2R32A

Crystal structure of human gitrl variant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
158
structure length
140
Chain Sequence
RMKQIEDKIEEILSKIYHIENEIARIKKLPCMAKFGPLPSKWQMAPPCVNKVSDWKLEILQNGLYLIYGQVAPNAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Assembly and structural properties of glucocorticoid-induced TNF receptor ligand: Implications for function.
pubmed doi rcsb
source organism Saccharomyces cerevisiae, homo sapiens
molecule tags Immune system
molecule keywords GCN4-pII/Tumor necrosis factor ligand superfamily member 18
total genus 32
structure length 140
sequence length 158
ec nomenclature
pdb deposition date 2007-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2r32A01
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r32A02
3KQGA 5AW4B 2E42A 5APTA 3NXSA 4GIQA 1KD7A 4MXVA 4QQOA 5KC5A 1G2CB 3B93A 4QQPA 3VN0A 2WT7A 1SLQA 2QM7A 3P32A 4N90A 1JUNA 1A02J 3ALQA 4J6GA 4MXWA 5L36A 5CMZA 1GTWA 4KGQA 5KWRA 1ALYA 2XZRA 3HE4A 1GU4A 1PK6B 4KHXA 3T97A 3M0AA 2WT7B 2XV5A 4NN0A 2Q5UA 2P7JA 1HWTC 4EN0A 5BNQA 1IQAA 2X29A 4KGGA 4E4DX 4I6MC 2P2UA 4LC1A 2Z5HA 2KP8A 1C3HA 2JG8C 3AB0A 5AVZB 4RSUA 2HEYF 1DU3D 2AZ5A 4MSVA 4AUWA 5APYA 2ZJCA 1X8YA 2VRSA 3HE5A 1A02F 5AVVB 1RJ7A 4RESB 2ZPXA 2O0OA 2E7AA 2H7HA 3VYIA 1DH3A 1CSBA 4C7NB 1GU5A 1XU1A 2ZFCA 4KG8A 3I5CA 2BASA 3TWIA 4F3JA 1OWAA 1SP4A 3L36A 2R3CA 5AVWB 5AW9B 2RJKA 1D0GA 3SWFA 2Q8OA 1CI6B 4DOUA 1JTZX 5KC6A 4TSVA 3HTKA 4JYBA 4DZOA 1IO4A 5AW2B 1JH5A 2Z5WA 4DB5A 3LIEA 1GK6A 3TYJA 4GKGA 3L37A 3QD6A 4XE5B 2HEVF 2WNVC 4G4FA 4G3YC 1YYCA 2Q7CA 4AYCA 2WTYA 3TNUB 2JG9B 4M3LA 1H89A 3UIAA 3L9JT 2Q3IA 4C7NA 1H88A 5AW8B 2WNVA 4D7YA 2TUNA 2WWWA 2XU6A 1FOSE 5APQA 3A2AA 5AVRB 1RJ8A 3M0DA 2WNUB 3KDPB 3FC0A 1CI6A 2R6QA 2QE3A 1HBWA 1NWQA 1WCKA 3WD5A 3M9BA 5AW0B 1S9KD 3MI8A 1CZQA 2C9LY 5AW7B 2WPRA 2JJLA 4AQRD 1S9KE 3VMZA 3A3YB 1OQEA 2OIIA 1NAFA 5AVTB 2QDNA 3V4QA 5APVA 3VMXA 2JG8B 5APUA 5APWA 3V5BA 4B86A 4OUSA 3P7KA 2IPPA 1A8MA 3HE4B 1PK6A 3VTPC 1GD2E 4QPYA 5AW5B 1PK6C 3URFA 3IR9A 3P8MC 1FAVA 1GK4A 4I2LC 3L35A 1DG6A 2JG8A 2P67A 2R5DA 1O91A 1T2KD 1U5XA 2KA3A 3M9HA 3B8EB 5AVSB 1D4VB 1GR3A 3IT8A 5CIRA 1OSGA 3MGNA 3HE5B 1FOSF 2E43A 2W27A 3TNUA 5APXA 2W6AA 4C46A 3M91A 1OQDA 5L19A 3QBQA 1C28A 1GZLA 1H8AA 2JG9C 2WPQA 1JNMA 2WNVB 5AW6B 3VMYA 1MFZA 1OXZA 5APSA 2Z5IA 1MUUA 5AVQB 2YO2A 1HUCA 4OUMA 5AVUB 2ZXEB 2YNYA 3NTNA 4GT1A 5AW1B 1T2KC 4QQ2A 3O8ZA 3V56A 2WPSA 3NFQA 3TK1A 2C9NY 3A7OA 4HYTB 2Q1MA 1U5ZA 3NMDA 5AVYB 2JG9A 1J2JB 2HEWF 2WNUC 2R30A 4QQLA 1S55A 4E4SA 3MD0A 2QM8A 2RJLA 2RE9A 2TNFA 3LIDA 3B94A 1I9RA 3A5TA 3LKJA 1TNRA 2R32A 5AW3B 3ME2A 3OAKA 5TSWA 4JYCA 3V4WA 4QQHA 1MV8A 1D2QA 5AVXB 4EOTA 2N9BA 2R5BA 1KXGA 3M06A 3K51A 1KQLA 5HBAA 2WNUA 1HJBA 1XU2A 4HT1T 3B9IA 1U5YA 3K48A 4MXWB 4OULA 4TWTA 1TNFA 3TYYA 2YO3A
chains in the Genus database with same CATH superfamily
5FP4A 5FRAA 3EQ2A 3H1IE 3H1HG 1K5MC 1V0AA 5CNAA 5JIAA 3SLIA 3ZFEC 2WT7A 3VV1A 1GQGA 3U10A 1GZWB 4Q1RA 5EP9A 3B5ND 2HBUA 1ZA4A 5A3WA 1NLRA 4X6QB 1GNHA 4AEMA 1LR5A 4Q29A 3FE5A 2J1SA 3M0AA 4BXLA 2XV5A 1B35A 2C26A 4WM7B 4XFFA 3RDIA 4EN0A 1SVFA 4IL6X 4YW6A 3I2JA 1RF1A 2NMOA 2MKVA 1HRI2 2WQZC 3PTRB 2WSEJ 2QQNA 3H1KJ 4NHMA 4AEJA 4H44D 3OBRA 2ARBA 3CX5I 4K9SA 3WCRA 1H4GA 3ZFEA 4YM2A 1RJ7A 3VBOB 1WKYA 2QUOA 2FYUD 1OVRA 3L71J 3H1KG 5FMDA 3C8VA 4AGVA 2VM9A 1DH3A 2LUWA 1JUHA 5KKZB 1SLAA 1L0NJ 3T97B 1K5JA 4CA9A 3I5CA 1RQUA 3IDCB 5FZHA 3KF5A 1CZSA 1CZVA 4E2SA 3R4DB 1POV0 1PZ8A 2XDJA 1W6OB 3D4KA 4B4QA 3LDKA 2UWCA 2LM3A 3DPRA 4QB1A 4JYBA 1RHI3 2R071 2Z5WA 5FY7A 2XJPA 3JD71 1URXA 3VBHA 5BV6A 4QDSA 3B5NB 5ISLA 4GKGA 3KD4A 3QD6A 3WG4A 2HEVF 2JX9A 5ACA3 1ZRTD 2RKLA 1IFNA 2JG9B 4QX5A 2B9VA 2A45I 5FBZA 4RL7A 3S4RA 1SFNA 3NAPC 1XYNA 4W7ZA 3ZLIA 1RUC1 2CK3H 2XWBB 4WB4A 3L73J 3N7MA 1BMV1 4NUBA 1NH4A 5AVRB 4ZONA 5FY5A 1G1JA 4CYDA 4JAAA 1RE4C 2YY1A 1RE3A 1R5LA 2RR13 2YV8A 2XJQA 5BNOB 4E2QA 5C8CB 2QDNA 3L2HA 1GICA 2B9UA 3CXHD 2VQUA 2WDBA 2W90A 1N2DC 1SPPB 4FPJA 4UW6A 4PI0A 4XAEA 4YVWA 2VECA 1OURA 4BMEA 4K3AA 5GJ6A 1ODNA 1W04A 3OOXA 3II6A 4IE5A 5JUVA 2ZA9A 4P9WA 4XA4A 2I2SA 1GD2E 1VBC1 3BU7A 5AW5B 4QPYA 4WM7C 1J3PA 1QQP1 3IR9A 5KJ7C 4H0LB 3K46A 5BNOC 2PHXA 1PPJD 1GL2A 4M0NA 4V1PA 4DIQA 2H89C 1CJPA 1EZVG 2KA3A 1JMMA 1SQBD 2WWSA 2ZHLA 3B8EB 3LQCA 5J3UA 3UNPA 5FZOB 3J4UH 4GMP1 3E7KA 4D6TE 2W1SA 5FPBA 2AEZA 1UNBA 2RM21 1HIXA 1DYKA 1SQVD 4GWNA 1WLDA 1RUF2 2YB7A 1RUH1 2G8YA 1OW8A 2FZ1A 2IXCA 5CYYA 2ZABA 4O65A 3T2OA 1AL21 2WNVB 4H0LC 1S0CA 5T5LA 4JQ0D 1NCRC 1R092 1E5SA 5ACA2 2H43A 3LGRA 5CA6A 3H1HD 5JSPA 2UURA 5JIUA 2BV4A 3I59A 1FZEA 3H1IG 2ZGSA 4QQ2A 5D1IA 4NIHA 3L2YA 2DUQA 3IB3A 4UB6H 4XDOA 3N9LA 3HN3A 4YZ3A 5KKZC 3T4VA 4RGGA 2EIDA 2WZEA 2B88A 3EYPA 4HANA 4YZ5A 2RMU2 1KEXA 4NE9A 3HWJA 4PJ0H 2JB4A 2HWC2 1W0PA 4COZA 2VOXA 4P9LA 4C0BA 4XC9A 1VIWB 3PHMA 3R4SA 5LK7B 1QX8A 1ZZ8A 2M5AA 5ANNA 1JY2N 1JTHB 5IVBA 1GP5A 1UZZA 4N7IA 3AFGA 3L74J 2M0BA 1CAWA 4Y5Z0 2HG5D 2B8MA 3QH9A 5L9RA 1NVOA 2Z79A 4Z2WA 1YIJP 4OZOA 2GH8A 1TG7A 5JAXA 4Y1ZA 2AENA 3NJZA 3O5SA 5LW9A 5CBNA 3ZN5A 1NKNA 3USSA 3AMPA 4XUOA 1VBB3 5SV5A 2JDNA 