2R32A

Crystal structure of human gitrl variant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
158
structure length
140
Chain Sequence
RMKQIEDKIEEILSKIYHIENEIARIKKLPCMAKFGPLPSKWQMAPPCVNKVSDWKLEILQNGLYLIYGQVAPNAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords GCN4-pII/Tumor necrosis factor ligand superfamily member 18
publication title Assembly and structural properties of glucocorticoid-induced TNF receptor ligand: Implications for function.
pubmed doi rcsb
source organism Saccharomyces cerevisiae, homo sapiens
total genus 32
structure length 140
sequence length 158
ec nomenclature
pdb deposition date 2007-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2r32A01
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r32A02
1CSBA 2HEVF 1JTZX 5AW9B 2Q5UA 2ZJCA 4GT1A 3M0AA 2TUNA 1DH3A 2Q8OA 1WCKA 1CI6B 1PK6B 3M91A 3QD6A 3M9BA 1PK6A 1GZLA 3P7KA 1JUNA 5AVRB 3HE4A 3ALQA 5AW4B 1X8YA 4DZOA 4MXWB 3VMYA 4GIQA 2E42A 3V4WA 2E43A 2W6AA 2Q3IA 2P7JA 1GD2E 3NFQA 4QQHA 2OIIA 4QPYA 3WD5A 5APWA 4G3YC 4XE5B 2Z5IA 4M3LA 2R3CA 1U5YA 5AW2B 5AW5B 3IT8A 3A5TA 2XZRA 3KQGA 2R32A 1IQAA 2O0OA 1NWQA 2QE3A 5AW7B 5APSA 1FAVA 1A02J 4QQOA 1OQDA 1GU4A 4C7NA 1OSGA 1XU1A 3V56A 2RE9A 1RJ7A 4HT1T 1GK4A 2E7AA 3TNUB 1JH5A 1ALYA 4E4SA 5AVUB 3B94A 1D2QA 4OUMA 1H89A 2VRSA 4TWTA 1HUCA 4I2LC 1FOSF 5AVTB 2JG8A 2WNVC 3ME2A 5CIRA 3B9IA 3T97A 1TNRA 4DB5A 3NTNA 5CMZA 2WNUA 3FC0A 2JJLA 2YO3A 2QDNA 4QQ2A 3IR9A 1KQLA 1SP4A 2Z5WA 2R30A 5AW8B 1JNMA 3TK1A 2JG9C 4JYCA 2WT7B 3VTPC 1HBWA 2WNVB 3L37A 5AVSB 1HWTC 3NXSA 1H8AA 1CI6A 2RJKA 3I5CA 1G2CB 2X29A 1TNFA 4JYBA 3O8ZA 2JG9B 1H88A 4MXWA 2R5BA 2HEYF 4LC1A 3MGNA 2ZFCA 1A8MA 4HYTB 4OUSA 3LKJA 4G4FA 4DOUA 2BASA 3B93A 4MSVA 5AVYB 3NMDA 5AW0B 4N90A 4RESB 3B8EB 1CZQA 1GTWA 2ZXEB 4EOTA 1SLQA 4B86A 4MXVA 3P8MC 1OXZA 2QM8A 2XV5A 2R5DA 4RSUA 4KG8A 5AVZB 3SWFA 1S55A 2ZPXA 2W27A 5APQA 4AYCA 1A02F 1KD7A 2N9BA 1DU3D 2RJLA 2WPSA 1IO4A 2P67A 3L9JT 3V4QA 3K48A 3TNUA 3URFA 4J6GA 1J2JB 3VN0A 1O91A 3P32A 3OAKA 1D0GA 5APVA 2WNUC 2KP8A 4D7YA 5HBAA 2KA3A 3TWIA 3VYIA 4KGGA 4QQLA 1OWAA 1GU5A 4AUWA 1T2KD 1DG6A 5AW3B 5AW6B 1PK6C 5L36A 2WT7A 2WTYA 2WNVA 1GR3A 3TYJA 2TNFA 4I6MC 4NN0A 1MV8A 3LIEA 3TYYA 2JG9A 5BNQA 5APYA 3M9HA 5KC6A 1I9RA 1U5XA 3UIAA 1FOSE 3HE4B 3V5BA 1GK6A 2WPQA 5AVXB 3A3YB 3A2AA 1S9KE 2P2UA 3AB0A 2YNYA 4KGQA 1U5ZA 5APUA 3LIDA 5AVVB 1D4VB 4AQRD 4C46A 3QBQA 5AVWB 2Q7CA 3A7OA 2XU6A 1HJBA 1KXGA 3L36A 3VMZA 2WWWA 4QQPA 1YYCA 3KDPB 3VMXA 2IPPA 2QM7A 2C9LY 2WPRA 5APXA 2AZ5A 4OULA 3K51A 3M0DA 4KHXA 4C7NB 1C3HA 5TSWA 4E4DX 2JG8C 5L19A 5AW1B 1NAFA 1MFZA 3HE5B 2H7HA 5KWRA 4F3JA 3HE5A 3M06A 2C9NY 3HTKA 1MUUA 1S9KD 2Q1MA 2YO2A 4TSVA 1T2KC 3MD0A 3L35A 1OQEA 4GKGA 1C28A 2JG8B 5APTA 2HEWF 5AVQB 1XU2A 4EN0A 2R6QA 3MI8A 2WNUB 5KC5A 1RJ8A 2Z5HA
chains in the Genus database with same CATH superfamily
2O8OA 4LBKA 2XJRA 4K1YA 1PIV3 1KILE 2D6OX 1AXKA 1PMJX 4GT1A 1X8MA 3WNNA 3R0RA 1UKGA 1PK6A 2V73A 4QPGA 4NIAA 2JD9A 3CQOA 3VOPA 3S9OA 4XF0A 5T5LA 4EZ4A 1NGMB 2W47A 4IDZA 3H7YA 2VUCA 2VZVA 3AK0A 1SLIA 4UW5A 2QUOA 4QQHA 1AR82 3L75D 3I2KA 2G19A 3D82A 2C1FA 3DPRC 5IT6A 5B4XA 1XSQA 5J96B 3I97A 2E7QA 3ITKA 3CWBD 4CEYC 5JSPA 4GA9A 1A02J 2PFXA 3OJBA 1H30A 1YIPA 2W90A 2DWRA 4ISQA 2G9GA 2ZT9D 3JXSA 1NE4A 4LO8A 3B5LB 3BGAA 3N36A 5FJHA 1RUG1 4CCJA 3RL0D 4MHRA 1PP9J 1AA0A 2YGMA 5DDJ1 3BCCD 1K12A 5F2SA 4WBBA 3L72J 1JY2P 1RUD2 1JY3P 4YVSC 1ZZ8A 3ZSEA 4LNVA 4A7ZA 2B4KA 2KIKA 1N73C 2NPIA 1V70A 5F3IA 4URAA 1W6QA 1VAKA 1KFMA 1EZVD 4SBVA 2Y26A 2IUWA 4CVUA 5KAFH 1QY4A 1SQPG 1UOFA 3ZSJA 1CI6A 2BDRA 2JP3A 4TLFA 3DKWA 1VP6A 4A7PA 2QQLA 1SQBJ 4ZNCA 2FYNB 4Y1ZA 1K45A 3SNMA 3OBTA 4MXWA 3CLPA 4AZZA 4HVOA 3ATGA 4OWFA 5EZWA 1YQCA 5JXJA 4AGVA 1EQ7A 4NVPA 4AAXA 1BCXA 1GWKA 1PGW1 3L70E 4XZUG 2DBNA 1YQ4C 4RD7A 2PP6A 1XNAA 2M5AA 3KZ4C 2ZAHA 3UESA 1XJAA 3U4XA 4F8AA 1SQXK 3RSJA 5LRSA 1B35C 2QM8A 3AKRA 3ZXDA 1NCRC 5FBJA 5AVZB 3CCMP 3OSDA 3WDXA 2HBTA 3ZN4A 3BATA 3I56P 3MIWA 4Q4Y1 4ARYA 4IGOA 1L7QA 1FZAA 5APQA 4N43B 2BQPA 2ZGTA 2D98A 2A3XA 2D6LX 2VECA 3CXHH 3E1IA 1M7LA 3URFA 2NN8A 4IFDK 2RMU3 3T2PA 1W8TA 4OVNF 1GWLA 3BU7A 3HPNA 3Q8FA 3QACA 3HWJA 4YRDA 3WG2A 4AI8A 2KSEA 3AE1C 1TEIA 1W3XA 5HXVA 4UFHA 2D6NA 1W8UA 5AW6B 4IETA 4LIVA 4D8MA 5HI0A 3FBMA 4ET7A 4PD4H 2YB7A 3KD4A 1HH0A 1GP4A 2JECA 4XJ9A 1RF1A 5IK8A 4YARA 3RFRA 4RGGA 4X6RB 5LA0A 3BASA 1O3TA 4I02A 2UWJE 1GQPA 2VZ1A 5EP9A 1NKZB 4F7ZA 1V9U1 5ANNA 1JOCA 5KJ7D 5ANQA 3RZLA 5FMCA 1DHKB 4NPLA 3WQ0A 2ZA9A 2P2KA 3ZSLA 1RF0A 5A7NA 3DXTA 2K3RA 3H1JE 3V2PA 1O5UA 1OPMA 2VCBA 2Z4EA 2VMDA 1ZBE1 3JSVC 2O1JA 2WT2A 1VJ2A 1W6PA 4A41A 1SCRA 1M90Q 3QBQA 4JV4A 1OFNA 3SH4A 3CL1A 4Y4YA 4D69A 3BI3A 4COVA 4QQPA 2FZ1A 2CGNA 4FFHA 1FZBA 4A2UA 3FLRA 1ULPA 3WDYA 2PQSA 1GWMA 3HD7B 4Y3OA 1DIWA 3L71E 4OGQB 1AL22 4OHZA 1DGWA 2W39A 4P02B 4Q4W3 2RMU2 4LKFA 3ZOIA 4EE2A 1JW6A 5BNPC 3CCUP 3U59A 1RUI3 4L75A 1GL2C 1TG7A 2VNOA 5LW9A 2J59M 2IYPA 1EV12 4CPBD 4XTMA 1DDLA 2XONA 3EMRA 3L70J 4ARXA 4WY4D 1NZIA 4E4ZA 4R8HA 1N7LA 3VP8A 1FC2C 3H1IG 3UGFA 1Q8PA 1VPHA 5AC91 1CW5A 1GICA 4M0NA 3ZYIB 3WF4A 1VQMP 4GB32 1AYN3 1E5HA 