2R32A

Crystal structure of human gitrl variant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
158
structure length
140
Chain Sequence
RMKQIEDKIEEILSKIYHIENEIARIKKLPCMAKFGPLPSKWQMAPPCVNKVSDWKLEILQNGLYLIYGQVAPNAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GCN4-pII/Tumor necrosis factor ligand superfamily member 18
publication title Assembly and structural properties of glucocorticoid-induced TNF receptor ligand: Implications for function.
pubmed doi rcsb
source organism Saccharomyces cerevisiae, homo sapiens
molecule tags Immune system
total genus 32
structure length 140
sequence length 158
ec nomenclature
pdb deposition date 2007-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2r32A01
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r32A02
4KGQA 1GK4A 1H88A 1A8MA 2R6QA 3VMYA 4G4FA 4JYBA 3B94A 4KHXA 4D7YA 3WD5A 2QM7A 3NXSA 1C3HA 5AVXB 3NFQA 1SP4A 3UIAA 3TNUA 1RJ7A 3M91A 1IO4A 3P32A 1S55A 2YO2A 4LC1A 3TWIA 1H89A 2R30A 5AVSB 3VTPC 2QE3A 1HWTC 5APQA 3HE5B 5CMZA 2ZFCA 2IPPA 2RJLA 4MXVA 4N90A 3FC0A 1TNRA 3K51A 1J2JB 5AVTB 2TUNA 1JH5A 1ALYA 3L35A 4RSUA 2R3CA 4QQOA 3ALQA 1PK6B 2Z5WA 4QPYA 4MXWB 2YO3A 5AW8B 1GU4A 5APXA 2X29A 5AW0B 1MV8A 3VMXA 2WPSA 3IR9A 2QM8A 5APVA 4E4DX 1D4VB 4HYTB 4XE5B 3L36A 2Q3IA 3KDPB 1U5YA 1PK6A 4M3LA 4MXWA 2YNYA 2TNFA 2WPQA 1U5ZA 3O8ZA 3P7KA 2HEYF 5L36A 3V56A 3OAKA 2Q5UA 1HJBA 3HTKA 2WTYA 5APWA 3V4WA 1C28A 1FAVA 4HT1T 2WPRA 3I5CA 1GR3A 4E4SA 1GK6A 3NTNA 2R5BA 5L19A 4JYCA 1X8YA 3TYJA 2WNVB 2RJKA 3MI8A 3HE4B 5BNQA 1DH3A 1S9KD 1YYCA 3M9BA 2W6AA 1FOSE 1CSBA 2P67A 1JUNA 2N9BA 4GT1A 2VRSA 3K48A 3VYIA 4EN0A 1PK6C 5AW9B 5KC6A 4GIQA 3VN0A 2O0OA 4EOTA 4TSVA 2OIIA 2WNUB 2WNVA 5APUA 2KP8A 3HE4A 5AVRB 4C46A 1HBWA 5AW6B 3TYYA 2R32A 3QD6A 5CIRA 3NMDA 1OSGA 3T97A 4OUSA 3URFA 2C9LY 1NAFA 2JG9B 4OULA 4DZOA 3TK1A 1GTWA 3MGNA 2WNUA 1IQAA 3KQGA 1O91A 4I2LC 2QDNA 1MFZA 1S9KE 1NWQA 2Z5HA 3M0DA 5AVUB 3V5BA 1GU5A 5KC5A 4F3JA 2R5DA 1OXZA 3L37A 5APTA 2E7AA 1OQEA 1XU2A 4AYCA 4RESB 4DOUA 5TSWA 2WNVC 4NN0A 2ZJCA 2Q7CA 2BASA 2JG9A 5AW1B 2KA3A 4C7NB 1U5XA 2JG8B 1DU3D 2Q8OA 5APSA 1H8AA 5HBAA 4J6GA 5AVYB 5AW3B 4TWTA 4G3YC 5AVVB 1A02F 2HEVF 5AW5B 4GKGA 2WNUC 3P8MC 4AQRD 4DB5A 2P7JA 5KWRA 5AVWB 3AB0A 1WCKA 1OWAA 4C7NA 2WT7A 3ME2A 2JG8A 3A3YB 3M9HA 1KXGA 3SWFA 1CI6B 1KQLA 1D0GA 2XZRA 2Z5IA 2JG9C 4KGGA 3M0AA 2XV5A 5APYA 2XU6A 4KG8A 5AW4B 4QQPA 1XU1A 3LIEA 3A7OA 2ZXEB 1DG6A 2WWWA 5AW7B 4B86A 2AZ5A 1GD2E 3LIDA 3M06A 1CI6A 3B8EB 4MSVA 1CZQA 5AW2B 1I9RA 4AUWA 2W27A 5AVZB 3IT8A 2C9NY 1OQDA 2JG8C 2Q1MA 3HE5A 4OUMA 3A5TA 3QBQA 4I6MC 4QQ2A 1JTZX 2HEWF 1GZLA 3V4QA 2ZPXA 1T2KD 2JJLA 2RE9A 2P2UA 4QQLA 3B93A 3VMZA 3LKJA 5AVQB 1G2CB 2H7HA 1RJ8A 2WT7B 1KD7A 1HUCA 1T2KC 1A02J 1TNFA 3B9IA 2E42A 1MUUA 1FOSF 3TNUB 3MD0A 1D2QA 2E43A 4QQHA 3L9JT 1SLQA 3A2AA 1JNMA
