FZ1A 1YC61 2V73A 1YJKA 1LULA 2N7GA 1O8PA 1Q3EA 2XDJA 3FWNA 1SLLA 2TEPA 4Q4W1 5IUQA 3V64A 4R4LA 2DFBA 3I2IA 4CEWA 5KTBA 1RUD3 5FZFA 1GZWA 2ZGPA 3FN9A 5DN2A 4IL6X 2R062 4RQPB 4LGDE 4N90A 3SC7X 4BLJA 1MZ9A 2BCCJ 3D6YA 3RK3C 2A45I 3CHXA 2I1KA 1TMF2 3BPSA 3IDCB 4MXVA 4NHYA 5IK5A 4JQTA 3BRVB 1TU3F 2JENA 1UYZA 4PIYA 5AC93 4NIGA 4NN0A 4DQAA 4KJMA 4BOWA 1EDIA 1UX7A 3KGLA 4Q0QA 2BCCD 4UFKA 4DJGA 3ZSKA 1EZVI 1RUH2 2UYAA 2YG0A 3RQ0A 2OYIB 2C9KA 1H8VA 2BEOA 5CB7A 2PAJA 1H89A 5C3RA 4ORFA 1N47A 1E5WA 1ZVFA 5AW0B 3J8F2 5EP9A 2NZ2A 1W6OA 1Z7S1 3RSJA 4EN9B 2WSVA 4KH9A 1QNYA 1YEWA 5FK8A 5I0UA 1S2BA 2GC1A 2WPQA 1J3RA 1FBMA 1VBB3 2BEQD 4UB8H 1KDMA 3ACGA 4I2OA 1QH6A 4Q26A 1VE0A 1YQCA 4DOUA 1LGNA 2VCAA 2GP5A 3PU3A 4LLFA 3ZX7A 1AR62 1SLIA 4IV1A 1BEV1 3UETA 5JOYA 5FYIA 1ALYA 1S4CA 2BV4A 3GJBA 2FYZA 4R9DA 3ZLIA 4ZU7A 3UKTA 3Q8EA 4BQ3A 1OFCX 5AW8B 3I59B 4F8AA 4YM3A 3BN6A 2KS1A 2O1KA 4CP0A 1JY3P 1WLDA 3CL1A 2Q8CA 5FPXA 2IX7C 4Q4V1 5A7WA 3P1IA 3GF6A 4PT6A 4BXSV 3IZOA 2UYBA 1ZMEC 3H1HD 1OD5A 2O01N 2QCSB 3SCFA 4R9AA 3H1IG 4AGGA 4BQYA 2R041 3I2DA 1W8ZA 3BCCE 2DUOA 1X7NA 3VHNA 3VBRA 2FDIA 1JW6A 4FPHA 3CMAP 1S55A 4I0AA 2FMDA 4EV0A 4H44C 3RK3B 2YU2A 2DVAA 2OZJA 2QJYB 1R1A1 2GC0A 2WWJA 4J6GA 1M90Q 4MADA 4N9HA 4UXAA 3UJQA 4EQVA 1WCUA 5F9TA 4YGEA 1J1DC 5KC6A 1G9DA 4BB3A 2C5DA 3M3QA 4BXFA 4XZUG 1PGL2 1GL2C 1HVVA 1R1A2 4Q5OA 4P9YA 4WM8C 3VKOA 4B1LA 5L19A 1LOEA 1NOVA 3EXUA 5KBFA 1CAXB 3BI3A 1SDWA 3AZXA 2SPZA 1H0TB 4UBHA 4LTAA 4Y22A 2KP8A 3WF3A 2XHNA 4AAPA 5F2SA 2A6ZA 3RGUA 2YXSA 5JSRA 3L70J 5HCFA 4FBFA 3RL0C 3FFQA 2YROA 4XTPA 4Y99B 1QDCA 2ZBJA 3USUB 5KWRA 1AF9A 1GTWA 5ISLA 2JB4A 3CX5E 2PLV1 3RZMA 4I2LC 3CC7P 2JXAA 5FMCA 5CHXA 1T6GC 1ONAA 2PHFA 2VQ0A 2AEZA 3HE4A 3T30A 1URQA 3LPFA 3ZN6A 1TZOA 1RUI2 2KM2A 3BALA 4CUGA 2E31A 1MFTA 2ZKNA 