5GZFA 2YMYA 1YFWA 1DEBA 4FPJA 3Q5SA 1QXJA 1LTJA 5FY5A 3UJQA 2JO1A 2L9LA 4LBQD 3GF7A 1Q3EA 4P9WA 2V5YA 5FZIA 1S0DA 2POHA 1GP6A 3OPZA 3CI9A 1PO13 1FAYA 4QHZA 1SQVE 2QG4A 5APWA 3MF6A 1AQTA 2VH9A 4PI0A 2N1TA 4J1XA 4W7ZA 3AXDA 1XE8A 1LEDA 5J3UA 4BCUA 4JQTA 3Q1MA 2Y6LA 2MEV2 3PUSA 1YQ2A 2PAKA 4RYDA 2R16A 2E32A 4SLIA 3AYCA 3CJXA 1R5LA 5LWBA 5FZBA 5IUQA 4H14A 4YPJA 5CKQA 4OQ9A 2EAKA 3DPRB 4B7EA 4E2QA 3RL0C 2C0XA 1RUI2 3WLUA 5A33B 3ECQA 3C7GA 5A7OA 1ZZCA 3MIBA 3H1LG 2VRSA 5FZLA 5DAVA 4K8FA 3ZMNA 5CIRA 3RK2B 4AVAA 2JE8A 2WNUA 3E5QA 4XUPA 5ISLA 3AEBC 1ZVFA 3ZYPA 1IFMA 2WL1A 2JG9C 2KNCA 1ACCA 4GH4A 1AR61 2WZ7A 1AYN2 1G8WA 2QJPB 1UIJA 4PI2A 4H44B 1JZ5A 4CDXC 2E6VA 2X10A 1RUF3 4YXWH 1LTIC 4YGBA 2OTJP 3L71J 5A7PA 2WQYC 4CU8A 3O8ZA 4NOTA 3AZZA 2W9XA 3J8F3 2LUWA 1WCUA 5FK7A 2OYHC 1G1JA 1SQPD 3I3DA 3POEA 4IEWA 3LIHA 4IV3C 3FFQA 3MBWA 3RWNA 1H2NA 2V7QJ 4B4RA 1G9DA 3LDKA 5A32B 2WABA 2FYUK 1BSHA 3ZR6A 4N90A 2VM9A 3FWLA 3FX0A 2GP3A 2DU1A 4MGTA 2PAEA 4PJYA 1NTZE 2O1KA 1E5RA 3RGUA 3UGGA 3S1KA 3GHNA 3TN91 4WV8A 3AP4A 2A45G 4AEDC 1TMF3 1UX7A 4CPGA 2WS91 5C4WC 2PHDA 4B4PA 1XNDA 3SITA 5ERLA 3DYMA 3VHNA 2WSFJ 1LOAA 2VQUA 4CDUC 2WR9A 4U7JA 3SMHA 2SLIA 5L73A 1DZQA 1H0TA 5ABJB 5IVFA 5A6QA 3WG4A 2HWF1 1NO4A 4AQ6A 3CJIA 2DUOA 5I8YA 1Y43B 1PK6C 1S5LH 3PIJA 4QPGC 4LOSA 4XMIA 2WFPA 4KH9A 3K46A 3FL7A 2YU2A 3UETA 2TNFA 1HIXA 4UFKA 4BE3A 2LXBA 5FMOL 2WYFA 5DAQA 2XUMA 1Q90D 4LT5A 4LA3A 3J8F2 5CFCA 3ZFEA 3KCYA 4PIZA 3H3ZA 1MS1A 1EAH1 4QDRA 3CCRP 1NYWA 1M06G 1QDOA 2HWB1 4L8QA 1SMVA 3JB8A 3KVBA 2H88C 4D6RA 2D2CB 3AZYA 4YLZA 1P84I 4JF7A 5F3CA 5FZDA 2K9JB 2YKOA 4YW6A 4XIOA 5LK5A 1VRBA 1OT5A 1VQ9P 3LW5H 1DYOA 2XU6A 4NE9A 1EUUA 3V6IA 3RZJA 4XDOA 2BGOA 3AE8C 3OGRA 1LHUA 3KF5A 4CCDA 5K5GB 1SQQD 5APXA 4OULA 2K9ZA 1QOSA 2NZ2A 2VOVA 2PXJA 4HVRA 3WDUA 1UF2C 1ZRCA 4EYUA 1W5CE 2WO7A 1NCQB 1QJU3 2ILMA 4TSVA 1EPZA 1OOPA 5B5EE 1LOFA 3JZVA 2IXHA 1YC61 3H7JA 1SFNA 3L75E 3S7EA 4RFRB 2HEWF 2IBZG 5BNPB 1PNGA 4ZKPA 4OZOA 3I49A 5KLVE 2KI7B 1ASJ2 1GNHA 3WNKA 2R043 3GMAA 2VTXA 4N7IA 1BQPA 2HWE3 3CWBE 1SLTA 1L0LG 3SKVA 3H1LJ 1C1LA 1NTZJ 1Q7YQ 3AM2A 4LLHA 1GZLA 2JR8A 1LRHA 2ADEA 4AQSA 2VMCA 2P3KA 5IK4A 3OYWB 3BCCE 3BVCA 3RMXA 5DN2A 4XIKA 4DUXA 1C8M3 4NJ4A 1MS8A 1CVNA 2IFWA 1NX9A 2ZHNA 2R3CA 1AVBA 1BBT1 4Y26A 1EZVE 5LATA 4P9LA 1KB9H 1QGKB 1IG0A 1HJGA 4LHKA 5LRRA 4RS5A 3RK3C 1W04A 1DQ6A 5FY4A 1WLCA 4XFHA 5A70A 1KITA 2W1WA 3VBRB 3NNGA 2XBO3 2VOXA 3EBRA 2GMMA 3HR9A 4JGYB 4FPLA 2WN2A 4BRYA 2RH0A 4QGNA 4EI2A 3GLMA 1Y7BA 4L99A 5BNOB 5DQ0A 4NUBA 2JG8A 1KYOI 4CP0A 1KV4A 2NPSB 4XYXA 2VD7A 3UKNA 1ZW0A 4DCKA 1RF1C 3FX3A 1ULCA 1YLLA 1RH5B 5EHDA 4HXCA 1GW3A 2VTXJ 4INDA 2AREA 3NXSA 4QU1A 5FUIA 5I8SA 4A6OA 3C8XA 2YHJA 1NJIQ 3GF3A 3GHMA 2JG9B 3Q9OA 1PO21 2GALA 2WFF1 1ZRFA 2WZPP 3ROUA 1BEV3 5DG1A 3JBG3 2UYAA 4CDXB 3H8RA 4ES8A 2RR11 2R1BA 3DYOA 1MEC1 1URQA 2CK3H 1FDMA 3M7AA 1Q43A 1K9MQ 2Q0AA 2ZXQA 2Y6KA 3H8XA 1OLME 1O6UA 5APAA 3O7OA 5KLVJ 2VL4A 1VIWB 1QNYA 4IV3B 2NZ9A 4W4ZA 1OXZA 4W6XA 5FYBA 2XV5A 1Q8SA 3ZVXA 2R5DA 4N9HA 3NMBA 1ND3B 1BXHA 1YIJP 4A42A 4LXLA 1BK1A 3SWFA 1SFPA 2P34A 2XBO2 1CQ9A 1LJ7A 4KMQA 4AHWA 4TXWA 3ILFA 3WF2A 4C1WA 4AFCA 2R0HA 3PUHA 1DZTA 1IK9A 3IDBB 1N86A 1WD4A 5APVA 4DIQA 5FZ7A 2ZZJA 3J7HA 3L73G 3K5BA 2E74C 3ZDVA 1CAWA 5C4WB 5B5EH 4HPKA 3ZIWA 1BMV2 4YZ1A 3I2GA 1NU1J 4XF3A 3CX5D 4XBQA 3G4SP 3RNSA 3H1YA 2J1TA 3J26N 4WM8C 1J58A 5A7QA 2WLQA 3UGHA 1KFNA 4AVBA 5I93A 3VBSA 4QM9A 1BEV2 3JBG2 4PT6A 3IPVA 1AR81 3SEPA 4FP2A 2C5DA 3OGVA 4KGQA 2BGCA 2F6BA 3E6DA 4UW3A 3CCEP 3AECC 4A3ZA 3FHQA 2CL2A 4A7KA 3TDKA 1FZFA 2WT1A 4COWA 4XCBA 1IK7A 4D6TJ 2GC2A 3VKMA 1RE3A 4QAWA 2K88A 1LHOA 1LTGC 3KDPB 3TGUG 1FMD3 1KILB 2WPRA 1H2LA 2R073 1AUYA 3W5MA 1C3HA 3HIFA 3E97A 5TSWA 3ETPA 4R9CA 5K0UA 3AMNA 1REFA 4QU2A 2WBKA 3ZMOA 1W8HA 3WHUA 4UFLA 3HE5B 2H7HA 3Q5RA 2YKPA 4QB6A 1RUD1 3ELNA 1AX1A 4FBFA 3AX4A 4PV1D 5FQ0A 4CPBA 2GN3A 1C28A 4GH4C 4DPNA 3D0JA 1J83A 4WY4A 2IXKA 2ZGMA 2EVXA 4JX0A 2VW1A 1W6QB 2X09A 3EFGA 2ZGQA 1OFCX 4NO4A 1GSLA 1TME3 2VCCA 1KFXL 2X53S 2AC1A 2YROA 2Q8OA 1CI6B 1JZ2A 3MIDA 1F9KA 4LA2A 4FTBA 4QX5A 4QXHA 2BFUS 2IXIA 3ALQA 4EN6B 4AFBA 3V2QA 2JE9A 5CEHA 1RVF2 4DZOA 2JB8A 3V2NA 2WA3A 1VB2A 2YV8A 1L7LA 4MXWB 3POWA 3CCSP 3TAYA 5FPXA 3RZMA 2E43A 3B5NA 2Q3IA 5GKAC 1NKGA 1RE4C 3FZ3A 4YPCA 3ZYRA 3O1TA 4BIFA 3AKQA 4YG6A 3EXUA 2VQ0A 2FY8A 1SQBK 2ZEYA 2M5AB 3A5TA 3MW2A 2A6XA 4NWVA 1SFCA 2FFDB 3M1HA 4ZXKA 4HVQA 2GC3A 1BDCA 1OI6A 3WW4A 1XNCA 2ES3A 3DL3A 3OY8A 1QU0A 3C9IA 4EROA 2B9UA 5JZGA 2AYHA 1W99A 2VCMA 4YSFA 1XU1A 5FZ1A 1JYIA 1M56D 2PHXA 1CZVA 2RS53 5A1FA 2ZGKA 4JQ0D 3RK3B 1SQPE 4H55A 5IVEA 1VRH2 5KHGA 5AVUB 1N1SA 1JZ6A 5IVVA 4TWTA 1HUCA 4UAPA 4I2LC 3VKLA 1QGLA 3CCLP 1WMDA 2BFUL 2LRPA 1OA2A 5KHHA 1TNRA 4YW4A 4W6WA 1UN1A 3WP6A 2OVUA 3TK1A 5CFCC 3ZFEC 1FZGA 1L0NE 1KJLA 3AP6A 3P6BA 3VDDA 3I5CA 4BB3A 1D7MA 1USEA 1R64A 1J1DC 1R093 2R7EB 2ETEA 4Q0SA 2CU5A 2D6KA 3J7LA 1W8ZA 2WAOA 1FV3A 5H9RA 2IFMA 3ZKUA 4HYTB 1ZA4A 4K3UA 2MJZA 4G4FA 1G1IA 5JUVA 3V65A 2JDKA 3ZN6B 1RUE3 3VKOA 2LKMA 1B09A 3B8EB 4PF5A 1W6PB 2J7MA 2ITAA 1ZZ6A 2DTYA 4UBHA 1M1JC 3WF3A 2Z69A 1NYHA 2J1UA 