2R32A

Crystal structure of human gitrl variant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
158
structure length
140
Chain Sequence
RMKQIEDKIEEILSKIYHIENEIARIKKLPCMAKFGPLPSKWQMAPPCVNKVSDWKLEILQNGLYLIYGQVAPNAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Assembly and structural properties of glucocorticoid-induced TNF receptor ligand: Implications for function.
pubmed doi rcsb
source organism Saccharomyces cerevisiae, homo sapiens
molecule tags Immune system
molecule keywords GCN4-pII/Tumor necrosis factor ligand superfamily member 18
total genus 32
structure length 140
sequence length 158
ec nomenclature
pdb deposition date 2007-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2r32A01
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r32A02
3NTNA 2R5BA 4HYTB 3B9IA 3P8MC 1CSBA 2KP8A 1RJ7A 4QQOA 4C7NB 4G4FA 1OSGA 3K51A 3L35A 2XZRA 1NWQA 3MGNA 1X8YA 3HE5A 3T97A 4C46A 2AZ5A 4MXWB 2R30A 4GT1A 5L36A 3M9BA 2WNVA 2W6AA 5APYA 3VMZA 3A5TA 2R32A 5AW3B 1D2QA 1GR3A 4EN0A 3TYJA 2QM8A 2ZFCA 3A3YB 3VMXA 4KHXA 1U5YA 2TUNA 3K48A 1JH5A 2WNVC 5AW8B 1HWTC 4E4DX 1FAVA 2RJKA 4C7NA 2C9NY 1I9RA 2QDNA 5AVVB 4RSUA 4I2LC 4B86A 2WT7B 2C9LY 1GU4A 5AVSB 5AVUB 1T2KC 4J6GA 4G3YC 5AW4B 1PK6C 4MXWA 1DG6A 5AW7B 2RE9A 4XE5B 3SWFA 3KDPB 5APXA 1S55A 1XU1A 2Q8OA 3P7KA 1RJ8A 5BNQA 2WNUC 1ALYA 2Q3IA 2P7JA 3WD5A 2WPRA 4KG8A 4DOUA 3NMDA 1XU2A 1HJBA 2Q1MA 1D4VB 5AVRB 5L19A 2WPSA 5AVWB 2WT7A 2TNFA 3OAKA 5APUA 3ME2A 5APSA 1OXZA 2WTYA 1MUUA 4JYBA 1H8AA 4EOTA 1FOSE 2QE3A 2R5DA 2ZPXA 3B94A 3FC0A 5AVQB 1KQLA 4GKGA 3UIAA 1DU3D 1OQDA 2WPQA 3IR9A 1GTWA 1GD2E 3KQGA 4QQHA 4NN0A 2JG9B 1GU5A 1GK4A 5AVTB 5AW2B 3V4WA 4MXVA 4TWTA 4DB5A 5CMZA 3A2AA 2ZXEB 3O8ZA 2WNUB 3L36A 2VRSA 3TK1A 1MV8A 3P32A 1KD7A 4OUMA 1IQAA 2XV5A 3MD0A 3URFA 2HEWF 3V5BA 3ALQA 3QD6A 1IO4A 2OIIA 4AYCA 1H88A 1SLQA 5CIRA 3NFQA 2HEVF 2JG9A 2JG8C 3A7OA 2JJLA 4I6MC 2Z5HA 3VN0A 1S9KD 3M0AA 2H7HA 4AUWA 1S9KE 1YYCA 2QM7A 2XU6A 1C28A 1C3HA 2Z5IA 2WNUA 3M0DA 5AVXB 1GZLA 2JG9C 2JG8A 4F3JA 5HBAA 1MFZA 2R6QA 5APWA 1U5ZA 4QQPA 2BASA 1CZQA 1OQEA 2E43A 4D7YA 4MSVA 4QQLA 4RESB 4HT1T 5AVYB 4E4SA 3VYIA 1JUNA 4JYCA 4OULA 3TYYA 2Q7CA 1TNFA 2O0OA 3LKJA 2P67A 1A02J 1A02F 3TWIA 5KC5A 2X29A 2W27A 2JG8B 2KA3A 5AW9B 5AW6B 5APVA 1NAFA 2Q5UA 4DZOA 1CI6A 2N9BA 1KXGA 3AB0A 3TNUA 1OWAA 4M3LA 1WCKA 2E7AA 2WWWA 1GK6A 1DH3A 4LC1A 2E42A 3QBQA 1H89A 3B8EB 2R3CA 1JTZX 1TNRA 1JNMA 3HE4B 1J2JB 1SP4A 1FOSF 4N90A 3L37A 4GIQA 2YO3A 3I5CA 1T2KD 1A8MA 2P2UA 3M91A 3LIEA 1G2CB 3VTPC 1PK6A 3M9HA 2RJLA 3B93A 4QQ2A 3HTKA 5APTA 3V56A 1CI6B 2YO2A 4QPYA 3VMYA 5AW1B 3L9JT 3TNUB 5KC6A 4KGQA 3IT8A 4TSVA 5KWRA 5AW5B 1U5XA 2YNYA 5AVZB 5AW0B 2HEYF 2WNVB 2ZJCA 2Z5WA 1HUCA 3HE4A 3V4QA 4OUSA 1HBWA 4KGGA 3M06A 5APQA 4AQRD 1PK6B 3HE5B 3MI8A 3LIDA 1O91A 2IPPA 5TSWA 3NXSA 1D0GA
chains in the Genus database with same CATH superfamily
1Y4WA 5FKCA 2R5BA 3S9OA 2FZ2A 2P34A 2PHRA 3WW3A 4E8DA 5FOJB 4PI2A 4QKBA 4O9GA 3AMMA 3HIFA 1SLBA 1UMIA 2HWF2 2JDUA 2ZGNA 4XE9A 2FYUJ 4AVTA 1VQOP 3SLIA 3HE5A 5FMBA 2WSEH 5LW9A 4RGGA 3GMAA 3MUY1 5GZCA 5B66E 1XTGB 1D2QA 3IDBB 4D6TD 2R32A 2W8ZA 2W87A 1VF5B 1C8M2 4IXLA 5FBJA 1ND3B 1K5MC 1U5YA 1NKNA 5F6LB 3ZXDA 3II6A 2WINB 2VMFA 2Y0IA 1KFUL 1OW8A 1PO22 3CXHE 5EFUA 5FIXA 1R092 2RJKA 2V4HA 2H6CA 4LR4A 4I2LC 4RHV1 1IG0A 4JBZA 4I0WB 1DBNA 4AEJA 1OQ1A 3L71E 3FJSA 2E31A 4I7ZB 4NRMA 1LEDA 5FY1A 2Q8OA 1JZ4A 4ZY9A 3VD9A 2N7GA 3P7KA 4IDZA 4LGDE 2R071 1HGVA 3EWKA 1W2TA 1BEV2 4K3AA 1ENSA 1GQHA 2A71A 1J58A 1YQ5A 2B9UA 2RDNA 2P3JA 1HJBA 2VBDA 3WF1A 1EV13 3AMNA 2VY0A 5GM0A 5I8YA 5JPNB 2VD7A 2DFCA 2C9AA 1MQTA 4JYBA 5EFWB 2ZPXA 3D4KA 4L9BA 2EIBA 1CPNA 5B4NA 3L2YA 3DECA 3TRSB 1ULFA 1PFIA 5CCGD 3AEGC 4FPJA 1RUF2 3W9AA 2M5AA 3BRTB 2HJIA 3JBG2 4JGZC 1LESA 1VQ8P 3RK2D 4TWTA 3P5BA 5F5CA 5FUIA 1ZZ9A 3VBUA 2W08A 4XBLA 1JI6A 2PLV1 4NIAA 2VNGA 1JY2O 3INAA 2K2SA 4GMP0 3P32A 5A3NA 2OUJA 5FRAA 1X33A 2ENRA 2PAEA 3RL0D 2YB7A 4AYCA 5FP3A 2HYXA 1U5IA 1CX4A 4DCKA 1UYYA 4NPEA 1EDLA 1XSQA 4IETA 5C4WA 2JB4A 2M0BA 3O1TA 3H1LD 4QX1A 3N9QA 3AP9A 3PVEA 5KJ7C 3CCQP 4XFIA 3VBRC 3JCUH 1NJIQ 3DXUA 1QIQA 3H50A 3NV2A 4URTA 2FDHA 2R1DA 5LA9A 3VKOA 5KHKA 1LR5A 3Q8FA 3VKNA 4Q4W3 2QG4A 1H8TC 3KD4A 1BBT2 3H1KE 2WJSA 3I2IA 2WYSA 3P8CE 3PVBB 2BPA2 4CTEA 1CD3G 2B88A 3NV1A 4WY4A 2VZSA 2CPSA 4GH4B 1OBNA 5FY7A 4DUWA 4Y20B 4GB31 5FPBA 1ND3C 4OZXA 4E9KA 1RB8G 3HD8B 1WLCA 5C33A 3BOPA 2CWSA 4YVWA 1MS8A 1AXKA 2D44A 3IMMA 2ILMA 3EQ2A 4LO8A 2KSEA 4IV3A 5F3EA 2YPDA 4MGSA 4L2NA 4CPGA 3VB9A 2VMDA 2DCKA 2FYNB 1XNDA 2OGUA 1NY72 1USEA 1NU1J 1NGMB 1APNA 1W2OA 1W8NA 5LATA 1P84D 4WY4C 3IDCB 4INDA 3WF2A 4HVRA 1S0FA 1WBLA 3SKJE 4BQYA 1E5IA 4GULA 4RN5A 4CEYB 4LE4A 2BTVC 3AYAA 1WZXA 1A78A 3ZFGC 4RR3B 3MTUE 1I5PA 1LHOA 1QJX1 4LBOA 2A6WA 4R52A 5D8AB 3VDDB 3WUDA 3MIBA 4S2DA 4BQ4A 5BYNA 3VMYA 1DEEG 3A0HH 3VHPA 5BV6A 3IT8A 4EE2A 5AW5B 5AVZB 2G19A 2Q8EA 4AG4A 1T6BX 5AFBA 5FPUA 3IAOA 5DUWA 5LK7B 3AC0A 3LPGA 1F9KA 3N9NA 5CEHA 3I97A 1UAIA 1VBB3 5JZGB 2ZMKA 1CR7A 1EV11 2PAMA 2R7EB 4MGQA 3U1AA 3CKHA 1D0GA 5F9TA 1NTKE 1UIIA 1PIXA 3PHLA 2A45I 4HYTB 3R4DB 4NHKA 1GMJA 