1Q8QA 2QSIA 1YI7A 4AEKA 1AYM3 2FCTA 3I3EA 3GZTB 1GTWA 2ZX4A 2GP5A 2IXIA 2Q5TA 2QQWA 4R4MA 4WVZA 2ZGNA 2FYUJ 2RN0A 4ZNCA 5GLUA 5T50A 1WUVA 5BNPC 5EFUA 2WT7B 1UKRA 3D6ZA 1NY71 2ZGOA 3RRDA 4CDXB 1GWKA 3AP9A 3E1IA 2CSGA 2QQVA 1PIXA 3BIWE 3K4DA 3K77A 5FY1A 3MW2A 2A6VA 1T3UA 3GCWA 4TTGA 2BEQD 2DFBA 5AVZB 3HRNA 5DZFA 5JPNB 1UIIA 1MEC3 1RUNA 5A32A 5DUUA 2WZPP 3WLUA 2LXBA 1QNYA 1W06A 3M4FA 1VR3A 1W6MA 4C91A 5JCTA 1SQVE 2H88C 2H7HA 1GOGA 2ITAA 4PD4I 1AQ5A 2RR12 4ONUA 1XU1A 4Y3OA 1PGOA 1KS4A 1RUC3 1N73C 2XKOA 1CPMA 2Z69A 4IEYA 1SP4A 3OUIA 1NG0A 4LMFA 4NHKA 1AR61 1K5MB 1QJU3 2WIIB 3I49A 1CWPA 2BZDA 5FDBA 4XUPA 2WFF1 4Y22B 3VP9A 4NRQA 1ZRDA 4I7ZB 2DDUA 4XMAA 4LKSA 4AFMA 3LIEA 2W2IA 3H1LJ 1LOEA 1RUG1 3N7JA 4P02B 1TU3F 5FLJA 3TYJA 2VTXA 3VKOA 2JR8A 1S4CA 2P3YA 2DV9A 4XJ9A 4YG6A 4JV4A 4XETA 5DG2A 5JR7B 3HEIA 3WF2A 5CFCA 4Z2AA 1H88A 2DFCA 5DXDA 1S2EA 2OS2A 4FQ4A 1ENQA 4ASMB 3TOJA 1WA4A 2LS6A 3CO2A 4INDA 5IVYA 2R0FA 5GZDA 3G7DA 4GMP0 3ZXLA 3M7AA 3CJIA 2XNXA 2VMCA 1SQVK 2R042 1OUSA 1ZBE3 1S9KD 1I1EA 2ZYAA 5AW7B 1W9WA 3AP5A 5A6QA 1XB9A 1K05A 2ZT9B 1MZEA 1BCCD 3MUY1 5FPAA 1PX3A 1LULA 2RVAA 3QACA 2VMGA 5FZIA 3V5BA 3MPBA 4ITCA 4M4PA 3ZFGB 2WYSA 3VTPC 5C3OA 5C4WC 2QKDA 4I3PA 3RVHA 2EALA 1P84H 3P1IA 4KWJA 1I5PA 2G19A 5FP7A 3S0MA 1UW8A 1WW6A 4XDQA 5H2FE 1O91A 3LW5H 3I59B 4FPCA 4LO4B 5FXZA 4AXOA 1UAIA 1RMU1 2IBZD 1EXJA 1WT6A 2X10A 1EAH2 4MGKE 3U11A 4A6SA 5B2GB 1WW5A 4YFZA 1NGMB 1G1IA 1CD3G 1AFOA 4PCRA 2HR3A 2J1VA 1UO9A 1IFJA 4YGDA 2OKXA 1GZLA 2X05A 5HXMA 3WQ0A 4PF5A 2D40A 2DVAA 3AYDA 3PIJA 4ASWA 3ZYHA 1A34A 1Q2NA 1XNCA 3H1KE 3OBTA 3VMAA 4AWDA 1FJKA 3WHTA 5J09A 1LHOA 2HWB2 1HH0A 3RZHA 2YNYA 3W20A 3CWBD 1S5LH 3FZ3A 3H1JG 4PF1A 5KJ7A 2KLVA 1WMKA 3WY6A 4UAPA 4WM7A 2C9NY 2XB6C 5A7WB 2XBO1 1KB9I 1W2NA 5FOBB 1COV2 1V70A 5DAPA 3AP6A 3RQ0A 4GKYA 4YZ4A 4AI9A 3WMM0 4DY3A 4IV1B 3HNYM 4YW2A 4CP0A 2R30A 3N7KA 1GKBA 1SQPK 3HD7C 4LA2A 3UYJA 1YQ5A 2Y6KA 2YUEA 3I2GA 1Q82Q 3BYWA 1G86A 3V6IA 2RS52 1RE4A 1NUKA 3PU8A 3U4SA 3T0BA 4OCTA 1E57A 2YFUA 3CMAP 1SQXK 5IK5A 1RUI2 4NIGA 5FZCA 3H8UA 1HGZA 1HV0A 1BCCE 2DF7A 2VZPA 1H0TB 3CX5D 2Y64A 3MYXA 5A80A 5A3MA 1NOVA 1BJQA 3IAOA 2WINB 3ATGA 4Y99C 1KYOE 1NCQB 3JB8A 2EAKA 2BTVC 3KCCA 3EXUA 3R4YA 4EDFA 4QQPA 3MTUE 3AJYA 1NE6A 3RGUA 4Q4V3 1PZ7A 4CU7A 2AH2A 2QA4P 1WWYA 5B5EE 3QH6A 3POEA 4WVMB 2UWJE 3HN1A 2ARCA 1L2PA 3A23A 3SKVA 3MIHA 3USUA 1BGYE 1VBD3 3ZFFC 2E74B 2KXPB 3L75E 1VQKP 1AR83 5A3UA 3KF3A 4I6MC 4I1LA 1PO12 3OSDA 4HETA 4IESA 5FZ0A 3VZOA 1PGJA 3AKQA 3GGLA 2YKQA 5FZDA 4ZU5A 3FMGA 3WINE 3WG1A 1OPMA 2R062 1KILC 2GMPA 1T3JA 2XHKA 2VCBA 3H1JJ 3VDCA 4QMAA 3WR0A 2WT0A 1LTAC 1HV1A 1RUE1 1SFCB 2Q8EA 2BOIA 1ODMA 2V7QJ 3NVCA 4XCAA 1QIQA 1N3PA 1MS1A 5KLVK 4JGYA 4KMQA 2Q8OA 1SFYA 3VZJA 4AEDA 4ET7A 5KXCA 1W2TA 4MGIE 2KIKA 1PVXA 1SQ4A 2F4LA 1SQPD 2HWF1 2IVIB 3MIBA 4YVSB 4DOUA 5CCHC 1AX0A 3GZUC 5FMOS 4RKUJ 3N9OA 4R4ZA 4CSWA 3ACHA 1BSNA 2C0ZA 1J1EB 4AHYA 1H6XA 1GP6A 4NIIA 3M9QA 4QD2A 3UIAA 4FCAA 4B4RA 5FUNA 4MO3M 3POFA 3R0RA 4CDUB 2WSSH 3MFCA 3CX5E 1O4ZA 1L4AA 2E5TA 2FBEA 3JUUA 4LR4A 3SH5A 1AQTA 5C3PA 5I0SA 4I30A 1VBA1 2O8OA 2WNUB 4KNCA 4XHXA 2WFF3 3B02A 3TB0A 1CI6A 4AAXA 2R6QA 1T2XA 1NWQA 5D8AA 2HODB 2PAKA 4NROA 5FYYA 3ZXDA 5KHIA 2PAJA 3KGZA 2WC2A 1VQLP 1LOFC 2WPRA 1V00A 2ZHNA 1US3A 4K40A 4GALA 3IIIA 5L9VA 1FZGA 3ZN4A 1DQ2A 5JZGA 2MJZA 1GWLA 3LB9A 4BMBA 1E5HA 5L7OC 2PGDA 1VQ6P 1VBA2 4B86A 1VQOP 1W0OA 2A3YA 1VAKA 1XTGB 1KTMA 3RBXA 2VBPA 5F3GA 3TEYA 5F6LB 5HCAA 1UOJA 4I0AA 3URFA 3WP3A 2RS33 1N7SD 2HKXA 2WS93 3I2FA 1V6LA 1GQHA 1FXZA 4NPEA 2AREA 3T1LA 1L0ND 1GMMA 4RGKA 4BXSV 4BRYB 4COWA 1BEV3 3CNAA 4S2GA 2FYUE 1FOSF 5A7WA 5I8YA 1XRUA 2VZ1A 2ZXQA 2W6AA 3GF6A 1EV11 3B4SA 1LTIC 3WDXA 4DXTA 4LBNA 1JNMA 1UPIA 1LHNA 2R16A 3L75J 3CQOA 2PQSA 3LAGA 5FPVA 5KXBA 5FZ6A 4EN6B 2OYHB 3ZIWA 2JDHA 2W47A 2YO2A 2Y6FA 4MYEA 4OUMA 5C3QA 4W6YA 2VD7A 5DN2A 1HW5A 1EP0A 1OLRA 1QMJA 1U12A 1VPCA 1FX5A 2EICA 3PVBB 4N53A 4QX3A 1KRIA 3HD7B 4P9GA 1XNAA 1YHQP 4Y5SA 4DFSA 5A33B 3A7OA 3RG0A 4DY5A 1J1LA 1U5ZA 2RV9A 4G9SB 3B69A 1PVC2 2ADDA 3F89A 3ZXGA 1MQTB 3U1CA 1QHDA 1YC61 1ZZBA 4CCOA 4DMIA 2QM8A 5A1FA 2RDRA 4Q4V1 3B94A 5M1BA 2QDRA 3S9OA 3ZXEA 1CX1A 1DYPA 4ZZ8A 2IDBA 4GODA 4K7JA 3RS6A 2BCCJ 1CQ9A 3V4WA 1S72P 3AL5A 3M3OA 1L0LE 4QQHA 4BA6A 4Y1UA 1YEWA 5AVXB 4UBGA 2OXBA 3RMYA 1R8EA 3DL3A 1PHMA 5J96B 2B87A 4D6SA 1KILA 5BNPB 1FV3A 3B9IA 3MIWA 2LRPA 1QVFO 3NKGA 5GZCA 1HXS2 2QG4A 3SXWA 3HUSA 2FMDA 5AW4B 1N1TA 3DV8A 2E76B 4LBOA 4ORFA 1RXFA 1PO23 2UWAA 4MXVA 4XILA 4BXFA 1QQP2 4N7UA 1ULPA 2J1AA 3KGLA 3LOBA 1L0NK 4MXWA 2XL7A 2YROA 3GBGA 5CMZA 1SLLA 1VRH1 3C2UA 1UIJA 5GKAC 4EIJA 2RS51 1H2KA 4ZKPA 2VOVA 4FAHA 5K5GB 5FYHA 3ZFGC 1N8RQ 4S2DA 1LOBA 1W9YA 2ZMLA 4LC1A 4IUGA 1S3JA 2A06G 1SCRA 1LNQA 3EFFK 1V9U3 2F6BA 1VQMP 2PFWA 3CZJA 4UFKA 1QNWA 3AX4A 2HEYF 1DU3D 2WL1A 4HG6B 4IW3A 3ES4A 1EC5A 2VRSA 3GZAA 1LNSA 4HSJA 3VBFA 5K7PA 4XURA 4E8CA 1FZAA 3JC22 2K9ZA 4Q4W1 2FFDA 2ID4A 1H2NA 3SKJE 1LGCA 1RUJ3 4IOIH 3P3NA 2BASA 4QGLA 3RWKX 3UGGA 3NJVA 2JE7A 1F2NA 1OOPA 1CI6B 2A45H 1ZXGA 1POV1 2HLEA 2OZJA 5FWEA 1MEC2 3A0KA 4DZOA 4KU7A 4HB1A 4RR3C 2O01H 