chains in the Genus database with same CATH superfamily
2B9BA 1G2CA 1BBT2 1FZFA 2UURA 1O3TA 2D6MA 1FAYA 2NM1A 4ATEA 1SDWA 4MH0E 4QHOA 4FAGA 3LFMA 4K1YA 5AVXB 1RJ7A 5FYVA 1AL23 1PO12 2E32A 2EIEA 1UX7A 1LR5A 5IK5A 3H1IE 3E5XA 5BY5A 1HXS1 5FP9A 2QQIA 2Q3EA 4ZXEA 5K4LA 5AC91 3AKPA 5DAWA 5FYCA 3FFZA 4BIFA 1TNRA 4XQDA 5ERLA 3POEA 2ZHLA 2P2KA 2A06D 5L73A 3N7MA 1OVPA 2O1JA 4BLIA 3AYDA 3LE0A 2DU1A 2QE7H 3I2IA 3DEMA 4AQTA 2N7GA 2JE8A 4N7UA 1X9TA 3AVSA 2I1JA 5DJTB 4YM3A 1FNYA 1U5IA 2ZX0A 4EN6B 4JHTA 2B7YA 2OTJP 1VE0A 1GOFA 1LT9A 5HI0A 1Q43A 2VW1A 3GZAA 1NOHA 1NCRC 2B87B 1E57A 1FV2A 4CP9B 4QX3A 3L75D 2BVVA 3MGUA 3O8ZA 3P7KA 2JX9A 4PDWB 2PGDA 2ZKNA 1CGPA 2YUEA 3EXUA 3WW4A 4Q4V1 2FDHA 4H55A 3VKFC 2KI7B 2B89A 1GICA 3M4FA 1JYNA 2YXSA 4XUOA 3ZXEA 1XOYA 3K5BA 1KYOI 2RM21 2WZEA 5FPUA 3OUIA 1BE3G 3WHTA 5EZWA 5F6KA 4D3WA 5LA1A 1MVEA 4LBKA 1NTZK 2RS31 3VLBB 4IV1B 1S9KD 4IE7A 1T3UA 3O5SA 3B5LB 1IG3A 5L9RA 3CF6E 4WVMB 1FZCC 4YW2A 4LKEA 5LBCA 3ZXLA 2C0XA 2E76C 4D6TD 3WNOA 2HWF1 5A6XA 1RUF2 2WO3A 5C8CA 4AVSA 2YKPA 4X8NA 4JDOA 2OTLP 1L0NJ 2ZGQA 4P5HA 5A33B 1YHQP 1J58A 1W0NA 4IL6E 1XNCA 2R44A 2P37A 5DAXA 1XSRA 1OZHA 2XNXA 5CKQA 4H2AA 4R4ZA 3EHKA 3MV01 5JOZA 3I97A 3THDA 2RMU1 3RS6A 5KHKA 1UPSA 3VDDC 2ZGOA 1JXNA 4QX8A 1R1A2 4B8EA 4MV2A 3OUJA 2D97A 2VZ1A 2ZGUA 3OGVA 2XHKA 2PELA 3VD5A 5HCFA 2YKQA 3KMHA 4GMP1 5FXZA 5GKAC 1F8VA 4YGBA 4DO0A 4NN0A 2ZJCA 4WM8A 1URQA 3MHZA 1RYYA 5KJ7A 3GGLA 4P9WA 3MLKA 3TGUE 4YVWB 1HDKA 4YZ2A 2BCCE 1EPWA 2EAAA 2YV8A 4BQWA 3FBYA 1A34A 1EY2A 2PHWA 1VR3A 2AEYA 5CCHC 2C0ZA 1IK9A 3V2RA 5IK7A 2OKXA 4YVSC 4DB5A 3LQCA 5BNOB 2KXPB 3JSVC 2AGSA 4WY4A 4MGSA 4FQ4A 4BOWA 3HD7B 1SQQE 1KXGA 5C3QA 3DPRB 1QXJA 3KCCA 3CWBE 2YGLA 1ASJ3 1W8WA 4W7YA 4XW3A 5CFCC 3BTZA 1WLTA 5APYA 1RVF3 4P00B 4L76A 4FOYA 2VZOA 1L0LK 2EICA 4OYUA 4M3CF 1GOHA 2UYBA 3FXEA 1VQ9P 1PGOA 1VBB2 3J7LA 4QX0A 4XHXA 1S5LH 1GD2E 1MQTC 1CI6A 4MSVA 2QQOA 2WAOA 2ZAHA 3PMEA 3VL8A 3BPZA 1VRH1 5A3OA 1NCQB 2LM3A 2ZGKA 1NU1J 2FD8A 1RUD1 1JU3A 4XPVA 3RBZA 1F9KA 1K12A 2DU0A 2WA3A 2HWB2 1YXWA 3NRUA 1LKNA 1RUC1 1U12A 2O14A 3J8F1 3ZXGA 4RL7A 1T2KC 1A02J 4Y5Z0 5FY9A 4NHLA 4NPLA 1OC1A 4CDUC 3N36A 1HJ0A 5FZBA 4LPLA 3L74D 2XB6C 3S5QA 4BYYA 3L9JT 4PV1C 4AVTA 2GUSA 2HWB3 