3C8XA 4AI1A 3PVOA 4C8DA 1CX1A 4W6WA 1KILA 1REEA 4CRQA 3V2PA 2RS12 3J7HA 4WVVA 4UAPA 1RUJ2 3K51A 3W59A 1RF0C 2X5IC 2ZX2A 3MPBA 5JR7B 4BYYA 4UF0A 1LTIC 2GN3A 2ORXA 3DL3A 4GKYA 1VBC3 2C0XA 3OY8B 4M3CE 3CCRP 1O6UA 4DXZA 2WNOA 1DP0A 3NJYA 4N43A 4XFHA 3WMM0 3WEZA 1L0NJ 2C4XA 2GU9A 3NWKA 4Y1YA 1JY3O 3GG2A 4NHLA 4S2HA 4WVMA 5FZ6A 3BI3A 1LOCA 2UURA 4B8EA 1RUJ1 3AECC 3WU2H 1AXZA 4Z2WA 3DUIA 2FCUA 2D6KA 3LF7A 3C7HA 2KNCA 4Y3OA 3CCLP 2HWB1 4EYUA 2RR11 3WP6A 2AEMA 4DXRA 4FPYA 4YW4A 4OH8B 1S2BA 2QQVA 5CHXA 1OXCA 5FY8A 2VMIA 5FZMA 5EP9A 4OLLA 3AE1C 2IZ0A 1SQXD 5CJ0A 1H8TB 3M1HA 4B4QA 1KB9H 3RL0C 1SBEA 4GQ7A 1CZTA 1OQDA 2JDYA 1NTKG 1GTWA 3ZFGB 1K45A 1LJ7A 1LTJA 2HWD3 4Q4W2 4DB5A 3FUOA 3RK2B 4ZZ5A 4M01A 1M06G 4PD4H 4EV0A 2WNUB 2NPSD 1BHGA 1D2SA 1Z78A 2Y34A 3ECQA 3MLJA 4GWJA 1ZRRA 2QQPA 5LB6A 2QKDA 2DU0A 5EJZB 4AFBA 4BZ4A 1O3QA 3LOIA 5K9YA 4UB8E 1EUUA 1URXA 4FPOB 3UKNA 3ZXKA 5JOZA 1DZTA 4R9BA 1NCRB 1UZ0A 2RDRA 4JC1A 2DDUA 1LTJC 2A3YA 3KHBA 1NHLA 1GP5A 5L19A 1YC61 1QLED 1PM7A 1UY1A 2K9YA 4LO6B 3VDDC 3L74G 2TEPA 1R64A 5F32A 3RVHA 4A42A 1SFPA 4QPIB 1MEC3 4ZZ8A 1W8UA 2D98A 3SH3A 4RGAA 1T6AA 3QH9A 3GBGA 4XF1A 4KBZA 4D6RA 1SDWA 4AZZA 3RI8A 4FAHA 3WNLA 4JYCA 4YVWC 4BISA 1PX4A 2WYFA 3U14A 4B3NA 3OB8A 4LE3A 4MHUA 2W27A 2ZVOB 4CUGA 2UYAA 3UK9A 4IOIH 2Q5UA 1LULA 3O7OA 4YNIA 1GZ9A 5C8CA 3V0BA 2OTJP 3H1HE 1SPPA 1RINA 1S0CA 3UT0A 4AHZA 2KIKA 2YMZA 3DF0A 4KI5M 5A1AA 3AE2C 3OJAB 1TNRA 3ON7A 4F7ZA 1IS4A 2PLV2 4XTPA 2X5IB 4YGCA 2QDRA 4JAAA 4EJRA 2XWJB 2P2UA 3WHTA 3LIEA 1UKGA 1IS6A 2RDSA 1IFMA 3AP7A 1FMD2 3ES1A 1D4M3 2RJLA 3I2GA 3K2OA 3W58A 1RQVA 3HTKA 2P6CA 3LDBA 4URAA 1SBDA 5C8CC 4K40A 1ZP0C 1OOPB 4K35A 3GF6A 4A6OA 1RVF2 1Y9BA 2B4KA 4A44A 4BCUA 1NTMD 1GW4A 1OF4A 5FO8B 2P3YA 3RYKA 5L7OB 4H13C 2K0GA 3AX4A 3CC7P 4QPWA 1BEV3 3EO6A 4QPGB 4CDWB 1UCXA 1CWPA 2E76D 3JCIA 2JDPA 5JXGA 4W8JA 1WCQA 1VAMA 1UY0A 1LOAA 2K1AA 2NMOA 1RC6A 2QZ3A 1HTLC 3E5UA 1VE0A 3NTNA 2XJSA 3CIHA 4XEZA 4Q0QA 1QF3A 4LHNA 3NAPB 1ZVFA 1CSBA 1EAH2 2XDJA 1W90A 4NVPA 3OYWA 2QVSB 4BLIA 1X8MA 4IEOA 3ZFEA 5JXIA 3C1LA 3MGNA 1W99A 2HLOA 2A73B 1EXIA 2ZHKA 2AZ5A 4MXWB 4K7JA 3K46A 3RBZA 4IL7A 1PZ8A 2XKOA 1PIV2 2ZT9B 1UOFA 3GHGB 1N1YA 2TUNA 4KHXA 2Q1KA 1V70A 1W2EA 4K1YA 3WG3A 4Q8KA 4ORFA 4AI3A 2XLAA 1STMA 1TG7A 1RL3A 3FWLA 1NTZK 5AVVB 1EY2A 2XQXA 1C5HA 2C9LY 2HWF1 4J25A 3HT1A 4QDQA 4RL7A 1PGQA 2XBO1 3K4ZA 1WMEA 3BATA 1QJX2 4HOOA 4HXCA 5FZOA 3AKRA 1RUC3 3ZFGA 2NP0A 1PVC2 1XB9A 2JECA 4IEQA 4QD2A 2EAAA 2PMWB 2WZEA 1ND3A 1FE6A 2OPWA 1F8VA 3SEPA 4Z1MH 1TME1 4Q8LA 2KK7A 3RMXA 1S2KA 3H1JE 2PA7A 2AACA 3HNBM 1SQVJ 1IS5A 3ZYHA 4LA2A 4META 5CU1A 4EI2A 2PP6A 3HRNA 1CPMA 1N7SD 2LXBA 1CAUB 3AKSA 3PIGA 4UBHA 5J1XA 1LNSA 2HWE2 1Q82Q 4GD4A 1IK9A 1LODA 1NOHA 4DXSA 3AE6C 3AYDA 4JV4A 2V72A 4MXVA 4OI4A 4ZKTB 3H7YA 2QQWA 2ZXXA 3A2AA 2IZWA 3LSDA 4PF1A 3KZIH 1B35C 3MUZ1 3S57A 2JENA 4XQ4A 1KB9D 2FCTA 2VRSA 3UGGA 4ZHNA 3CO2A 3LQCA 4D6TJ 1QVGO 1IQAA 4SBVA 3MD0A 4XW3A 1LWUA 4AVCA 4XILA 3L74D 3VD4A 2KR2A 4TN7A 5JLVA 5BNNC 1H88A 2W3JA 1SLQA 2M5AB 5TISH 2NM1A 1ULGA 1DQ1A 2R1BA 4HJGH 3N9PA 1NTZE 1GWLA 2W39A 4LBQA 4XFBA 3MW3A 4OHWA 3BASA 3IBMA 4XJZA 4OGQD 4UT5A 4Z82A 4ASKA 3R4UA 5JOXA 2ZZJA 4CCLA 3F5HA 1H4GA 4HONA 1LWUC 3OBAA 1GYKA 1BGYG 1R8EA 2KLUA 4MGYE 3I3QA 2JWPA 3ZM8A 4FXGB 1QJU2 3CL1A 4K6BA 5C4WB 2JR8A 1NTME 4H13B 1O8SA 3QWOC 5LEKA 3LKJA 4HPKA 4QHBA 1A02F 4RFRB 4QB2A 1NE6A 2E76C 2JJ6A 5KHJA 2PGDA 4N78E 3VBOB 3L72J 1RYYA 5KAFE 2J5UA 2W1SA 2G9FA 4NO4A 2BERA 1L7QA 3V65A 1YFUA 4N43C 4XURA 4ASLA 5C3OA 1FMD3 2LROA 5CBLA 1JZ8A 2MEV1 1FZCA 1BE3G 1MS9A 3WDXA 3AEFC 3WNNA 1YQ8A 5DZEA 2NRGA 1FOSF 5FPAA 2DCZA 1KILE 1KITA 3WU2E 1LEMA 4N90A 4O7XA 1W0NA 1OA4A 4UOJA 1CAXB 1M57D 2FKWB 1D0HA 1DYKA 2EIEA 3CBNA 4NPLA 2IZ1A 1J1LA 4AFMA 2QJYB 1W9SA 4BK4A 3WUCA 1W2UA 1W6OB 3ASIA 1SQBJ 3DYMA 1VB4A 4CCJA 3HQUA 1UMZA 2ARAA 2ZJCA 1IFJA 2LR2A 3RZGA 2KZJA 1SQ4A 1E79H 1HGZA 2QFEA 3UV9A 5I8TA 1LGHB 3M06A 2A3XA 1RGSA 5K5GB 3MBWA 4XUNA 4ZS2A 4FPFA 3LIDA 4RR3A 1WLDA 3SITA 4FOWA 1S0DA 2Q1ZB 5IVJA 3TF5A 2PAKA 2EXKA 1B35B 2JX9A 4CVUA 3H1HD 1ZREA 2J1AA 3CCUP 4AEDA 2YGLA 4LKSA 5KHHA 1NTMK 3IWZA 2OYZA 1VRH1 1S5LX 4AFCA 4LPLA 2ID4A 4QQOA 5J3UA 4C7NB 3CCEP 3U37A 1IKPA 2OXBA 2ZKLA 3I3DA 2XJVA 2LS6A 3ABZA 3ABVC 3E97A 3KQ4B 1F5FA 1WGPA 5JCTA 2WA3A 4QWNA 1KS5A 2A06E 4HETA 2WT1A 4RYDA 3N4MA 4Y1XA 2YFUA 3CMAP 3USUB 2IVIB 3LEMA 5DG2A 3L75G 3TGUE 1ZMEC 4FPCA 2WA4A 3NJVA 2VU9A 3AZYA 1VBA3 2WNVC 2JDAA 1BE3E 5FO7B 2YKPA 3RS6A 3B5NB 3K3OA 1L4AB 3NSTA 3TNQA 5FZ0A 5A1FA 1ZBE3 2QJPC 3GYDA 4D6TG 1OPOA 2NPSC 3M3QA 4RFT0 1W9YA 5DAPA 2JIGA 3LB9A 1JYXA 3U0ZA 2D2CC 1DG6A 1NZCA 4XE5B 1DQ2A 1QJEA 3L74E 2ZKNA 3RK2C 1W6QA 2BCCE 3GXUA 3QACA 4OUEA 1MACA 1ALYA 2QQNA 3BVCA 3S6PA 1AHSA 1TQ5A 4MH0E 1UX7A 1EC5A 2PAJA 1PGPA 4OCTA 1BGYE 4MGTA 1JMMA 4WY4D 2ZX0A 3H0OA 2DTWA 5GTIE 1AX2A 3L70G 2IYOA 1ZZ8A 4P5YA 5ACA1 4COWA 2VMEA 3FC0A 2KNCB 1KQLA 1UQXA 2J1UA 4P14A 2Z42A 2Y6GA 1T3UA 4JQRA 1FMD1 3AK0A 4BM8A 2CAVA 3B71A 5L73A 5CMZA 1KYOH 1HQNA 1SQQG 2ZXEB 3O8ZA 3LFMA 1TU3F 3O12A 2Y33A 4FAGA 4CDQA 1Q8OA 1IPSA 1K5MA 4IQPA 4CDXB 1ZRCA 5A7NA 1JZ6A 5E88A 5FZ7A 