1LHNA 1BE3G 4B86A 2XDJA 1UOJA 2GM4A 4CDWA 3SFEC 2DDUA 3NAPA 3JQXA 2YU1A 1AL21 1ZV8A 1XQNA 1NA1A 1BVP1 1K5MC 4AYCA 1DX7A 2NLRA 2RMU1 4UXAA 2RS52 4JTOA 2QQJA 1LOFC 4XJWA 3KZIE 4KNCA 2O01H 5JR7B 3AFKA 3AKTA 5C6CA 3K48A 1WWYA 2VVDA 4J6GA 3FN9A 4DOJA 4FI9A 4AHXA 1OMIA 2ARXA 1LTBC 1UYXA 3TGUJ 3ZKYA 1CAXB 5LBFA 2W5FA 3C2UA 2OTKE 4IEPA 4EQVA 2B45X 4HOOA 1VQKP 3WP5A 3MGUA 4U36A 1SQXG 3H1KG 5F2WA 1XXNA 1LGNA 2W52A 3GJAA 4A3XA 3L73D 5ACA3 1Y4WA 2VMHA 1J3PA 4GB31 4RR3A 4V1PA 1SQQE 4OHYA 3BODA 4L76A 5KC6A 2J1SA 1GNZA 4XHXA 5JOYA 4ZHNA 1MR5A 1GK6A 2WPQA 1LJ2A 4CSWA 1LTJB 3A3YB 1RUE2 2ZEWA 4WVZA 1XNKA 2WT0A 3AB0A 5FUNA 3PLQA 1AXYA 1FPN2 4MN4C 2VW0A 3NW4A 3H8UA 2IFNA 3VZKA 3I2HA 4RS5C 2HWD2 3LIDA 1YJLA 1UL9A 2IXJA 2YMZA 1Q82Q 1BCCG 1F4AA 2JDNA 1PMHX 1ODNA 1R1ZA 3GZEA 4FOWA 2N1TB 2MEV1 4PQ9A 2VQAA 1OX3A 5C8CB 2HODA 3GYDA 1JMMA 4K9SA 1NG0A 1L0NJ 3JUUA 3TNQA 4Z1VA 4L97A 3HNMA 5A3MA 3NWKA 2ID4A 3ZFFA 1DZRA 3WG3A 3TSIA 1QJFA 1RUI1 5C5TA 1JODA 2H0VA 2L5GB 2QQNA 2JG8C 2NMNA 2C9KA 3OD0A 2BVVA 2GNMA 3GZUC 1S9KD 5LZ6A 2CYFA 2W6BA 3O1OA 3GGLA 1HJFA 5DDJ3 3DEMA 2WNUB 2E26A 3NNLA 1NTMD 1UKRA 1H8TA 1AYN1 3BTXA 3H6PA 1JCDA 2W46A 4LEJA 2KNCB 4A44A 4GH4B 1YJWP 2W83C 3ZXEA 1YHQP 2OYIA 3QD6A 3MF9A 3ABZA 1LTTC 3C1LA 4AVVA 4FPOB 3WCRA 1Q5OA 4QKFA 1URQC 2LS6A 1X8YA 2Y0EA 1AV1A 2G3AA 1PO11 2WA4A 4E27A 3RI8A 3AE9C 1POV0 2P7JA 2K37A 1PX3A 2PHUA 3HQUA 3M4FA 3MFAA 3DECA 3GHGA 3VBUB 1YHFA 4XE5B 1HB1A 2XHKA 3L74G 2XNXA 1GP5A 2J1VA 2YXRB 4C7NA 1CJPA 1LAJA 1TE1B 2FCTA 3ILRA 3V56A 4I0AA 2DCKA 5IVJA 5DAWA 1UPIA 3OW2O 4QKBA 3OPTA 2BCCJ 3WF0A 4Q4Y3 5DG2A 5CISA 2A3YA 2A06G 3KZIH 1XC6A 3M3OA 1NOHA 2WDBA 3LEMA 3TEWA 2VOKA 2E5YA 1H0TB 2XL7A 1N7SA 1LOCA 2W0XA 3NTNA 5CMZA 1Y47A 3K4ZA 2OX0A 1N3PA 3V2RA 3HEIA 1KQLA 1LHWA 3CJIB 2R30A 5FXZA 3VBSC 2IX7C 3F5HA 1H8AA 1SLLA 3BIWE 2VZ3A 3J8F1 1QVGO 5CKMA 1XRUA 2ZGUA 1SQVK 1F4HA 3ZSKA 5CFCB 3ZFEB 1IHMA 1PMIA 3LEGA 3QCWA 3MGNA 4UBGA 1ZRIA 5GLVA 3IMNA 3INAA 1MVEA 1SQXJ 2HYKA 4LHNA 3U1CA 3UYJA 4P9IA 2XHNA 1RMU2 2K0GA 5BNNC 3B93A 3J4UH 3PNAA 5FY9A 2IZ1A 1RE3C 4DUWA 1GNYA 1GFF2 5BUVA 1KS4A 4PJ0H 3WHTA 2AEFA 1AFOA 3PUQA 2G9FA 5H2FE 4JDNA 3CIHA 1L4AC 1VQPP 3CO2A 1JUHA 1CZQA 3R6SA 2I1KA 3Q8EA 4MXVA 3CX5E 5A3TA 2ZXXA 4GDOA 5K0UC 3BYWA 1VBE3 5JXHA 1MZFA 2YZ4A 1W6NA 4O7XA 1HJ0A 1TMF1 5IW0A 2ORZA 1BGYD 2N9BA 1BE3D 5FPVA 3ZXLA 5D8AA 5J37A 5DABA 4YVWA 4B1LA 4EIJA 1BCCJ 4KU7A 4JBZA 2RV9A 4QB2A 4NIHA 5B66E 1S0JA 5FTTC 3MHVA 1OOPB 4NHXA 1GDTA 1VR3A 2E31A 5E16A 2OYZA 3W20A 1DG6A 1SPPA 3BTYA 3IAQA 2JKXA 1ASJ1 1YFUA 4CUCA 4LO4B 3ZXAC 2E5TA 3HOBA 2WNVA 5M1BA 3GF6A 4BM8A 3E6CC 5F5IA 2B88A 1F15A 3NRUA 3JCUH 5SV5A 3H1KD 3N9LA 1HB4A 4U3FG 1E79H 4L92A 3M9HA 1ZLLA 3WR0A 4BU2A 1XE0A 3T08A 4O65A 2AXCA 1KD1Q 4HH2A 2WITA 5LASA 5L8RJ 5FKCA 2PHWA 2JKVA 5EFWB 1USDA 1YJKA 4YFWA 5FZ3A 2QNKA 1SFCC 2ZVOB 4ZXEA 5FZOA 4K20A 3FFZA 3OF1A 2B9BA 2AR6A 1NTZK 5C3SA 2Q1KA 5AVVB 1HTLC 4AQRD 1PGOA 3WDVA 1BKZA 2WSCJ 1VBE2 4IEVA 4AFAA 4BOWA 3N9MA 1YYCA 2YC4A 1ZZ9A 4XOGA 5A3WA 2ZACA 1W6MB 4FT8A 1KB9I 2E75D 3EQ2A 3M0DA 3AMMA 4OHWA 2E53A 4E8CA 1HW5A 2BBAA 1RC6A 3OTFA 4JKMA 4H13C 5FZCA 1NUKA 4MHUA 3N7NA 1YUDA 2ZX0A 4QHBA 5JCTA 4F3JA 1FS0E 1E57A 4EDFA 2W87A 5JI7A 1IZ3A 3L35A 4BRYB 4ZMDA 1FYUA 5LBBA 1D2SA 3A22A 2JG8B 3VD9A 1W06A 1UNBA 4P9GA 4BQ5A 5DPNA 2HWE1 3PU8A 3VDDC 3VL8A 4PLMA 4S2GA 1ZBA2 1X50A 1WMKA 1RUJ3 4LK7A 4AGGA 2X8KA 3IDAA 2MNGA 4Z8BA 4CZSA 2DW3A 4I7ZC 2AXTE 4I01A 1KQGB 3M91A 4M3CE 1IZNB 1EYBA 2EAAA 2IXCA 1AR63 3B02A 1H9PA 5FFOC 2JEMA 1C8M1 4PBOA 4ZKUA 5FZGA 2YYOA 3WQ7A 1XSRA 5E79E 1FT9A 1AJKA 4LULA 5DUWA 1JU3A 1URQB 3NAPC 2D44A 4ATEA 2JIJA 2GU9A 2ZX2A 1CD3G 4IGQA 1NA1C 2GUVA 5H9PA 2RMZA 1ENQA 5H2FH 4B29A 2B8MA 4O9BA 5DUUA 2ENRA 1JYWA 5LBCA 1Y9MA 4XVHA 5HV0A 1FAVA 1FNYA 1ONAA 5FLJA 2XBO1 3AE6C 2QJYC 3CX5H 2A73B 3T1LA 3N7LA 3VBOA 2G8YA 5GALA 2ET1A 3MDPA 2RE9A 2R1DA 3L74D 4LK6A 4YW1A 3N9OA 1H9WA 1GQGA 1GK4A 1LNQA 1PZQA 5KLVK 5A33A 1UOBA 5BU8B 1VBD3 1JYNA 3L2YA 2Q5TA 3OD4A 2ZMLA 1H89A 4CYDA 3TN93 4IFMA 3O5SA 3ZYBA 1BMV1 3P3NA 5CCHD 2WS93 3DCQA 2CDOA 1WUVA 3O1VA 4RR3C 5B66H 4HKOA 1POV1 1CJDA 3HQXA 4HPKB 2A06D 1RUJ2 1SP4A 3CZUA 1Q8QA 4CP2A 3H1HD 3IKWA 1RUC2 1LULA 2P3IA 4NPEA 3ZPOA 3FJSA 2NQYA 2A75A 1BEV1 3JBG1 2C0ZA 2DFBA 1TZOA 4LE4A 4KL1A 1RUH2 4B7KA 1POQA 1YCIA 1NU1K 5EPAA 1RINA 2AGSA 4XDPA 4KWJA 4AVTA 4HANA 3RMYA 5D1IA 1P8JA 4OHXA 4RESB 5BPXA 2KZJA 1KDKA 2IWGB 2HWB3 4Q8LA 3MIEA 3ZFFC 1JY2N 2ZXEB 2GNBA 1JY3N 4C0HA 1UIIA 3P8MC 5FYHA 3HD7D 1HN0A 1YNAA 3L73E 1AQ5A 2PHTA 1NTKE 2ZX1A 4ZKTB 3S4RA 4R4ZA 4ASWA 4CDQC 3BVHA 4AFMA 5IWFA 5I0RA 2P37A 2YBPA 2B39A 5C3RA 1ZA7A 1J2JB 4L74A 4V2WA 2ZEXA 1ODMA 2EF6A 1AHSA 5A3NA 1QKQA 4QKNA 2P6CA 5A1LA 4RL7A 3RYRA 4D7YA 5GLWA 2OARA 2ZJSE 5FQ0B 5GLUA 5GTIE 1T2KD 3O1MA 4MH0E 1CIYA 3F2ZA 1AJOA 4WY4B 2IBZI 4KU8A 3SC7X 2OYIC 2BWCA 1YI7A 1I1EA 4EWEA 2ZHLA 5AFBA 5FP7A 5KHKA 3UL2A 2XMLA 2WTYA 1GR3A 2FYUD 3AKSA 3SEEA 2KXPB 3C7FA 3TYJA 3T2QA 1ZR4A 3L4FA 5AVPA 2YC0A 3ZR5A 4J1WA 3S30A 4AW7A 1RVF1 3FLPA 1YWKA 1Z78A 1I9RA 3M3EA 3POYA 4XETA 1DYPA 2AXTH 4PQQA 4MG2A 5AVXB 1JOJA 2WQ8A 1SHWB 5BXXA 3AJZA 2DUQA 3C3VA 