3POIA 2W08A 4OHZA 3LOBA 1XNBA 2F4LA 3O8ZA 1PO11 2WPVB 3V0BB 1ZRCA 3CX5I 3KV4A 1JO5A 4FFGA 3VKNA 4F7ZA 3GZTB 1CIWA 4YW1A 5GTIH 1PP9G 2E51A 1VQOP 2VNVA 2W39A 2Y64A 4LE3A 1WCSA 4A44A 2NQYA 4GB31 1VQ5P 3MICA 4JGYC 4LUMA 5FV3A 1XBFA 3GHGA 5AVSB 4IESA 1X0TA 5ACA2 1NCRC 1VQ8P 1VBD2 1YI7A 4C46A 2Q3IA 4Y1UA 1SQBG 4EWEA 1JZ2A 1PHMA 1LTTC 1IG3A 3MBWA 4P5HA 3AE1C 1NCQA 2A6YA 1JZ7A 1R091 3CCUP 4E27A 1EV12 3AMPA 2YMYA 2XKPA 5F5IA 1RF1B 3H25A 1S5LH 4JDMA 1GNHA 4UW5A 1CD3G 1GQHA 1LOBA 1XU2A 2ZX2A 3TAYA 4YW7A 3SISA 1OVUA 1ZA7A 2OW4A 2VZ1A 4CEWB 2WQ4A 5CADA 3DUIA 4QKFA 1JYIA 1GSLA 2QQNA 1OQEA 3FL7A 4IFMA 1M1JC 4JYCA 3BASA 1FPN1 2DVGA 5CYYA 2XVKA 1N3PA 3RS6A 3I5CA 2R0FA 5DDJ3 1XSQA 3VDDA 1VBC3 3GALA 1RUJ1 1X22A 5DAWA 4YPCA 2P67A 2KSEA 1NJIQ 1FPN2 1XNKA 1YQ5A 3NV2A 4U36A 3CF6E 4XCBA 3W59A 4Q0VA 2XLAA 1QU0A 1JYTA 5K4LA 1AR93 5FUIA 3ZM8A 5K0UB 1CPMA 1H2LA 4CCJA 2VVFA 2WO2A 3ZR6A 4Z2AA 3H1KG 1XE0A 5IVCA 2BWCA 3FMGA 5BXXA 1YTZT 3WHTA 2D6OX 1U57A 1WMFA 5FZ8A 2W3JA 1OUXA 3OAKA 1RJ7A 1SQPE 4HYTB 4NAMA 2E7AA 2EIDA 5JZGB 3HNMA 4FCAA 3AE8C 2QJKB 1VDFA 4C8DA 1RHZB 4PBPA 3AE9C 1S72P 3RZHA 1G2CB 1N73A 4Q0PA 1FJKA 4WY4C 5FZLA 5T5JA 3KDPB 3ZDMA 1S0FA 1H2KA 3PURA 4WVVA 2VQAA 4RSUA 4AYCA 4Q4Y2 1O8SA 3PUSA 5CBLA 1N1VA 2VZ3A 3K46A 2Z5WA 3ZO0B 4AVCA 4R4MA 1MUUA 2WNVA 4LUKA 1VBA2 2IC1A 1BE3D 3K51A 1DGWA 1WMXA 5E16A 2Q6QA 1NHLA 1HXS1 4Y4YA 1MQTA 2D3RA 1RE4A 4ZS3A 4DEQA 3GBGA 4XF1A 3TYYA 4Y5SA 3L71E 1ZRIA 4XE5B 1HN0A 1SCSA 3BTXA 3MGNA 1NE6A 1RB8G 3WU2H 2MHFA 3QH6A 1CSBA 1R093 4D6QA 5A33A 3FJSA 3N35A 2P58A 2M0BA 1UZVA 3U1CA 2JDKA 3H50A 1NG0A 1F9KA 1ULPA 4RHV3 4AE2A 1SACA 1RUOA 2AREA 3VL9A 1POQA 3NL1A 1FOD2 2ZAAA 1OVPA 4X8NA 2XLFA 3HTKA 5J48A 1SQXK 3U1AA 1RHI2 1QMJA 4N43A 1FPN3 5H9RA 1PL5A 4Y1ZA 3R4YA 1VAKA 3S6PA 3THTA 4AHWA 2V72A 