3CC4P 2OZJA 1BCXA 1H88A 4G4FA 5CCGA 1YI9A 1CN1A 3WLUA 1UOBA 4RD7A 3PIGA 5ANNA 4S2DA 4DY3A 1K05A 1AYM2 3QH9A 1PHMA 4KU7A 2KXLA 1SHWB 5A7WB 4XJWA 3U4SA 2J58A 4XF4A 3B5NC 2VD7A 1FDIA 3WDTA 3SH4A 2FDJA 3GF7A 2RS51 1DHKB 3RK2C 1SQXG 3THCA 1LTSC 4N7IA 4RQPA 1HV1A 1HXS2 2I2SA 3ZMNA 2BVBA 1EP0A 1PV3A 4FQZA 2BCCD 4EZHA 1SDDB 2WT0A 1SQVE 4MXWB 3N3HA 1UCXA 3P5BA 3ZN4A 2VE1A 2Q9IA 1JTHB 4FTEA 2WRAA 1HLCA 1N1TA 1LHNA 1O6UA 3MHVA 1SQQD 2Q3IA 1IGOA 1ODNA 4LHKA 5FYBA 5HCAA 2FFDA 3CZJA 1KTMA 2FYUK 1QJU1 2D44A 1RF0C 2ZEYA 1LNQA 4I0WB 2GN3A 3PLNA 3E6BA 2Z42A 1H2KA 2NPSB 3V4WA 4CA9A 2EXIA 3PLQA 2RDNA 3ZKYA 2KB7P 4HT1T 1JOPA 1DQ4A 1WA6X 3G6JB 3DYMA 2VBDA 1MS8A 1PFIA 1ZA4A 4UF0B 5ABJB 4IUGA 3VB9A 5BV6A 4TZDA 2VOTA 4I2OA 4N9IA 2R49A 3C7EA 1PP9E 1CONA 3HNMA 2RM22 1XNAA 5D1IA 5DAVA 1FOSE 2ZJSE 3CCUP 5KKZC 3KD4A 1DLCA 3J9SA 4Q2FA 1IPSA 1W3VA 3CCEP 4GIQA 3K4ZA 5LASA 4QKNA 1ZBA1 1ZV8A 1AUYA 3MDPA 4DINB 3BUCA 4DEQA 2W87A 2W68A 2BNMA 1JYXA 4UFMA 4HL0A 1L4AD 4Y4RA 4QXBA 4EN9B 5KHHA 1W2BO 1OSGA 1N7LA 4Y20A 1OD3A 4C0BA 2XMLA 4OUSA 3RRDA 4WM7B 5FY8A 4K8RB 3BRTB 1V9U3 1GTWA 4IEYA 3B9CA 1LTEA 3BVCA 3CJIA 4CU7A 1IFPA 1J1DC 4I2LC 1HQNA 3MIEA 5B5EH 2RMU2 5FBZA 2VTXJ 4F3JA 4LBMA 4OZXA 1ULFA 5A32A 1XU2A 4L9BA 4EYYQ 2LS6A 4KJMA 3ETQA 3O1VA 3AZYA 5IFPA 4YXDC 2WSCJ 5L7OB 3H1LE 1PZQA 3R4DB 2PAEA 1PPJE 2EALA 4AEDA 4IV3B 1YC61 4LKDA 4ZS3A 3OY8A 4MGQA 5D2AA 1ULPA 1M1JA 3CXHH 1JZ6A 2P3KA 3VDAA 3L72E 4X6QB 3S30A 3SH5A 1A02F 3I2OA 5TISE 3SMHA 4GKGA 3AP5A 4YG3A 1A6CA 2KS1B 3AYEA 1SQVD 1P84I 5KWRA 1RE4A 2RN0A 1DD4A 3ACIA 2POHA 4A7ZA 3ZFGC 1JO5A 4NPFX 1ZR2A 3PP5A 3I56P 4QGNA 1GKBA 2V73A 1C57A 4FPJA 1KQLA 3Q5RA 1EZVG 1V70A 3L2HA 3M0AA 3IDEA 4R52A 2XJTA 2PQQA 1NTKG 5EHDA 2P17A 1HGVA 2FBWC 3OA7A 1AQTA 2KNCB 2XJUA 4RS5A 4ZU7A 4D6SA 2ZGMA 1Q2NA 1MR5A 2OYOA 2Z2SB 2CWMA 3LGRA 3ITKA 2W27A 2BPA2 3G71P 2BBAA 3ZFEA 2OXBA 3AP7A 1RF1C 2HEWF 1PP9D 3TN91 1D0HA 2ZPXA 3M3IA 3H50A 1FDMA 1VRH2 1Y9QA 3W9AA 4EWAA 4JGZB 3LKJA 3N9NA 1FYUA 1GU3A 4FPEA 3H8XA 5JXGA 1MUUA 1VBC3 4Y4YA 1DZRA 4ZXKA 4ORFA 3WT3A 1RUC2 1OXCA 1QQP1 4QQHA 2XLAA 3J8F2 1RXGA 4NIGA 5GM0A 2YBSA 4CCCA 1SLQA 1RUJ1 4AWDA 4BM8A 1DX7A 3OGSA 1QJY3 1GK4A 3T1LA 4FP3A 3MLLA 2Y8KA 2NRGA 1M8OB 2OUJA 3K2OA 5FMBA 4K21A 3NFQA 1SP4A 3UIAA 3BU7A 4LLHA 3G3ZA 1ULEA 1S55A 4FFIA 1RUH1 5CB7A 3W5MA 3TWIA 1FNZA 1OW8A 2AREA 1G8WA 1UKRA 5A3TA 2I07B 3VP9A 4ZY9A 1RC6A 5EFUA 1SFCD 5IT6A 5BNNB 1LWUB 3H1LD 2DFBA 4IL6X 2JKXA 4E4HA 1COV1 3WG1A 1T8ZA 1G9FA 2Z5WA 2NMOA 3L72D 2G3AA 5DAQA 2OS2A 2GC0A 1IPKA 1PO21 