4M0HA 3MLJA 1S9KE 1PVXA 4LBQB 2B46X 1LP1A 4U3FD 3B5NB 3B7MA 4YM0A 2GH2A 1W2EA 3MV11 1KC8Q 1OLQA 5E79H 1G9CA 1FMD1 1NTME 1DGRN 5T5JA 1SFCB 2R071 5JSOA 2ERFA 3BRTB 2IPPA 1P84D 2QZ2A 1RL3A 5T3NA 1LGCA 1MQTA 3N9PA 1BBT3 2YG0A 3OY8B 3FHIB 3VZLA 5JZGB 4UB6E 1VRH1 2WNOA 1RYYA 3N7MA 1OD3A 3RK2D 3RZGA 3UKVA 2E76C 5A6YA 4GAZA 4N9IA 4H13B 4EYYQ 1XU2A 5IAVA 4ZZ5A 1UXZA 4EN0A 1A34A 3AC0A 4WVVA 4WVMA 2VZTA 1HLCA 5K4LA 3MTUE 1SBEA 5J1XA 4WM7A 1K05A 1V0AA 3I2FA 3GCXA 1UWWA 2R062 2BJSA 3NJZA 3ST7A 1R1A2 1NTKJ 2CGOA 4QDSA 1PVC3 4IE4A 3VDDB 2RVAA 4UI9L 5BV6A 2AEJA 1SG3A 3MIFA 3FLTA 2BW8A 5HPOA 4QX1A 1QQP2 2EIBA 3SFDC 3U1XA 4RHV2 5FIXA 1IS3A 3S6PA 1UY2A 3UNPA 4PLOA 2HKXA 2C9AA 1SS1A 4GMP1 3FUOA 5JIUA 1BLZA 4COZA 4META 2I07B 2QIWA 3P5BA 2XPJA 3A21A 1WZXA 1LU2A 2B87A 3S57A 3ASIA 3KCXA 1PP9G 4N43C 5D8AC 3FGAD 1R083 2QVAA 1MEC3 3LA3A 4C8DA 1IFIA 1R8EA 2JDIH 3LEIA 1WCQA 3PUAA 4PDWB 2QA4P 3I3BA 5APSA 4CDWB 1U7MA 3NAPB 5FMDA 1UO9A 1K04A 2RS51 2CSGA 1ENXA 1RJ7A 4OI0A 4LLOA 5LY2A 1Y8AA 2Y34A 1U7JA 3D3AA 4Y1VA 2VZUA 2QJYB 4JGYA 4E4SA 5FPAA 1QX8A 2D40A 1NY72 5FXVA 5C3QA 2WNVC 5CCHC 2Q3EA 2UWBA 2VW2A 3CC7P 1H4GA 2PELA 3ME2A 4WVWA 1SQBG 2NPSA 2XGXA 2ZHKA 4CUBA 2JJLA 1AR73 4QPIA 1LKNA 5GTIH 4LPLA 2JENA 3ZM8A 3LSDA 4EN8B 1F35A 1R091 3WQ1A 1PPJD 3AP9A 1VF5B 4XBNA 1KYOD 2HH9A 4CTEA 1QMJA 4RR3B 2D6PA 1G6NA 2OZ6A 1BGYE 3VBHA 4N53A 1BE3E 1DLLA 2D2CD 1XTCC 3LFIA 3M9QA 4JGZB 4ITCA 4LC1A 4XILA 1RUE1 3NSTA 1NLRA 2WLPA 1DQ4A 2J1EA 1FPN1 2WUHA 1MZEA 4FVVA 3VD7A 2BASA 5CG9A 3O1RA 5CBLA 4AQ2A 1HVVA 3NQHA 3ZX7A 1OPOA 4W50A 2QCSB 3M0DC 1AR83 2Y8KA 2DVDA 4EOTA 4OGQC 5FZFA 2DTWA 4NMIA 1M1KQ 1ZM1A 1ND3A 3KS7A 4FCAA 2W27A 1JOBA 3H1KE 1CGPA 1IO4A 3NL1A 2LW8A 3AEEC 3JC22 4QXKA 3RJRA 1JN2P 3H3LA 2FDHA 4HN1A 1JMBA 1H1MA 3MUY1 1W2AX 1O7FA 4UB6H 2FMYA 1L0NK 2ZHMA 2RM23 4QQLA 3LCPA 1GL2D 2YKQA 5F5CA 1PZ7A 2PAMA 2OW4A 2VZRA 5ACA1 2KYVA 4CU7A 4QB1A 3WVJA 3GBWA 4QX3A 1H8TB 5FJKA 1V6NA 1G2CA 3L2HA 1AVOA 4XABA 1CZSA 2GNDA 3NNMA 2Y33A 3MIHA 2OYIB 2VUDA 5APYA 1LOGA 3KHCA 1VQ4P 1X8EA 1JUIA 4MX3A 5LEKA 5F6LB 4DXRA 4C91A 2HLOA 5C3PA 4FXGB 4AL9A 3GALA 3G6EP 5FYMA 2PGDA 4NHYA 2I8DA 4KBZA 5HCAA 3ZYHA 4C46A 1VLNA 3GHGB 2Q7CA 1JMUB 1VQNP 3SQOA 3MW3A 3OBZA 1GBGA 2VXJA 4FAGA 3VMZA 1YITP 4XQWA 1L2PA 2WO3A 2C9LY 3SCHA 3H1MA 1QJX3 3JD73 5T5OA 1KILA 2XNDH 3L70G 3PVEA 1LENA 2H6BA 4C7NB 1G9FA 1F31A 1J59A 2DUPA 1FV2A 3HE5A 3RK2C 1CAUA 2C9NY 4AEKA 2RM22 3OPWA 3MD0A 4GKGA 5KHJA 3F95A 3ZIXA 3WOGA 2QDRA 1SQQK 1W8OA 3LOIA 5F32A 3LA2A 2QJPC 1N7SB 2OT7A 4H44C 3MUDA 2Z5HA 5F3EA 1REEA 1LU1A 1JEKA 1DD4A 1W2NA 1VQ8P 2E76B 3APBA 1JTZX 1OA3A 5A6ZA 2JDUA 3VBFA 3BIEA 1COV2 5I0SA 4TTGA 2Y0CA 2XWBB 4DEQA 2FKWB 1G7YA 4EV0A 2X5IB 3HJRA 1ULOA 5EJ1B 2L91A 2XUEA 5FPZA 3THPA 2V4HA 2BU9A 4BWOA 2P1BA 1IQDC 1WLWA 3VMYA 1RMU1 2BWAA 5FYUA 2E42A 3WEZA 2WZEA 1UY0A 3WUUA 2G9ZA 3ZDMA 1WCSA 2OIIA 2Y38A 2EALA 4EN7B 1OVUA 3B71A 1W8FA 1U5YA 3AE3C 4ASKA 5IK7A 3CCJP 2ARAA 2A06E 5DAXA 3KV9A 3ZXKA 2FFDA 1QJX2 3JD72 5CFDA 3H1HE 4ZU4A 1N47A 3PTYA 1J1LA 3H1JG 1W0NA 1C5IA 3V0AA 3RI9A 1W6NB 1KTMA 1FATA 1S72P 2JX9A 1Q8OA 4Y24A 2HJIA 1F5JA 1FI2A 2FCUA 1PP9D 4QXCA 3I2DA 3BTAA 4LE3A 5D8AB 3L72D 5ABJC 4YVWB 1T6GC 1BYHA 1AL23 1PGQA 1W2TA 3OBAA 3I2JA 2VPVA 3U14A 2VXRA 1E5WA 1WRGA 2Z79A 4GULA 3L71G 3CMEP 1KS5A 1SPPB 1EV13 4JHZA 1Z7S2 3TBDA 3VHRA 2WNVB 4UYBA 3G71P 3WQBA 3PTZA 2D2CC 3SSUA 1JTHA 4ASLA 4LQRA 4E8DA 4GB33 4XHBA 5FXWA 4AE2A 3IFMA 1QL2A 3HT2A 5FUPA 1VBA2 3AEDC 3PL0A 3H3UA 2ZKNA 3AEAC 4LR4A 4XXAA 3ZN6A 1ZBE2 3OEAA 5FZOB 1XNTA 4L73A 1VBE1 4LBJA 2R3SA 1IG3A 4ZZ8A 4XE9A 4NPRA 5KKZC 2P3JA 2KB7P 1OW8A 4IL6X 2FYUE 1IS4A 2BNOA 3DF0A 3PLNA 2JD4A 1Y9BA 1OC1A 4ZU5A 4HK8A 1SQVG 1GZ9A 1NCQC 2MEV3 1DU3D 1EP0A 3G6JB 5EXOA 5K9YA 2MKVA 1HXS3 1UYPA 5EYXA 5FXXA 1Z56A 4Y1UA 3KMHA 3WNXA 4U3FE 1AR93 2DURA 4KGGA 1GU5A 3EB7A 5K8SA 3UJOA 1CAXA 4E2GA 4GXLA 1ZBA1 2WINB 5LY1A 4D6QA 1ND2A 4P5YA 4QWNA 2WT7A 5M0TA 3AZXA 4AWDA 3IZOA 4HONA 1UZYA 1P84E 2XLGA 4GWMA 3KQRA 1CX1A 4G9SB 4NIIA 4Q0UA 1O3QA 2ZGSA 2XJPA 3LB9A 5J36A 4XBLA 1UIKA 1UPSA 4Q0VA 3KV6A 4E2SA 3NJYA 5C71A 5LA2A 2VNVA 5FLIA 2PHFA 5F7UA 3GZAA 3B69A 1IFNA 3K3NA 5C8CA 3PHLA 2XL9A 3VBRC 3N9NA 1HV0A 2BNNA 3VLBB 4AF9A 3RK3D 3V0BA 4JGYC 2WWUA 3VBOB 4CEYA 5BNOC 4M3CB 4JDMA 1VBB3 1HXS2 1N8RQ 1QXRA 3BRVB 1SEFA 2GDFA 1ZRRA 2NPSC 4L0PA 2D3SA 3M06A 2XXZA 4N7UA 1AR92 1GMJA 3ZSMA 4QPIC 3RVHA 1NTZG 2DV9A 3JU9A 4I09A 3H1JJ 2ZYAA 1RUJ1 4NAOA 5IAXA 5JMOA 2R6QA 5KBFA 2WO1A 1RUC1 1ZREA 4IW3A 1Y3TA 2J1AA 3OUJA 1K8AQ 2VZPA 3O0VA 3W59A 1UU5A 3K77A 3RQ0A 1GKBA 2RS33 3M70A 1EXJA 4BQ3A 1RUH1 4OI4A 2W08A 5AVRB 1VAVA 3O14A 4BXSV 5LK7B 2Y0OA 4Z82A 1ULEA 3USUA 4YNIA 3ETQA 4P9XA 4YYOA 4RFT0 2BBVA 3EJKA 4MGQA 3WUDA 2P3YA 4CP1A 3VZOA 1ND3C 3AVSA 5CBOA 3VBUA 3PVOA 3IT8A 2XLAA 5FMOS 1T2XA 3BALA 2XJQA 3CL3D 2BNMA 1PPJE 2RS12 1KYOE 3AFGA 4OZXA 1B35A 2K9YA 1NCRA 1OSGA 1KQRA 2X05A 1VBB2 1AYM2 2WZR3 1VBD1 5EIYB 1KORA 4ATFA 5CCGA 4HT1T 3EHKA 3OA7A 1JI6A 4FPHA 1JYCA 3S0MA 1EDKA 2QZ3A 1JOPA 3LW5J 3B9IA 4AVSA 2AEMA 4COYA 2WNEA 1JXNA 1SQVJ 2YO3A 4QQ2A 3U11A 4A6SA 2E74D 3OG2A 1S0CA 1DD3A 2Z5WA 3ZN5A 1CZTA 