2HEWF 1T8ZA 2VVEA 3G3ZA 3V5BA 4AHWA 4L99A 2I1JA 4H44C 1Z56A 1Q8SA 1EQ7A 1WLWA 3M7AA 4WZCA 2VO5A 2C9KA 1RF1B 2HEVF 3A0BH 3NJXA 2IFRA 3A7OA 1QNYA 3QH6A 3OUJA 1S9KD 1NKGA 3M9QA 4GXLA 4XIKA 3ZDVA 1W6PA 3ZSMA 2XU6A 2DTYA 2R062 1PMIA 2WNUA 4Z07A 3ZYGA 5AVXB 3D70A 1R082 1FPN3 3JD71 1IFPA 2OYIA 1OW6A 4R4MA 2HWB3 2OZ6A 2Q1FA 2UWCA 2JDZA 3H3UA 2JP3A 3AL5A 3LEKA 2AXCA 2OYHB 3ORJA 3L4FA 3ZR6A 3AYCA 1YEWA 2WAOA 1PGOA 1L0LD 4HT1T 5A3MA 5CFCC 3ROUA 1OLMA 3CCVP 4CXXA 1WD3A 1ZRTD 4RKUJ 5FPZA 2VMCA 2VPVA 3RNSA 3T1MA 1WLTA 5TISE 3PHMA 3ZDSA 3WP4A 5GKAC 1BMV1 5H2FE 1NCQA 1IFIA 2GH2A 4X6QB 3SISA 5FXWA 3ZFFC 2LXCB 2BOJA 4QPIA 2WSEJ 1CI6A 2N9BA 1UU4A 2BVBA 2QJPB 5FUNA 4JVAA 3WV6A 4EZHA 1J1DB 5LBBA 1E5WA 3D6YA 1VQMP 3C7OA 3IB3A 1WD4A 4YFWA 4UFJA 1JTZX 4FP2A 5BUVA 4Q4X1 4V2VA 1JNMA 4N53C 1J2JB 1SP4A 5I8SA 4D6SA 4DZGA 3A0NA 1JZ5A 3BKZA 2YO3A 2RMU3 3HR9A 2WFF1 4U36A 5DZGA 4IFDK 2A06D 1ZYBA 2DF7A 1K5JA 1XNTA 4RHV3 1OUSA 4PI0A 1F5JA 3TEXA 4WM7C 4DIQA 1FNZA 3MW2A 4EQVA 3ILFA 1UIKA 5KC6A 2H8PD 2RS33 2XLGA 1OLQA 5GZEA 3SCFA 1JM0A 3UL2A 2QVAA 3ACHA 5A3UA 3EFGA 1XC6A 1JB0J 1RUE2 4DMIA 2QQOA 3G9RA 3IKWA 1NZIA 4LHKA 2WMMA 1OVPA 2ZT9C 1MEC1 4A45A 3HN3A 2IPPA 1DGWA 4L92A 3KZ4C 4PLMA 3HTKB 1HH0A 1X7NA 2UY9A 4BXLA 2YBKA 2AEZA 3R0RA 1FS0E 2VBBA 4XFAA 1OOPA 5FXZA 4CPBA 2ZX4A 5IT6A 1BCCD 4LIVA 1MZ9A 2Y0DA 2CV6A 5LA0A 3TB0A 3WDTA 2XBO2 1MPXA 2Q30A 2WPVB 3BCWA 2KB7P 4QPGA 4CDWA 2XJRA 1WW5A 3A21A 1DQ6A 3OD0A 5DMYA 4C46A 2VOWA 1X9TA 2OQ6A 4CP1A 3FZ3A 5EJ3A 3IAPA 5B5EH 3L73D 3M9BA 1IK7A 1ZBE2 2B5HA 2WNVA 2CU5A 1N7SB 2KS1B 1W8TA 5KLIB 1QJY3 4R4ZA 3PJSK 2ZFCA 1WBFA 1JEKA 1JTHA 1RUD1 1RH5B 1WW6A 4CCNA 1DYPA 1LOEA 5EYYA 3T2QA 3O1MA 2V73A 3S7IA 1K3IA 4E27A 3ACLA 1D4M1 4MVTA 2MKVA 2WSSH 5AVSB 4DJGA 1RUI1 2VH9A 3B5LB 3QOPA 4IERA 2Q8CA 1DIPA 1C57A 1SQPK 3DGTA 1HXS2 2DWRA 4H3WA 4MXWA 1HLCA 2EIGA 5CNAA 1J59A 4GWMA 3SHRA 3HD7C 1XXNA 3GHGA 5CCHD 3CJIC 1AR81 5CCGC 2HH9A 4FQZA 3ZFFB 4LO5B 4AAXA 3LWCA 4NPFX 5E79E 3BPZA 5C3SA 2VUAA 2F6BA 4P9JA 1E57A 2TBVA 1J1DC 2HR3A 4TT3H 5AVRB 3KB5A 1JCDA 1LT9A 2WO2A 3OBZA 1HIXA 2JDHA 2FYUG 2KD7A 4Q1RA 3ZYPA 4BJ0A 2B46X 2JD9A 3N7NA 2JWAA 1V6LA 4QM9A 5DUXA 3MP7B 1O5UA 3UKVA 4BB3A 3R2PA 2JE9A 1SQBK 4YLZA 2FD8A 1H6YA 2F4LA 1H0BA 1AR92 2AC1A 2A3WA 4LTAA 1SQQE 1AYM2 4GODA 2VMHA 2W68A 2WLPA 5A80A 3ZSLA 2A5ZA 4PV1B 3POWA 1URQB 1UWWA 4XMAA 5JIAA 1W03A 5JI7A 3TK1A 1V6MA 2E53A 4B7EA 3EHKA 3POFA 5F1RA 1MZEA 2XV5A 3T4HB 2JE7A 1MQTC 1CAUA 2W47A 2YMKA 2ZHNA 4EWDA 2CNAA 3NVCA 3WUVA 1RUE1 1VB2A 3FHIB 2GN7A 3KS7A 2JJLA 4I6MC 3M0AA 1ZZ6A 3JUUA 4O9BA 1JHJA 1HRI3 5BNNB 2OQ7A 3TGUJ 3A4UA 4QQPA 2PHTA 1OVUA 4QU1A 1AA0A 1TME3 5IW0A 3OEAA 4D6TE 2VG9A 3D71A 4GWIA 2BU9A 1S5LE 1WA6X 3PMSA 4OGQC 1JODA 1HXS1 4AI0A 3TEWA 2SLIA 3TYYA 1J1EC 1NOVA 2ZXQA 3GDBA 1IZ3A 4KNCA 3EYPA 1GW3A 1L0LK 1JMBA 2IUWA 1EP0A 1UZYA 4XCBA 5E16A 1RE3C 1C1FA 2X10A 4A3XA 5IFTA 1W04A 1NUKA 1DD4A 4JKKA 4DZOA 1RUD2 2WRAA 3EMRA 1I3HA 3HOBA 1EZVD 1KXGA 1GICA 2ZOEB 4QGLA 1W2AX 2WSCJ 2YDEA 1KZUB 2QE7H 3H9AA 2EALA 3I8TA 2QA4P 2WO1A 1N3PA 4I01A 3VBHC 5C5UA 1FC2C 3Q8AA 4JTNA 3B5NC 3L37A 3Q5PA 4LULA 2K3RA 1A8MA 3JU9A 4O9EA 5FXVA 1XTCC 4NE9A 1QJU3 4XJUA 1GQPA 1GSLA 1W8WA 2VZOA 1RUF1 2FDGA 4V2WA 1JCCA 3WG1A 4XZUG 5EHDA 1OVVA 2GC2A 4TSVA 4BWOA 5M0TA 3KT4A 4CP0A 1AYN2 4IE7A 2BNNA 2WAAA 3TSIA 4AI9A 5FJKA 1BZWA 1FAYA 3OJBA 4XABA 1O3SA 5GTIH 3DYOA 2ZTNA 3KMHA 3SMHA 2XLFA 3LDKA 4CCKA 5C70A 1G2CA 1AF9A 2VVFA 2GSYA 3LD8A 3WP5A 4AR2A 3S0MA 1N73B 1Y47A 1W6NA 3PP5A 3LA7A 4IV1B 1IOAA 1J1TA 2A6XA 3OF1A 2BNMA 3GCXA 5DQ0A 1YXWA 2W52A 3W5NA 4DY5A 2HYKA 4CDQC 1ZX5A 2NPSB 3BPSA 5F6KA 1PO11 2KI7B 1VL2A 3L35A 1QOSA 1RXFA 2UU8A 4YYOA 4HKZH 1ASJ2 1XYPA 1AR93 2ZX3A 5C3QA 3GF7A 3O6QA 1B35A 4HFSA 4H55A 4K20A 2BRTA 3SNMA 5KAIE 4OHXA 1PP9E 2AEJA 1MS3A 2VZQA 4LJHA 2VULA 3O1OA 5GLWA 5L8RJ 5HBAA 1COV3 2OUHA 4F83A 2DBNA 3OOXA 5C3PA 4DPNA 1Q8PA 4QKFA 5FYYA 4J6GA 3KT1A 2R063 2ZGMA 4M00A 1KQSO 1K05A 1GZTA 3K5BA 3SH4A 2VOTA 1RHI1 2WDBA 1Q5OA 5HXVA 3USUA 3F89A 3B01A 1GOHA 3FFQA 2GNTA 3AEEC 2I74A 5SV5A 1ACCA 4KQ7A 4DEVA 1P84I 1BYHA 1L4AA 2HYNA 4HN1A 4CDUA 1AZDA 4CPBD 3O1PA 3H1KG 4AQSA 2TNFA 2FXPA 1R1ZA 3VBHB 2ES3A 1FZEA 5IYYA 3N7LA 5LBFA 1S1AA 1NH4A 1JOJA 1S0GA 1DU3D 1FNYA 3I59A 2WPQA 4XBNA 5GLUA 1LCLA 4UXAA 5T3NA 3NNGA 4HL0A 5IVBA 1W9WA 3MO4A 4LK6A 1REFA 2ZAHA 5A6YA 3RK3C 3EQEA 3HBZA 3THTA 2GUSA 4W4ZA 4IL6E 1G7YA 1HQLA 4HK9A 5CFDC 5FYCA 1FDIA 2XONA 2WN2A 3C7FA 4H2AA 5IATA 1PVXA 2VXRA 3SSUA 4B4PA 2E33A 4IGOA 4U3FJ 4P5HA 5CBOA 3AYEA 4GA9A 2R043 5BNOC 1XBFA 2VQ0A 3D0SA 1L3JA 2ERFA 2JG8C 3OPWA 4RD7A 1VBC1 3T08A 3MIDA 4BPZA 2H7HA 4JQTA 2XNXA 3LIHA 4Y5SA 2Z5IA 1DGRA 3U59A 1EYBA 4CDQB 4FBFA 3WX5A 1K5MB 5BY5A 2BBVA 1JZ3A 2YU2A 3TNPB 4XF0A 1L7LA 1SQVK 4MSVA 1GV9A 2ZGKA 4QKDA 4UFLA 3RZKA 5AVYB 3VD3A 1NTKJ 3ZN6B 4FVVA 4ZXKA 3WNOA 1BVP1 2QIWA 3I54A 1C1LA 1YRZA 4QX7A 1QQP2 3BUCA 2KA3A 4AL9A 4CCCA 3S4RA 5APVA 4U3FD 5IHRA 4XHBA 4AOCA 1ZLLA 2WFPA 3B02A 2GNMA 2ZA9A 5K0UC 3AB0A 3LGRA 1L4AD 2WC2A 3I2KA 3VL8A 1ZBE1 2WWWA 5DJUB 1NT0A 2EF6A 5FZIA 1W2BO 3EFFK 3PUIA 5FWEA 4QXHA 2DUPA 5A33A 2BDRA 2VUJA 4GJZA 3NJZA 5FFOC 3JBG3 