2G8YA 2QQKA 3VYIA 5F3CA 2WTYA 4COUA 3KV9A 1NVOA 1W6MA 1WBFA 1JZ3A 1YQ6A 4ET7A 1L0NJ 1PK6C 5BVZA 2XQRA 4I3GA 2RS52 5DJUB 3IM0A 5IAVA 3F89A 1QH7A 2YZ4A 2BCCE 5TSWA 1W6NB 1AR91 4MOAA 4H44D 3I2KA 3ZKYA 1FI2A 3QWOC 3W68A 4NPEA 1YCIA 3DEMA 4KT0J 4Z07A 2RJKA 2QJYC 4IV1C 2G3AA 1H1MA 3N4MA 1Y47A 4K35A 3WG1A 2R30A 3A0NA 1GANA 4R4XA 2JKBA 5DZFA 2WABA 3LDKA 3WW4A 4BZ4A 5EPAA 3U4XA 3PHMA 2XUMA 5HBAA 1PK6A 2RMU1 1KQFB 3FBMA 3O14A 4DIQA 4DRVA 3VL8A 3II6A 3L71D 1NYWA 1I9RA 5LBFA 5CCGA 1H0BA 1H30A 4LBOA 3TEWA 2HWF1 1W04A 4ZKTB 1C1LA 2PAMA 2Y60A 3TRSB 5FDBA 2DU0A 4DUWA 1YRZA 3AXEA 3O5SA 2PQQA 1SCRA 2WSEH 4XMAA 1K5MB 1SQBK 4H44B 4WBAA 1VQ6P 1HQWA 3P8MC 3E97A 5FP7A 1OLQA 4P02B 5A32A 3LEMA 2JG9A 3O0XA 2WSUA 4OFGA 3CWBJ 4FSJA 2L5GB 1QJY2 3GDBA 1KILC 1SFNA 1RUC3 4UB8E 3OG2A 2WS93 3AEBC 1W2EA 2XL9A 4XF0A 1MS0A 3VBRB 1JBCA 5GALA 1Q7YQ 1QJY1 2VUDA 5D21A 4LITA 1ENRA 4Q4X3 4MHUA 1GKBA 3CWBD 1RMU1 1EAH3 1E5RA 1SFYA 1SLAA 4QX0A 2DCZA 5GTHE 1OHFA 1R081 2WFF1 4XC9A 4NMIA 4EN7B 1LTAC 4GKGA 4TYSA 2VZTA 1S0JA 1QXPA 4IE6A 4GALA 3T4HB 3I49A 1C5HA 1WZXA 4CUAA 5KAFE 1B09A 1GQPA 3CNAA 1Q2NA 1DF0A 4HJGH 2WA3A 3GCXA 1TNFA 1KJRA 3N9MA 5H9SA 5CKNA 3ASIA 4HB1A 5EFUA 2EIGA 2JWPA 1FC2C 3FX3A 1AR83 1HB3A 3OEBA 3Q8FA 4JZRA 4KU8A 4QXKA 4BMEA 3PUAA 1VQLP 3ZOIA 3T08A 2G9FA 4H7MA 4UFMA 1ZZ9A 4SLIA 5EJ1B 5FZKA 5A7WB 2YBPA 2I74A 5A32B 3N4XA 1EAH2 1AXYA 2GC3A 1JODA 1ND3C 2YO2A 2BOJA 3DL3A 2AR6A 1QL2A 4NHMA 2Y6FA 1PMHX 2QQIA 1XU1A 2VR4A 3M9QA 1NXD1 3ABZA 4FO9A 1IFIA 4NWWA 4CZSA 5CJ0A 2G4IA 4JGYB 3RYKA 4NRQA 3MIHA 5G04L 4OI1A 2UWJE 3D70A 2FBWC 3SWYA 1S2KA 3IT8A 4ASMB 1L4AC 1GP4A 1T2KD 1YFXA 4NRPA 3WF1A 1DQ5A 2HWB2 3NJXA 1TME3 2UWAA 5C39A 2P2UA 2VULA 3GGLA 1SQBE 3I3EA 4HL0A 3RL0g 3GHGB 3WDTA 4GKXA 4GWIA 4FPJA 1ASJ3 2NM1A 4QMAA 4H0LD 1JY2O 5DZEA 1XNAA 