4Q1PA 3VTPC 1HBWA 3RZHA 2RS32 5AVSB 5DZGA 4FFFA 1ASJ3 3L71D 1JZ7A 2KLUA 3K4DA 4Q4V3 2FMDA 1DBNA 4MYEA 3I3EA 1UAIA 3J7MA 2I1JA 5GZDA 2KXLA 4DEVA 4LBLA 2WJSA 4IEOA 1GZWA 3CEWA 1XYPA 5KLVG 1EAH2 2ZGOA 1CN1A 4RQPA 3I2IA 1QLED 1C5HA 1XYOA 3S5QA 1YFYA 2OYOA 1DQ5A 2OA2A 3BTZA 5IHRA 1D4M2 1OVVA 1LP1B 4LKSA 4CA9A 2N1TD 4H0LC 1KILC 4Y99B 4D6SA 3R2PA 1MACA 1SLQA 1OH4A 1JZ4A 2UY9A 2VMGA 2WWJA 2BERA 2XH6A 3WNOA 4KG8A 2WSVA 2RDSA 2B89A 5FZ0A 4NIDA 2CDPA 1W03A 1S55A 2WZR2 4EWDA 4HKWA 3KHBA 1MQTB 4LJHA 4LO6B 3RBZA 2HWC2 4OI2A 3BU0A 3TF5A 2P6HA 5KKZB 5FP4A 4UFMA 1NU1G 1EZVG 3TNUA 2HFED 2P5BA 4W65A 3HUSA 1Q86Q 1IS6A 2KK7A 2XQXA 2O3JA 2EIGA 2KP8A 4N8MA 4FOQA 1IFDA 1JM0A 4Y4RA 2BPA2 1GL2A 1OWAA 5LA9A 3VBFC 2OTLP 3H50A 1IPKA 3LDBA 4DUVA 5L36A 1QEXA 4WVMB 2WKKA 5JIAA 2K1AA 1OD5A 2A7AA 2R061 5DXDA 5IFTA 3U78A 4WM7B 4Q4V2 2O1QA 4K21A 4MV2A 3H32B 5JVVA 1QQP1 5BNQA 3H1ID 2OUHA 4RHV1 4IL6E 1FOSE 2DVFA 3MZWB 2NP0A 4IV1A 1DFQA 4D6TG 3Q3DA 2Y0DA 1HB3A 1ULDA 4XF4A 3D8CA 5AFEA 3SXWA 2Y64A 2ZGLA 4AHYA 3AXEA 5J48A 2FFDC 2E7TA 1SZBA 4BJ0A 4XFJA 1NTKK 3GJBA 3GZTB 1HB2A 4CCEA 2N9YB 1GYKA 5AVWB 3WW2A 1W2BO 4EWAA 1KXGA 2B87B 2WWWA 4Y28J 4FTEA 1DGLA 1QF3A 5GM0A 2QM7A 4I0BA 1W6MA 2QVSB 1WBLA 5T50A 2JICA 2YDEA 2JWDA 3ITQA 3LEKA 5FWJA 4MUVA 3ORJA 2Q30A 2NYYA 4Y5Z0 1UY1A 3POGA 3W58A 1EDIA 4AFDA 1WMEA 1LGHB 2WMMA 5E1RA 1KYOH 5L19A 1QWRA 5EV7A 1X82A 2JKBA 4DY3A 1N1VA 4IGPA 2QBXA 1O59A 1NY71 1MUUA 3IF4A 2VQTA 4OMCA 3TNPB 2VBDA 3CMGA 4J25A 1KB9D 1M8OB 3RZZA 3VN4A 3HVDA 5F8PA 2ADDA 3C8VA 3IWZA 3EO6A 5C70A 5C7GA 5APTA 3RBXA 1S4CA 3NKTA 1YO8A 1GU3A 4S2HA 2FDKA 5KC5A 4Y5SA 3AZWA 1OW6A 4QPIB 2XVGA 3H1LD 4NPDA 1CSBA 1NTZD 1PVC1 3POSA 5AW9B 3PMEA 2Q5UA 4I3GA 2ATFA 3SH3A 4MGIE 1POV3 2FCVA 3M8LA 4XFGA 4MZUA 1HRV2 1KEXA 5IVYA 4HK9A 2TBVA 1RF0C 3VBHB 3WINE 4N53B 3HE4A 3A23A 1PO22 3CF6E 2VGDA 3L72E 2WFF2 2WWSA 4GKXA 3SKJE 4BLIA 2LXCB 5KXCA 1NQDA 2BUKA 3MO4A 5GJ6A 2RR12 4S2FA 4BPZA 1QHDA 5C39A 1OUSA 1NAYA 1I3HA 1T3UA 1CR7A 1R081 3OGJA 3L75J 4XUOA 2GNTA 3H9AA 2XZRA 1IQAA 4YXDC 1NWQA 5L7OA 5GZGA 1GMMA 3MP7B 4QQOA 5GLZA 1URXA 4D3WA 1GU4A 3CWBJ 3SISA 3FE5A 3MICA 5EQUA 3S7IA 2CNAA 3FHAA 1O4ZA 4NRPA 1LWUB 4DZGA 4AEDA 3A0HE 1ND2C 3W67A 4ASVA 1N1TA 1AR71 3BCCJ 1XYNA 3VDBA 1T6BX 5CJ0A 3HRNA 3N7KA 2WAAA 3D70A 3AMQA 2BOIA 1IKPA 3EWKA 1JNMA 1FZCB 1OLMA 1N1YA 5C33A 3ZYJB 1IPSA 2W1SA 2Q9IA 3ZYGA 1PZ8A 1NT0A 5FOJB 1G2CB 1LTJC 2X29A 4Q4X3 3GW6A 1Y9GA 4CU6A 4JYBA 4DRRA 4DRVA 2OXBA 2QQUA 5DZFA 4DJGA 2ZX4A 3HN3A 1FU1A 2BP6A 3QH6A 4UOJA 5KJ7A 4OVEA 1RVF3 1BJQA 4IL6H 4DY5A 2N1TC 4PCRA 4MSVA 4YWAA 5C8CC 1NVOA 5AW0B 5KLVD 2FYZA 3A0NA 1FNZA 4YGEA 5T54A 4NPFX 1W39A 4JCKA 5FOBB 4BWNA 2W3JA 5JPMB 4P9YA 3AE4C 3HD8B 1WW4A 2XVLA 4CEWB 5FZMA 2DYCA 5A80A 1OBNA 3RPQA 2CWSA 5GTHE 4IFFA 1T6AA 4NPMA 4H0LB 1RXFA 2E75B 3NV1A 5GZEA 4BZ4A 3LSEA 4YM2A 1V6IA 1LT9B 4XJUA 3PJYA 5D21A 2RM21 5IK5A 3VD4A 1CAUB 1VQ5P 1D0GA 2WNUC 2PAJA 3T4VA 3PIGA 2PFWA 5FY1A 1GOGA 1VRH3 1NU1D 5FPBA 1PIV2 2JWAA 3OUHA 2C4XA 1GV9A 4FPYA 4H3WA 3CLQA 1J3RA 2HG5D 4IEQA 3IIAA 3HMYA 3WUTA 3TEYA 2FXOA 1COV1 1LNSA 4DXTA 1KN7A 3MV01 2BZDA 4Q4X2 2Z42A 4FO9A 3MLKA 2GAUA 3O0WA 3VBFB 2D5FA 3RK3E 1FDIA 3KGZA 2IBZD 1QOTA 3I3MA 4GWJA 3KHUA 2KM2A 1JO5A 3WDTA 2Y9ZA 5T55A 3VBUC 5JXGA 1L0NG 1URQD 1L0LD 5HCHA 2YNYA 4YZ5A 4LBQA 5J09A 2VCAA 1DEEG 2JDAA 3PMSA 4D6TD 4CXWA 2YBKA 1EDJA 1QJX1 3JD71 4KT0J 4Q26A 4GMP3 1S0BA 1O8SA 5CFDB 5CCGC 5HCFA 5FPUA 4FP3A 3USSA 2AEYA 3V0AB 2QEXP 1HF9A 2XWJB 4BMEA 1VAMA 4E4DX 1S1AA 1RTVA 5FZ8A 3G3ZA 3FXDA 1VQOP 4BISA 1NAFA 3P1IA 4ZS2A 2BEQD 5FCCA 4KJMA 1J3QA 4IEZA 4FAHA 2Z2SB 1S0IA 2YO2A 2E51A 3T0BA 2DCJA 4O9GA 2DVBA 3CXHI 3CJIC 1CWPA 3K2OA 1VL2A 4NR1A 1R5SA 2XB6C 3E1F1 3U0ZA 5FYYA 1K42A 3EYPA 2O14A 2ZKLA 2ZX3A 2W95A 2FDGA 3A0HH 1LT1A 1Z7S1 5A6XA 3GBFA 3D6YA 1WGPA 1JHNA 4QM8A 4XFCA 5JOXA 2VAUA 2FHRA 1JU4A 1VBC3 3WCSA 3VZMA 1E5SA 2FD8A 4RQPC 3VUOA 3BPSA 4LGDE 4PD4I 2O01J 1S2EA 5IJRA 4RGKA 3LIGA 5FZ6A 2GMEA 1TVGA 5CVRA 3RJ2X 2HPCA 1JTHB 1VBA1 3NJXA 4YG3A 1ZR2A 4D0QA 4XAEA 4ONUA 4X8NA 3V4WA 4HZFA 1SQQG 4QPYA 3WD5A 1J1EC 4PIXA 1S3JA 5FAXA 2FBEA 3HQRA 4UFIA 1FPN3 5AW5B 5CA6A 1PV3A 2HWD3 1O4TA 2BCCG 1L4AD 1OXCA 2R44A 2Q1ZB 2KZIA 3CCVP 4PDWA 4BYYA 3HUSC 1YFXA 4XFBA 1RY3A 4FPKA 4HJGH 2WVRA 2B9VA 1OOPC 5GTHH 4LHSA 4ASMB 1LODA 2HYXA 5E88A 4BMBA 1YTZI 1VB4A 1QH7A 1D2QA 3QH7A 2B5HA 3T09A 1S5LE 2Y6FA 1EV11 2Q1FA 3PJSK 4JRAA 3NKGA 4Q27A 4LOTA 3WP4A 1LTSC 4XQ4A 2JJ6A 4CXXA 4ES9A 2GUSA 2Y6JA 1J1TA 2M0BA 5L9RA 1YTZT 1VBC2 5I0DA 4URTA 1ND2B 2YIUC 2WT7B 2JDYA 4PBPA 1TQ5A 1X7NA 4IV1C 3CHXA 2XVKA 3WZ1A 4LKDA 4WM8A 3E5UA 4C90A 4PHZA 3N7JA 1O3RA 1H88A 4ZPIA 4ORFA 1C4RA 4JGZA 2NM1A 1X22A 3B5ND 2EIEA 3PRJA 3R05A 1QJEA 1SQPJ 2PQQA 3HNBM 3HBZA 4XFAA 3WNPA 2IVIB 1PHMA 3MPPG 5T52A 3I7DA 4BQ4A 1ST8A 3O1PA 1SFCD 2V72A 4Y33A 5BU5A 3WG1A 4R9BA 5L9BA 1M4WA 2BOJA 2ZMKA 1W9YA 2WC2A 1W2UA 4RSUA 2PN5A 1HX6A 1W8NA 2ZT9C 3KGLA 4Q4W2 2G1MA 2WQZC 1T3JA 2RJ2A 1HXS1 2W1QA 3MEPA 1OA4A 3M3IA 3V0BB 4QGMA 1MS0A 4X8PA 3H1IE 1XE7A 3TRSB 2ET7A 3T4HB 4CEYB 2WPVB 1AR91 4Y20A 3AYEA 1DIPA 1JZ3A 1CAVB 2GC0A 3TGUD 3D5OA 1GLHA 4H13D 4UWDA 