1Y9GA 1N1TA 4FFHA 3SCHA 4AQ2A 5JMCA 2ZAEB 1NCQB 3LPFA 4RA0A 4YVWB 1HKDA 1LKNA 2FDJA 3AZVA 3B93A 1ZZBA 3RMYA 4IV3B 1LHWA 3UYJA 2JXAA 2WQ8A 2YUEA 2CGNA 4FSJA 2UWAA 2XHNA 1UO9A 2P1JA 4KBBA 3ZPOA 1RUC1 4CU9A 2VOKA 3W68A 5KWRA 1KFNA 1RHI3 3J8F3 4YVSC 2FMYA 3X29B 3WQBA 5BNQA 4OWFA 3H8OA 5DXDA 4OI1A 1SQQJ 4QM8A 1NU1D 5T50A 4LIUA 3H8UA 5D2AA 2ZZQA 3G7DA 3SKVA 3VDDA 2CHHA 2JDNA 4R4XA 3H3LA 1USDA 1AV1A 1FATA 5APAA 4H7LA 5A1LA 1W0OA 5CCHC 1DCSA 1RIRA 1KV4A 3EJKA 3QH7A 3LCPA 3QCWA 2ZEXA 4LEJA 3MIEA 1VQ9P 1G9CA 1DGLA 3RWKX 3KLSA 1FI2A 2HODA 3B4SA 1G6NA 4FCAA 4MOAA 2XOMA 5BNPA 5JZGA 4QXCA 3E1IA 4KT0J 3TN93 1JYIA 1WT6A 3A5TA 4C91A 4FFGA 1FV3A 2B9BA 1IGOA 2V4AA 4XVHA 3VBSA 4IGQA 4CEWB 2IX7C 2BYVE 1FT9A 2VOVA 4RGKA 3VV1A 1LGNA 1LENA 1ST8A 5C9AC 1KQRA 3BOWA 4H44D 3PDQA 4IEXA 4PCRA 3AE8C 5I0TA 2D6PA 4XDOA 2W46A 1WCUA 5CKNA 5LA2A 2P10A 1OHFA 3U78A 4ATFA 1T2KC 4UF0B 4K9SA 4B1MA 2FCVA 4FTEA 3BYWA 1X22A 1ULDA 5JR2A 1NKZB 1ND2B 1N7SA 2KS1A 4U3FG 1S55A 2V09A 5HI0A 1C4RA 3CLPA 3S5AA 1URQC 1F31A 4Q5OA 1NLRA 5CAZA 1JOBA 2WPRA 3Q1MA 1OC1A 1VMJA 3ZR5A 5C5TA 5B4XA 1SQXK 3SEEA 2EXHA 4O61A 1I6XA 1OH3A 1NTMJ 1RUH3 5FMCA 5KHIA 4Z2AA 3O0VA 3ACIA 5LASA 3PUQA 3D3AA 2N9YB 3VDCA 2YKOA 1Y7BA 2JEEA 3L72E 5FK8A 2L9LA 1PV3A 4D3WA 2ZYAA 2FDIA 3CXHI 1GU5A 4IW3A 2BGCA 1TZOA 4HVOA 1SFNA 4CCEA 4YG0A 2RS13 4FOVA 5BXXA 1N8RQ 1QJY1 1JYCA 4QX5A 1JZ2A 1LTEA 3P3PA 2RDQA 3HVDA 4JKLA 1IS3A 2HG5D 1DHKB 1ZBA1 2UY8A 1JOPA 4JTOA 2ZACA 2PHXA 2VBPA 1Q3EA 2Z5HA 3AVRA 5FREA 3LSEA 1URQA 4L8QA 3N36A 2JG9C 4F3JA 4V1PA 3KV6A 2WL1A 3N35A 1V0AA 1U5ZA 3O1RA 3O0WA 4I30A 2WKKA 1CZQA 1OX3A 3POYA 1DQ0A 3TGUD 4Y26A 5GLZA 2C0WA 1RUNA 4CCOA 5AC93 1NCRA 1YTZI 1N86A 3HNYM 2K37A 5KKZB 1FDOA 3GHGC 1EDKA 3CJIA 5CKMA 4YARA 4CU7A 1OI6A 2BEZF 2E32A 3GJBA 1XPWA 5FZCA 3VBSC 2CY6A 3ILNA 3AFGA 3DXTA 3E7KA 4UB6H 2QQIA 4BMEA 1VBE1 2VAUA 3TNUA 1OWAA 1PIV1 3T2PA 4ZKPA 3H8RA 1VQNP 2PXJA 3QBQA 5CCHA 1SACA 1ULPA 3JQXA 1CGPA 3U4SA 3AKPA 1RHI2 1JYWA 2YMYA 1PK6A 3WHUA 4BQ3A 2QZ2A 2P2KA 3LAGA 4N7IA 2ZEWA 3L75D 1YHQP 2MHFA 2OS2A 4I3GA 2HWE1 2QNKA 3FWNA 2EVXA 3ZX7A 3B9CA 5AW1B 1S0BA 1KEXA 1M7LA 3CD6P 4XHXA 1QOTA 4AK3A 2V4VA 1VBC2 2JKVA 2DVBA 2J1VA 4BHPA 3IDAA 4CCMA 3H1IE 1LOFC 1HUCA 2GC0A 4YFZA 3N7MA 5APQA 3CI9A 4GALA 4DRVA 3MI8A 2X09A 2ZBJA 3P6BA 1CW5A 1JO5A 3PVNA 5T55A 1QXRA 1SFYA 2WITA 4YM2A 3FGAD 1UN1A 1MZ5A 4XUOA 5L9BA 3MUDC 4Q4Y3 2O14A 5C4WC 2QJKC 2M3EA 1AJKA 3AE5C 2RM21 2J1TA 4PD4E 1N2DC 4JRAA 1ZM1A 2ET1A 1K42A 1BKZA 1YLLA 2PYTA 3J7NA 3PTZA 4PDWA 3UJOA 1BLZA 3BN6A 4CEWC 4KWLA 3T97A 4MGKE 1Y43B 4HKLA 3VZMA 2GMPA 3CJXA 5L36A 3TEYA 3UGFA 2VL4A 2SBAA 5CFDB 2R16A 3L73J 2E7TA 4LKFA 3RQ0A 3AFKA 1FZFA 1HRI1 1B09A 2PFWA 1SQQD 2A7AA 5FZ1A 3V64A 3KYQA 3NAPA 3IIIA 1JYNA 2NPSA 3ZSEA 1KTMA 4I09A 2ADEA 4YW2A 4AWDA 4DINB 1U0AA 2CYFA 2VC9A 1H1IA 4EN6B 4HSLA 2BNOA 1SFCD 2C5DA 3F95A 1EZVG 3KWVA 4OFGA 3FX0A 1HB1A 2RS53 4K21A 1KORA 1RMU1 1H0TB 1XU1A 4JHZA 1D4M2 5FZDA 1N1SA 1OA3A 2OZJA 2D3SA 4W6XA 3WOGA 4YRDA 4BDVB 1NU1K 2D40A 3GNEA 1V6OA 3NL1A 4MZUA 3IAQA 3HUSA 2OPKA 2D93A 1KDKA 5BU5A 2SPZA 2FHRA 4X8NA 1LJ2A 5AC91 5IVVA 4N8MA 5FZOB 3OGGA 3KSCA 4CUAA 2WBKA 4ZU4A 4ET7A 2GM4A 4XDQA 1VF5D 1DGWX 4LORA 4P9IA 3TBDA 4CEYC 1WMXA 5KLVE 4GKGA 3MV11 4LITA 1GKBA 1VP6A 4QQHA 4YW6A 5CJ4A 2VQUA 4Y24A 4Y5TA 3ZOIA 1UY2A 1VBE3 2CL2A 3AZXA 1UKRA 5F3CA 5LZ6A 3CX5E 1POV1 3ZMNA 1NU1E 3ZYJB 5DDJ3 1F2NA 3AP6A 4WV8A 3WNPA 1IPJA 1SVFA 3C8VA 2CK3H 1NTKD 3I59B 1AYN3 2R0FA 5T5PA 4BQ2A 5ISLA 2MJZA 4TLFA 3VBFB 5T5LA 3NFQA 1L4AC 1CZVA 5CVRA 5F39A 3RJ2X 3CWBG 4QXKA 4KWKA 4PQQA 1YYCA 1WMDA 4EIJA 2JG8A 5FPLA 4AE2A 5FQ0B 1KQFB 5APWA 3H1KD 2VM9A 4AW7A 1IJDB 2ITAA 2A75A 1YQ3C 2DYCA 4F8AA 2D43A 2D7FA 1PVC1 1LTBC 4SLIA 5FDBA 3KVAA 1AYM1 4AHXA 4BA6A 4LBQB 1W28A 2Q7CA 1VAKA 4H44B 1A02J 3BU0A 3TWIA 3G4SP 5JZGC 4HLTA 4PIXA 2PTMA 2R073 3WW4A 3VHOA 4LKDA 1GDTA 1GZWA 3KV9A 1XE8A 2JKBA 4YW3A 3H32A 5FZFA 5L7OC 4L74A 4MO3M 1CIWA 3AMHA 3KV4A 1WUVA 1VQ5P 3GZEA 4ONUA 3O1VA 2ATFA 2E42A 3J4UH 4BE3A 1PP9G 1SQXJ 2J1SA 3I55P 2B39A 1Z0HA 3EXUA 3CWBJ 5FBZA 3SC7X 3S7EA 3WDVA 1NVOA 1POQA 1T2KD 1YFWA 1EAH3 4WBBA 3M9HA 2BVVA 5A3WA 4RS5B 3P8CD 5BNPC 1R081 4K8RB 4QPYA 3T2TA 1SLLA 2BGOA 4A41A 3AZZA 5KAFH 3L9JT 2RMZA 1HB4A 1YJLA 1FZCB 2R3SA 5KXBA 5A33B 2RR13 2O1QA 1NA1B 3TAYA 2EICA 4FFFA 2PRRA 2RN0A 3Q3DA 4IEZA 2VZRA 4J1WA 4QHOA 4Y1ZA 3VZJA 3WQ0A 3NQHA 5CBNA 1CAWA 4I3PA 4LLFA 4NR1A 1KQGB 1UL9A 2J22A 2IDBA 2DVDA 2Y6FA 3B3QE 3E5QA 2WSFJ 3EBRA 2W9XA 4I0AA 2J59M 4MYEA 4XAAA 4AHYA 3M3CA 2VQAA 2PELA 4Y28J 3IDEA 1HQWA 3POEA 1W8ZA 4NOTA 3ZPYA 1PHMA 4GOFA 4MG2A 2JWDA 4WZFA 1O4YA 1D7PM 5IK5A 4IEUA 1XOYA 3R4YA 4LXLA 2VTXJ 4WM8A 2AYHA 1TEIA 2XZRA 1XQNA 2FZ1A 3VBFC 1H2LA 2E74D 2Y0CA 3PJQA 4YGDA 2AXTE 2ORZA 4AFAA 1POV3 2W83C 1VQLP 3POGA 4IEPA 3UETA 5EZWA 4CP9B 1JY2P 2V5YA 5HV4A 2WN3A 3V0AA 4OHYA 4GMP1 5FY0A 4AEDB 3A3YB 1AL22 2GP5A 4L75A 4JRLA 2POHA 4YVSA 4LBMA 4LUKA 2YHJA 3ITKA 3CZUA 3FX3A 2H0VA 3JQWA 1A6CA 1OMIA 4C7NA 1MS5A 2GMMA 3VBOC 1C8NA 1SQQK 1K9MQ 4LUMA 1KB9E 4B86A 1JBCA 1GU4A 4XF9A 5D21A 2HODB 5C9AA 1G9DA 1DDLA 1UU5A 1CJDA 3WNKA 1ZR2A 1NXMA 3OGVA 3J7LA 