5IHRA 5GZDA 2BRTA 4I6MC 2JIGA 1KILB 3JB4C 1SZBA 1UKGA 3LW5J 3JU9A 5DUXA 4HFSA 1LESA 2VNOA 2ZYGA 5AW4B 1KD1Q 1AL23 1GUIA 2OT7A 2WNEA 3IMMA 2ZXQA 1OW7A 3PIGA 3B4SA 4HK8A 1DQ6A 4XF3A 3J26N 3HT1A 1MS8A 1NTKK 1XRUA 2VVEA 1N3QA 5LA9A 3CJXA 3S1KA 4JC1A 1W0NA 3CMEP 3AKRA 1G1JA 2HLEA 4P9WA 3HMYA 3SKVA 5L8RJ 3OUIA 4LPLA 1SLBA 5GTIE 1P84E 3UIAA 1KEXA 5DAPA 1BVP1 1ZRTE 2IUWA 4OI2A 2HWC3 1ZZCA 1LT1A 2D6MA 2BPA2 2H7HA 1W6PA 2QDRA 5LCWL 4KG0A 4CUBA 1D2QA 1JCCA 2WINB 3AB0A 5BV6A 4TZDA 4W8JA 4QDSA 5JOWA 1JTHA 2I45A 1DEBA 2HLOA 2DVDA 1EXJA 4QQOA 5F3EA 1TVGA 4M3LA 5F8PA 3MI8A 3ZMNA 2R1BA 1V00A 3JC22 4R8HA 1PPJG 5FJKA 1RUE3 1UY1A 4DB5A 3SLIA 5J1XA 1LRHA 2WAAA 2XHKA 2RS31 1UN1A 3POGA 4GWJA 5DAXA 4AQ2A 4PD4D 1LR5A 2VZOA 3AP9A 1GW3A 1AR61 4QHBA 2ZVNB 4XBLA 1ZREA 2XJVA 1TME2 2RS32 3BVHA 1FZCA 1ZX5A 2A06G 2ADEA 2FHRA 4FFHA 5F39A 1YNAA 4RFRB 2C9AA 3O0VA 3R4SA 3F5HA 1TME1 1DQ1A 3B02A 2O8OA 4L73A 4HG6B 2JDIH 3AE7C 2OQ6A 2HYNA 2R071 3ETQA 3N9OA 3I8TA 5FZCA 4Y1YA 1LHUA 3BKZA 2W83C 1QJU3 3OGSA 2EIBA 3VOPA 1C57A 3C8XA 4XIOA 1QJX1 3M06A 5CIRA 4CDQA 5FPVA 3IWZA 1LTJB 1US2A 1W6QB 3IDEA 1MS9A 3WDVA 3KM5A 5BNOC 1IHMA 5C71A 3I56P 1J3QA 3HN1A 5A3LA 4KBZA 3MW2A 3PVOA 1YXWA 1AR72 1N1SA 2YC0A 2OYIC 1QXRA 4OI4A 3RI9A 4BXLA 3ST7A 3G3ZA 3V0AB 1JZ6A 1V6JA 4Q2FA 2ZYAA 2XJRA 3SCHA 3AE3C 2Z4EA 1MZFA 1MEC2 4OULA 3LA2A 5IVVA 2J59M 3HQRA 2CTVA 1CAXA 4W7ZA 3ZN4A 2YHJA 1FS0E 1FZGA 5FPAA 2HYXA 2VZPA 3BVCA 3ZFFB 4CCNA 5B5EH 1AR73 3K3OA 2PMWB 2KK7A 2QIWA 1S0CA 2QBXA 2CDPA 5FP4A 4UI9L 3ZFEB 3GJAA 2ARXA 2ZEZA 2W9XA 3B9CA 4CDWB 4MX3A 1PPJE 1KD7A 1W99A 4WM7B 3LIDA 2A06E 5FAXA 1G9FA 1W0OA 2R1DA 4XA4A 4CCDA 5KLVK 3KS7A 4XFHA 2O1QA 2OTKE 3AFGA 2YDEA 1W2NA 2CYFA 3U75A 2HG5D 4Z1VA 2WZPP 3N7NA 4OMCA 2B39A 2QQLA 2XXZA 1M57D 1CJPA 4FOWA 3EJKA 1Y9BA 4URTA 