3TRSB 4AQTA 5IVEA 5AC91 3L72E 1VP6A 1N1VA 1ZZ6A 2JJ6A 2PQQA 4GH4C 4RHV1 4JF7A 2NPSA 3CD6P 1RITA 2D7FA 2WNVC 3BPSA 4AYCA 4XXPA 5F6KA 4EROA 4QX7A 5CADA 2A45G 1Y9BA 1PNGA 2K1AA 4FPHA 3PUIA 3LW5J 1GV9A 2FYUK 1XXNA 4GWJA 4AFAA 3WNOA 1HGVA 1JB0J 3AMNA 4PLNA 1AR71 1JCDA 4AK3A 1QWRA 1N1YA 1SLBA 2WS91 4A7KA 5FOJB 1IS6A 2W68A 4OQ8A 1RQVA 4IE6A 2XUEA 4Q0VA 1NU1J 1C8M2 1URQC 2TBVA 3LWCA 4ATEA 1ND2C 3JCUH 4IFFA 1Q8PA 2OIIA 3IMNA 1EDLA 4E27A 1AR63 5APVA 1QJU1 1A3KA 2DCYA 2VCCA 4B1MA 2QJKB 3GHGA 1R64A 3PJSK 1S0JA 3H1WA 3JBG2 1EY2A 1XQNA 3I3BA 1M1JA 5KXEA 3MUZ1 1GZTA 2MNGA 4OI0A 1ZP0C 5DZGA 4AHZA 1RUG3 4KJMA 2BVVA 2DBNA 2VNOA 2Z4EA 4FPYA 2BRTA 4DCKA 2Y6JA 2ZBJA 1OFSA 3THDA 2JG8A 1NU1D 3U1XA 3WT3A 2O01J 2P67A 3KZIH 4O9BA 3ZYFA 4U36A 4MGTA 1Y4WA 2WO2A 4CP9A 3IT8A 3IWZA 5FKBA 3OJAB 5CIRA 1F5JA 3MBWA 3Q1MA 3TNUA 4C46A 1J3RA 3JBG3 4QU2A 2WSFH 2UU8A 4RR3A 3ZKYA 4GB33 1W3VA 4FAGA 1VF5C 1B09A 4D6TJ 3KHUA 1ZBE1 2E7QA 4UFJA 2H0VA 5APSA 1LKNA 2P3IA 3SHRA 4CDQA 3OD0A 4YARA 2Y60A 5CBOA 1YFWA 4GT1A 4Y20A 1RL3A 1PPJG 1G6NA 1V6OA 2QBXA 2YFZA 2IYOA 4EJRA 3MFAA 1RUF3 3ZXKA 1OOPB 1QVGO 1OHFA 2F4PA 2Q1MA 1CZTA 2W91A 3SCFA 4AOCA 5FK7A 3FUQA 1S1AA 3LEGA 3DXTA 1DGWA 3VDDB 1BQPA 3VZMA 1DQ1A 4IL6E 1PO21 2YC0A 3V64A 2WZR3 1PO22 3IIAA 3G6EP 2AYHA 4IEPA 5IVVA 1OF3A 2P58A 3LKJA 2G9ZA 1NTME 2JEEA 5AW3B 1TNRA 3H7YA 2BNNA 1C4RA 4MV2A 5TSWA 1OVUA 1IFDA 4XFJA 1MV8A 1S4XA 2K3RA 2VJXA 3I2HA 4OI1A 1ZBA1 1ZN5A 5FZLA 5BXXA 2WRAA 5FZ1A 2NN8A 3ZSLA 1IK9A 1JHNA 3POJA 1XYPA 2PAMA 4WVMA 3WDVA 2YMZA 4HSLA 1K12A 2NQYA 4TN7A 1OA2A 3WQ1A 1OBNA 1MR5A 2C6SA 2GZWA 2EIBA 2KXLA 3MICA 2NMNA 4GQ7A 4DXRA 4BYYA 5C33A 5FO9B 1GP4A 4I3GA 3RZJA 3BCCJ 2JDYA 3ACLA 4BPZA 4MG2A 3AMQA 5KWRA 2O1KA 3S57A 1LHUA 2XZRA 4Q4W3 3OEAA 1XNBA 3T1MA 2UYBA 2VOKA 3VBOC 4XZPA 1V6JA 2Q5UA 3WXPA 2X29A 4D8MA 3WF4A 1HRV2 1HN0A 1E5IA 4D6TG 2N9YB 1SQXE 3IDEA 3KMHA 3MIEA 2X8KA 3NAPA 1LGHB 1C3HA 1C8M3 1LWUB 3PLQA 4CDUA 1L7QA 3FWNA 1ZA7A 4JKKA 1YQ2A 4AUWA 4XF1A 2GMMA 3ZYGA 2OX0A 1CIWA 5JI7A 1PNFA 1ZMEC 4UFLA 1T6BX 1AA0A 5FY9A 2XQXA 3VYIA 2RS53 2D6PA 1M57D 3ACFA 4C7NB 2NPSC 1PGSA 3BVCA 3HIFA 4N43B 4B7EA 3AJZA 4KG8A 1DQ0A 3TWIA 3VD3A 3HNBM 1KILE 2OYIB 1AR73 1DDLA 1JTZX 2XH6A 4YVWC 1H8VA 1YWKA 2WZ8A 1LTSC 3J7HA 4LHKA 3S5AA 2EXHA 5FXVA 1ST8A 4AI3A 4QT6A 4WM8B 3NNLA 4HJGH 4NRPA 5J36A 4YTPC 1I3HA 4FOQA 1JTHA 4Y1XA 2W52A 4FFHA 1AZDA 3FXDA 3L70G 2TUNA 4AVSA 2UY9A 4PLOA 3RK2C 2CTVA 4X6RB 2YGMA 5FK8A 2IFRA 2IYPA 1C5IA 1I5ZA 4P5HA 5I93A 4Y22A 3TEXA 1QDOA 5FV3A 3BATA 4CCCA 5JZGC 4DUXA 4LHNA 5ABJA 4QPGB 3ZMOA 4CCNA 4CUAA 4H44B 5CBLA 1PGL1 1H1AA 1OFNA 2HWD2 2W83C 2BP6A 5DZEA 2DUPA 4EZHA 5D8AB 1G9FA 2OTKE 4JGYB 2VOWA 5FYBA 2P37A 1XC6A 4Q1PA 4I2OA 3AP7A 1JMBA 5F3CA 3L73G 2JWDA 3SFEC 2VPVA 3LDBA 4P00B 4AG4A 4DO0A 5JZGB 3ZN6B 1GK4A 1QJX2 3SFDC 5AVSB 1DX7A 1O8SA 4RS5C 5F3EA 2W9XA 3UGHA 3ZSKA 3ZVXA 4BH9A 2R1DA 2PP6A 5HBAA 2E76C 3F5HA 3TF5A 1VBA3 2VY0A 4ISQA 1NOHA 1C28A 3MW4A 1NZIA 3J7LA 2GNTA 3PJYA 2GUSA 1KN7A 3NW4A 3JSVC 3VMYA 3VBSA 3T08A 5EHDA 1RMU2 3B5LB 4S2FA 5DUVA 2Q30A 5BNNB 1AUYA 4RFT0 4S2HA 1LENA 5GLVA 3KHCA 4Y4YA 1NYWA 3N35A 2Y9ZA 5C7GA 1TME3 5FPXA 2BDRA 3N4MA 1JYIA 4FSJA 1DF0A 2UY8A 3TEWA 5K4LA 3UETA 1NZCA 1Q5OA 3OTFA 3WOGA 2JDPA 2BOJA 2FHRA 2VZSA 3FBMA 5A6YA 1QU0A 4PT6A 1J3QA 1S0EA 2A75A 4B1LA 1L3JA 4ASKA 2GDFA 1V6MA 4HVOA 2RJLA 4E8DA 4YG3A 2FXMA 1SHWB 1DFQA 1X8MA 2D3PA 2WBKA 3G9RA 2Y33A 3D3AA 2X09A 3NNJA 4JYCA 1GW4A 4XF4A 1IZNB 4A7ZA 4CXYA 1UY1A 4YZ2A 1R083 2KLUA 1RUF1 3WDTA 4EQVA 1W8ZA 4KBZA 5FZ4A 2IXKA 1YTZI 3N36A 4YM1A 1OXCA 4XMIA 4A41A 4D6RA 4NO4A 4YVWB 4DNYA 5CKNA 5CFCC 4CDUC 3MLKA 5APTA 4JGZA 4QQOA 2YIUC 3B93A 1GDTA 1Y47A 2XDVA 5FYVA 3GM8A 4IEZA 4FPOB 4K1ZA 2VH9A 3D0JA 1EYBA 4UFHA 2PXJA 3J8F2 3ZXAC 2BFUL 2EA7A 1ALYA 5E79E 2Y34A 3I3QA 2YPDA 4L8QA 5H9SA 2QEXP 5C3SA 4PI2A 1FE6A 3ST7A 2Q1ZB 1HXS3 3OPWA 3ABZA 1PL5A 1O4YA 4FTEA 4O9GA 3D71A 3VB9A 3CMEP 3MV01 3B9CA 3IBMA 4QX0A 1HF9A 4RSUA 3I8TA 4XFBA 2PLV1 2WSVA 2WN3A 1L0LG 4MGSA 2HWD3 3MEPA 1BDDA 4OMCA 1NJIQ 2O8QA 3P6BA 4AI8A 5CVRA 1OVSA 1ZZ9A 2FDIA 3AL6A 3OGSA 1VBB1 1ZYBA 2ZS6B 5D2AA 1XE7A 4FOYA 3H1JE 2XJUA 3RYKA 2R3CA 1QXRA 4Q8KA 2ZZQA 1Q8VA 3T2QA 1NCQA 1J83A 2ETEA 1JH5A 4N43A 4D3WA 4DB5A 3BVHA 1TE1B 3H25A 4WY4C 4Q4V2 3AE9C 5LY1A 2WZR2 1AVBA 2A06D 1ZR2A 3BIEA 2KSEA 2N1TB 4BQ5A 1NY72 1DHKB 1JI6A 1X7NA 4D7YA 5IK4A 3B5NA 4K8FA 4OHZA 1MZ6A 2IZ1A 4PV1D 5APQA 2YC2A 3VHNA 4M3CF 4M3CA 1AX1A 1GL2B 3UGFA 4MADA 2QE3A 2Q8DA 4HVQA 3VD4A 1WCKA 3BODA 3WQ7A 5K8SA 3AE1C 3M9BA 3O0VA 1LCLA 3PUAA 5JLVA 4A3ZA 5EYXA 1OX3A 2CPBA 3D6EA 3LPGA 3A21A 3ZIXA 5AVTB 1LESA 1Y3TA 1QLED 3Q8CA 4Q2FA 4XCBA 3V4QA 2FXOA 2QJKC 3VMXA 3MF6A 1NTZE 4HMZA 5K0UA 1RUD2 4CCJA 2JDZA 1NAYA 4XUQA 3VN4A 1W9SA 1YJNP 2Q3EA 1LOCA 1OH4A 2GC1A 3OUHA 3IAPA 3H1IJ 3VLBB 1VF5B 1ASJ2 1F31A 1SDWA 1PP9J 1ND3C 2WT2A 4Z8BA 5KBFA 4N9IA 3NMBA 4X8PA 1R091 5ACA1 2ORZA 4BQ3A 1E5WA 4TLGA 4HK8A 1YQ8A 3RFRA 1URQA 4Q4X2 3HE5B 2FYUG 1IG3A 1W2AX 5L19A 4NPDA 5JOYA 1DP0A 2WPQA 2ZGPA 3ZYPA 5A32B 1FOD2 2XKPA 3KV4A 4J25A 4TZDA 3C7HA 4FXGB 1Q43A 3CDZB 2KI7B 3VL9A 3H1HE 3UK9A 3UV9A 3DEMA 4AQ2A 4FTSA 4A7PA 1PP9G 