4EWEA 4OHVA 4YM0A 1VQPP 2IFNA 3SWFA 5DDJ2 3FFZA 3J8F1 3SH5A 3HUSC 4CEWA 2WFF3 1IFNA 5J96B 4KWUA 1BK0A 1KJLA 1S0JA 4Q4X2 2BGPA 3PRJA 2C26A 5I0UA 4COZA 1SLAA 3B5NA 2B42B 1J83A 1S3JA 2P37A 5I0RA 1XJAA 1M90Q 1HXS3 4IESA 3B69A 4HZFA 3OAKA 5APUA 3VKLA 1MS0A 4BRYA 2CDPA 4C0HA 4TTGA 1FOSE 1LOFA 3UJQA 1Y9MA 5LBEA 1VQKP 5A3OA 1ND2A 1ZRDA 1JS9A 1HN0A 3A22A 4PLNA 2J42A 3HEIA 1RY3A 1YNAA 4NN0A 4RS5C 5FPVA 3THPA 1GK4A 1L0NG 3V4WA 1X9VA 3NMBA 3MEPA 4NHYA 1FYUA 2W92A 3Q8CA 4OHZA 1TMF3 4FFIA 1N47A 2PQQA 3AKQA 4PBPA 4UW6A 1YCIA 1DZRA 2XGXA 1QWRA 1BSNA 1S1CX 2K9ZA 1ZOYC 2Z4FA 1Y3TA 4UBGA 1JOCA 3I7DA 4PV1D 3WNXA 4CXWA 5ABJC 3ZYIB 3RZHA 4MN4C 3HAGA 1AR62 2FFDB 2ZEZA 2ZEYA 3CX5I 3H1LE 3PH0A 3NNJA 4IGPA 4PF5A 5BNOA 1T3JA 4JGYC 2D6MA 5IJRA 5GZGA 2A6YA 4BMBA 3N9OA 4EROA 3RFRA 2M3BA 3H1LJ 1EZVI 1PNGA 4ZKUA 3G6EP 3CX5H 1BEV1 4BXSV 4HG6B 3M3EA 4W65A 1PGW2 2VZUA 1RITA 1AJOA 2RR12 3SWYA 4M3CB 2IBZE 2HWB2 1LB2A 1QVFO 1BBT1 2HWC3 3OGJA 4S2FA 3ZXAC 1RF1A 3CPWO 2K9JA 1DYOA 1A3KA 1KGYA 2O0OA 3DPRA 1GBGA 1RUI2 3Q8BA 1W6PB 3TN91 5KC5A 2NLRA 4RHV2 3PIJA 3VZKA 2DU1A 5FZ9A 3AZWA 4U7JA 2RJ2A 4ASWA 2DBIA 3H7JA 1PZ7A 4DUVA 3M4FA 3H1MA 3AE3C 3TOJA 3U07A 4Y22B 1BMV2 3DCQA 3N9MA 5HCAA 4K1ZA 1YQCA 4H7MA 3WUUA 5FUPA 3D8CA 4QX3A 1K12A 1LT1A 5DUUA 1RF1C 3CL3D 2Y64A 5GLVA 4CZSA 3HE4B 3CJIB 2VQTA 3OEBA 3BCCJ 4PJ0E 4KWJA 2D3RA 3T0BA 1NAYA 4L76A 4M0HA 2KM2A 1Y8AA 4N3YB 5FYHA 3WW2A 3SFEC 2ETEA 1ZBA3 2HWF3 3HD7A 2Y6LA 1W06A 3S5QA 1CI6B 4AEDC 2YO2A 4BOWA 4CCDA 3TNUB 1HJGA 5JAXA 1YIJP 3AEBC 1GP4A 1XYOA 3DEMA 3H1WA 1HDKA 1MEC2 4JF7A 2IC1A 4JGYB 2VZVA 2AEFA 4ZNCA 4CDXC 1E5SA 5JSPA 4P9WA 1L0ND 2R44A 2FQPA 3GALA 1UU6A 1Q2NA 2IFWA 3IFMA 1H9PA 1DD3A 1O91A 2VXJA 1S72P 1QJY2 2ZGOA 4FQ4A 4IE6A 2WO7A 5FMDA 3WG2A 1GFF2 2WUHA 2P4EA 3KGLA 3AP4A 4XQDA 5IVFA 4CUBA 1KD1Q 2VOXA 2HPCA 2XR4A 1JY2N 3T4VA 1VRH2 1S5LH 1WW4A 2KOGA 1ZA7A 3MIHA 5LY2A 1X0TA 5H9SA 1LECA 5J48A 2WFF2 4D8MA 2A6ZA 4N53B 3HQXA 2CPBA 5DAWA 4COVA 4D0QA 2XVLA 3H1HG 2E7QA 5A7PA 2Y60A 2WZPP 4AVSA 2P17A 3AL6A 1SQVE 1NLSA 1Q8VA 4XA4A 4GZ9A 3UESA 4DY3A 4A3ZA 3VMZA 2MNGA 4BWNA 3D5OA 1EUTA 4QU2A 4ARYA 2BFUS 3VMXA 2YROA 1FPN1 3JD73 3T1LA 1HWTC 1BXHA 2E51A 1FAVA 3HMYA 3HWJA 4HKOA 5FZ4A 5IUQA 1VBD3 2JICA 4OMDA 1VQ4P 1YQ2A 5FOBB 1BDCA 3W5MA 2WT7B 2NMNA 5EIYB 2N1TD 1VLNA 5ABJA 3B5ND 4N78D 1FOD3 4I02A 4BQWA 5K7PA 2EIDA 1SLCA 1LAJA 2PHWA 2YC0A 1UW8A 5K0UA 4OQ8A 4GB33 1F4HA 4LBLA 1EZVE 2H0BA 2WNUC 3IM0A 2Q3IA 3M70A 2P7JA 1EXJA 1R5SA 4IEVA 3CHXA 5CB7A 4FTSA 2WQYC 1RUF3 2IXHA 1NTZD 3WW1A 4GDOA 1OD3A 3POJA 2ZS6B 3ME2A 1NXD1 3N7JA 2BEQD 1PIV3 4KMQA 1SQXE 1J3QA 3ITQA 4Q4V3 2QE3A 4EN8B 2AREA 1Q7YQ 1H8AA 2EXJA 1UMHA 1TMF2 1JUHA 4RQPB 2DW3A 1MFTA 2RM23 2B45X 5A7SA 3ZSKA 2FBWC 3GZAA 4FXKB 4LOSA 3PUAA 5E89A 1LGBA 3ZFFA 1JYTA 3OA7A 5AVTB 4L11A 4BQXA 1V6JA 3MLLA 2E76B 1ONAA 3CQOA 4FPEA 5FLJA 2BWCA 4KU8A 4Q0UA 5GTHH 1VQ6P 1ENQA 1ODMA 1SFCC 3JBG1 1M56D 2Z79A 3MUDA 1KDMA 3ALQA 3KGZA 4NWWA 1PZ9A 5BVZA 2GC3A 2OIIA 1PMHX 1UXXX 1CZSA 2R49A 2VCAA 4FPKA 4D7TA 5FZ8A 1O8PA 4UFMA 1HVVA 5DN2A 3H1JD 2PFXA 1EDIA 1RVF1 2VCBA 3WG4A 1S9KE 1ZBA2 1VMFA 4MV2A 3H1IG 5DAQA 3M0DA 4W7YA 1DGRN 1HW5A 2XHKA 3ZN4A 1RUG2 1MFZA 1UPIA 1H4HA 1NTKK 2AGSA 1SLTA 4XUPA 4D7SA 5JDBA 2NZ9A 4R4LA 4TXWA 2FYUD 4Q4Y1 4CU6A 4FP3A 1ZV8A 2WQZC 3RYPA 4AFDA 2XBO3 3MICA 1ZR4A 3VBFA 1YITP 1IHMA 3H1ID 4E4SA 5FZGA 4OULA 5LY1A 1AR73 2G4IA 1BE3D 2MEV2 2P67A 5LRSA 2ZYGA 1AL23 4LHSA 4CDUC 3CX5D 1OKOA 1CESA 2CGOA 2JG8B 4XJ8A 1VMHA 1R091 3KF5A 2RV9A 3R05A 5B5EE 3A0HE 5KJ7D 5B66H 1EDJA 1PO21 2OT7A 2PQSA 4RQPC 1LT9C 3WQ1A 5C71A 4E4HA 4IEWA 1G9AA 3BCCD 1GK6A 1J84A 4MUVA 4PD4D 5FKBA 1QDOA 5GLTA 5IVCA 4AXOA 1K04A 3VBRA 1ZXGA 3O1SA 1VBA1 4GIQA 3GBWA 4NAMA 1QH6A 5FP4A 1SQVG 3VTPC 1N3OA 4XF3A 4XDPA 5FMOL 1HRV3 1UZVA 3BRVB 3VDAA 5FK7A 1LHUA 4W80A 2YIUB 1UYPA 4L97A 3H32B 3Q2YA 2WWSA 3Q5RA 4A7YA 4IFMA 3KPEA 1BSHA 4WM7A 3CF6E 4B4RA 1FPN2 3WP3A 4NWVA 1FV2A 3V4QA 1YFYA 4OUSA 1MS1A 1I5ZA 4NPMA 3VMAA 4PBOA 3PUSA 2R041 5J37A 1OIPA 3WNMA 4Q1PA 3BTXA 2E5TA 2XUEA 4RS5A 1H2MA 4UYBA 1EPWA 1QQP3 3L71J 1AYM3 2XKMA 2XWBB 4QX8A 3R4SA 3V2QA 1KJRA 1REDA 5T54A 4I1LA 3QLQA 3B9IA 2J7MA 3P8MC 5CZKA 2IXKA 5CYYA 2XQRA 1NA1A 2J58A 1MVQA 2W1QA 4G4FA 4IEYA 4P9GA 1GNYA 1PGSA 1G1JA 2I1KA 4QX0A 1RUE3 1OVRA 5KXCA 3E6CC 5B2GB 2R30A 1N73A 1ZNPA 2O8QA 3ZIWA 2QTWB 2E75C 1YQ6A 1UOGA 5TJHA 2XPJA 3M3OA 3TYJA 2QM8A 2XDVA 2B9VA 4UW4A 1OT5A 2E6VA 1JW6A 1ULOA 3HQRA 3O14A 2FFDC 2QUOA 4BQ1A 1RUC2 4WM8B 5CFCB 4AQ6A 3U10A 1OF3A 2VUDA 2XB6C 5AVUB 5FYTA 3GF3A 2FYNC 3CCSP 4G3YC 4IV3C 3NNFA 2GNDA 4U3FE 1UXZA 3O6QB 4MADA 2YG0A 5FJHA 5CKQA 1N1VA 3PMEA 3L71G 3VZOA 1W0PA 2Y6HA 4YVSB 2WQ4A 1N3QA 4AGVA 1W8FA 1V00A 1XU2A 3BCCG 1PP9J 3AMPA 4WBAA 1HV0A 1O7FA 3ATGA 3BU7A 4E4ZA 5C9AB 3FXEA 3B00A 1G9FA 5FXXA 2L5GB 3KHUA 2W1UA 3WF3A 1OXZA 1ASJ1 1MUUA 1ZW0A 4UB6E 3KF3A 4U2AA 3MF9A 2R5DA 4AAPA 4P9XA 4DRRA 3A0BE 1R093 3NKTA 2H88C 1UYXA 2WZ7A 4PDWC 5GALA 1GD2E 2ZGLA 1NTZG 2WSVA 4NHXA 1LTTC 3S30A 4CDUB 3IZOA 1XNAA 3E1RA 5FYMA 3N7KA 1L0LJ 4YTPC 2VNRA 4BRYB 1U12A 4DFSA 3VBHA 4GMP3 4J1XA 3GHMA 4OUMA 1LOBA 2J1RA 2RMU1 4N9HA 1VF5C 1JZ7A 