1F8VA 3TWIA 2DF7A 1S0GA 1VMHA 4AUWA 5FY7A 3CU7A 4JDOA 4WZFA 1O4YA 1YQ5A 3T0DA 4YVSB 2ZYDA 1OHFA 2XQRA 1N73B 2A6VA 3ZDSA 5CKNA 4LO5B 2V5DA 1ZX5A 1DCSA 3T2OA 3LPGA 1WLDA 2UURA 3E6BA 4WZCA 1VQ6P 1KDMA 2OKXA 3TYYA 2FDJA 3K3OA 2PMWB 2OPKA 3V5BA 1PO12 4UW4A 4K7JA 2PLV3 5J98B 1KB9E 3USUB 3KYQA 3FMGA 2VBBA 1U5ZA 1H4HA 2GN7A 5C9AA 5L7OC 2J42A 1RMU3 5A7SA 1OFSA 1RE4A 1OURA 1L0ND 2XJSA 3L36A 2UU8A 1UCXA 1VQLP 2RS11 4GWNA 5BY5A 3H1LE 2ARBA 3AVRA 1GW4A 4FSJA 5TISE 1VBB1 3BPZA 2AZ5A 1ZXGA 1AYM1 4YFZA 2LTNA 2EICA 1UMIA 4ZY9A 4WBAA 4W80A 1B35B 1SQQJ 1NCRB 4OFGA 1WW5A 2H0BA 2KR2A 3G7DA 5BYNA 4Q29A 5FWEA 4Q2FA 4M4RA 3AE2C 2F17A 3PVNA 4XW3A 1RHI3 2XKOA 4FFGA 1X9TA 1XB9A 3WUCA 3QOPA 4RJTA 3KF3A 2TEPA 2V7QH 3WMM0 1RXGA 1IGOA 2PTMA 5IVCA 1VF5D 2RS31 4AG4A 3M2MA 1RUF2 5FYIA 1H6XA 4UW6A 2Y9YA 2ZEZA 2GSYA 2H6CA 1DP0A 1N2DC 2ZS6B 2JDZA 3M0AA 5A7WB 2XLFA 5KJ7C 3CDZB 3P3PA 2X5IA 2Q8CA 4XC9A 1JUNA 3I54A 2IXLA 3H1IJ 3C7EA 3Q8AA 1GZWB 3ZXFA 3K4AA 2PLV2 2UYBA 3GCWA 1D4M1 2QQKA 4RQPB 4QPWA 4XACA 1UU6A 2WSFH 3CC4P 4RGAA 3VHOA 2F4LA 2OS2A 3AMPA 2A6WA 4G3YC 2XDVA 3OJAB 2Q6QA 4CCNA 4AGRA 2DCZA 4R4MA 2H43A 2O0OA 1M1JA 2B42B 2QQOA 1AVYA 4R9DA 3PURA 1SCSA 2WZR1 4KG0A 1LTAC 1J1EB 2HWC1 5FO9B 1TMF2 4DNYA 3O6QA 5CJ4A 1OIPA 2BCCD 3AP5A 2C6SA 1K5MA 2E7AA 1RHI2 1AX2A 3TNUB 3AE7C 1JH5A 4WY4C 3HUSB 3D6EA 1YYNA 4Q1RA 2YXSA 3PU3A 1KQFB 4QHOA 3THDA 3T97A 3THTA 1GL2B 1QOOA 1LOEA 2WYSA 3ES4A 5EJ3A 4K1ZA 4AI1A 1NXMA 4QX7A 4EJRA 5BVZA 4CXYA 2C26A 1MS5A 4Q4V1 3JQWA 1UY4A 3L37A 1ZRTD 1F5FA 1HWTC 4HSJA 1ZP0C 3SCFA 4OI1A 3Q8CA 4M00A 4BQXA 1CESA 2D6MA 1GOFA 1ZBA3 2BGPA 3JB4C 2D43A 1IS5A 4BK4A 1ZN5A 4I30A 1WLTA 1SQXD 2YIUB 3B5NC 4Z2AA 4MLOA 1A8MA 3BOWA 4IV1B 5LA1A 3CKHA 3LKJA 3OB8A 5CNAA 4TYSA 3WF1A 2RKLA 2CTVA 3ZPYA 1NXD1 5AVYB 4W6YA 1NU1E 4JZRA 4MADA 5KR7A 2W2IA 3P8CD 4YZ4A 4HMZA 3IIIA 3CCQP 5JZGC 4Y22A 5CBNA 1LESA 4XCAA 4C1XA 3O1SA 2ZPXA 2QQWA 3MPBA 5CAZA 1BCCD 3KV4A 3WU2E 2IBZE 1QJU2 2WPSA 5FYTA 5TISH 2HR3A 5EJZB 4HETA 2JWPA 4AQTA 2WO2A 2RDNA 2JDHA 2VZQA 2ZT9B 1O91A 4M3CF 4P14A 1L0LE 1WCDJ 3AE5C 3RL0B 4JVAA 5HBAA 3THCA 2EXIA 5KHIA 1N7SD 2IVJA 3BB6A 3VYIA 5CB7A 2A5ZA 1KRIA 3FXEA 1S0EA 2R042 1QVFO 3AKPA 1LEMA 1YRZA 1EY2A 4D6TE 1IC2A 4MGSA 2HWE2 2E76D 4KWUA 4BHPA 4FPCA 2OPWA 3HN1A 3K75B 4HN0A 3OCPA 1OZHA 1HRV1 3WDWA 4I6MC 4BLJA 4NN0A 3OGGA 4Z92B 2HBUA 3R4UA 3LIEA 1SBDA 1RUC3 2ZMNA 3PH0A 3SWYA 1C1FA 1H1AA 3HE4B 2W8ZA 2Y6GA 4P9JA 2PHRA 2W91A 1C8M2 4AVCA 2VE1A 5L9VA 1RUH3 4YGCA 4XUTA 2OYHB 2VR4A 3I4IA 1NE6A 3LZZA 3GBGA 1Q56A 1D4VB 4PDWC 4CDWC 1LCLA 4OUEA 3LOBA 3PP5A 4GIFA 3NV4A 4FTSA 4XJAA 3N35A 4I0WB 3ZFGA 2R49A 2A45H 2UY8A 2JDMA 5CZKA 5L7OB 4HFSA 4FPFA 1PGL2 1H6YA 1DQ1A 4KHXA 1VALA 5IVBA 3HAGA 1C8NA 4L2NA 4Y1XA 1KQSO 1MZ9A 4M3CA 3KQ4B 3U37A 1OF3A 1MPXA 1KJRA 3HTKA 2PHLA 1VMJA 2ZOEB 1G9AA 3AMHA 1NTKG 2DU0A 4AEDB 3WSOA 3VZNA 2IZ0A 4IERA 1OKQA 1STMA 1YBKA 1VF5C 3MFCA 1DQ0A 1H8VA 2QFEA 4CDUB 1RJ8A 3MYXA 5FZKA 1FDOA 2VZOA 5CHXA 3POBA 2HEVF 1UZ0A 4PF1A 3UV9A 3MW4A 2RG4A 5DZEA 1Q2NA 3FBYA 4KWKA 4JGZC 3NNJA 1H1IA 2TUNA 3RGBA 1PK6B 4HBNA 3POIA 4QPGB 1DYKA 1S4XA 1TU3F 1EXIA 5A3UA 5B4NA 3T3YA 4R4LA 1REDA 1IOAA 2D5HA 4XUQA 3T0AA 4DMIA 3RL0g 5C8WA 4JQRA 1L0LJ 1PIXA 1QJY3 3ACIA 5BNNA 5JMCA 2J22A 2JB4A 1V6OA 3X29B 5FYZA 3KQGA 4COUA 5JOZA 2AENA 1XTGB 3OEBA 1L4AA 1S1CX 1NHLA 1XPWA 1WT6A 2QE3A 1UD1A 5AW7B 3F89A 3LPFA 5FRAA 4OGQD 2WIIB 2WZ8A 4M4PA 1K5JA 3PTRB 2JXAA 5F37A 1DQ2A 4DO0A 5J7MA 1GOHA 1HDKA 1EZVI 1NTMG 2AUYA 1A78A 3LGRA 1FZEA 3WU2H 5LBEA 4WB4A 1S2BA 4XEZA 4RA0A 4OUMA 2KS1A 3KB5A 3WV6A 3II6A 3IAPA 1L3JA 1PIV1 1WMFA 4JC1A 4XPVA 2E63A 3ZYFA 1H8TC 1VDFA 1XNBA 2QDNA 4GWIA 1VPCA 1GZTA 4XMAA 5E89A 2SBAA 4KI5M 4Q4X1 4YW3A 4P5HA 4CCOA 4YM3A 1U57A 2CAVA 2Z4FA 4LORA 2RJKA 4QT6A 1ULFA 4XFFA 4MOAA 5DJTB 2QKDA 2R063 4LKEA 1BSNA 2BTVC 1R1A3 5C9AC 1ZZBA 3WT3A 2ZFCA 3PVBB 1OH3A 1SLAA 1FOD3 4OUSA 3GHGC 2D3PA 1QJY2 3TGUE 1S0FA 1QQP3 2Q8EA 5H9QA 1GQHA 4UT5A 4RHV3 2OQ7A 3PUIA 3AEFC 3I59A 1FMD2 5A3PA 2ZAAA 2QQIA 1Z0HA 4TT3H 1U12A 4X6QB 2R072 3T2TA 3ZXJA 1AJYA 5KLIC 1FX5A 5DUVA 3UT0A 1SLBA 1FE6A 3SCGA 4IE6A 3C7HA 3D6ZA 2CPBA 3Q5PA 4N3YB 3V4QA 1W0OA 3U1AA 3TOJA 3VN0A 5F6KA 2D7FA 5FO8B 4AEJA 1NH4A 3OAKA 1N7SC 3KSCA 3KLSA 1MVQA 1MKMA 4JRLA 1YQ6A 4CP9A 3O0XA 2DVAA 4GALA 4IE7A 5FREA 1W6OA 4YZ3A 5DMYA 4GD4A 1TME2 2ZGNA 2X5IC 2XOMA 5FYSA 4H44D 1UZZA 1RF1B 4U2AA 1IJDB 1PGSA 2GZWA 2XG3A 3I2OA 3L73J 3KV5A 2SPZA 4RKUJ 3IAOA 1UW8A 3WP3A 3H32A 2WSSH 4AXOA 2CHHA 1IKQA 2A70A 2H8PD 1U5XA 1V00A 4FQZA 1FOD2 3B9CA 4IUGA 2HPCB 4OH8B 1E5IA 4HKLA 2EXJA 1D7PM 4Q8KA 3G9RA 2Q8DA 1HV1A 2YXQB 2YY1A 4IQPA 2YGLA 2XR4A 1ZOYC 5LEJA 1HQLA 2CPSA 1BGYG 4LHLA 1SACA 1YIFA 3NO8A 1IFJA 2ZVNB 4NWWA 3DN7A 4Q0QA 1HRI3 4AR2A 2DVGA 1X0TA 4YVWC 1A6CA 4H2AA 4BQYA 2Y60A 2XJUA 5H9SA 2VUAA 4CCMA 1I6XA 4N78D 2ARCA 3LE0A 3MIGA 5KWRA 2J58A 2IYOA 2DFCA 4XJZA 3KWVA 3WNLA 3VHPA 3VKFC 3RWKX 1VE0A 4AYUA 4I2OA 5FBZA 2ZZQA 2BEOA 4Z07A 5JXIA 1X36A 1VBC1 4UF0A 3POJA 4AAPA 4BQ2A 2E74B 2A1XA 1NTKD 1R092 2PRRA 1IPJA 1NTMJ 1UIXA 1UMHA 1DH3A 4I3PA 4B1MA 3M9BA 1H2KA 2PYTA 2GA1A 4QX2A 4WM8B 2BCCE 2XKMA 5JSRA 5AW4B 