4HKZH 5AC92 3O8ZA 4RHV2 4M4RA 4BK4A 4R9DA 1TMF2 3D5OA 1CGPA 5IK7A 4PQ9A 4H2AA 3AEEC 4EWDA 5F7UA 2E26A 1DQ5A 1Z78A 3J8F3 1YQ4C 2D44A 4LULA 4NIAA 3W5MA 4AGRA 4UWDA 3H50A 5IAXA 1QJX1 1VAVA 4B3NA 1YI9A 1RXGA 4NOTA 5DMYA 1GUIA 3DKWA 2JICA 4K3UA 4Z1MH 1N7SB 2VZOA 2WNEA 4B29A 2NYYA 2WA4A 1L4AB 2N9BA 1IPJA 1RB8G 4GDOA 1MVQA 1RUC2 4C0HA 4FO9A 1HJBA 3NKTA 3ZM8A 5LBEA 4EV0A 3Q9OA 2WSUA 1FBMA 1ND3A 2W27A 2E42A 3QWOC 2KOGA 3V0AB 3AE7C 2ZVOB 2D97A 3ON7A 4COVA 4FQZA 2FQPA 4L9BA 2BCCD 5BYNA 2YXQB 1JUNA 1AYN3 5JR2A 1U7JA 3SWYA 3ALQA 3LEKA 1CPNA 3M70A 4IEUA 2N7GA 1SQPG 3AE3C 1YRZA 4COUA 5IJRA 5T54A 3RK2D 4D94A 2V4AA 4HPKA 3WG3A 1BVP1 4W50A 5F8PA 2D3RA 4PD4E 3VKNA 4WY4D 1KQFB 1DCSA 3CZUA 1IHMA 2G3AA 3VGIA 4JVAA 1KORA 1UQXA 3GF7A 1PZ9A 4YW4A 4YZ1A 4EN7B 5LRSA 1W28A 2CGPA 4QPGA 4DOJA 5IATA 3BN6A 2GU9A 5B4NA 1HQLA 4XJUA 2VZUA 3LIHA 2VUJA 4IL6H 2ET1A 4AAPA 3V0BA 5LY2A 4YGCA 4JRLA 2Y6LA 1UZVA 4B4PA 2Y6GA 1BE3G 1GU5A 1UZYA 2W3JA 1XBFA 3NSTA 5FY8A 3GMAA 3UKNA 4QDQA 5A7NA 1NQJA 3OJBA 1A6CA 2VMDA 1UOGA 2WLQA 1OLME 2XUMA 3EQEA 4NPMA 1W05A 4TLFA 2HYXA 3HTKA 4WVWA 3H8RA 1UIKA 1XYOA 2A3WA 3DECA 1GK6A 1LT9B 1UYYA 1N73A 2HWD1 5IFTA 3GYDA 2E5YA 1W3XA 4XFIA 2GC3A 4NWVA 1EZVE 5A3NA 5AFBA 3KQ4B 1K3IA 3E1F1 4Q0UA 2K9YA 5LWBA 2Z42A 4OZXA 5T52A 3AKTA 5HV0A 2WNVA 3L72J 3QLQA 5BNOA 5C8CA 1DEEG 1HJ0A 5L73A 2E33A 4J1XA 3A2AA 4X8NA 3M1HA 1EV13 1UY4A 3CF6E 1WD4A 1DEBA 1S0DA 2W46A 5FP9A 3KS7A 4DEVA 4YM3A 2XHNA 3A7QA 4WBAA 1DZRA 5EYYA 2JJLA 3OW2O 2Q9IA 2CDOA 1OQEA 2WO7A 4LO8A 4UF0A 4UXAA 3WDYA 5F9TA 3HMYA 4XIOA 1Q90D 1RE3C 2OW4A 1K42A 3CCQP 2VNGA 4PHZA 3QH7A 1LTBC 3THPA 2PYTA 4RFRB 1XNTA 1KDMA 3L74D 1YLLA 2VGDA 2YU1A 2A70A 2IUWA 2VW0A 2WAAA 1YJLA 4HZFA 1PV3A 1BEV2 2P34A 4Z82A 1O5UA 3PP5A 1W6OA 1NU1E 1YJKA 3OYWA 3IDAA 2ZGLA 4HH2A 1MZFA 1LRHA 2A06E 3AEGC 4OH8B 2QQJA 2BGOA 5HCFA 1QJY1 2WSFJ 1A8DA 3T2PA 3CC7P 2W6BA 1H6YA 4K6BA 4LNVA 5FZ9A 1XTCC 3VBFB 1LJ7A 4CDQB 3V2RA 4YLZA 4A2UA 1S5LE 5GTHE 2CAVA 1S5LX 2JIGA 1UZWA 3CMGA 1JMUB 3S1KA 1PMHX 3CIHA 5A7QA 1C5HA 3Q8BA 3KVBA 4W4ZA 4BHPA 4D6QA 5BU5A 3LSEA 4Q4Y2 1ONAA 4MN4C 4IE0A 3VDBA 3AYCA 2CHHA 4BWOA 1LAJA 1BLZA 5AVAA 3VBSB 1PPJE 2OGUA 3LA2A 4CCDA 1RTVA 1IKPA 2BJSA 5T5OA 3S7IA 1IJDB 3ZPYA 4UYBA 5CCHA 1KILD 4P9XA 2EAAA 2FDHA 3WV6A 5CKQA 2FY8A 2HEWF 2QQOA 2WNUC 1Q7YQ 1ZR4A 4GZ9A 3RWNA 5LEJA 1NCRA 3AE8C 3ELNA 4U3FE 1FDIA 1SFCD 1RUG2 2K9JA 5F2SA 2OYHA 4ZXKA 3VBSC 5CEHA 2HWE2 1ULGA 2UWBA 2EF6A 2UYAA 1ZRCA 1AYM2 4C90A 2ZEWA 1RYYA 5FQ0A 1D2QA 2XR4A 5EJ3A 4AI0A 2WUHA 5LA1A 4HOOA 1J1EC 2IVJA 1J84A 2OA2A 5B5EH 1LTJB 1XSQA 1SLTA 3H42B 2CGOA 3NNGA 5F5IA 4W80A 2GC2A 1KYOD 5F5QA 2IXHA 3LCPA 2GAUA 2VAUA 4RQPA 3D8CA 3I56P 3MDPA 5CAZA 1TME1 1WMXA 3T30A 4LUMA 3MUDA 4OGQD 4ZPIA 4CUGA 2D6NA 4N90A 1OA4A 5A6XA 5FUIA 2R1BA 1POV3 1BSHA 4XTPA 4CDWC 4MHRA 4ES9A 2LXCB 3ZDMA 4W6WA 1ZVFA 5EJZB 4CEYA 3IN6A 2WT1A 2V5DA 3O0XA 2P7JA 5KAFH 3OY8B 3BI3A 1KQSO 4KGGA 4E4DX 4XJZA 4ASLA 2LTNA 3AXDA 1UZ0A 4L76A 2BBVA 4YVSA 2W5FA 1KGYA 1JS9A 4GA9A 2C0WA 2N1TD 1SQQD 4UB8H 2D6MA 3JU9A 4LUKA 3OD4A 4MSVA 2ZYGA 4AVVA 4YGBA 2LW8A 4URTA 2VUDA 1KMIZ 1POQA 2PHUA 3EMRA 2CU5A 4L92A 2HH9A 4GKXA 4JDOA 4TXWA 1UYXA 3AZXA 1EDJA 3SNMA 1OWAA 3S5QA 2DCKA 5I91A 1O8PA 1BZWA 4BIOA 3G3ZA 4QHBA 2AEJA 3MP7B 1SS1A 4V2VA 1WBLA 4IERA 3CCUP 2ZHKA 3HNMA 4BCUA 5LZ6A 3L37A 2DTWA 1JY2O 1HQWA 2QRXA 1KZUB 1Y9MA 1QH6A 3L75G 5FZ8A 2W1QA 3ASIA 1H89A 3KQRA 1VL2A 5CFDB 3CI9A 1REDA 5E6HA 2BEOA 3ABVC 4R4LA 3LFMA 4LEJA 4AGGA 3BKZA 3DCQA 2XU6A 2Y0EA 3WUVA 1FOSE 2VE1A 5E79H 2PHFA 1FNYA 3M2MA 4XAAA 2OYIA 2KB7P 1JEKA 1HVVA 2B87B 2WMMA 3M0DA 3K2OA 3CHXA 3PUHA 4IV1C 5FO7B 1HBWA 2EXJA 1RF1C 2AXTE 4ZXEA 5FZGA 3JD73 1GOFA 2AEYA 2R49A 4MGYE 4EWAA 1W8OA 1QJY3 5FLHA 3VMZA 3OGJA 2KZJA 2K2SA 5HXVA 2JDIH 4JZRA 2B7YA 1AJKA 4XF0A 1AL22 4WM8A 4AVAA 5APUA 2VBBA 4RQPB 1JZ7A 1BGYD 3P7KA 1F15A 2B5HA 2VR4A 1KJLA 1A8MA 3WP6A 3AZWA 4BLIA 4LKDA 4PV1C 1VBE3 4RS5A 3E1RA 1FAYA 1MPXA 4XE9A 4LITA 1DG6A 1EZVD 2R5DA 1K45A 1L7RA 1T2KD 2CYFA 5FQ0B 3T2TA 1SQXG 1JYTA 1LWUA 2VTFA 3CXHI 3L71G 1CW5A 1U7MA 1UU4A 2J1TA 4L97A 3S30A 4C1XA 4RA0A 1OSGA 3WCSA 3MGNA 2D43A 1MS8A 2YIUB 1SEFA 2E76D 2LROA 1DQ4A 1RVF1 2VG9A 1LGBA 1NLSA 3BALA 3ENRA 4Q0PA 5FY0A 3WNXA 2V7QH 3M3CA 1NKZB 4QU1A 4ATFA 2FDKA 2FFDB 1VBC3 5LRRA 4C1WA 4UT5A 2ZEZA 1YFYA 5KHHA 1SQBJ 5AVQB 1ZZCA 3RJRA 2XPJA 5FYTA 2JDKA 3H3ZA 2ZEYA 4HL0A 4Q5OA 1L4AD 3WU2E 1YJ9P 5F5AA 1JCCA 1OF4A 1RHI2 2D6LX 1NT0A 3DXUA 3UKTA 3CWBG 3WQBA 3ILRA 1S0FA 2X5IA 5G04L 3LD8A 1X33A 3OA7A 2BGCA 2Z2SB 3LIGA 1FPN3 1HKDA 4KL1A 3FUOA 4WZCA 4AVBA 4A4AA 1BK1A 1F4HA 5DUXA 5KHJA 4QX1A 3A5TA 1FATA 3TNPB 4FFGA 3OAKA 1MS5A 3OGRA 1BXHA 3CU7A 4LBJA 3MHZA 4IV3C 2PELA 4MHUA 3BCCD 1HDKA 2GNBA 2LKMA 1LODA 3D82A 2VCMA 4CEWA 4XPVA 1KQLA 1HB4A 1RUJ2 1UMZA 2IXJA 3VKLA 1U5YA 2YBPA 2VOTA 3V2NA 1GMJA 2YO3A 1VQ7P 4BQ4A 3HBKA 5BY5A 1G2CB 3VOPA 4XW3A 1R1ZA 5CCGA 2ENRA 2EXKA 4CDXA 4M01A 1WZXA 3PIGA 1X9VA 1OIPA 1VQNP 4RS5B 1EDKA 5E16A 2J42A 3GHNA 3J8F1 3NJYA 1ND3B 4QX2A 3THCA 4UFIA 5FZBA 1GQPA 4D6TD 3KT4A 3K3NA 3L75D 3T97A 1JHJA 1X9TA 2ILMA 3BOPA 1JY2P 2B39A 2Y26A 3I3DA 3OBAA 4GXLA 1S2KA 4M00A 