2YBPA 3ZKUA 2WPVB 5A6QA 1NGMB 1KB9I 3WX5A 4CDQA 4QXCA 3RZZA 1S0FA 2Q1FA 5FPVA 2VZQA 1C8NA 4ZKUA 4XE5B 3TB0A 3WR0A 1UF2C 2YXRB 3KDPB 5JDBA 1CAXB 2GC1A 2E51A 1AJYA 1ZRTD 3JBG2 3LDRA 1B35B 4XETA 3MUY1 1QX8A 1KFXL 3PMSA 3KQRA 4HKZH 1D4M1 3WU2H 5FYYA 1WD3A 2XJRA 1MS1A 5EP9A 3AJYA 1QJU2 4LBQD 3CBNA 3VBOB 3BCCG 2HYNA 3SCHA 1OPMA 3B7MA 1JODA 2B87A 3JBG3 2ILMA 2W91A 3D82A 4CP9A 2CYFA 5BNPC 3W68A 2RR13 4PDWA 3GCWA 3MI8A 3L73G 3KSCA 1AYN2 3KV6A 2BOIA 4BLJA 1I1EA 4Y99C 1VLNA 1ZRFA 4HJGH 2VY0A 4C91A 4Z2WA 1REDA 4PD4E 3WDVA 5GZFA 2DUOA 5GLTA 4NR1A 2IFWA 1K42A 4IV1A 1LHVA 1RE3C 2DBNA 1GNHA 4O9EA 1CIYA 4QKFA 1HN0A 1ZBA2 5JR7B 3LW5H 2YXQB 1J59A 5SV8A 4L74A 1OMIA 1R092 3UKNA 2IVJA 4KT0J 3KS7A 3TEWA 1CWPA 1LOAA 1LOGA 5DUUA 3IB3A 4A41A 5A33A 1OOPB 4NO4A 4Q4X1 2IX7C 3ZMOA 4XCBA 1TQ5A 3T2TA 1XTGB 3CLQA 1VQ8P 5GZDA 3AKRA 5KC5A 1OXZA 3G9RA 3L37A 2XBO3 1ONAA 5FFOC 2E74B 5IVEA 3OPTA 1AX0A 1DBNA 2QIWA 1W6NB 5F1RA 4C7NB 2J7MA 1E5HA 1WCUA 5LA0A 2K9YA 1YFUA 4FPLA 4WVWA 2OYIB 1JZ2A 4DT0A 2ZT9B 5C3RA 1PNGA 4IFDK 1HTLC 3VBRB 1W8HA 1GL2B 3O14A 3QOPA 1FZEA 1HB2A 2P34A 4ASVA 5LA9A 2GMEA 2HWD1 1WCKA 5C5UA 4TLFA 3U11A 2P3IA 4YVWA 5DG1A 1ZRDA 2TEPA 4QDQA 3HUSC 2KOGA 1MZ5A 1POV0 3ORJA 1DP0A 3R4UA 2JG9C 4P02B 1LEDA 5LW9A 1HRV1 1NUKA 3II6A 3RL0g 5BNOA 3CCLP 1PMJX 3NJZA 3PHLA 4IL6H 2EIDA 4FTBA 1S0EA 3VBUA 3ZYFA 3MBWA 3DPRA 1ODMA 2V72A 5G04L 1OQDA 2JG8C 1N2DC 3M3CA 4U3FE 5FPXA 1L7LA 3A5TA 4RFT0 3CHXA 1UZYA 1EPZA 1UXXX 3RL0D 1KGYA 4YG0A 4I30A 5JZGC 1RQVA 5FRAA 3FHAA 3RI8A 2IFNA 3POWA 2WSFJ 1HUCA 3M3EA 3KLSA 3WG4A 1NCQA 5I0UA 1VBD1 4QM9A 3TOJA 3H1HE 4PD4D 1JW6A 1LJ7A 2O1KA 1G9DA 2UWAA 3BOPA 5JCTA 2QQLA 4JDNA 3L74J 3LSEA 3MTUE 4FPFA 3ZYIB 2FZ2A 5LY2A 1NCRB 5C3SA 1SBDA 5KLVG 2WSVA 5IAVA 4LO5B 1URQD 2P6HA 2R1BA 2IXLA 1OHFA 1O59A 3A0NA 2E63A 2YU2A 2ZGTA 3OBAA 3RK3B 2B45X 2V5YA 3IPVB 4CDWA 1VF5D 2E31A 2HH9A 4FO9A 3WUVA 4J25A 2D98A 2GP3A 5AVSB 3ZX7A 2QE3A 5APQA 2Y6KA 3CX5I 4YRDA 2E26A 5FO8B 4YWAA 4GD4A 4OHZA 5AVTB 2J59M 3A7QA 5A7WA 1PIV3 2AENA 4LHSA 3MUDC 1FZCB 5FLHA 3ALQA 3OSDA 3GHGC 4EIJA 2E76B 4XF9A 4ZHNA 3OG2A 5APXA 5CEHA 1COV2 1DLLA 3HN3A 1TME1 1VBE1 1J1EC 5FZKA 4E4DX 2VCAA 1AJOA 2ZGLA 1UAIA 1SQBG 4PIYA 1PO22 2GDFA 4CUBA 1SQQJ 2B46X 1XNTA 4GAZA 4UAPA 5BPXA 4MXWA 1VRBA 1NKNA 4MG2A 4B1LA 4N43C 4DXZA 3VDDB 1NQDA 1JTHA 4A6OA 2ARAA 2A1XA 1G1IA 3WUCA 2HJIA 3INAA 3OGGA 3LFIA 1ZVFA 3PDQA 1D4M2 2XLFA 3T30A 2WPRA 1LU2A 3POIA 3MIFA 1JS9A 1BQPA 1Z7S1 4UOJA 2FYUE 2X5IC 2PLV1 4JTNA 2XQRA 2WFPA 1G9AA 4NIAA 3U75A 4AYUA 1ZP0C 2LKMA 