2B5HA 4L76A 1WRGA 1XE8A 5EV7A 1PO22 5FZ0A 1UOJA 2P6CA 5I91A 1W6MB 3ZXGA 1UD1A 1CPNA 4QDRA 3E5XA 3RK2B 4WWIA 1GP6A 5CCGD 5APQA 1R5SA 4IQPA 1OIPA 1HF9A 1XC6A 3K4DA 4LBJA 2XWBB 2R063 1EQ7A 2K37A 3M0AA 1CX4A 1H6YA 4Q4X2 5I0SA 3AVSA 5GTHH 4BK4A 5EYXA 5C8CA 5J96B 2ARCA 1FNYA 2E76D 2PAEA 2VTXJ 1OA3A 1PZ7A 4MG2A 1J2JB 2GUVA 4K6BA 4DZGA 1RQVA 3H9AA 1H4HA 4RS5B 1DQ2A 3HEIA 4FXKB 5J37A 1KYOD 3V2RA 3AYCA 1FZBA 3N9QA 1P84D 4YTPC 2HEYF 2WBKA 1ZRRA 3H7JA 5BNNB 1Q82Q 4AG4A 1Q8PA 3V2QA 1QXJA 3CZJA 3N7JA 2LS6A 3T0AA 3B8EB 1KQRA 2YPJA 3WVJA 2QJVA 5C9AB 1O4YA 1AA0A 1RUJ2 4AI1A 2ZAHA 4Q4W2 2DCTA 3WLUA 3G7DA 3Q8BA 2VZQA 4LLHA 5A1AA 2FD8A 2MEV2 4BQWA 1YYNA 2GMPA 3HE5B 1DGLA 2WNUA 4P9LA 3ZFFC 3ILFA 2ZACA 3VZLA 1JMMA 3CCEP 3N9NA 2Q1KA 2PHUA 3B00A 4YSFA 3CC4P 3THPA 5FPUA 2WWUA 4OUSA 4YVWB 1OI6A 3VDCA 3ZXJA 1OA2A 5IVFA 4FP3A 1PGQA 3PUQA 1KORA 1SQBD 4IXLA 3AEDC 3B5NA 3IF4A 3M9BA 2LALA 5I0DA 2AXTH 2WT2A 3PL0A 4X8PA 4AQRD 1SG3A 4MXWB 4XAEA 5FLJA 3VD5A 3HTKB 4AEJA 3KCXA 3D8CA 3SEEA 1CVNA 1OLME 2FBEA 2KIKA 4COVA 1JU3A 4PJYA 3OY8A 4QWNA 3K77A 3HD7C 3RZZA 4WBBA 1K04A 1KILE 5A3PA 4YGDA 5JXJA 2HJIA 1IS6A 3SQOA 4IEVA 3D82A 4NAOA 4OHXA 5C8WA 3A23A 3AKSA 1Y3TA 2JDMA 3DKQA 1FOSE 4O9GA 1S3JA 2CSGA 2KB7P 2Y9YA 1BEV2 1CJDA 1LNSA 1UZ0A 2JDYA 4QHZA 4OQ8A 1H2MA 1OKOA 2E9QA 3FZ3A 4XCAA 4PJ0H 4YG0A 2OVUA 4AHZA 4BQ4A 3LDRA 3GF7A 3AZZA 5H9PA 3LIGA 5KLIC 1UXZA 2CNAA 5FCCA 4NPDA 2XJTA 2W2IA 5FLHA 2CGNA 3LFMA 1L7LA 3AXDA 4NHXA 1Z56A 3PUHA 3T1MA 1IQAA 1WWYA 1N2DC 1JYNA 5BNQA 1L3JA 5E6HA 2NPSD 1ZR4A 3AYDA 3RWNA 1QVFO 5L7OB 1WKYA 4LLOA 1YLLA 4HONA 3SMHA 1YITP 1JHNA 2GSYA 4GH4C 3UJOA 4OHVA 4LO6B 2GNBA 1W05A 3QD6A 2OTLP 1DZRA 1QL1A 1CGPA 1MS1A 2YKPA 1OH4A 2FYUE 5LW9A 1S5LE 4BRYB 4HLTA 5DUUA 1ND3B 2ET1A 1VQ4P 4CEYB 4GAZA 1K45A 2IZWA 2P7JA 1KB9H 3T4VA 