1SQBG 4QPIC 1NYHA 3J7NA 5LA2A 1NTMG 2KP8A 5B66E 3KCXA 1FU1A 3NRUA 5K9YA 4LORA 1GU3A 1UXZA 4FPKA 4HPKB 1HB2A 1MS9A 1O3RA 2VC9A 4XF3A 1ZBA3 1S0IA 4R4XA 4EYUA 2WWUA 1LOAA 1AYM1 4GULA 5AFEA 3H1LD 3DGTA 1GSLA 2P1JA 2O0OA 1YNAA 3M3EA 1BYHA 5DG1A 4MUVA 5FY4A 1ENSA 1NA1A 1JUIA 3WP4A 1CSBA 4MOAA 5K0UC 2ZFCA 3OCPA 1C57A 5SV8A 3U14A 4UB6E 4F3JA 1XE8A 3KYQA 5KHKA 2TEPA 1K8AQ 4CPGA 1BVVA 1SQVJ 1FMD1 2N1TC 3FHIB 4XBNA 1O3SA 1PFIA 2GH2A 1ZBA2 2P2KA 1VMHA 2DCJA 2Q1KA 2VW1A 4N8MA 1MEC1 1UU5A 4XOGA 3VD5A 5GZGA 1WRGA 5CJ0A 1EAH3 1GZCA 3MGUA 3ZSMA 2XL9A 4JHZA 3L70J 1KD1Q 2YHJA 1W6MB 4BK5A 3NQHA 5CU1A 3SCGA 5TJHA 3X29B 1SMVA 1AXZA 4ARXA 3P8CD 1C8M1 1OH3A 1NO4A 3H1LE 1BEV1 2EXIA 2WWWA 2H0BA 3NNMA 4DQAA 3TEZA 3POYA 1M06G 3M3QA 4JHTA 3U1AA 3ZKUA 3KDPB 4PD4H 4UB8E 2OPKA 3FC0A 4JX0A 4Q4Y3 3VDDC 2YMKA 2J5UA 1JZ5A 4P5YA 1LP1B 3H8XA 3A22A 1NAFA 4WV8A 3RYPA 2GA1A 1O59A 3TBDA 1FZCC 2HWC3 4QHOA 4XHBA 3L73D 4FFIA 4B7KA 3T0DA 4HK9A 1COV1 2DURA 1GBGA 1MACA 3HOBA 5DJUB 1D4M3 5FZ3A 2VNRA 1ZZ7A 4Q27A 4FP3A 5FIXA 4LHSA 3VHRA 1NA1C 3L72G 1WCDJ 3EHKA 1OA3A 1WBFA 2F17A 2WYFA 2P1BA 2WKKA 4AL9A 2ZEXA 4CDWB 4DINB 1NTKE 3M9HA 2BPA2 5JXIA 4NPLA 1R1A2 1ENXA 2XQRA 1LP1A 5FJKA 4R9CA 1C8NA 1J1TA 2XLFA 5FBJA 1W2UA 2FYZA 1X36A 4KI5M 2QVAA 1SQQG 4JKLA 3BCCE 1JU4A 2DU1A 3JQXA 5LATA 3THTA 4CTEA 2JG9C 4GH4B 2NPSD 3WEZA 4YFWA 1UY3A 1OXZA 2IFMA 4IGPA 1IFIA 1UN1A 4XZUG 3RZGA 1SQXJ 1YIFA 3LF7A 4XEZA 3NTNA 4H3WA 4K8RB 4QKNA 3O1SA 1Y9GA 1Q56A 3FL7A 3PU3A 5JXJA 5FXWA 1RUI3 4XBQA 3PMSA 2WPSA 3N7LA 1URQB 2W95A 4LTAA 4NIDA 4Q0SA 1K73Q 4HYTB 5K0UB 3GJAA 1VRH3 3ORJA 1DYOA 1VRBA 2AXCA 1M4WA 4DEQA 5IFPA 1JZ4A 2HLOA 5BVZA 2D98A 4AQ6A 2QQLA 3MD0A 2RE9A 4Z07A 4QWNA 1W8FA 4L2NA 5F32A 2GN3A 5C8CC 1V9U1 3AZVA 4M3CB 2IZWA 3AM2A 1QJZA 3AXEA 1PGPA 5A33A 3P5BA 3R05A 3VHOA 2VZVA 1VBD1 3B5NC 2D2CC 1LHWA 2K9JB 1SBEA 3HD7D 3KSCA 5DJTB 1BE3E 1XU2A 3HQUA 3OB8A 5DUWA 2YMYA 2VUAA 3OBZA 1IZ3A 1IFMA 3CCSP 2W92A 4GIQA 4MH0E 1LHVA 2ZKNA 4AQSA 3VBFC 4QM9A 3VN0A 2MHFA 2QM7A 3P32A 1SPPA 1A02J 2PHWA 2ZGQA 2POHA 1VQ5P 4XFAA 4J6GA 3PLNA 4XTMA 5CISA 5DPNA 4KGQA 4RN5A 2G4IA 1N3OA 4PV1B 3GJBA 4UI9L 1UL9A 3FBYA 4RHV3 2B9BA 1GZWA 4HFSA 2ZXXA 1W6PA 2SPZA 1K5MA 4XDPA 1SQXD 2R3SA 3O6QB 3LSDA 5D8AC 5LBFA 5APAA 3L71E 3RYRA 3KV5A 4H7LA 2VMEA 3T4HB 1QL2A 2CDPA 1BGYJ 2PTMA 3O1VA 5JPMB 1X8YA 1ND2B 2R7EB 3GNEA 5AVVB 2WFF2 2R44A 4YW1A 2ZCWA 2HYNA 2QJYC 4XBLA 2HWB1 4NVPA 4V2WA 3VD9A 1IC2A 5CG9A 3AE2C 1CN1A 3A0BH 3VP8A 5IUQA 4IETA 3L36A 3ZPOA 3RK3D 2XGXA 1FDMA 1LTEA 4QB6A 4WM8C 1T6GC 5BPXA 1WCQA 2OYHC 1IO4A 5AW2B 3EO6A 1JBCA 2YPJA 3U07A 3ZDVA 4DZGA 5F37A 1DZTA 1TVGA 2LALA 3AVSA 4XE5B 4NPFX 3TDKA 2GN7A 3FN9A 4G4FA 1K04A 1WCSA 5J1XA 3ZR6A 3DN7A 4A6OA 4CPBA 3M0DC 2OYIC 4COYA 3AYAA 4HKOA 2E31A 2OQ6A 1IOAA 1D4M1 4LKFA 4IEXA 3BCWA 3VBHC 1MQTC 2ZYDA 3BCCG 1H4HA 2V72A 3H0OA 3DPRC 4IDZA 3GLMA 1NTMD 1CJDA 5KAFE 5KLVD 1IPSA 1N1SA 2HWE1 1WCUA 3HQXA 4RYDA 3AE5C 3QOPA 3CCLP 4LBMA 3WZ1A 3ZR5A 3G4SP 1DGWX 3I2KA 4JBZA 1CAUB 4BJ0A 2E9QA 1FI2A 1PO11 4LA3A 2Y0IA 3PDQA 4OI4A 1URQD 1NXD1 4RQPC 4AW7A 2RS32 4U7JA 2JKBA 3HT1A 4JGZB 3WG2A 5APWA 5DDJ3 4M0HA 5C8WA 2IPPA 4OHYA 3VKMA 1SDDB 5GZFA 5H9QA 4GJZA 4M3CE 4CE8A 3W58A 1C1FA 5FP8A 4L11A 1J1DC 4OHVA 3CL1A 4F7ZA 1JODA 1U5XA 3USUB 4AVCA 1QF3A 2WZR1 2E75B 2WO3A 2Z4FA 2V73A 2K0GA 3PRJA 3E6DA 3SITA 1B35C 3KWVA 2PHLA 2ZJSE 1PMJX 1EPWA 2G9GA 4A3XA 3OG2A 3BRVB 4B8EA 3S6PA 4DPNA 1VQ9P 2W0XA 5AW6B 1OW7A 1SZBA 1UU6A 2D5HA 3NV2A 3GCXA 5JMCA 2Z5IA 1QJY2 2ZMKA 5JI9A 4NRMA 2A1XA 3MV11 4P9IA 4YYOA 4AFCA 4UW3A 3I55P 1JY3N 2VUCA 4P08A 1UY2A 4LO6B 2KNCA 3WUUA 3ZYJB 4H0LD 3TN91 1DGLA 3V56A 3TN92 1AYN1 1OPOA 1SACA 2XBO2 4AVTA 1YJWP 1GNYA 2JO1A 2FCVA 1GYKA 2A7AA 2OUJA 2K37A 1RUD3 2OVUA 2ZGKA 3GHMA 3IZOA 2BWAA 5LBBA 2FBWC 4DUWA 1N86A 1BE3J 5KHGA 1VJ2A 1NTMK 1IG0A 2YKOA 3POGA 4JQRA 1PGW2 2R32A 1Z56A 1AYN2 3FWLA 3SEEA 4EN8B 2KR2A 1LB2A 2XVGA 2XVLA 1QDCA 2VCAA 1VDFA 1FS0E 1RUI1 3M06A 3B7MA 5EFWB 4YW3A 3V2PA 3GZEA 3B3QE 3AMMA 3LPFA 1CAXA 4KU8A 3R4UA 5EPAA 1JOPA 3RMXA 3VZLA 2O14A 1DLCA 5C39A 3NXSA 3H7JA 4IL7A 2FDFA 2RMU1 3RL0B 3MZHA 5B4XA 3BTZA 1NTKK 1T8ZA 1X22A 4BZ4A 1D4M2 4RD7A 3CKHA 3KV9A 4FOWA 3RZLA 1OKQA 3N9MA 1UCXA 5GLZA 5GTIE 1SFCC 3B01A 4QB2A 3Q5RA 4YPCA 1V9U2 4FXKB 1PK6B 1X9PA 2Q8CA 5CG8A 4H55A 5I0UA 5BNQA 3VDAA 1QJX3 3VBRC 3M3IA 1J58A 1SBFA 2Q1FA 2JG8C 5HCHA 1OKOA 4W7YA 1AR72 2GP3A 3WNKA 4AE2A 2NPIA 4XVHA 5APYA 4HN0A 4PIXA 3SCHA 2JB8A 1DGRA 3HE5A 5KAIE 2DU0A 1O5LA 1YHFA 4N9HA 3VBUC 1S1CX 2ZPXA 3UT0A 3VZKA 3ZMNA 4C8DA 1AJYA 3Q8EA 2VVDA 2G1MA 4BU2A 1ZV8A 4ZU4A 2GC0A 3HVDA 1ND2A 1W03A 4XQDA 5AW9B 2WS92 5F39A 4CCEA 5GALA 3SWFA 4DXSA 1F8VA 3AEBC 1KQRA 2M8RA 2C9KA 2VZQA 2WA3A 1EUUA 1SQPE 5LK5A 5A6ZA 2VZTA 4E4HA 2VBDA 1IS5A 3L74G 1NKGA 2JWAA 4H13B 1LTJC 4K21A 2KS1B 1BKZA 3MIFA 4O7XA 4YRDA 1SQQK 3H1HJ 4EI2A 4TYSA 1W90A 1YQ3C 4BWNA 5A3OA 3IPVA 3CLPA 2L5GB 1JY3O 5AW8B 1RUJ1 1FOD3 2BYVE 2DVGA 2ZVNB 2XLAA 2E6VA 2E75C 3CXHH 4DJGA 4CEWC 1DBNA 4AFDA 4IV3A 5FO8B 4GB32 1X79B 1M56D 2P3JA 5B66H 5FYUA 2ARAA 3ES1A 5C4WB 5CZKA 1PZQA 3NV3A 4LLFA 2BNOA 5CHXA 1XSRA 1O6UA 4GAZA 5IVFA 1YO8A 1KYOH 