1VBB2 1IG3A 1GANA 1AUYA 1GP6A 2D6NA 5KLVJ 5CIRA 5FPXA 3MGUA 1LNQA 1FXZA 4JGZA 2YYOA 3MFCA 3OTFA 4G9SB 1C3HA 1UOBA 3RDIA 1CN1A 1WRGA 5JMOA 4IFFA 3NV3A 1XRUA 1Z7S3 2WT2A 4CE8A 3E6DA 2JO1A 3FBYA 4CU8A 1PO13 1QJZA 2QQKA 1ZRFA 2YBSA 4IL6X 5F37A 2Y6JA 1OLME 4CXYA 4PT6A 3ZKUA 1V6KA 3ZMOA 1ZN5A 2FFDA 3ZKYA 4BK5A 5A6ZA 2QBXA 1AR91 4XUTA 2M8RA 3RSJA 3I49A 3I2OA 3KM5A 2IXIA 3BGAA 1F15A 4NJ4A 4OI2A 3W20A 3H42B 5HCHA 1CAVB 3RJRA 2IVJA 4EN7B 4Y4YA 4LA3A 4A6SA 2HWD1 4KL1A 2IXLA 2DVAA 1WCKA 3VD5A 4NUBA 3ZN6A 1M1JC 4EZ4A 1DH3A 4XQWA 4AVBA 2Q9IA 2LUWA 1H89A 1NCRC 2R3CA 1K8AQ 1UOJA 2BWAA 1X82A 2D97A 1NTMG 1X79B 1LP1A 1V9U3 5FP9A 5TSWA 3BIEA 1VBD2 5L9RA 2ADDA 3CWBE 5ANQA 1FU1A 3MIWA 1L7RA 4L0PA 4ASMB 1W39A 2BOIA 1KB9I 4XETA 5JIUA 3UKTA 5IK7A 1DFQA 3PU8A 4H0LC 4LT5A 4CYDA 1T2XA 4FPLA 2HLEA 2PN5A 2XVKA 4JDMA 4YM3A 3HE4A 2DVGA 1OD5A 3PURA 4XCAA 1NQDA 4PIZA 3AJZA 5GZFA 3FXDA 2D2CD 3HD7B 2JB8A 3IF4A 2VZ1A 3BTAA 2DVFA 1IPKA 4XF4A 5DZFA 1K73Q 3OW2O 3GJAA 5FYSA 5HCFA 3POSA 5KLVG 1O4TA 2OARA 3WUTA 3IIAA 2G9ZA 4QDSA 5H9PA 1VIWB 2E26A 2Z69A 5FV3A 1JYVA 4JGYA 1RJ7A 2AENA 2HWC2 1CIYA 5G04L 4ARXA 2GUVA 5H9QA 1RE4A 1OLRA 4BU2A 1LGCA 1R1A3 1OFSA 4Q29A 4GT1A 3OPZA 1QL1A 2OX0A 2CSGA 3WXPA 1HRI2 4JX0A 1GR3A 1G1IA 3CMGA 5GZDA 1QHDA 2KXPB 2HPCB 4NRQA 3PL0A 3K48A 1FBMA 3WF0A 2A6VA 4E4DX 2FYZA 2OQQA 4PV1C 2AH2A 3V2RA 1HB3A 1O5LA 1AR82 2V5DA 3ELNA 5J36A 4P00B 1BCXA 2WZR2 4N53A 4KH9A 4YG6A 4PJ0H 4QT6A 2CWMA 1BBT3 2HWC1 2WABA 3LA3A 4QPGC 1GOGA 1J1EB 2FY8A 1MQTB 2RM22 1UZZA 1XSRA 4ZS3A 3VBSB 1SBFA 4FOYA 4ZU5A 1E5RA 3RK3B 1SCRA 1NCQC 2ZMLA 3HT2A 1Z7S2 4KG8A 5E6HA 2HWE3 4WVZA 5A7QA 3THCA 4N6JA 5AVWB 1M1JB 3CXHH 1AQ5A 4Q0PA 4YPJA 4M3CF 4XMIA 2Y9ZA 3D0JA 3B94A 5JSRA 1SQVD 4YXDC 1V6IA 4QGNA 3RZJA 2I45A 4OYUA 1HJ0A 3MHZA 4CDWC 4YW1A 4QB6A 3KQGA 4NPDA 3UGHA 3ZXGA 2O3JA 5ANNA 2NYYA 2QCSB 1PNFA 1BQPA 1JUIA 3A7QA 1WKYA 3J26N 3PU3A 3L36A 5LK5A 1VPHA 3L72G 5CG9A 1SEFA 3CC2P 1AR63 1V9U1 2LW8A 1XNBA 1AXYA 4Y4RA 5C7GA 1VBE2 3E6BA 1ND2C 1BE3J 1KMIZ 4XZPA 5IK8A 1DQ5A 3GM8A 2KZIA 4WY4B 1R083 1BCCE 2P5BA 5F5IA 5JVVA 4GH4A 4EDFA 1OKQA 1YJKA 4AUWA 1JU4A 4Y20A 1QGKB 2QM7A 1PZQA 1BCCJ 1KILD 2XG3A 4LNVA 5FYUA 4BQ5A 3LOBA 3V6IA 2XKPA 2ZHLA 4LLHA 4UW5A 5A32A 2YZ4A 1LTAC 3KZIE 5IFPA 4UWDA 4K3UA 1PGL2 4ATEA 1SQBG 2E43A 1RQUA 4LO4B 1V6NA 1GZCA 3TDKA 4Q4Y2 2YXRB 5AVAA 2R0HA 3ZXFA 2FXMA 2CDOA 1TNFA 1PPJG 2WWUA 1JHNA 5FLIA 1DLCA 5A6QA 4I7ZC 4K8FA 3AM2A 2Z4EA 2AXTH 2ARBA 4I0BA 5T52A 4BIOA 2P6HA 3MF6A 4DT0A 5D8AA 4N9IA 4IV1C 2ZHMA 3H25A 3JXSA 1QY4A 2Q0AA 1TVGA 2BV4A 3VP8A 3ZYBA 2XMLA 1DF0A 1JY3P 1W9FA 3I3EA 4QAWA 4QGMA 4QXBA 3B8EB 2R072 2XJUA 5LBCA 3KCYA 5AVPA 4OVNF 5JXJA 3I5CA 4WWIA 4WM8C 1UX6A 5F2SA 1YFXA 5JWPA 1OURA 3HN1A 3MIGA 3L73E 2VCMA 3VUOA 2PHDA 2WSFH 4PHZA 4YPCA 1DLLA 2WR9A 3E1F1 1SG3A 3NW4A 2R061 4XJWA 4C90A 5CADA 4KGQA 2H43A 1GLHA 2ZCWA 3RL0B 5F7UA 5DG1A 4DOJA 1L0LE 3T0DA 1PGJA 1AL0G 1OH4A 1BDDA 4C1WA 4LHLA 1GOFA 4YZ3A 1W8OA 2GDFA 2IBZI 5KKZC 2UYBA 1GL2C 3S1KA 3U75A 4JZRA 1NG0A 4XYXA 1PK6B 3MHVA 2YBPA 4OZOA 1SDDB 2BEOA 1M8OB 2YY1A 1RTVA 2ZABA 2XJTA 3R6SA 1O4ZA 2Y8KA 4N43B 1U7MA 1SQPG 2PLV3 3A23A 4NMIA 3C2UA 4OVEA 1XYNA 4D94A 1RF0A 4WM7B 1U7JA 4NPRA 1O3TA 2DUQA 1NU1G 3KCCA 3L70E 5KR7A 1RHZB 1PO23 1YIFA 2Q4SA 2VE1A 2X53S 3H1IJ 2ZVNB 1X8YA 1DX7A 1QX8A 1Q81Q 2G3AA 2RS52 3OGSA 4XIOA 1UYZA 4FPGA 5F5AA 1YTZT 3I56P 1W3VA 4AEMA 4DEQA 1SQPD 2W6AA 1YI7A 2BZDA 2FYUK 5AW3B 4Y5Z0 3OG2A 4FI9A 1W2NA 2YC2A 4ITCA 4NAOA 1GU3A 5DABA 5FP7A 2FDKA 3C7EA 1JH5A 1YJNP 1SZBA 2BW8A 2Q6QA 3SFDC 3DPRC 2GNBA 5G05L 4H13D 2ZAAA 3RL0g 3JCUE 1HRV1 2VMGA 3CDZB 4YWAA 4JQ0D 4GB32 4MX3A 1FJPA 3K4AA 4PDWB 4LBKA 3CZJA 3T97B 1W6MB 4BIFA 1SQBE 5CCGA 1H8TA 3GZUC 3VHNA 3FLTA 4D6QA 5K0UB 4M4RA 2RE9A 3NNMA 3MYXA 4H14A 3P1IA 3KDPB 5APXA 4UI9L 5CFDA 3RPQA 5C8WA 2IFMA 1RJ8A 1XE0A 1GWKA 1COV2 2JKXA 3DYPA 3K75B 1LTJB 2KUBA 2EAKA 1NA1C 2JD4A 4ES9A 4PD4I 1S2EA 1HF9A 4QKNA 4RR3C 1GL2B 3AE9C 1J3RA 1C8M1 2ZYDA 3K77A 5FYBA 5LEJA 1AVBA 4WB4A 1ZZCA 4UB8H 1P8JA 5C3RA 2VZPA 1NAEA 3AMQA 1FZBA 4QMAA 2VECA 2YPJA 5KXEA 1Q56A 1PX3A 3PTYA 5JUVA 3TEZA 1SQPE 3UIAA 1H0TA 4W6YA 4XPVA 2XH6A 4Q2FA 5I93A 4L73A 3H1YA 1G8WA 2JG9B 3O0XA 5EJ1B 4W7ZA 1LHVA 1S0IA 1YYNA 4FO9A 1L0NE 3HUSB 2F17A 3ZXLA 4LBNA 4AF9A 4JDNA 3B7MA 3SWKA 2JDKA 2RS31 4B1LA 1KD7A 5BNNA 3FHAA 2BCCJ 1QOOA 2BUKA 2RVAA 3JD72 5D8AC 5A3TA 1JN2P 4X6RB 2XNDH 3VL9A 3KV5A 1BGYD 1BK1A 1POV0 2E5YA 4QX2A 1H8VA 1SHWB 5HXMA 2CAUA 2B87B 1GZLA 2E74C 3C3VA 3KCXA 3KT7A 5FTTC 4DS0A 4XAEA 3H1HJ 5LWBA 1SFCA 1DEBA 2KYVA 2BASA 1COV1 4AGGA 1OQEA 5C8CB 1O3RA 4YM1A 1SCSA 3VKFC 3V0BB 3CNAA 2OYIC 1GMMA 1SPPB 1PGW1 3Q8EA 1M4WA 2CGPA 2QRXA 3BIWE 4C7RA 2VR4A 1JUNA 3CXHD 1QXPA 3RG0A 2X5IA 2X29A 3VZNA 2C6SA 5I0SA 1VR3A 2C1FA 3VKMA 4YGBA 5ACA2 1PPJE 2WSCH 3FLRA 3AKTA 1NAFA 5FQ0A 4MLOA 1A8DA 3C7GA 3RZLA 2PHUA 5BPXA 1KYOI 5CISA 5IVYA 3ZVXA 1RUJ3 5I91A 3UNPA 1RUI3 3DKQA 4GKXA 2MPFA 2RS51 3FE5A 5DJTB 4OGQB 3M91A 2ZGPA 1AR83 2XXZA 5LA1A 1GZWB 3MZHA 2VW0A 2ZMNA 2VGDA 3GLMA 4RO0A 5EXOA 1YJ9P 1OFNA 1NYHA 4Z1VA 3BODA 3OUHA 1GUIA 1TMF1 5DAXA 5F2WA 3N4XA 1VQ7P 4BXFA 4COYA 1L2PA 2JDMA 