4OI0A 3BPZA 4YG3A 2BVVA 5A80A 5GZCA 2R16A 5E79H 2VECA 1VR3A 2VMGA 1YQ3C 3SFDC 1GZ9A 2JX9A 1OOPA 1XNDA 4XDQA 5L9RA 2RMU2 2RDNA 1BCCJ 2JDNA 3JBG1 4N43C 4WVMA 1XTCC 4XFCA 4E4ZA 2AYHA 3EHKA 2NPSB 1VRBA 3POWA 4D3WA 4ZZ5A 5FYZA 5GZFA 2I1JA 3AM2A 3NV3A 2HWF2 2JECA 3PVBB 5A7OA 5T5OA 1EXIA 3AEFC 3H1HJ 5TJHA 2CPBA 2XVLA 3B5NC 2PLV2 3L73J 1RGSA 5JOZA 1LHVA 1NLQA 4BYYA 1NU1J 1LWUA 1AXZA 4MSVA 3PJSK 1MQTB 5KJ7C 2GALA 2FCTA 3LQCA 4EZHA 3R0RA 1RUI1 4PJ0E 4BRYA 2KNCA 4D6RA 5KLVD 1DH3A 4QX3A 1JZ4A 3J7NA 2PFWA 3NVCA 2Y26A 3BTYA 3WUDA 1L0LD 1NTZD 1CN1A 2W6AA 3ES4A 4JAAA 3VKLA 5KAIE 3RDIA 4YW5A 2WDBA 4COWA 3BIWE 1LNQA 3NAPB 4ZU5A 3CLPA 3DF0A 2VOXA 1F5JA 4NJ4A 5DUWA 3WDWA 3KHCA 1GNYA 1YFWA 5JDBA 1ZA4A 5FZ9A 1FOSF 4N53B 1RUH3 2Y6JA 3FLTA 4WVMB 1VBA3 4GB32 3AMMA 1BGYG 3L70D 2A73B 3N7MA 3VD3A 2WQZC 5LY2A 2V4AA 1GW4A 1RH5B 1RUG3 3AKPA 3AZYA 3AKQA 3TSIA 2GN3A 2VCBA 3HBZA 5FPZA 4M4RA 5DABA 1Q81Q 1W8HA 3THCA 1O3RA 1SFCB 1Y9MA 4KG8A 3CWBE 2WZ8A 3IIIA 3T2PA 3WP5A 1KB9E 1RL3A 5CFCC 4OZOA 4P9GA 2PGDA 4K3AA 3KQGA 3BCCD 1UPSA 2TUNA 4A3XA 2CV6A 1O5LA 2YFUA 3KF3A 3PJYA 3MHVA 1RUD2 3UL2A 3RBZA 1ULDA 4HKOA 3FUOA 4LQRA 4CCKA 3DCQA 4QX2A 4DMIA 2QVSB 2J1VA 3FHQA 1LP1A 1H8TC 2A3WA 2WYSA 4KHXA 3AL5A 3NW4A 3PMEA 4NROA 1PK6B 4PIXA 3TN92 3NAPA 1ZBA1 1IFNA 2WT7B 4PBOA 1N7SD 3Q5RA 1ULCA 2JDPA 1PGOA 1MS4A 1V6OA 2QQWA 4Z92B 1HB4A 5LZ6A 3RK2C 2W47A 3T2OA 2W6BA 3ZKUA 5HCAA 4AF9A 5FY9A 2HWB1 2K2SA 1SFCD 5A7QA 4N3YB 2WNOA 1W9SA 3A7QA 2V4HA 1H6XA 2BNNA 1M7LA 2IBZG 1BDDA 2X5IA 1FV2A 3NKGA 3WOGA 3VP9A 1WCKA 2GZWA 3ROUA 2WL1A 3LE0A 2A06D 4L99A 3I3QA 3DN7A 4M4PA 2PRRA 2R3CA 4KBBA 1HXS3 2XNDH 3HUSB 2Q5UA 2FFDC 1I3HA 3OSDA 4BIOA 1PP9J 5FY7A 5KKZB 2BUKA 3EFGA 5FP9A 5BNNC 4QX1A 1ULGA 4YLZA 4Z2WA 1NTMG 1FAVA 4M3CF 2W90A 1OH3A 1SQXJ 2WFF3