4FPLA 1VRH2 2X5IC 3J26N 3A0BE 3D6YA 3KT1A 4GB31 1CESA 3IPVB 5AVPA 4YPJA 1PK6A 1YXWA 3O1UA 2YXRB 5IVJA 2WSCJ 2JECA 2CWSA 5FWJA 1UOBA 3LEMA 1FAVA 3OGVA 1PGL2 3W9AA 4PQQA 2MEV1 1NTKG 3TGUE 2DVDA 2XONA 1EUTA 2P5BA 3L9JT 4LQRA 3VBHB 2IWGB 4CDQC 4OLLA 3ZFGA 4E2GA 1F9KA 4UF0B 3RBZA 1SLIA 1W8NA 1IGOA 2FDJA 1RF0A 3B71A 2XBO3 4BIFA 2VXRA 5GM0A 5KXDA 2VNVA 3WW1A 5CCHD 3I4IA 4LBQD 4UBHA 1Z7S3 3O14A 4Y20B 1KFNA 3A0HH 1MFZA 3O12A 4PDWA 5FZ7A 1H2MA 3TAYA 3HD8B 5T3NA 3MIGA 1PIV1 3MIDA 1SFCA 2I1KA 2R041 5A3LA 5C5TA 4YGEA 1JZ8A 1EQ7A 2GMEA 2QTWB 2RDSA 5A1LA 2HWC1 3MF9A 4ZY9A 4I02A 1VF5D 4OVEA 3KVAA 1OUXA 2O1JA 4NAOA 2PN5A 2BUKA 1FJPA 2CWMA 2VU9A 5FLIA 3T09A 3NMDA 2HWF2 1WLTA 3ZXJA 2GALA 3AKSA 3SQOA 4AI1A 3OUJA 4CCMA 1CAWB 3DYMA 1GWMA 3J9SA 3V0AA 4JQTA 5FZKA 1W0NA 3Q8FA 3ZO0B 4BQ1A 1DQ6A 1PMIA 2ZAEB 1BCCJ 2JKXA 4LPLA 4BDVB 1A78A 5FREA 3GBFA 2ZGUA 4Z1VA 5CB7A 3UJQA 4L74A 3A0NA 1OD5A 1LTGC 3Q2YA 1G2CA 1KXGA 2ZX3A 3I2DA 3T3YA 3EBRA 4CXXA 1M1KQ 1AR81 1LT9C 1T6AA 5I0TA 1UIXA 2PA7A 1U57A 3N4XA 3AE4C 1ZOYC 2OUHA 3KZ4C 3PVEA 5EWSA 3PH0A 3WVJA 1TNFA 5ANQA 4DXZA 4PIZA 3GHGB 2E51A 1R082 1RGSA 3H3UA 1P8JA 1O3TA 5KTBA 2AGSA 5FJHA 1YTZT 1B35B 1H0TA 4BM8A 5JDBA 1CAVA 2JDAA 4OFGA 3CC4P 4ISRA 3E5UA 5HCBA 1SBDA 1PGW1 4LXLA 2ZAHA 3ZSJA 1NTZD 1R1A1 3NO8A 4LBLA 3HE4A 2QQKA 3C3VA 4LJHA 4XJWA 4YWAA 4Q8LA 5D21A 3WX5A 1H0BA 1HWTC 2IBZI 1UXXX 2Y0OA 5GLWA 1L0NG 4YG0A 3UL2A 3VD7A 3BTXA 2P2UA 2X5IB 3BOWA 3Q8AA 4CRQA 2RH0A 2HWF3 3WHUA 3AEDC 1F35A 5IW0A 3ZYBA 2JDUA 4XQWA 1U0AA 4HXCA 1IK7A 1H1MA 3H8OA 1KB9E 3INAA 2XJRA 4SBVA 4RESB 3HJRA 2ZGMA 1SFPA 2Y8KA 4DRRA 5FYIA 1GL2D 3V2QA 5L8RJ 5FPUA 2BFUS 3C8XA 1FOD1 4OUEA 3OY8A 4XQ4A 1WMDA 1X8EA 4OUSA 1DGRN 1W6NA 5T5PA 2VULA 2BU9A 2AUYA 4LBKA 3OYWB 5KC6A 4TSVA 5IVCA 4Y33A 2ORXA 4LIUA 2E74D 3WUCA 2WQ4A 5J37A 4WY4B 3NV4A 1Q81Q 3F95A 3FFZA 3K3OA 4LE4A 3Q5PA 2FD8A 5C70A 5FR3A 5FYZA 5G05L 1KB9D 1MQTA 2Q3IA 4GOEA 4C7NA 2YBKA 4ZHNA 4TT3H 4EE2A 4FT8A 2P10A 2NM1A 3CL3D 1BK0A 1LTTC 2RS31 2WQ8A 2ZX2A 3FLRA 3O0WA 1GNZA 1BCCG 3HUSB 1M90Q 5KAIH 1QXPA 5I8TA 4AEDC 4WY4A 4PLMA 1NQDA 2OARA 3NV1A 1KILB 3TGUJ 2DTYA 4GJYA 1W8HA 1W9FA 4ZS2A 3JXSA 3NL1A 5I0DA 3AKRA 3H1KD 3I2IA 2A6WA 3ILFA 5FZFA 4CZSA 2K88A 1O7FA 1Z7S1 4QXBA 5FZOA 2IC1A 1CIYA 1VB2A 2SBAA 1XOYA 2EVXA 2VW2A 3CWBE 4JDMA 4OWFA 4JRAA 1HRV1 3L71D 5GTHH 2ZX0A 3L35A 2M3BA 1GL2C 1LU1A 1ZREA 2W39A 2W8ZA 1FPN1 2Y0DA 2NZ2A 2PFXA 3AVRA 3ZYIB 5JXHA 3ETPA 1VB4A 3CCMP 1ZLLA 1ASJ3 3SC7X 1QH7A 1VBC2 3U78A 2Y6HA 4IE4A 2OQ7A 1RUH2 1STMA 3PJQA 3VUOA 2NRGA 1G8WA 2D93A 2P6HA 3WW2A 2HPCA 2Y0CA 5H9RA 2P17A 1ULDA 2D2CB 3AZZA 3C7FA 1QJFA 2PHDA 1JO5A 3KLSA 5HPOA 1NTKJ 2FZ2A 5FYSA 1FDOA 2MEV3 2ZGRA 1FZCB 2BW8A 1AVYA 3CLQA 3L72D 5DAQA 5LB6A 2DCZA 5CJ4A 2RDQA 2WO1A 5T55A 1UKGA 3BPZA 5FPLA 3O1RA 3MHVA 3NFQA 4IEWA 2DVBA 2QJPB 3C1LA 5FUPA 4WWIA 2FYNC 2JG9A 4PBOA 2FYNB 1GFF2 3WW3A 4BLJA 4URAA 3OPTA 4FPFA 3CCJP 3L4FA 3GALA 2PHTA 3LDRA 2KM2A 1XE0A 3MLLA 4IQPA 2MEV2 3ZX7A 1PIV3 1I9RA 1VMJA 1O4TA 2CL2A 2IXLA 3DKQA 4RO0A 3VHPA 4JTOA 3NJXA 1RVF3 3WF0A 4CDWA 2NP0A 2C0XA 1IS4A 1OVPA 3ECQA 1JOCA 4EOTA 4QPIB 2YYOA 4PJ0E 3FHAA 4U2AA 2RS12 4ZS3A 2KZIA 1AF9A 1WMEA 2KD7A 4QKDA 1HTLC 1PM7A 4JKMA 3TYYA 4HT1T 3K48A 4NHYA 1USEA 3PL0A 4HVRA 4TWTA 4N78D 3FLTA 4W6XA 5KC5A 3LA7A 2WR9A 1UOFA 2X53S 5EIYB 1Z0HA 1ULCA 2JD4A 3JCUE 3BASA 4K35A 1W2OA 3I2OA 1VBD2 2R072 1RVF2 3C7GA 1AHSA 1JZ3A 3W59A 3HQRA 1KFMA 3LFIA 5EJ1B 3C7OA 3ETQA 1M1JB 2BCCG 1MS0A 3GBWA 2VTXJ 1GU4A 2HBTA 1EAH1 4NN0A 4ZKUA 2LR2A 3E5XA 4JGYC 2OYZA 4KT0J 1IQAA 2OZ6A 4U3FG 4XXAA 1AJOA 3H1LG 5A7SA 2AZ5A 4BISA 1L0LD 2B89A 1Z7S2 4HN1A 4QPGC 5HI0A 2A71A 3ZXFA 2XJTA 4PJYA 3KHBA 4NPRA 3RK2B 3GW6A 4ARYA 1H9WA 1WW7A 4WVVA 1X82A 1SQQJ 1FZCA 3NWKA 4MVTA 3KV6A 1QY4A 2ZMNA 5E1RA 1COV3 4AHWA 5TISE 4QKBA 4CVUA 3E6CC 1QQP3 4FTBA 1JYCA 2GSYA 3I54A 2WTYA 1SQBE 3RSJA 4IV3B 3TNUB 4RR3B 5KLIC 3E6BA 2QQUA 2M5AB 4P14A 3H32A 2Q4SA 4A7YA 1OC1A 1JYNA 4GIFA 2IFNA 3C7EA 3JZVA 3N7NA 4QPIA 3U59A 2QVSB 3N9NA 2E75D 1RJ8A 1OLMA 2SLIA 4WZFA 2OTLP 4P9YA 4L0PA 3R6SA 2ZACA 1BCXA 1WLCA 1P84I 4GWIA 1OMIA 1KB9H 1IQDC 4UW4A 1S9KE 1W6QA 2ZOEB 3RPQA 2CNAA 4BQWA 1I6XA 3KM5A 4IEQA 3WF1A 4DRVA 5FMOL 1OT5A 1UMIA 2N1TA 1YI2P 4MLOA 4AZZA 4HKWA 5FCCA 3N3HA 4D7SA 3KPEA 4LOSA 1YFUA 3UJOA 3RL0g 4XUNA 5LASA 1FMD2 3G6JB 4FPEA 3I7DA 3VL8A 1WMFA 4LLHA 3P8MC 4QDRA 1W6PB 5FZMA 5DDJ2 4I2LC 1AX2A 1NU1G 1BHGA 4Q26A 1ZRTE 1RINA 4QPWA 4NR1A 1LT9A 1KV4A 3MW3A 1JW6A 1TEIA 2KS1A 3CEWA 3O6QA 1E79H 1TMF3 3UESA 4CU6A 5BNPA 1RC6A 2IX7C 3GHGC 2K46A 4NJ4A 1ZRFA 3WU2H 5KLIB 1P84E 3QBQA 1H8AA 2W08A 4XFCA 2KSJA 1EXIA 1SQVG 5H2FH 1REEA 1UMHA 2JE9A 1JN2P 1G7YA 2MPFA 5CKMA 1GW3A 5C9AC 3ZDSA 3PTZA 3D70A 3IKWA 5BUVA 3IMMA 4N78E 1MUUA 3PVOA 1LEDA 4KG0A 3IF4A 3ZSEA 1ULEA 1MS3A 2BQPA 3CXHE 2H6BA 3ITKA 3OF1A 1T2KC 1HB1A 2OT7A 1YYNA 1OLQA 1AR82 3ACIA 3E97A 4KWUA 4H44C 5DAXA 1FV2A 3MO4A 4CU9A 5A7PA 1LOGA 3QCWA 4KH9A 3TK1A 4A45A 3JBG1 1LU2A 3IN9A 5M0TA 1RF1B 1AR93 2IBZE 1YCIA 2WNOA 1RIRA 3AZYA 3GG2A 2OYOA 1WA6X 3VBRA 1H8TC 4F8AA 4OGQB 3TGUD 4LK7A 2RM23 5EV7A 1LWUC 2I1JA 1KS5A 1VBE2 3K4ZA 1SQQE 3SMHA 5C5UA 3O1OA 