2D3PA 3OPTA 4XTMA 2Z5WA 5BU8B 5CG8A 3ZFEB 2UWJE 4AQRD 4UFIA 1C8M3 2EA7A 3H8XA 1VRBA 3A0KA 4XJAA 5KBFA 3LZZA 2BQPA 3J8F2 2WS93 1QJFA 5L9VA 5DDJ1 1MKMA 1OVSA 4XC9A 1FZGA 2WZR3 4JHTA 5FZAA 2KP8A 1PM4A 2VW1A 4O65A 5SV8A 2B8MA 2N1TA 3L70D 1F4AA 1XE7A 1VALA 2OVUA 1NWQA 2QJVA 1OW7A 1VPCA 1CAWB 1YO8A 3AXEA 3I4IA 5D1IA 5BNPB 2X8KA 4AI2A 4NIDA 2E75D 3L74J 3HJRA 5KLVD 1UIXA 1ULCA 2DFBA 2VCCA 1DQ4A 3MFAA 3ZYFA 3H1JJ 1NYWA 5FY4A 1Z7S1 3WCRA 2JDIH 5K8SA 5K4LA 5FYVA 2OTKE 4E2GA 3KQRA 4GJYA 5FWJA 4A7ZA 2DCYA 2XUMA 4TYSA 1L0NK 1PO12 4M4PA 5JI9A 2ZGSA 1A34A 5M1BA 1S4XA 2BCCG 1MVEA 2PHLA 3PJYA 4CP9A 3V0AB 5AW7B 3T30A 4DO0A 2W6JH 3CLQA 2WLQA 2FBEA 3USSA 1AX1A 2ARXA 2AUYA 1DZQA 1UD1A 4Q27A 4FT8A 3LW5J 3VDBA 2D6OX 3NMDA 4TZDA 1D7MA 2IBZG 2GH8A 1D4VB 5A7OA 1JY3N 1AQTA 2WPSA 1UPSA 4Y1UA 3RRDA 3LEGA 5HPOA 3L75E 3TGUG 2WTYA 4OMCA 5C39A 4Y1VA 4EOTA 5LCWL 1LWUB 1NO4A 3GCWA 3NO8A 4QDRA 4PJYA 4WVWA 2Y0EA 5FO9B 2FDFA 2E75B 3IN9A 1P84H 3D82A 1US2A 1URQD 1EAH1 2D2CB 3HD7D 1FJKA 5EPAA 1QJU1 2WO3A 1JU3A 4GIFA 3VGIA 2IXJA 2VTFA 1M1JA 3AEAC 3C9IA 5FY5A 2P3IA 2HFED 3G6JB 1MV8A 4HH2A 2G1MA 1LTSC 3URFA 3ZFEC 1QNWA 3IPVB 3RZZA 2YXQB 3JSVC 5A7WA 4LLOA 1SS1A 3WQ7A 2LRPA 3KHCA 1NLQA 4YXWH 4HVQA 2KXLA 5ERLA 3BCCE 2C0ZA 1I9RA 3W67A 4HPKB 3RWNA 4HB1A 5FY9A 2DV9A 5C6CA 2QJKB 2LTNA 1KYOD 3H1KJ 1FDMA 4NHMA 4R9AA 1H2NA 2R6QA 2QJYC 4Q0SA 3VBOA 4P9LA 3WY6A 4EWAA 5KTBA 1VBD1 4LO7A 4ZU7A 3K4DA 3M3IA 3FWEA 4OQ9A 3H1JG 4RESB 2QEXP 3FLPA 4QQLA 2OA2A 4XOGA 4D7YA 1UZWA 2YGMA 1PGL1 2D6LX 1OPMA 4HKWA 5A3PA 2WS91 4YZ5A 2A45H 3NAPC 4XACA 2QQUA 5BNOB 2GAUA 3HPNA 1R1A2 2WZR1 2YC4A 2HWD2 1XNKA 1CAXA 3DN7A 1SMVA 1OOPC 2G9GA 5AW6B 4GAZA 5A32B 3AE7C 1FZCC 1E5HA 2ET7A 4IE5A 5FYIA 3ZYRA 2A70A 4E8CA 2UWBA 2C24A 4M3CA 4Y99B 3KVBA 1W6OA 5E1RA 1KS4A 1RUH1 3OCPA 4YZ4A 4AQTA 2E7AA 3U4XA 1V9U2 3SQOA 3T09A 2DCTA 4LC1A 2O01H 2K9JB 4ZPIA 5EQUA 3VN4A 4R9CA 3DPRB 3WF4A 4CSWA 1KFMA 2QQMA 2VZ3A 2Q3EA 2I2SA 2V7QH 1W5CE 4ZONA 2WSUA 3RGBA 1BVVA 1FX5A 1XNCA 5GTHE 2W1WA 1ULEA 1LU2A 2DCJA 3FN9A 5FAXA 1NX9A 2W91A 4D69A 1W05A 4QQ2A 3ZXJA 3WVJA 5APTA 4DNYA 3V56A 4Y22A 3ZO0B 4ISRA 1PP9D 3N3HA 2P3KA 1U5XA 2YNYA 1UY4A 3FBMA 3JB4C 3OGRA 3RBXA 1KFXL 1LOGA 2AR6A 2JIJA 2Z2SB 4R9DA 2VTXA 5FZBA 3THDA 2Y38A 3LFIA 5AC92 1PPJD 3HE5B 1AR72 2QQLA 1H1AA 3RGUA 1YJWP 1RVF3 1YHFA 2BFUL 3I2HA 4HSJA 4Q4V2 4XBQA 5HCBA 4AVVA 4HANA 1ASJ3 2VZTA 4C0BA 3PLNA 2JE8A 3D6EA 2O1JA 1HB2A 2DUOA 3H6PA 4XFFA 5A3LA 4Q4W1 4AEKA 2GALA 1OSGA 4IE0A 4PIYA 1GNZA 2WNEA 4YGEA 3EB7A 1WCDJ 4ASVA 1YI2P 3CMEP 2D5HA 4M0NA 1X50A 4HK8A 1EPZA 1AR71 2GC1A 1SLIA 4YZ2A 1G86A 5APYA 1AL21 2XJQA 1IFDA 2K46A 3JB8A 3GBFA 1W6QB 2RKLA 1OZHA 4P02B 3PUHA 5FZKA 1BGYJ 1PL5A 4COUA 5KXDA 2F4PA 2NPIA 3SCGA 1AYN1 3CU7A 5DPNA 4N7UA 4X8PA 2Q8DA 4XXPA 1X8EA 2QDNA 5A6XA 3RK3E 4TLGA 4QHZA 2W90A 5A7WB 5F3GA 5IWFA 4CUCA 1H9WA 1Q8QA 2RH0A 3L2HA 1RE3A 4IE4A 4MGIE 3VD7A 2IXCA 4XXAA 3G71P 1NQJA 4R8HA 2HBUA 1OA2A 3W21A 3OSDA 5FR3A 4EN9B 1MZFA 4DOUA 3KXDA 1NY71 1US3A 3VBUB 1O59A 1ENRA 3AXDA 4HMZA 2WT7A 3AP5A 4NIHA 2MEV3 5ABJB 5APSA 1W6MA 4CDXA 2G8YA 1UNBA 5T5OA 3J9SA 5IVEA 3FL7A 5FMOS 3L72D 1ZA4A 3ZSJA 4A7KA 1VBB1 4DUXA 2IBZD 2WZ8A 4CA9A 2Y26A 2E74B 1YIPA 1QEXA 1LU1A 2A45G 1QXJA 3WLUA 4Q26A 1GL2A 4EN0A 2ARCA 3JZVA 4LMFA 4HN0A 1X9PA 4OI0A 4MGZE 2W2IA 2OYIB 4GOEA 1EV12 2E9QA 3MLKA 5J09A 5H9RA 1OFCX 3WSOA 1Y9QA 5KLIC 5DUVA 3QD6A 1IO4A 3D6ZA 3H3ZA 2OYHA 4RQPA 3MIFA 1QJX3 3NV4A 2D5FA 1LTGC 1IKQA 3AEDC 2HBTA 2OW4A 3P3NA 2JG9A 2WWJA 3PLQA 3T2OA 4XFCA 2LM3A 4UFHA 5JOYA 1CONA 1C28A 3SXWA 3CEWA 1W9TA 4FOQA 3NKGA 3PTRB 4YZ1A 1AVOA 1RUD3 5EYXA 5CA6A 3Q5SA 3BB6A 3WDUA 1OUXA 2FYUE 1YUDA 2VVDA 3V2NA 2Y0OA 4KU7A 2O01N 3IN6A 4IL6H 4UW3A 4NIIA 1RUG3 3L73G 1RMU2 1QU0A 3U1CA 4YW5A 3MDPA 4ES8A 1IZNB 3VYIA 2Q5TA 2B7YA 5E79H 4LKEA 2W6BA 1RMU3 3ES4A 3GHNA 2O8OA 4CEYA 5FZLA 2B87A 1ENXA 3K3NA 1CQ9A 3HNMA 5AW9B 1H2KA 2W95A 4LOTA 3FHQA 5F3IA 1SFCB 5F5QA 1TE1B 2A06G 5KAIH 3BALA 3E5XA 2BCCD 2I07B 4DQAA 3VOPA 1R1A1 4M3LA 1RXGA 2V7QJ 4YG3A 3WR0A 3OBTA 2RMU2 4NIGA 2XL7A 3I3BA 2BJSA 4BH9A 1U57A 2O01J 1DIWA 1AFOA 5FYZA 5I0DA 4LBQD 2H89C 2N1TC 1G9BA 1QL2A 3I2FA 3O5SA 4GH4C 2A1XA 1H1MA 3POBA 5E8AA 3VBUC 3ZIXA 4NRPA 2YKQA 1N7SC 3DV8A 1WWYA 3BTYA 3L75J 1NTZJ 4JPZB 1F35A 1MZ6A 3OBRA 3OUIA 4Q4V1 4QPIC 1I1EA 2L91A 1ZZ7A 5AW0B 5JPMB 1KILB 3OD4A 2KSJA 5ACA3 2H6BA 4HBNA 1KC8Q 3WZ1A 3VBRB 1L0LG 2GA1A 3VP9A 5HV0A 5FZEA 2B89A 3F2ZA 4A7PA 4AGRA 1HN1A 4GWNA 4AYUA 1GWMA 2BBAA 2YFZA 3AJYA 2O1KA 3NXSA 1HV1A 4RJTA 5KJ7A 2WNVB 3OY8A 4B29A 4B7KA 2XJPA 1AVYA 5DAVA 3WT3A 4PQ9A 2W5FA 1JTHB 2RS11 5LRRA 4I2OA 3AE4C 1FZAA 5J98B 4WVMB 3MZWB 2OKXA 4IUGA 3ZXEA 5JXHA 1SQXG 2P1BA 1VBA2 2RHPA 1UF2C 1PVC3 4E2SA 1GL2D 3L70J 1WW7A 1J3PA 2LALA 1NE4A 5KHGA 3MW4A 2I8DA 2ZGUA 4ISQA 4LBJA 4W50A 1RUH2 5JOWA 3GZTB 1W3XA 2YIUC 2ZGQA 4A4AA 1MR5A 3T3YA 3PNAA 5FLHA 5AW8B 3RYRA 4CP2A 3FUQA 1UIJA 1BJQA 1CVNA 2ZX1A 3FMGA 3WINE 2C9NY 2N1TB 4RSUA 5T5JA 1R5LA 1LT9B 5FZHA 2BP6A 3RK3D 1KRIA 2KLVA 2WS92 3ZLIA 1AX0A 5KLVK 5AW4B 1PK6C 1WMKA 3HBKA 4P08A 3ETQA 3CCJP 2ZJSE 5IK4A 5J7MA 4AVAA 5AFEA 3O1UA 1HRV2 3LDRA 1MS4A 2OYHC 5EV7A 