chains in the Genus database with same CATH topology
5CCHA 1RUF3 5C4WB 2XJPA 1ZRDA 3KB5A 5CMZA 1ZBE3 4H55A 4XQWA 1G8WA 4W80A 1NCRA 1O3TA 4N7IA 1QNWA 3M3IA 1T8ZA 4FT8A 4HT1T 3E6CC 4X6RB 3DPRB 4XXAA 2PP6A 4IV3A 3TNQA 3VGIA 5KXDA 4FPCA 4YVWC 1MZ6A 5GZGA 1OKQA 2FYUK 3WV6A 1A6CA 4A7KA 2Q7CA 1COV3 3L9JT 5JR7B 2OUJA 4MGZE 2UY9A 3QLQA 1KILD 2A45H 2WNVC 1RHI1 2WZR2 4W6XA 1F8VA 2RR13 1HBWA 1Y7BA 2HPCB 3CJIA 5AC91 3PVEA 3VBHA 4LBLA 1R1ZA 3L37A 2IXJA 2WWWA 2EXJA 3QCWA 4GA9A 1NO4A 2WZ7A 4Q4W3 3RK2D 4PF5A 2PAKA 5D8AA 1QQP2 2GNMA 4YG6A 5C9AC 2A3XA 2GH2A 2HYKA 4QPGC 2ZX0A 1SQVK 1QQP1 3ZYGA 4LEJA 1OMIA 4LO7A 3E1IA 1M1JB 3T97A 2WT1A 4OUMA 1S0BA 4I30A 5C4WC 3A3YB 1FMD1 2BGCA 1U5XA 1RUF1 3NFQA 5APTA 1TEIA 2UU8A 3N36A 5KHJA 3V4WA 3E6BA 4KGQA 1S0DA 2O8QA 3RNSA 2HWC1 4JV4A 3VBFC 4A2UA 1FMD2 2ZPXA 3ZSMA 4CEYC 3ELNA 1HRI1 4HKLA 2CWSA 4WV8A 2ZMLA 2P3JA 4AUWA 5L7OA 4ISQA 2XBO3 1APNA 1X9VA 1Q8OA 2HWC2 2YY1A 1WUVA 2XL7A 5D8AB 2D7FA 3MF9A 1R1A3 1CW5A 5AW1B 2PHDA 4OHYA 2D93A 2Y38A 3M0DA 1BMV1 1X36A 1WD3A 4XW3A 1J58A 1L4AA 1RIRA 2HWE1 2JJ6A 3OD4A 1EV13 4QPIA 1NY72 1ZRFA 2ZJCA 5KJ7D 1WW5A 1FDMA 3D5OA 5I0RA 1O3SA 2NZ9A 4Q4Y3 1A78A 1EY2A 4DOJA 1FZCB 4I02A 5AC93 4YM2A 5CFCA 2PHLA 2PLV3 3I59A 2OZ6A 3VMXA 1OPMA 4GIFA 4RA0A 1PO21 5C33A 3V0AA 2D3PA 3RI8A 1ENQA 1QJX3 1Q8QA 1IPKA 3V5BA 3WDYA 1OFSA 1PO13 2N9BA 1FJPA 1ZZBA 2XLGA 4BZ4A 1A02F 3CJIC 5H9QA 1C4RA 2A3YA 2D97A 1RF1C 3IFMA 2K0GA 2BWAA 2D98A 3JB8A 4W6YA 2LUWA 3NJZA 3FHIB 4XETA 4XE9A 2QDNA 1BZWA 1J1LA 2NYYA 3WW1A 3LW5H 1M4WA 4L8QA 2NPSC 5DG1A 4ZXKA 5FO8B 3M7AA 1G9BA 5EYYA 2CGPA 3L2YA 2D6NA 5T5LA 2ZGRA 3AMHA 2OYZA 4M0NA 4CYDA 3IR9A 1Z7S3 4A7ZA 4EWDA 4XJUA 4R52A 4DPNA 1V6NA 1LTBC 2YKQA 3KT7A 1KILA 1NA1C 2IXCA 4FOYA 3WW3A 2OPKA 4LR4A 2JG9C 1Z0HA 2OYHC 4COZA 3IN9A 4XFFA 2H43A 4M3CA 3INAA 2XG3A 