4IGQA 1TQ5A 4CCLA 4PBPA 4OMDA 4W65A 3K4AA 2YKPA 4K1YA 1Y43B 2FFDC 1GANA 1M1JC 2CY6A 1EZVI 1H2LA 2R043 4MXWB 3RZMA 1VAMA 3KQGA 3W21A 1VQPP 3BB6A 4A44A 4Z92B 3ILNA 2YDEA 4CUBA 1SLQA 1L7LA 1UPSA 1Y8AA 2XOMA 3HBZA 4P9JA 2NPSB 4IFDK 4LE3A 4N43C 1MVEA 5J98B 4D7TA 3O1PA 1NA1B 1DZQA 1HRI3 1HLCA 1RHZB 2KNCB 3ZFFB 4KHXA 5C71A 4LO7A 5JOXA 1V6IA 1MKMA 5CCGC 1RY3A 1M8OB 3JB4C 5A1AA 3U4XA 1CX4A 3O1TA 2W6JH 1YIPA 2AC1A 1USDA 1S2BA 2E53A 1F5FA 3LOIA 4Q4W2 4XIKA 1WW4A 5A3TA 3Q5SA 5FTTC 2PLV2 1A02F 1QL1A 1N3QA 2ZAAA 3IAQA 2QJVA 3KCYA 4LO5B 1VLNA 4FVVA 1N7LA 1AXYA 2AEMA 2E7AA 2HWE3 3TSIA 1N7SA 2Y38A 1BE3D 5E88A 3SH4A 3WNPA 1OOPC 4QXKA 1MS4A 4CPBD 2BWCA 1VMFA 2B42B 1LTJA 1Y7BA 3F2ZA 4UFMA 5AVWB 4E9KA 2ZX1A 2RJKA 1D0GA 1BBT1 4F83A 5CFDA 1MZ5A 3ZN6A 1KC8Q 5FFOC 1BMV2 3AK0A 5JMOA 5KLVJ 2ZGTA 1QJU2 4Y24A 1CAVB 3L73E 5FYCA 1REFA 4LT5A 3RI8A 4PD4D 3OGGA 1OW6A 4UW5A 4YVSC 2HODA 1S0BA 4FOVA 5CCGD 5C3RA 1PVC1 2GM4A 2PHRA 2FDGA 1SQPJ 3EB7A 3PURA 2RS13 1LEMA 2HWB3 2Q0AA 4YM0A 5JXGA 3FHQA 2R063 2XVKA 5AW0B 4OHXA 2QJPC 1CZQA 1ZNPA 4AQRD 1JM0A 5F5CA 3S7EA 3ZYRA 2L91A 2KK7A 3CX5H 1HJFA 2VXJA 3D0SA 4Y28J 1QKQA 3WSOA 3BU0A 2JG8B 4CCKA 4L73A 2QQIA 3CC2P 3PTYA 4EN9B 1IPKA 3OPZA 3RK3B 3TN93 2RM22 5FPZA 1BDCA 4J1WA 3GF3A 4AEDB 4XFGA 4H7MA 1JYWA 1BGYG 5LEKA 4OYUA 2YZ4A 5DABA 4GD4A 4EZ4A 5JOWA 5TISH 3K75B 1NTKD 3I97A 3WNNA 1ZX5A 4PDWB 2QIWA 3RJ2X 4PIYA 4A42A 2ADEA 2V09A 1W99A 1WD3A 4LHLA 5L7OA 1VQ8P 3C9IA 1JXNA 4Y99B 1NCQC 2L9LA 1W2BO 4I0BA 2WJSA 4IV1A 3N9QA 5IWFA 1KJRA 3SEPA 2CGNA 4Y1YA 3CBNA 1LOFA 3PNAA 1GOHA 4AYUA 2DYCA 4BB3A 1Q8OA 2WITA 4N53C 4IXLA 3HAGA 1UX6A 4KBBA 3ITQA 4D69A 3W5NA 1HUCA 2Y9YA 3H6PA 5AVUB 1QOTA 2E7TA 2DW3A 3LA3A 4DS0A 2RMU3 2ARXA 5DDJ1 4ES8A 3MLJA 1O3QA 2ZT9D 1KQGB 1XJAA 1JOBA 4RJTA 1TMF1 3L74E 4WBBA 4ZZ5A 3H1JD 3HUSC 1BBT2 1ULOA 2R0HA 5AVYB 1TME2 2KYVA 3P8CE 1YQ6A 2XG3A 3EJKA 1JOJA 4HLTA 4KQ7A 4LIVA 4EWEA 4E4SA 2H8PD 1DLLA 1S55A 1ZW0A 1AVOA 1AV1A 2H6CA 3IFMA 4DT0A 1TZOA 1VBB2 1XNKA 2W94A 4GWMA 1W2EA 2OTJP 2DUOA 1EDIA 5ABJC 5JWPA 1NAEA 2XMLA 4XFHA 3L70E 5KJ7D 1GLHA 2C24A 2G9FA 2GNMA 1NLQA 5T5JA 2WFPA 3K51A 3U37A 1PGQA 2JP3A 3JQWA 4R52A 4U3FJ 3ROUA 1KFXL 3G71P 1AL0G 2WNUA 1JY3P 3CCVP 3V65A 1HXS1 1H1IA 4MX3A 2XJVA 4Q4X3 5JSRA 4H13D 4ZMDA 1FYUA 3VKFC 2O01N 3POIA 3W67A 1ULFA 2YGLA 1W8TA 4BOWA 2PLV3 1SCSA 2J22A 1FMD3 4JDNA 2BVBA 2VZRA 4AF9A 5L36A 4OHWA 2J59M 2RHPA 2XLGA 1RUD1 1J59A 2JWPA 4N3YB 5JOZA 5DAVA 1XNDA 1DD4A 1R081 4RGAA 3MUDC 1LECA 1WGPA 1L4AC 2C4XA 3DUIA 4XF9A 1G9DA 1FT9A 4L99A 2QNKA 1RH5B 1BBT3 2WZ7A 5KLVG 4CUCA 2A6YA 3PUQA 3AB0A 1OFCX 3HTKB 1C1LA 1ZBE2 2AR6A 2HFED 2VQAA 2YU2A 5F2WA 2ZJCA 5KR7A 5FYMA 1NX9A 3J7MA 4BQ2A 1AR62 2YXSA 4XJ8A 4I0WB 2J58A 5F1RA 3CCEP 3TNQA 2IZ0A 3EFGA 1D0HA 4Q4Y1 4QGNA 1JYVA 5CFCB 3BRTB 1SG3A 1HRI1 3DPRB 3K5BA 1ZM1A 2J1UA 2RR11 3H1MA 3N9PA 4QXCA 5E8AA 5H9PA 1UX7A 5IK8A 4QQLA 2AEFA 1QGKB 3VBOA 3CCRP 4IFMA 4HONA 2YG0A 5FKCA 1G9BA 1V6KA 1W8UA 3CJIB 3SH3A 1QXJA 2AACA 4R8HA 5FMBA 3RL0D 3H32B 2A6XA 4N53B 5CFDC 4Y26A 1NTMJ 3HD7A 2QZ2A 2DVFA 4AR2A 5GZEA 2ZHMA 4META 1OZHA 2O1QA 2BEZF 1XPWA 1N7SC 4I7ZC 4M3LA 1JU3A 4LLOA 4JC1A 1JYXA 3V0BB 3H9AA 2ZTNA 4GMP3 1CR7A 4LBQB 5ERLA 5FZAA 2I45A 4O61A 2NLRA 1GZ9A 2B4KA 2VZ3A 4XUTA 3ZFFA 1NE4A 3PMEA 1EPZA 3HR9A 3POWA 2RJ2A 1NTZJ 4BQXA 1YITP 2ZKLA 1RF0C 2PRRA 2QJYB 1ZRRA 2B45X 1R093 2IFWA 3ACGA 4ASVA 1PM4A 4BRYA 1YFXA 4JTNA 4MGZE 3A3YB 4QAWA 1UF2C 2D5FA 3FLPA 5L7OB 1PP9E 1AR92 4KWKA 4ZKTB 1YBKA 1E5RA 4XABA 1PVC3 2DBIA 2JDMA 2EIGA 4LBQA 5LA9A 1CAUA 3RNSA 2ET7A 1PK6C 5FMCA 3AFKA 1KDKA 2VQTA 1OI6A 3U0ZA 2JIJA 5I8SA 5J48A 1WLWA 3T0AA 3RI9A 5C6CA 1US2A 5LBCA 4R9BA 5IHRA 2XNDH 4YXDC 1FC2C 3CWBJ 3RL0C 1D4VB 1GR3A 1NTZK 1CONA 2WABA 1X50A 3WDUA 2W1UA 2QQPA 1OQDA 2ZZJA 4QXHA 3KT7A 1PX4A 3PHLA 4BQYA 2Q6QA 1RUOA 3KZIE 4Y1VA 3AC0A 1DD3A 3PUSA 3UKVA 3FXEA 4C7RA 2OQQA 1HX6A 1VBE1 5E89A 4L75A 1FNZA 3VZNA 4CP2A 4CXWA 1N47A 4MZUA 2BERA 2I8DA 1UWWA 2B46X 4YSFA 3SISA 5AW1B 3POBA 4IE7A 3AKPA 2GNDA 2QQMA 2RDNA 4QKFA 3FWEA 1APNA 2JD9A 3H3LA 4XYXA 5F3IA 1G9AA 3O1MA 3AEAC 2W87A 3MPPG 5FZEA 2O3JA 1OVVA 2IBZG 4BE3A 1ACCA 2VMIA 2C5DA 3HPNA 4K20A 3IDBB 4Q4X1 1DIWA 5BNNA 4YW7A 2C1FA 3FJSA 2A6ZA 4CEWB 2E63A 2WSCH 1Q86Q 1QOOA 2V4VA 4QHZA 5A70A 5C9AA 1M7LA 4LGDE 4NMIA 5DQ0A 1VE0A 2D6KA 2QFEA 2W1WA 4NWWA 5KLVE 5HV4A 1FZBA 3B00A 1H30A 4QX8A 4ZU7A 3SWKA 4XACA 2PMWB 3VBRB 4GOFA 3Q3DA 3FX0A 1EV12 1NXMA 2P3KA 1MFTA 4H13C 5C4WA 3VBUA 1MZ9A 1W5CE 1S0GA 2M3EA 4D0QA 5GTIH 4OULA 4FFFA 1HQNA 1VPHA 2V5YA 1KD7A 4JPZB 5FAXA 1F4AA 1QEXA 1NTZG 3WUTA 2JENA 2JEMA 2E32A 2V4HA 1OQ1A 3LZZA 3NNFA 4PDWC 5EQUA 1UY0A 2BGPA 4NHXA 1AR91 4FBFA 5EXOA 3MZWB 5AC93 2VL4A 1NHLA 4IGOA 3VBUB 3U75A 4OVNF 2VMFA 3RZKA 3RK3C 3CPWO 1W6NB 2WQYC 5A7OA 2FXPA 1JZ6A 2Z5HA 2I74A 2XJSA 1D7MA 2ATFA 1HJGA 3JD72 1JZ2A 2XKMA 3KXDA 4E4ZA 2FCUA 3AMHA 3KB5A 4O9EA 2ZT9C 3SSUA 1LGNA 1RHI1 1DIPA 1UYPA 1NU1K 2R073 3LE0A 4YXWH 2E74C 2QCSB 4OQ9A 1H8TB 4AI2A 5FXXA 5L9BA 3M8LA 4HKLA 1IS3A 4MGQA 5DAWA 2VO5A 2VMHA 3WF3A 2HPCB 1VALA 5J7MA 3ZOIA 2RG4A 2XWJB 5IAVA 1PO13 1LT1A 3JCIA 3WNLA 4I01A 1D7PM 4IEOA 4W8JA 3BGAA 4H14A 