3I3MA 1Q90D 2YU1A 2WVRA 3WD5A 3NRUA 1RUG1 3LW5H 2Q1MA 1BCCG 5CFCA 5H2FH 4YW7A 2Y6KA 3GW6A 1AJYA 1LRHA 5FP8A 1YBKA 1N73C 1H30A 4MHRA 1JXNA 2HKXA 1IC2A 2FMDA 3I2JA 5FZ3A 3MPPG 2OYOA 3BVHA 4Q4X3 2X05A 5AVQB 3CCMP 1VJ2A 1VRH3 3I2DA 1KN7A 1W8HA 2NQYA 3RI9A 3IR9A 4Y99C 1QDCA 4H0LD 2CTVA 2NN8A 3AVSA 3ST7A 2QSIA 2LKMA 5AW2B 5A70A 4ZMDA 1HX6A 2RG4A 2W0XA 4H0LB 1IQDC 3LEIA 1YQ4C 1KILC 4E2QA 4AI8A 2XVGA 2YXSA 4C1XA 3POIA 3GGLA 3N9LA 3WCSA 3WDYA 4XFJA 2FXOA 1ODNA 4XUQA 4EYYQ 2VNVA 4KG0A 4PLOA 3VLBB 1SQPJ 1LHNA 1QKQA 2GZWA 3VZLA 5F8PA 4KJMA 1QMJA 3VN0A 2GMEA 1QH7A 2K88A 1WA4A 5GJ6A 1QQP1 1FOD2 1VAVA 2Y9YA 2ZGTA 1T6GC 3NNLA 1S4CA 2WT0A 2VUCA 4JCKA 4Z8BA 4YSFA 3VHRA 1WMFA 3IPVA 4Q0VA 3U1XA 1Q86Q 3LIGA 3M8LA 1YWKA 3DKWA 4UFKA 2VW2A 3ZN5A 2E63A 3IMNA 4BLJA 4JGZB 1RUOA 2EXIA 2VJXA 4LK7A 1QGLA 1HJFA 3JC22 2WIIB 1UY3A 4Y33A 3ACGA 1PMJX 1SQBD 2ZT9D 2OTLP 3ZDMA 1YI9A 2JEMA 4QB1A 5JSOA 3ENRA 2AEYA 3L71D 2DURA 2GP3A 3TN92 3LE0A 1P84E 3RZMA 3ACFA 2PHFA 4Z92B 3BTZA 4FTBA 5L7OA 3ILRA 4JKMA 1KYOE 5IAXA 1C5IA 2XL9A 1JMUB 2IWGB 4A2UA 3APBA 3CWBD 1G2CB 1VDFA 1X36A 2W94A 1GNHA 3H1LG 2NZ2A 1S0EA 3LA2A 1CAVA 4XJ9A 1RE4C 2P58A 1H6XA 1GQGA 1Q43A 1W6NB 2ZGRA 3M2MA 3M0DC 3CC4P 3Q9OA 4FPHA 4IV1A 1FOD1 3U11A 4DXTA 1CJPA 4LQRA 1N7LA 1WCSA 4ZXEA 1ZRIA 1ZRTE 2HEYF 4S2GA 1M1KQ 1AR61 2VNOA 2YV8A 2QQJA 4JDOA 2R042 5IAVA 3T0AA 5FCCA 3ETPA 3OYWB 1HBWA 2J1EA 2IYPA 1LP1B 3MV01 4KGGA 4NROA 3WDWA 4P9YA 1TME2 5EWSA 3J7MA 2RS32 4XFGA
chains in the Genus database with same CATH topology
2R5BA 2FZ2A 2P34A 2PHRA 4O9GA 3AMMA 3HIFA 1SLBA 4AVTA 2HWF2 2ZGNA 4XE9A 5HCAA 3SLIA 3HE5A 2WSEH 4RGGA 5GZCA 3IDBB 1XTGB 1D2QA 2R32A 4IXLA 1C8M2 1ND3B 1K5MC 1U5YA 1NKNA 5F6LB 3ZXDA 3II6A 2WINB 2Y0IA 5EFUA 1KFUL 1PO22 1R092 2RJKA 2H6CA 4LR4A 4I2LC 4RHV1 4I0WB 1DBNA 4AEJA 1OQ1A 3FJSA 1LEDA 2Q8OA 2N7GA 3P7KA 4LGDE 2R071 1HGVA 1BEV2 1ENSA 1GQHA 2A71A 4LLFA 1J58A 2B9UA 2P3JA 1HJBA 1EV13 3AMNA 2VY0A 5GM0A 5I8YA 5JPNB 2DFCA 2C9AA 1MQTA 4JYBA 2ZPXA 3D4KA 4L9BA 1CPNA 3L2YA 3TRSB 1ULFA 1PFIA 5CCGD 4FPJA 1RUF2 2HJIA 3BRTB 4JGZC 3JBG2 1LESA 3RK2D 4TWTA 3VBUA 1ZZ9A 2W08A 4XBLA 2PLV1 2VNGA 1JY2O 3INAA 2K2SA 4GMP0 3P32A 2OUJA 5FRAA 1X33A 2ENRA 2PAEA 3RL0D 4AYCA 1U5IA 1CX4A 5C4WA 4IETA 3AP9A 3PVEA 5KJ7C 4XFIA 3VBRC 3H50A 3NV2A 4URTA 2R1DA 3VKOA 5KHKA 1LR5A 3VKNA 4Q4W3 1H8TC 3KD4A 1BBT2 2WJSA 3P8CE 3PVBB 2BPA2 4CTEA 1CD3G 3NV1A 4WY4A 2CPSA 4GH4B 4Y20B 4GB31 1ND3C 4OZXA 4E9KA 1RB8G 3HD8B 1WLCA 5C33A 3BOPA 2CWSA 4YVWA 1MS8A 1AXKA 2D44A 2ILMA 3EQ2A 4LO8A 4IV3A 4L2NA 2DCKA 1XNDA 1NY72 1APNA 3IDCB 4WY4C 4INDA 4HVRA 1S0FA 1WBLA 4GULA 4CEYB 4LE4A 2BTVC 3AYAA 1A78A 3ZFGC 4RR3B 3MTUE 1QJX1 1LHOA 5D8AB 4LBOA 2A6WA 4R52A 3VDDB 3WUDA 5BYNA 3MIBA 4S2DA 3VMYA 3VHPA 5BV6A 3IT8A 5AW5B 5AVZB 4AG4A 5AFBA 5LK7B 5DUWA 1F9KA 1UAIA 1VBB3 5JZGB 2ZMKA 1CR7A 1EV11 2PAMA 3U1AA 1D0GA 5F9TA 2A45I 4HYTB 3R4DB 4NHKA 3PVOA 4W6WA 1KILA 1REEA 4CRQA 3V2PA 2RS12 4WVVA 1RUJ2 3K51A 3W59A 1RF0C 2X5IC 2ZX2A 3MPBA 5JR7B 4BYYA 1LTIC 2GN3A 4M3CE 3DL3A 4GKYA 1VBC3 2C0XA 3OY8B 4DXZA 4N43A 4XFHA 3WMM0 2GU9A 3NWKA 4Y1YA 1JY3O 4WVMA 4NHLA 4S2HA 1LOCA 2UURA 4B8EA 1RUJ1 4Z2WA 1AXZA 3DUIA 2D6KA 2HWB1 2RR11 3WP6A 4FPYA 4YW4A 4OH8B 1S2BA 5CHXA 2VMIA 4OLLA 5CJ0A 3M1HA 1H8TB 4B4QA 3RL0C 1SBEA 4GQ7A 1OQDA 1GTWA 3ZFGB 1LJ7A 1LTJA 2HWD3 4Q4W2 4DB5A 3FUOA 3RK2B 1M06G 4M01A 4EV0A 2WNUB 2NPSD 1D2SA 1Z78A 3ECQA 3MLJA 1ZRRA 2QQPA 2QKDA 2DU0A 4AFBA 4BZ4A 1O3QA 3LOIA 5K9YA 1URXA 4FPOB 3UKNA 5JOZA 1DZTA 4R9BA 1NCRB 4JC1A 1LTJC 2A3YA 5L19A 1NHLA 1PM7A 4LO6B 3VDDC 2TEPA 4QPIB 1MEC3 3SH3A 2D98A 4RGAA 4XF1A 3GBGA 1SDWA 3RI8A 4JYCA 4YVWC 4B3NA 4LE3A 2W27A 2UYAA 3UK9A 2Q5UA 1LULA 3O7OA 4YNIA 1GZ9A 5C8CA 3V0BA 1RINA 1S0CA 4AHZA 2YMZA 3DF0A 3OJAB 1TNRA 4F7ZA 1IS4A 2PLV2 4XTPA 2X5IB 4YGCA 2QDRA 4JAAA 4EJRA 2XWJB 2P2UA 3WHTA 3LIEA 1UKGA 1IS6A 3AP7A 1IFMA 3W58A 1FMD2 3ES1A 1D4M3 2RJLA 3HTKA 1SBDA 5C8CC 4K40A 1OOPB 3GF6A 1RVF2 4BCUA 1GW4A 5FO8B 3RYKA 5L7OB 3AX4A 2K0GA 4QPGB 1BEV3 3EO6A 4CDWB 1UCXA 3JCIA 4E2QA 2QZ3A 1VAMA 1LOAA 2NMOA 3E5UA 1RC6A 1HTLC 3NTNA 2XJSA 4XEZA 4Q0QA 1QF3A 4LHNA 3NAPB 1ZVFA 1CSBA 1EAH2 2XDJA 4NVPA 3OYWA 2QVSB 4BLIA 1X8MA 4IEOA 3ZFEA 3MGNA 2HLOA 2A73B 2ZHKA 2AZ5A 4MXWB 4K7JA 4IL7A 1PZ8A 2XKOA 1PIV2 2TUNA 3GHGB 1N1YA 4K1YA 4KHXA 1V70A 3WG3A 1W2EA 4Q8KA 4ORFA 4AI3A 2XLAA 1RL3A 4PQ9A 1NTZK 5AVVB 1EY2A 4Q4Y3 1C5HA 2C9LY 2HWF1 4RL7A 3HT1A 5BNPA 2XBO1 1WMEA 3BATA 1QJX2 3AKRA 1RUC3 2NP0A 1PVC2 2JECA 4IEQA 4QD2A 2EAAA 1ND3A 1F8VA 4Q8LA 1TME1 3RMXA 1S2KA 2PA7A 1IS5A 4LA2A 4META 5CU1A 2PP6A 3HRNA 1CPMA 1N7SD 1CAUB 3AKSA 4UBHA 2HWE2 1IK9A 1LODA 1NOHA 3AYDA 4JV4A 4OI4A 4MXVA 4ZKTB 3H7YA 4AHYA 3A2AA 3LSDA 2IZWA 1B35C 2JENA 4XQ4A 2VRSA 3CO2A 4XW3A 1IQAA 4SBVA 3MD0A 1LWUA 4AVCA 4XILA 5JLVA 5BNNC 1H88A 1SLQA 2NM1A 2R1BA 1ULGA 1DQ1A 3WR0A 4LBQA 4XFBA 2W39A 4XJZA 4D69A 3MW3A 4OHWA 3BASA 3IBMA 4Z82A 3R4UA 5JOXA 2ZZJA 1H4GA 1LWUC 1GYKA 4MGYE 4FXGB 1QJU2 3CL1A 4K6BA 5C4WB 5LEKA 3LKJA 4HPKA 4QHBA 1A02F 1NE6A 2JJ6A 5KHJA 4N78E 3VBOB 2G9FA 4NO4A 3V65A 4ASLA 1YFUA 4N43C 1FMD3 5CBLA 2MEV1 1FZCA 1MS9A 3WDXA 5DZEA 1FOSF 2DCZA 1LEMA 1KITA