1D4M3 3FFZA 2WITA 4CDUA 2OYHB 1QOSA 4D7TA 1OQDA 2RHPA 2GH8A 5APUA 1WT6A 2ZHKA 1GICA 4CDWC 1SBDA 2EA7A 1TMF3 1M06G 1RUNA 2XNXA 2YGMA 4GMP0 1Q43A 3HUSA 2VW0A 3HD7A 2H0BA 4L92A 4B7EA 1H9WA 2ET7A 4YM0A 5D1IA 5T3NA 5F6KA 1B35B 3IBMA 5BNPB 2BASA 1D0HA 2VRSA 2ZS6B 3D0SA 3DKWA 4Q8LA 1PM7A 4XOGA 1A8MA 2KXLA 2NMNA 4O9BA 1RE3C 5FLIA 2BBVA 4ZU4A 1JY3O 2DTWA 3AJYA 2VVDA 2R042 4HBNA 5GLWA 4RR3C 1GL2D 4Z82A 2YNYA 1RVF3 4IEZA 2IPPA 1PMIA 3A2AA 3J9SA 1YYCA 1HLCA 4YNIA 1LGCA 2ZKLA 5J98B 2DVFA 1RUC2 2CWMA 1UIKA 1PGL1 3ENRA 4CRQA 3M3OA 1HJBA 2XU6A 4PLMA 4PLNA 4S2GA 1RF1A 5APSA 1VPCA 1AYM3 1PNGA 4B8EA 4J1WA 3APBA 3I54A 1HRV2 5CCHD 2BFUS 1LJ7A 2OARA 4JGZB 1N86A 1S0GA 4IEPA 2VNRA 1CI6B 1CAVA 1S1AA 1URQD 4LBMA 1PGW1 4NWVA 4F83A 1RE3A 1JNMA 2BTVC 4MVTA 5T55A 5JPMB 4XYXA 4LA3A 1QDOA 1U5ZA 5J36A 2A75A 2HKXA 2OA2A 4Y1VA 4QPYA 3MIWA 1CAUA 3B7MA 1QGLA 4NHKA 4RD7A 3KT1A 5CFDC 2Y0IA 4Q27A 4JYBA 1ULEA 4EN8B 4N78E 4RS5C 4AI8A 1QF3A 2Z69A 5L7OC 4GWNA 1YWKA 3HQXA 5AVZB 2E63A 5ACA1 1C28A 1H1AA 1RUJ3 4YVSA 4YYOA 2JEEA 3UKNA 1POV3 4HN1A 4P9XA 1UAIA 5KXCA 1D4VB 1KJLA 1HW5A 1FNZA 3WCSA 4FPOB 1H2NA 2XWJB 2A45G 1LB2A 1WGPA 3V4QA 3P8CE 4QQLA 4XHBA 4IERA 4BWOA 1DQ4A 1JTZX 2RS12 2HFED 4CP1A 5J3UA 1H8TA 1J1DB 4N53C 1GFF2 5E1RA 4R9CA 1C3HA 2ZX4A 1LOFC 2MNGA 1YFUA 3H1YA 4QGLA 4MLOA 3VZNA 2MEV1 5CNAA 4JRLA 3MW3A 4YRDA 3UKVA 5EJ3A 3GBFA 4FVVA 4XPVA 5IK7A 1RF0A 3OGGA 5I93A 3WP4A 3EO6A 1H88A 2VPVA 4K21A 3WHUA 1H8AA 3S7EA 1OWAA 1A02J 2M8RA 2AH2A 3QACA 5AFEA 5I8TA 3VP8A 4QPIB 2W68A 2ZGTA 1DDLA 2HODA 3B01A 5BNPA 2ATFA 1VBA1 4EIJA 1YIFA 3VV1A 3P3NA 1CONA 3RL0B 1A8DA 1NA1B 1XE7A 3DPRA 2JE9A 2ZHLA 2HWD3 1X50A 1UW8A 4GH4B 3MLJA 3AP6A 4XILA 5AW7B 3AP5A 4H7LA 1BBT3 2ZFCA 5CVRA 1FYUA 1J1EC 2WSFH 3HR9A 2SLIA 1NLSA 1IS5A 1RJ8A 4E2GA 3VUOA 2WIIB 4RS5A 1REFA