3OBRA 3P3NA 4U3FD 1LTJA 2P67A 1VBA1 3I2DA 3ZYJB 5CBOA 1J3QA 4CP2A 5J09A 1SLTA 5F3IA 4UF0A 1XPWA 5CCGD 4YVSB 3E1F1 1KQSO 3AEDC 1OD5A 1OPOA 3H1HD 2ORXA 3ZSKA 1EAH1 5JAXA 2JDHA 1PGL1 1NTME 1ZYBA 3NMDA 5FBJA 3KM5A 2WQ8A 3L71G 3DV8A 5IVBA 3Q5PA 2M8RA 3D0SA 5CFCB 1DGRN 4JV4A 3DXTA 3FBMA 3QLQA 4K3AA 3DUIA 4QHBA 1RUG1 3BPSA 2R5DA 3WQ1A 5A7OA 4HKLA 3ZN5A 4QX7A 3WW1A 2E7AA 2YB7A 1GZCA 4TXWA 3TSIA 4O9GA 2D6NA 4LO4B 4BQXA 3H1KG 2WNVC 3TAYA 4WM7A 3KGLA 4BQYA 4Q4Y2 4WVVA 1AVOA 3RZJA 3KT1A 3GG2A 4DUWA 2D5FA 4Y26A 2TBVA 1DEEG 3V2QA 4BZ4A 4QX5A 4M0NA 1WMEA 2HKXA 4GZ9A 3S5AA 4QPIC 1DDLA 4K3UA 5L7OA 1BCCE 1W9SA 1TEIA 1ZZ7A 2BEQD 3I49A 4IV3A 2VAUA 1H0BA 2CGNA 2B9VA 4AFCA 1KMIZ 2XKOA 4XFGA 3H1IG 1H6XA 4DCKA 5F5AA 1HJGA 4PV1B 2HWD2 1D0GA 5C3PA 4B29A 3AMHA 4LA3A 3O1PA 2KS1A 4D69A 3L2YA 3BTXA 1NAEA 1RUI1 3T2QA 2Q8DA 5AW7B 4ZONA 5LK5A 1NQJA 1K5JA 1SLCA 2GUVA 1V6IA 4CU8A 4XBQA 2RG4A 3AP6A 4UFHA 3L73J 3B5NB 2B5HA 4AHZA 1LENA 1J3RA 2OTKE 4CYDA 1CPNA 2W83C 2R063 5FYMA 5AC93 2OZ6A 3QBQA 4P9IA 1NJIQ 3RK2B 5K7PA 3FUOA 1LTIC 2N1TD 1PP9J 1L2PA 2YPJA 3S7IA 1M56D 3T0AA 1PZ7A 1ULGA 3SISA 1SFNA 1KD7A 3C9IA 1BSHA 5FZDA 4YPJA 4W80A 5J96B 1TMF1 3H0OA 4UW3A 5TISH 3ZYHA 1V00A 3I3DA 1VBD2 1AL0G 4Y28J 3O1MA 1NTMD 3A2AA 1JNMA 2HWE2 4JGZA 1UL9A 2JKBA 4A6SA 3H1JE 2QM7A 3H1WA 3T09A 1JI6A 4QPGA 2KLUA 3DXUA 4XUTA 4Q4V3 2Y60A 3FHQA 4I09A 1BMV2 4AI0A 4XF0A 1FMD1 2R30A 2D6KA 2CDOA 4AXOA 4JC1A 3JC22 3ZIXA 3U78A 3UYJA 1DIWA 3VP8A 3ES4A 1AX2A 3AKTA 2RMZA 3NVCA 2RS33 1HRI3 1R081 1ZZ6A 1S4XA 3H1LJ 1IKPA 3FFQA 3RI9A 3I2HA 5L9VA 1SFCC 1FPN2 5HV0A 1KFUL 5FY7A 2RV9A 5T5PA 5D8AA 3CKHA 2UWCA 1BYHA 4IFFA 3H1MA 2HWF3 3KHBA 4CUAA 2CSGA 1OX3A 5BNNA 1LWUA 1BCCD 1FZBA 2WPSA 4XZUG 3RPQA 4DS0A 2VZPA 2M0BA 4UFLA 3ATGA 4M3CE 2VC9A 3MP7B 1STMA 2YDEA 4FPOB 2E75D 5FJHA 1TME2 4OQ9A 2X8KA 2CGPA 3VBSC 4B4PA 1FOD2 4AVAA 3H8UA 3UETA 1OVSA 1N3PA 1XQNA 1ULDA 3TGUG 1S0IA 3Q8AA 3E6CC 1J1DB 2DW3A 2J1UA 5EJ3A 1RTVA 4P9YA 3C8VA 1W3XA 3PRJA 3V0BB 2IBZE 2WS92 4GMP3 3W20A 1B35A 1ZZBA 3KT7A 4YZ3A 5FP8A 4A44A 1X7NA 1FOD3 1KYOD 3K3OA 1Z7S2 5D21A 2Q0AA 4XFHA 4QM8A 1AHSA 2PLV2 3OTFA 1YJWP 2N9BA 1N73C 3VD3A 1SZBA 2GZWA 2PHFA 4YPCA 4EN0A 1PK6C 3CWBG 1W2AX 2ZX3A 4XMAA 2O0OA 1QKQA 5B4NA 3NNJA 3AE4C 1XE7A 3AFKA 3AL6A 4Z1MH 3WW2A 4CEWA 5C33A 2K2SA 5GLWA 1YNAA 4XOGA 3ZFGB 5F8PA 4GXLA 5K0UC 3Q8CA 2VM9A 3NKGA 3CPWO 1PGL2 3H6PA 4NAMA 2WWSA 4CSWA 2WLQA 4AOCA 5J37A 3VHNA 2MJZA 4AQ6A 3AVRA 5C39A 3CL1A 4R4LA 5GTHE 4WBBA 1RUG2 4PIXA 2BASA 5HV4A 1L0NE 2GNBA 2FCVA 2VGDA 1OOPA 4CCDA 