3FWEA 4PJ0E 2D3RA 2ZGRA 4OYUA 1HKDA 3R4YA 4BH9A 1N3QA 4GIQA 4NROA 4PLNA 1QJZA 2W6AA 4BIOA 2H89C 1MS3A 3N4XA 2HWD1 3SLIA 1O8PA 2J1RA 2KD7A 2Z5IA 4M3LA 2QQVA 4FPGA 1ZMEC 4XA4A 1PGJA 1HRI2 4HSLA 4YG0A 1EDLA 4Q4W1 3FWNA 2LROA 1ZRTE 3NJVA 5FYCA 5E6HA 4BQWA 2EXKA 1OQDA 1SQPK 1JB0J 4HL0A 3VDCA 1OVRA 1MS9A 5E8AA 1SQXE 5FK8A 1AX0A 4S2DA 3AP7A 1RB8G 2WSEJ 4PV1C 3AEGC 4Y20B 4CDQA 1G86A 5JPNB 3J7NA 4WWIA 3E1RA 3U75A 1RUG3 4CUAA 4Y1YA 1PFIA 1LWUA 5KXEA 2I45A 1V6MA 2IDBA 1RUNA 5FMBA 3FC0A 2NMOA 4LIUA 5ACA2 2Y6HA 3JCUE 3P8CE 5FZEA 2GH8A 4R4XA 2VJXA 4TN7A 2F4PA 1FZCA 3TB0A 4IESA 5SV8A 3GG2A 1W0PA 5FP9A 3LAGA 3M3CA 3D4KA 4XAAA 1TNFA 2MHFA 1BCCE 1QXPA 3U07A 1COV3 2W68A 3CMAP 2R5BA 5IYYA 3B3QE 3ZLIA 1Q8VA 3PJQA 2GMPA 2YC2A 4DOUA 5LB6A 2WSEH 4AEMA 1QH6A 3A0KA 3MZHA 1JYXA 2VVFA 2DCYA 5KTBA 5K7PA 3ZFGC 1G9BA 2W92A 3N9QA 1UX6A 5C9AB 1QDCA 5FDBA 5FR3A 1W3VA 2I2SA 1KMIZ 2FXPA 2IZWA 4YM1A 5JOWA 4E9KA 2BRTA 3DUIA 3PHMA 3VBOC 4MGYE 2GC1A 4CEWA 4XDQA 1HGVA 4XF1A 4W7YA 4K35A 4YW7A 4AK3A 1MS4A 1KD7A 5IATA 4P00B 3EQEA 1YQ8A 1UYYA 1F2NA 1BGYJ 5T5PA 1LT9A 1BE3J 4JKLA 4LBMA 2FDFA 3ACLA 3I55P 1RUG2 3RDIA 5KLIB 4H7LA 3H1HG 4XXPA 4K3AA 2OZJA 2IFRA 2LALA 3P32A 1H2MA 5DDJ2 2GP5A 2KA3A 1JCCA 2NPSD 2VO5A 4DT0A 3SWKA 4NHLA 5G04L 3IN6A 1RUOA 3AYAA 1BZWA 4OLLA 2IC1A 4XFIA 1AXZA 4UFJA 1RUF1 1PZ9A 4MO3M 3IMMA 5CG8A 2ZTNA 1T8ZA 1AF9A 4K40A 4BXLA 1JS9A 1WMXA 1ENRA 1Z7S3 4IXLA 1MV8A 5FY8A 2QQMA 3WX5A 2PLV1 1WA4A 2DBIA 5I8TA 4JTNA 3UIAA 4UB8E 3H1KJ 1YEWA 4I1LA 1SDWA 5FY0A 3L74E 4P08A 1J1DB 4HB1A 1M57D 2P2UA 1V9U3 4GKYA 1JZ8A 4RN5A 1NAEA 2P4EA 3B01A 3J9SA 4GJYA 1VBA3 1PGW2 3GNEA 1LHVA 5FPLA 4CU9A 2QE7H 1ZBE3 1HJBA 4L9BA 4QGLA 3GM8A 2RDQA 1UU4A 3OUIA 5A3LA 1M1JB 4IE0A 2CGPA 2P58A 2ORXA 1QIQA 4ISRA 4N43A 3AJYA 1OVPA 2FZ2A 4DS0A 4Q4Y2 2C0WA 3O6QB 1FBMA 4DXSA 5I0UA 2R0FA 5JAXA 1RHI1 3T30A 3LWCA 1MZ5A 4HLTA 4E4HA 2W1UA 2K2SA 2AEZA 2FXMA 4AI0A 1K73Q 3VD3A 1K5MB 1APNA 2FYUG 5KAIE 2HLEA 2EA7A 1OQEA 4JHTA 2WN3A 1ULGA 3WXPA 3E7KA 2A71A 3RYKA 2YPDA 5HV4A 4QDQA 3T97B 3WY6A 3MI8A 5CCHA 5F5QA 1W8WA 4FQ4A 1DLCA 1WW7A 2Q4SA 4DQAA 2YUEA 2XKPA 3CXHD 5CYYA 4O61A 1HQNA 4JAAA 1U0AA 5FKBA 4C7RA 2ZAEB 2QRXA 5AC93 2A3WA 1SQBD 1MZ6A 4ZU7A 3P7KA 3I3QA 4A45A 1A8DA 5CADA 2VMEA 3CD6P 4NRQA 1V9U2 2Y0IA 1V6LA 1Y9QA 2AACA 4Y99C 3AYDA 3IN9A 3NFQA 4KWLA 4PD4D 2BYVE 2JDPA 3PDQA 2WSUA 1K3IA 1CIWA 2VOWA 5AW2B 2FQPA 5D2AA 1MQTC 2R32A 2VULA 4RS5B 4H0LD 3N3HA 1KILD 1W9FA 4OQ8A 1PGPA 4M01A 4Y22B 3HD7A 2YMKA 5HXMA 1XBFA 1QJU1 1MFTA 3AL5A 2M8RA 3W5NA 1W9WA 4GMP0 2CAUA 4DXZA 5FYVA 5JDBA 4LUMA 3OGSA 1ZRDA 5FZ9A 2BEZF 1YXWA 1PL5A 4GOEA 3RYPA 4R52A 3L74J 1X33A 4MVTA 1D0HA 1O5LA 4CCLA 1JY2O 1QNWA 2R041 2K46A 4NIGA 1JY3O 3VV1A 3D0SA 4D7SA 3VDAA 5DAPA 1V6JA 1EUTA 4A7YA 1I5PA 4WM7C 4PV1B 2YFUA 2W94A 2WRAA 3W9AA 2OUJA 1FJKA 5AW8B 2VBPA 4JYCA 4BQ1A 5F3GA 2WSCH 4BK5A 4V2VA 2BVBA 2A6ZA 1BVVA 1LOBA 1WKYA 3POFA 5AC92 5LCWL 3H1HJ 1H0BA 2C24A 3ACHA 1HGZA 5IFPA 2E9QA 4AOCA 1UZWA 5F1RA 4Z1MH 3VMAA 3HT1A 4ZS3A 3AZVA 5CU1A 1RGSA 4NHKA 3VGIA 1U5IA 4C0BA 3UKTA 2LR2A 4DINB 2VVEA 4QX8A 4UB8H 5GLTA 4QMAA 5GZCA 5F5AA 2BV4A 3NMDA 3LQCA 3EFFK 4JPZB 2VMIA 1UQXA 1NOVA 1GTWA 3MUZ1 3RZKA 3H8OA 4YZ2A 3IDEA 4B8EA 1YI9A 3NNFA 1NZCA 2ZGPA 1YQ3C 1OLRA 3TEZA 3RS6A 3BKZA 1PGL1 3ZFGB 4CRQA 4F83A 4FFIA 3SHRA 5EFUA 4Z2WA 4L11A 5JR2A 3DPRA 2ZBJA 2A45I 2OQQA 1OUXA 2DCTA 2RS13 1SVFA 1JBCA 3N4MA 3L9JT 5I0TA 1UY3A 4LITA 2YBSA 4LO7A 2YPJA 1BDDA 3CX5I 3A0BE 1PM7A 1AYM3 4PIYA 3DKQA 3HTKB 1CAVA 3VKNA 1PPJG 1X9PA 1ZZ7A 3L70D 4XUNA 5DJUB 4B3NA 1GANA 4XURA 2QSIA 3A4UA 1KGYA 3B4SA 1CAWB 5KAIH 4GOFA 1EC5A 1W9SA 3KCCA 4YVSA 2ZABA 2HWF3 3VBHC 3KPEA 4N53C 2N7GA 1N73A 1AR62 3VL9A 2FYUJ 4LUKA 3BN6A 1JYTA 4TZDA 3VBSB 1X9VA 1NLQA 1ZNPA 3LF7A 4RO0A 3VZJA 2QQPA 2RDRA 2JE7A 3Q8BA 4N78E 3IPVB 2QTWB 4IE5A 4XF9A 3ON7A 3BOPA 1RIRA 5EYYA 4LTAA 1EAH3 2P17A 3WUVA 3KXDA 5A32A 1RITA 3U4SA 4NRMA 5FV3A 2E33A 4U3FJ 5KXBA 1SFYA 1D4M3 1RQUA 4CE8A 4GJZA 5BNNB 3ZO0B 4QX0A 5EWSA 3KT7A 2KOGA 1L4AB 2HYNA 2B7YA 1BHGA 2G4IA 1RHZB 4K8RB 4Q0PA 1PX4A 5KXDA 1S2KA 2VNGA 3WW1A 1CPMA 1L0LK 3H25A 4QXBA 5AVAA 5A1AA 5G05L 2XJTA 5K0UB 1LWUC 1VBD2 4FXKB 5B2GB 1HN1A 3GXUA 1MFZA 2QJKC 3FUQA 1EPWA 3TN92 1NKNA 3IDCB 2OGUA 2HWC3 3HBKA 4JKKA 2Q1MA 1SBFA 2A6YA 3H1JD 2WS92 1OF4A 3WNMA 5ABJA 3UK9A 2KS1B 3ZXGA 3KVAA 1FZCC 5I91A 3LA7A 4FOVA 1CPNA 1J84A 4QKDA 3QLQA 3VD5A 2HWF2 3ACFA 1ENSA 1IFPA 1PM4A 1DF0A 1SQ4A 2MPFA 2ZJCA 3RG0A 2VY0A 2J5UA 4BA6A 1WCKA 5TJHA 5A7WA 1NQJA 3L75G 4IEYA 1P84H 3CC2P 4FOYA 1QJY1 2KSJA 2QJVA 1PNFA 4FPEA 2O8QA 3WW3A 2HWB2 1XOYA 2PA7A 1VMFA 2K9JA 1GD2E 3CNAA 4MGZE 1ZYBA 3VB9A 3CWBG 2VZSA 4CEWC 4EZHA 3Q2YA 1JHJA 2CWMA 3LD8A 1CX4A 3I59B 2E75C 3KT4A 4Y5TA 1WW6A 1O3SA 4XZPA 1LT9C 3NVCA 3BCCG 3JCIA 2FBWC 1C57A 1OW7A 3KM5A 2P10A 2VNRA 3ACGA 3R4SA 4BDVB 3BUCA 1NCQA 2D97A 2W6JH 3RRDA 2RN0A 3ES1A 1OVSA 1FXZA 1ALYA 4YW5A 3B94A 4KQ7A 1FOSF 5AVTB 4IL7A 4HKZH 3MUDC 1V6KA 4CCCA 1SQVD 3GDBA 4OCTA 3A0BH 4GODA 1KFUL 5BNPA 3O1UA 1US3A 4CP9B 1TME1 4LBOA 4DB5A 3E5XA 2VG9A 4OMDA 1W6OB 1L7RA 3IR9A 3H1WA 2FYNC 2UWAA 1LGBA 5DUXA 4DFSA 3LFMA 4QD2A 3OBRA 1QL1A 1YJ9P 