3NAPB 2WPVB 3FX3A 5IYYA 3I3MA 3W68A 2D6OX 3R2PA 1W9TA 5LA0A 1R1A3 4U3FD 5I0RA 2CPSA 1SLCA 3AP4A 4AFBA 5JSOA 2I07B 1H8TA 1FPN2 1Q3EA 4G3YC 1YYCA 2Q7CA 1HB3A 3CJIC 5GLTA 2RMZA 1RMU3 2WWJA 2DCTA 2WVRA 1ASJ1 2JKVA 1N73B 2VQ0A 1W6QB 1W8WA 3H1YA 4FI9A 4CP1A 2D2CD 3P3PA 2J1RA 3GXUA 4YW5A 2BNMA 1J1DB 2FMYA 3H1ID 2XXZA 3WD5A 3RK3E 4HBNA 4QGMA 2A73B 2C9LY 3MI8A 1QOSA 2CAUA 2D3SA 2P6CA 4OI2A 1LJ2A 1IFPA 1X0TA 4JGZC 2A5ZA 5JVVA 3DYOA 1U5IA 2EIEA 1RUH3 3POSA 1W39A 1D2SA 4R9AA 4CDXC 3HE4B 2J7MA 3WDWA 2BBAA 3WP5A 5C9AB 2PAEA 2ES3A 2HJIA 1H9PA 1ZRIA 4Q0QA 2GUVA 4AHXA 4NAMA 3A0HE 1ENRA 4UOJA 3BTAA 1R5SA 4JCKA 1L0NE 4GH4A 2A3XA 1FZFA 2OPWA 4Y4RA 2J1EA 1RUE2 1UYZA 2E43A 1CAXB 3AYEA 5APXA 3FFQA 3ZFEB 1P84D 3M91A 2RS11 2VVFA 4CU8A 4LK6A 4QM8A 1Q8SA 4I09A 4KWLA 2JXAA 2CV6A 2R061 3AECC 2ERFA 2YC4A 3RGBA 2FKWB 1KFUL 1G9CA 3L70D 1PP9D 5FP3A 3OEBA 4N6JA 4FPGA 4XJAA 3RZZA 2DWRA 2VVEA 3O7OA 3AEFC 1PIV2 3FGAD 1OD3A 3LEIA 1L0LK 4IEVA 1YUDA 4NHLA 1KYOI 2ZXEB 4Y5TA 5EZWA 5ABJB 4DUVA 5LCWL 2WAOA 3E5QA 4CEYB 1UD1A 3DYPA 2C9AA 4CP9B 1CVNA 1L0LJ 4OGQC 1V6NA 4LOTA 1SQBK 1HRV3 3EWKA 3APBA 1QJEA 1VQ4P 1J2JB 3HT2A 2BCCE 1AL23 4FP2A 4LKEA 3VDDA 3WNMA 5IT6A 2KUBA 1K9MQ 2WSEH 3TGUG 2TNFA 2HYKA 2WLPA 3LIDA 3CJXA 1HN1A 3DF0A 3PVNA 4CEYC 3ME2A 3A4UA 1Y9QA 2WN2A 1AXKA 1KITA 2YBSA 1IKQA 4EYYQ 3GDBA 3BUCA 2R5BA 1NCRB 2QZ3A 5BNNC 3AE6C 1YQCA 2NZ9A 5A3PA 3WUDA 3IM0A 4SLIA 1QGLA 5BU8B 1RUE3 2P4EA 2JE8A 3BTYA 2QE7H 4YNIA 3WW4A 2AXTH
chains in the Genus database with same CATH topology
5FRAA 3EQ2A 5CNAA 3SLIA 1K5MC 5JIAA 3ZFEC 2WT7A 3VV1A 1GQGA 3U10A 1GZWB 4Q1RA 3B5ND 1ZA4A 1NLRA 4X6QB 1GNHA 4AEMA 1LR5A 4Q29A 3FE5A 4EN0A 3M0AA 1B35A 2XV5A 4WM7B 4XFFA 3RDIA 1SVFA 1RF1A 2NMOA 1HRI2 2WQZC 4NHMA 4AEJA 3OBRA 2ARBA 4K9SA 3WCRA 1H4GA 3ZFEA 4YM2A 1RJ7A 3VBOB 2QUOA 4AGVA 1DH3A 2LUWA 1JUHA 1SLAA 3I5CA 3IDCB 4E2SA 3R4DB 1POV0 1PZ8A 2XDJA 1W6OB 3D4KA 4B4QA 2UWCA 2LM3A 3DPRA 4JYBA 1RHI3 2R071 2Z5WA 2XJPA 3JD71 1URXA 3VBHA 5BV6A 3B5NB 4GKGA 3KD4A 3QD6A 3WG4A 2HEVF 2JX9A 2JG9B 1IFNA 4QX5A 2A45I 4RL7A 1SFNA 3NAPC 1XYNA 4W7ZA 1RUC1 2XWBB 4WB4A 3N7MA 1BMV1 1NH4A 5AVRB 1G1JA 4CYDA 4JAAA 1RE4C 2YY1A 1RE3A 2RR13 2YV8A 2XJQA 5BNOB 4E2QA 5C8CB 2QDNA 3L2HA 1GICA 2B9UA 4YVWA 1N2DC 4FPJA 4UW6A 4BMEA 2VECA 5GJ6A 3II6A 2ZA9A 4P9WA 4XA4A 2I2SA 1GD2E 1VBC1 3BU7A 5AW5B 4QPYA 4WM7C 1J3PA 1QQP1 3IR9A 5KJ7C 5FBZA 5BNOC 5C8CC 2PHXA 4M0NA 1GL2A 4V1PA 1CJPA 5J3UA 2KA3A 1JMMA 2WWSA 2ZHLA 3B8EB 3J4UH 4GMP1 2RM21 1HIXA 1DYKA 4GWNA 1WLDA 1RUF2 1RUH1 2FZ1A 2IXCA 2ZABA 1AL21 2WNVB 1S0CA 5T5LA 1NCRC 1R092 5ACA2 5CA6A 2H43A 3LGRA 5JSPA 2UURA 5JIUA 3I59A 5D1IA 1FZEA 4QQ2A 2ZGSA 3L2YA 2DUQA 4YZ3A 4RGGA 4HANA 4YZ5A 2RMU2 3HWJA 2HWC2 1W0PA 4COZA 2VOXA 4P9LA 4C0BA 1VIWB 3PHMA 3R4SA 5LK7B 1ZZ8A 1JY2N 1JTHB 1UZZA 4N7IA 3AFGA 1CAWA 4Y5Z0 2HG5D 2B8MA 2Z79A 4Z2WA 2GH8A 5JAXA 4Y1ZA 2AENA 3NJZA 3O5SA 3ZN5A 1NKNA 3USSA 3AMPA 1VBB3 5SV5A 1Q8QA 1YI7A 4AEKA 1AYM3 3GZTB 1GTWA 2ZX4A 2Q5TA 2IXIA 5GLUA 2ZGNA 4WVZA 5BNPC 5T50A 1WUVA 5EFUA 2WT7B 1UKRA 1NY71 2ZGOA 3RRDA 4CDXB 3AP9A 3E1IA 3BIWE 3MW2A 2A6VA 1T3UA 2DFBA 5AVZB 3HRNA 5DZFA 5JPNB 1MEC3 1RUNA 5A32A 5DUUA 2WZPP 3WLUA 1QNYA 3M4FA 1VR3A 1W6MA 4C91A 5JCTA 2H7HA 4ONUA 2RR12 1AQ5A 1XU1A 2Z69A 1KS4A 1RUC3 1N73C 2XKOA 1CPMA 4IEYA 4KU7A 1SP4A 4XOGA 1NG0A 4NHKA 1AR61 1K5MB 1QJU3 2WIIB 5FDBA 2WFF1 4Y22B 3VP9A 1ZRDA 4XMAA 4AFMA 3LIEA 5FLJA 1LOEA 1RUG1 3N7JA 3TYJA 3VKOA 2DV9A 4XJ9A 4YG6A 4JV4A 5DG2A 5JR7B 5CFCA 1H88A 2DFCA 5DXDA 4FQ4A 4ASMB 1ENQA 3TOJA 1WA4A 3CO2A 4INDA 2R0FA 5GZDA 3G7DA 4GMP0 3ZXLA 3M7AA 3CJIA 2XNXA 1SQVK 2R042 1I1EA 1ZBE3 1S9KD 5AW7B 3AP5A 1MZEA 1LULA 3QACA 2VMGA 3V5BA 3MPBA 4ITCA 3ZFGB 3VTPC 5C4WC 2QKDA 4I3PA 2EALA 4KWJA 3S0MA 1UW8A 1WW6A 4XDQA 3I59B 1O91A 3LW5H 4FPCA 4LO4B 4AXOA 1UAIA 1RMU1 1WT6A 4MGKE 1EAH2 3U11A 5B2GB 1WW5A 4YFZA 4PCRA 1G1IA 1CD3G 1AFOA 1IFJA 4YGDA 1GZLA 3WQ0A 4PF5A 2D40A 2DVAA 3AYDA 1XNCA 5J09A 3OBTA 4AWDA 1FJKA 3WHTA 1LHOA 2HWB2 1HH0A 2YNYA 3FZ3A 5KJ7A 2KLVA 3WY6A 4WM7A 2C9NY 2XB6C 2XBO1 5FOBB 1COV2 1V70A 3RQ0A 3AP6A 4GKYA 4YZ4A 3WMM0 4DY3A 4IV1B 4YW2A 2R30A 3N7KA 1GKBA 1SQPK 3HD7C 4LA2A 2YUEA 1G86A 2RS52 1RE4A 1E57A 5IK5A 1SQXK 1RUI2 3H8UA 1HGZA 1HV0A 2DF7A 3MYXA 5A3MA 1NOVA 1BJQA 2WINB 3ATGA 4Y99C 1NCQB 3JB8A 2EAKA 2BTVC 3KCCA 3EXUA 4QQPA 3MTUE 3AJYA 1NE6A 4Q4V3 1PZ7A 2AH2A 3QH6A 4WVMB 3HN1A 3MIHA 3USUA 1VBD3 3ZFFC 1AR83 4I6MC 4I1LA 1PO12 4HETA 4IESA 3VZOA 3AKQA 2YKQA 4ZU5A 3FMGA 3WINE 3WG1A 1OPMA 2R062 1KILC 2GMPA 1T3JA 2XHKA 3WR0A 4QMAA 2WT0A 1LTAC 1HV1A 1RUE1 1SFCB 3NVCA 4JGYA 1N3PA 1MS1A 5KLVK 2Q8OA 1SFYA 3VZJA 4AEDA 5KXCA 4MGIE 1PVXA 1SQ4A 2HWF1 4YVSB 3MIBA 4DOUA 5CCHC 1AX0A 3GZUC 5FMOS 4R4ZA 2C0ZA 1J1EB 4AHYA 3M9QA 4QD2A 3UIAA 4FCAA 4B4RA 3R0RA 3MFCA 1O4ZA 2FBEA 1L4AA 3JUUA 4LR4A 3SH5A 5I0SA 4I30A 1VBA1 2O8OA 2WNUB 4KNCA 4XHXA 2WFF3 3B02A 1CI6A 2R6QA 1NWQA 5D8AA 2HODB 2PAKA 3ZXDA 2PAJA 3KGZA 2WC2A 1V00A 1LOFC 2WPRA 2ZHNA 4K40A 4GALA 1FZGA 3ZN4A 1DQ2A 5JZGA 2MJZA 3LB9A 4BMBA 5L7OC 1VBA2 1W0OA 4OUSA 4B86A 2A3YA 1VAKA 1XTGB 5F6LB 5HCAA 3URFA 4I0AA 3WP3A 2RS33 1N7SD 2HKXA 2WS93 1V6LA 1GQHA 1FXZA