4XUNA 4OVNF 4EQVA 5BUVA 4KWKA 2CDPA 1JU4A 1RF1B 1RUD3 4YM1A 3MF6A 1W2EA 3T0DA 4FPCA 2ZMNA 2JWAA 4AL9A 1VAKA 2FY8A 2WBKA 1YEWA 1W6NA 5ISLA 3TEYA 3AB0A 1NXD1 1BEV2 4C7NA 4FTSA 2WT7A 2X10A 1GFF2 5EXOA 3O6QB 3OCPA 5I8SA 3SWFA 2OYIA 1W90A 2K3RA 3VBRA 1GL2A 2VMGA 3VZOA 4PD4H 4GWMA 4SLIA 4XFCA 1A3KA 2C1FA 4QPWA 3GF3A 3PTRB 4Q0PA 3LIEA 2RS11 3A7OA 3ZDMA 2XJSA 3DKQA 2VUCA 1JZ7A 4XEZA 1RUI2 3FGAD 3PJSK 2IBZD 1JY3N 3DYPA 2ITAA 1CAUB 2R3SA 3LD8A 2VECA 5F6LB 1W6PB 4EN7B 2PFXA 2UYAA 2ZBJA 3LDBA 2RS53 4R4XA 2JDMA 5FJKA 3VHPA 2WFF1 2XUMA 2ZTNA 2DV9A 4FAHA 3MV11 2GN7A 5C8CC 1QJX1 4IEUA 5FXXA 2H7HA 1YQ2A 4XTMA 5CZKA 4BISA 4COUA 1PGQA 1RHZB 3RL0C 3LCPA 2Q5TA 3IMMA 2ZGRA 1AR61 1SQ4A 4HONA 1OA4A 3I3QA 3A0HE 3NO8A 4AI8A 4Z07A 2IXKA 2QSIA 2O3JA 1GQPA 3D0JA 4ZMDA 1UYYA 4RO0A 2QJPC 3WSOA 3WQ7A 3VD7A 3P1IA 2A5ZA 4AFDA 4KHXA 4JKLA 1NE6A 3WD5A 4A4AA 1NU1E 2Y33A 4XURA 5HXVA 4I01A 1QH6A 2I74A 4H44D 1P8JA 4E2QA 3H3UA 3AEEC 1URQC 1WMKA 5F2SA 3VZLA 1H89A 2WSEJ 1UOJA 4ITCA 2KD7A 4ES8A 3GM8A 3WG2A 1OW6A 3VTPC 1AF9A 2K9ZA 3GALA 3HE5B 2GC3A 2QCSB 3LEIA 1VF5C 2V4AA 5FYIA 4CCOA 4FPYA 4N53C 5BNPB 1KDKA 5EWSA 3RJRA 1L0ND 4E4ZA 4OVEA 2XPJA 1HV0A 3JB8A 3FWLA 3IPVA 3IF4A 5DJUB 5FV3A 2G9ZA 4LE3A 4DQAA 1C1FA 2QBXA 4MYEA 5KXEA 4R9AA 3F95A 4Y99B 2YO3A 1Q5OA 1O4YA 2F17A 3AM2A 3D8CA 4AEKA 1MV8A 1QL1A 1ENRA 3PUHA 5A3LA 1Q81Q 4K7JA 5APVA 4W65A 4JRLA 2OX0A 2QJYC 4BXLA 1FZCA 2EXKA 3VL9A 4JVAA 3MW3A 2FKWB 2F4PA 4PJ0E 4G9SB 2PHTA 3RSJA 5ANQA 1PPJG 2IVIB 1Q82Q 4QDRA 5B2GB 2R071 1RINA 3WF3A 5HCBA 3GYDA 4Q4W1 4NWVA 1SQQK 3SH3A 3LSDA 3OF1A 1YYNA 2YG0A 2HBTA 5JXIA 1FE6A 1OFCX 4IGPA 3TEXA 3VDDA 2JDAA 3K4DA 3TF5A 5K5GB 5EYXA 2Y0EA 1OVUA 3ES1A 4IE6A 4GT1A 4U3FJ 1ZXGA 2J1SA 5AW9B 4BCUA 3MIHA 4BXSV 5A70A 3SKJE 4TSVA 3FE5A 1PNFA 1QMJA 3SCGA 4ARXA 2LRPA 2RVAA 3HUSB 5CCGC 1RMU3 1SLAA 1VMFA 4YW4A 5CCHA 1OUSA 2JG9B 4YVSA 1VIWB 3ZDSA 4CCMA 4I1LA 3WEZA 1FZGA 4CP0A 2H6CA 1O91A 3NAPC 1SFYA 1D7MA 1CESA 1NU1D 1GBGA 2M5AB 2PAKA 3IIIA 1YBKA 5DUVA 1JYIA 4A7PA 2W1WA 2LTNA 1NG0A 3CCQP 3IN6A 3EBRA 1HVVA 1PM7A 3V2PA 3PU3A 4AEJA 5EQUA 1AL21 1LP1B 5AW1B 4Y1YA 5CFCA 1MACA 5FZ1A 3WF0A 2JG8B 1RB8G 3VD4A 1TE1B 4S2FA 5A3WA 1JZ5A 4PIZA 4XJ8A 2G19A 1Z0HA 1BBT1 2IXJA 4QDSA 1URXA 4DOJA 3TN93 2R042 4G3YC 5JZGB 4NPDA 2AUYA 2G4IA 1X50A 3B69A 5DDJ3 4JF7A 2YHJA 2ZZJA 1FV3A 1GANA 1XNKA 3UL2A 1ZR4A 1AR72 5JIAA 2JP3A 4IGOA 2CNAA 5LBEA 3LOIA 1OQ1A 1QQP3 1P84D 1GP4A 1OLRA 1DD3A 4LGDE 2P6CA 1RUJ3 2AEZA 3H25A 2CK3H 1R8EA 2ZZQA 1SQVK 1IG0A 2CPSA 5GTIE 1Y3TA 2F6BA 2WA4A 1K3IA 