2LM3A 1SDDB 2M3EA 4A4AA 1R1A1 4EN9B 1I5ZA 1WA6X 3OOXA 1FOD1 2P1JA 3CZJA 2HEYF 3OYWA 2XJVA 3I8TA 4I7ZB 1HRV3 5HCBA 2NRGA 2VU9A 1WBFA 4XQDA 2CY6A 1PO23 2EXHA 4AI3A 3DGTA 1YI2P 1A3KA 2WFF3 1LTEA 3TEXA 1UXXX 3ILNA 1LECA 3SH5A 5CFDC 4K6BA 3DXUA 2RR13 1LR5A 3L72G 1DGWX 2M3BA 3S5AA 1BK0A 1BBT2 5FZAA 1UYZA 3ENRA 4MGKE 1FJPA 2YFZA 2UWCA 3QWOC 3B00A 1NA1B 3CPWO 1A02F 1HQWA 4KBBA 5CCGD 1OKOA 4ZONA 3VBRA 1GUIA 2RJLA 3H42B 2P67A 1GZCA 3MLLA 5A3OA 4AI9A 2EIDA 1JYVA 3V64A 2V09A 4NAMA 4XTPA 4O9EA 3H0OA 2ZYGA 5BNOA 3D71A 4LMFA 1YJNP 4CCKA 1W9TA 2O01N 4YGDA 5FZHA 4BXFA 5JWPA 2ZCWA 3IBMA 5KAFE 3CBNA 2D93A 4NHMA 2KUBA 5AW3B 1KZUB 4UF0B 2OQ6A 2AH2A 3MHZA 1PVC2 3W21A 1UZVA 1UMZA 4CUGA 1RQVA 4H7MA 1NLSA 1W2OA 5F9TA 1VQ7P 3IB3A 1W05A 5C5UA 3NV2A 5FP8A 4GQ7A 2VMFA 4GZ9A 4IOIH 2JG9A 1LB2A 5C3OA 4TLGA 2VUJA 1S5LX 4R9AA 1PP9E 3LDRA 3M3QA 4CDXA 3IM0A 3QH9A 3A2AA 3U10A 5F39A 2WQ4A 3R4DB 3T1MA 1NTMK 5JLVA 1UOGA 3HNYM 1Q81Q 3O12A 5FP3A 4D94A 5APUA 2OYHA 4AHZA 3A7QA 1R082 1MEC2 3HD7C 4AI2A 3A7OA 4N6JA 4IV3A 1HRI1 2FDIA 1AL0G 3AL6A 3DV8A 2HODB 2I74A 2JEEA 2CV6A 3VMXA 2V4AA 3CXHE 1SLCA 5JI9A 1W90A 3ZFFB 4Q5OA 1WD3A 3K51A 1OQ1A 1SQBE 3DYPA 4YW2A 2VTFA 3BCWA 2V4VA 3C7OA 4OHVA 5AW1B 4W8JA 4XJ8A 1W28A 4LLFA 2VOTA 3VP9A 4YTPC 4HG6B 1DGRA 1AZDA 1N3OA 2RHPA 1T2KC 3W68A 3ABVC 4CDQB 1X79B 2JIGA 1AR72 5FZ4A 4PD4E 4D7TA 3NV3A 1RUD3 5FLHA 5AVQB 5C4WA 2QJKB 4LBNA 2KLVA 2VC9A 1CONA 1US2A 4IEUA 4IEXA 4B4QA 4CDUA 3KT1A 5FO7B
chains in the Genus database with same CATH topology
2O8OA 4LBKA 2XJRA 4K1YA 3H6PA 1JCDA 1PIV3 4LEJA 2HEVF 2D6OX 3UV9A 1AXKA 3O0VA 4GH4B 3W59A 3MW4A 1UU5A 5DZEA 4GT1A 3FBYA 4KWKA 1X8MA 4JGZC 3RQ0A 1GKBA 3ZXEA 1H1IA 2OYIA 2TUNA 2RS33 3M70A 3R0RA 1PK6B 4HBNA 3QD6A 4QPGB 1UKGA 3MF9A 1PK6A 1DYKA 1RUH1 2V73A 4QPGA 1LTTC 4OI4A 2W08A 5AVRB 1VAVA 4FPOB 1Q5OA 3WCRA 4AVVA 1URQC 1REDA 3VOPA 3O14A 1X8YA 1IOAA 5LK7B 4XF0A 1PO11 2Y0OA 2D5HA 2WA4A 5T5LA 4DMIA 4Z82A 4E27A 1ULEA 3USUA 3RI8A 4YNIA 3ETQA 3H7YA 4P9XA 4YYOA 4RFT0 1POV0 3AK0A 1SLIA 5C8WA 2BBVA 4UW5A 4JQRA 2P7JA 3EJKA 2QUOA 1QJY3 3WUDA 4QQHA 1AR82 2PHUA 3M4FA 4CP1A 3MFAA 3VZOA 3GHGA 3VBUB 1ND3C 1YHFA 3VBUA 4XE5B 3PVOA 2XHKA 5BNNA 5JMCA 3D82A 3IT8A 1V6OA 2XLAA 2C1FA 5FMOS 3X29B 3DPRC 3BALA 3KQGA 2XJQA 4COUA 5IT6A 5JOZA 2AENA 1XTGB 3CL3D 1L4AA 2BNMA 5J96B 1NHLA 1WT6A 2E7QA 2QE3A 1UD1A 2XNXA 5AW7B 2RS12 4CEYC 5JSPA 4GA9A 5FRAA 1A02J 3AFGA 4OZXA 3OJBA 1H30A 2WIIB 1YIPA 4C7NA 1B35A 1CJPA 1NCRA 1OSGA 1KQRA 1VBB2 2DWRA 4ISQA 1TE1B 1AYM2 2WZR3 1VBD1 2JXAA 3ILRA 1DQ2A 2G9GA 3V56A 1NE4A 4I0AA 4LO8A 3B5LB 3N36A 5J7MA 4ATFA 5CCGA 1RUG1 2DCKA 4HT1T 3EHKA 3OA7A 1UPIA 1HDKA 3RL0D 2AUYA 1A78A 3LGRA 4FPHA 2YGMA 5DDJ1 1FZEA 4Q4Y3 1JYCA 5DG2A 2A3YA 4WBBA 4WB4A 1S2BA 3S0MA 3M3OA 4XEZA 4RA0A 1NOHA 4OUMA 1JY2P 3KB5A 1RUD2 2VOKA 3WV6A 1JY3P 4YVSC 1ZZ8A 2QZ3A 3ZSEA 3II6A 1L3JA 1PIV1 4LNVA 4A7ZA 1WMFA 3B9IA 4JC1A 4XPVA 2E63A 2XL7A 4AVSA 1N73C 1H8TC 2NPIA 1VDFA 4COYA 1N7SA 2WNEA 1LOCA 1V70A 3NTNA 5CMZA 2W0XA 1JXNA 1XNBA 2YO3A 1W6QA 2QDNA 4QQ2A 3U11A 1VAKA 1VPCA 1KFMA 1N3PA 3V2RA 4XMAA 1S0CA 4SBVA 1KQLA 1LHWA 2Y26A 3CJIB 2Z5WA 2R30A 5E89A 2SBAA 3ZN5A 4Q4X1 4YW3A 4P5HA 3VBSC 4Q1PA 3VTPC 1QY4A 1HBWA 2IX7C 2RS32 5AVSB 5DZGA 3ZSJA 1H8AA 4YM3A 1SLLA 3BIWE 1ASJ3 2CAVA 1CI6A 3J8F1 4QT6A 2RJKA 1ULFA 3DKWA 4TLFA 4XFFA 1VP6A 4Q4V3 2FMDA 1DBNA 4MYEA 1UAIA 2I1JA 2QKDA 5GZDA 2KXLA 1XRUA 2ZGUA 1SQVK 4LBLA 2R063 2WJSA 2BTVC 4Y1ZA 3ZSKA 5CFCB 4IEOA 1GZWA 3OBTA 3SNMA 1R1A3 1XYPA 3CEWA 1IHMA 3ZFEB 1PMIA 1EAH2 4MXWA 2ZGOA 3QCWA 3CLPA 5C9AC 1ZZBA 3MGNA 3WT3A 4HVOA 2ZFCA 1CN1A 3ATGA 3PVBB 4RQPA 4UBGA 5GLVA 1C5HA 3IMNA 1XYOA 1MVEA 3INAA 5EZWA 1YFYA 1SLAA 2HYKA 1FOD3 4OUSA 1DQ5A 4LHNA 2OA2A 3GHGC 3U1CA 1QJY2 1S0FA 2D3PA 1EQ7A 4AGVA 4P9IA 4NVPA 1QQP3 1RMU2 2K0GA 5H9QA 5BNNC 1BCXA 1D4M2 3B93A 1GQHA 3J4UH 3PNAA 1PGW1 1RE3C 1GFF2 5BUVA 4RHV3 1KS4A 2N1TD 3WHTA 1AFOA 4RD7A 2PP6A 2G9FA 4JDNA 1L4AC 3CO2A 1JUHA 1CZQA 3R6SA 2I1KA 3I59A 1KILC 4Y99B 3R2PA 1FMD2 3KZ4C 2ZAHA 1MACA 2ZAAA 1SLQA 3U4XA 4MXVA 4F8AA 1Z0HA 1SQXK 2UY9A 3RSJA 1U12A 2VMGA 5LRSA 5K0UC 1B35C 4X6QB 2QM8A 1VBE3 2R072 3AKRA 3T2TA 3ZXDA 1NCRC 3ZXJA 2XH6A 4KG8A 1MZFA 2WSVA 5AVZB 2YZ4A 1W6NA 3WDXA 3ZN4A 3BATA 1FX5A 5DUVA 3MIWA 4Q4Y1 1TMF1 1S55A 2WZR2 4EWDA 4HKWA 1SLBA 1FZAA 1MQTB 5APQA 3SCGA 4N43B 2N9BA 2BQPA 2ZGTA 2D98A 4LO6B 2A3XA 2HWC2 4OI2A 3ZXLA 5D8AA 2D6LX 2VECA 5J37A 2CPBA 4YVWA 4N3YB 3E1IA 1M7LA 3V4QA 4EIJA 1W0OA 3U1AA 3TNUA 2HFED 4KU7A 3URFA 2NN8A 3TOJA 4IFDK 2RMU3 3VN0A 4W65A 3HUSA 5F6KA 2D7FA 5FO8B 4AEJA 1IS6A 1NH4A 3OAKA 1N7SC 2EIGA 2KP8A 3KSCA 3KLSA 3BU7A 1MVQA 1S0JA 5FTTC 1OOPB 3QACA 3HWJA 4FOQA 1IFDA 1GDTA 4JRLA 4YRDA 2BPA2 1VR3A 3O0XA 3WG2A 1GL2A 1OWAA 5E16A 2OYZA 4AI8A 1DG6A 2DVAA 1TEIA 4GALA 5HXVA 3VBFC 1ASJ1 5FREA 1W6OA 1YFUA 3H50A 2D6NA 5AW6B 4IETA 1IPKA 4YZ3A 4LO4B 5HI0A 1TME2 3FBMA 3ZXAC 5L36A 2ZGNA 4WVMB 2WKKA 2X5IC 5JIAA 1OD5A 2A7AA 2R061 2WNVA 3KD4A 5DXDA 3GF6A 4BM8A 1HH0A 1UZZA 2JECA 1RF1B 4WM7B 3E6CC 4XJ9A 4Q4V2 1RF1A 4U2AA 1IJDB 1PGSA 2GZWA 2XG3A 5IK8A 4YARA 4RGGA 2O1QA 4K21A 4X6RB 5SV5A 4MV2A 3BASA 3H32B 1UW8A 5JVVA <