5CFDC 4B86A 1AR73 3MEPA 4W6XA 3V6IA 4SBVA 1RUH3 1YQ4C 2RS12 2PYTA 2D5HA 2YROA 2XVGA 1PMHX 3PJQA 2KK7A 1AXKA 2UY8A 4I6MC 1O4ZA 2CTVA 4FPGA 3JD72 3O12A 1VL2A 3CMEP 4GOFA 1Y8AA 1YIPA 3IM0A 2ZX1A 4E8CA 2VVEA 4UT5A 3VMZA 2BGCA 2JR8A 3ECQA 2WYFA 1MS4A 3GHGB 2ERFA 2WFF2 2N1TC 1N8RQ 4WV8A 1ZA7A 2Y0DA 4DRVA 1USDA 2MHFA 2IZ1A 3JD73 2K1AA 1J1EB 1O3QA 3OYWB 4OI1A 4P14A 5LZ6A 1VQ7P 4XIOA 2G9FA 2RH0A 1C3HA 3KF3A 1O4TA 4N43B 4DFSA 4CP1A 1BKZA 1PVC3 2D3RA 3WNLA 4DEVA 2VU9A 2O8OA 5KHGA 2W47A 1DFQA 3ZPOA 4GB33 5CNAA 2ET1A 1IZ3A 1EUUA 2IXHA 4CXYA 5FP4A 1OLQA 1PZ9A 4AEDC 4AGGA 4XCAA 4A2UA 4OCTA 3BODA 2H0BA 4YXWH 2JEEA 2PP6A 4MXVA 1RF0A 5FWEA 1UIKA 3W5NA 5IATA 1FBMA 1H8VA 5CG9A 2VZVA 3NNGA 3S7EA 3A0KA 3O1OA 1R1A1 1NO4A 3EJKA 4AI3A 3U59A 4P9GA 1Q3EA 3HWJA 1AX1A 2FDIA 1RITA 5FKBA 3ZYGA 1S1AA 1U7MA 1YIFA 3WP6A 1U5YA 3BTYA 1SPPB 3POYA 2TNFA 4R9CA 2VZUA 5HXMA 1SLBA 3GW6A 4NRQA 1L4AB 4FP2A 2E75C 2WTYA 1PVXA 1EYBA 1ASJ1 1H6YA 4I3PA 1N7SD 2VOKA 2XDJA 2GH8A 4W8JA 1XC6A 1K9MQ 1OA3A 4CXXA 3H7JA 1ZZ8A 1V6LA 4GODA 1C8M2 2WNVB 2R072 3POGA 2Z79A 4Q4W2 2VW0A 4ARYA 4JBZA 2JJ6A 1UN1A 3RGUA 3VD9A 3V0BA 5KC6A 2FYNC 2QVSB 1LESA 5FZ8A 3Q3DA 2VTXA 2LXBA 4QPIB 5LB6A 2LALA 1LAJA 3KZIE 2ADEA 2MEV2 4C46A 1Q56A 4NPMA 4RR3C 5GZCA 3SQOA 1W6OB 4I3GA 1WCDJ 5C9AA 1DGWX 1BE3D 5EIYB 4BB3A 1H4HA 1PGW1 2QQWA 2Q8EA 1HRV3 2HWB1 3WDWA 1S9KE 1SMVA 5AVUB 4UWDA 3F5HA 5SV5A 2NQYA 3O0WA 3ZFGA 2WIIB 1HN1A 1J83A 1ZZ9A 2JD9A 2ZEZA 1R5LA 1DYOA 5IVJA 3ACGA 3V2NA 1PMIA 3IDAA 3VUOA 1KILD 2WQYC 5FYHA 2QQMA 1JCDA 1YI2P 1LRHA 2X53S 5DZGA 1RUOA 1AL22 4RA0A 2FCTA 3SSUA 1N47A 1L7QA 4HLTA 5CKNA 2X09A 4OGQD 2AACA 4PT6A 4CDQC 3HBZA 4MHUA 2BNNA 4AQRD 1AYM1 3JXSA 5FKCA 2O01J 5FZOA 1HB3A 2QQNA 3X29B 1AR93 1GOGA 4GJYA 5DAPA 3CDZB 3M9HA 2H6BA 4MOAA 3AJZA 1WW5A 4Q5OA 4XDQA 1RF1A 4XBNA 4NJ4A 1YQ8A 2SBAA 1JYCA 4FFHA 1GDTA 1JYTA 1SQPJ 1XYOA 1SQXE 2QQJA 5IYYA 2DYCA 2HLEA 5ACA3 3C2UA 5AVPA 3Q8EA 1KFMA 4BMEA 5EPAA 4YYOA 1UO9A 2ZXEB 3D70A 3AKSA 2RJ2A 3U1CA 2VR4A 1Q8SA 3O6QA 5B66E 1QGLA 3DF0A 1VDFA 3M06A 1KEXA 3CQOA 2GALA 4YFZA 5F5IA 3RZMA 1WBLA 3ST7A 3R0RA 1S2EA 1UY3A 3WW3A 3FX0A 1FZAA 3VKNA 1JY2N 2QNKA 4PHZA 1MZ6A 1G9CA 4ISQA 1BK0A 3KV9A 4QQLA 1W9WA 2OYZA 5FZ6A 5GTHH 1XSQA 4PLMA 4NPEA 1SFCB 1RJ8A 1ZN5A 3IAOA 2LUWA 3AZXA 3GHMA 1GW3A 1RUE3 3C7OA 4OI2A 1UIXA 5LA2A 1YRZA 1NYHA 1D2QA 5J7MA 1EXJA 1VBE3 3VDCA 4LK7A 1JY2O 2FYUG 3D4KA 5JOWA 5CG8A 3VMYA 4NMIA 4D7YA 3QACA 2YPDA 3VBSB 4M4RA 4RN5A 1QU0A 1VQ4P 3WZ1A 4RHV3 3H42B 2W94A 3DCQA 1GNZA 3BU0A 2C24A 1OVVA 4NHKA 5CAZA 5FZHA 4HK8A 4XJZA 1HWTC 5CMZA 4H44C 2RJLA 3BI3A 4KNCA 1WGPA 3Q5SA 2J1RA 2JDNA 4LBQB 4OZOA 4LE4A 3LEKA 2D43A 2A71A 3CEWA 3L74E 1YUDA 3L35A 1FC2C 2OT7A 5KLIC 4TLGA 1NTMG 1JY3P 1N73B 2ZHNA 1VBA3 1PK6B 2ZCWA 1Y9MA 3OJBA 1KJRA 2VXJA 1KORA 3ACHA 4FT8A 1N1VA 3H3ZA 2X29A 1BGYG 3MIGA 3ZR6A 1OLMA 4XC9A 1ENQA 2CPBA 2J1TA 4HYTB 2DBIA 3IMNA 2F4LA 1H2NA 3I2GA 2Q6QA 4B1MA 2ZEWA 1EAH3 4PF1A 2WZ7A 1H8TA 3L70J 1ZRRA 2C9KA 5F5QA 4L73A 4L2NA 1M1KQ 2HEYF 3VBUC 4HN0A 5K0UB 2W6BA 3A0HH 1SQXD 1BZWA 4XHBA 4ZU4A 4P9LA 2KIKA 2YGMA 2JDYA 1RE3A 2XJPA 1I6XA 5JWPA 2K0GA 5CHXA 1SBEA 2BBVA 5F5CA 3DYOA 3ABVC 1MZFA 3U1AA 1ASJ2 5FZCA 3N9OA 5EJ1B 3PU8A 1RVF2 3AE9C 1BCCG 1Q8PA 2XDVA 4IFMA 4OMCA 2FXMA 4EYUA 2WZR2 2ZA9A 3UT0A 4F7ZA 1TVGA 2VRSA 1EZVE 5K9YA 2YC4A 5FXWA 1UOFA 1RGSA 1UY4A 2WNOA 2E53A 4CU6A 4RGGA 2GNTA 4J1WA 4JQRA 1UYXA 2IZ0A 1O7FA 3ILNA 4CDXA 5FPLA 1ZBE3 2BERA 1NA1C 4BMBA 3IWZA 3HN1A 3P8CE 2ZABA 4EV0A 2WZR3 3AEBC 4OHYA 1G1JA 3ASIA 2VQUA 1CAVB 5LEKA 3UNPA 1LHWA 2AYHA 3URFA 3PNAA 4Q27A 4CDWC 4B4QA 1MKMA 2XR4A 1JZ3A 2A6VA 3OB8A 2A3XA 2Z5HA 1QJY1 1GU5A 1LOFA 2VQTA 2EXHA 1YQ6A 3HUSA 2WQ4A 1POQA 3PIJA 1PGW2 1VQ5P 1WBFA 3RWKX 4XDPA 4DOUA 1NTZJ 5TSWA 4PJ0H 3HOBA 3WCRA 1DQ1A 3CC7P 4K40A 1KITA 2Q7CA 1XBFA 2JG9A 3AK0A 3S0MA 4Q8LA 1U5XA 1YFXA 2M5AA 3ACFA 1KRIA 4HH2A 1H8AA 4H0LD 2K37A 3NSTA 1NY72 1W0PA 5C8CB 3N9QA 3WQBA 3GBGA 1PZ8A 4OI4A 1K5MA 1WW7A 1FU1A 3P8MC 3H1JG 1LP1A 1X0TA 1CPMA 2IXCA 3RL0B 2WLPA 4L0PA 3ZN6A 4KWJA 4Q29A 3RJ2X 3M0DC 2JG8A 2ZYGA 1TMF3 4CU9A 5KAIE 3NJYA 2Z4EA 4GDOA 3JQXA 1GW4A 1VQKP 5JZGA 2QJPB 3O1SA 4BDVB 4KGGA 2QUOA 5F3CA 1S4CA 1H0TB 4MO3M 1W8FA 4Z1VA 5I8YA 4A7YA 2BV4A 2VOWA 3FMGA 3N9PA 5FP7A 1CR7A 1URQB 1GWMA 1MS3A 5AVZB 1OA2A 2CHHA 3T1MA 1FMD3 2VJXA 3IAPA 2MNGA 1LTJC 2VNGA 1VF5B 1XRUA 4N3YB 3LF7A 4N53B 1JTZX 1UIJA 2XWJB 3POBA 4P08A 3AP9A 2D2CD 3JBG1 3WP4A 1OIPA 1EZVD 4CZSA 3HNYM 3EQEA 4L75A 4LLOA 3HBKA 1NTKD 5T5JA 2FXOA 1CD3G 3R05A 3TEZA 1QJZA 2W1SA 1M57D 2E6VA 4LULA 2JO1A 3BCCE 4BPZA 1LTTC 4R9DA 3EYPA 3P8CD 3LEMA 4LOSA 1EV13 3WDYA 2P5BA 2W5FA 2QJYB 1GP6A 1YFYA 2K88A 1W8TA 4AHYA 3L73E 1AYN1 3GHGA 2V4HA 1Q7YQ 1L0LJ 3FN9A 4AFBA 2HFED 3CMAP 4FBFA 3JUUA 5BYNA 2OPKA 1YQCA 5KR7A 4KWUA 2DVFA 4EJRA 1V6OA 5FUNA 1XE8A 3NV2A 2BFUL 1S0GA 3H7YA 1PM4A 2ARCA 4IGQA 2WSCH 2E5TA 3NNMA 1NTMK 4LO7A 1CAWB 1YJLA 1EDLA 1E5RA 5GTIH 4GMP0 1V9U2 2XBO1 4JX0A 4N43A 2FMDA 4NIIA 1WKYA 5FZ0A 1R091 4BXFA 2WSSH 4RSUA 4BIOA 1ZW0A 2FYZA 5LBFA 4QQOA 1YO8A 3WUDA 5JIUA 3N7KA 4HK9A 1MS9A 2YZ4A 2XGXA 2HWC3 2A45H 3IR9A 4PD4I 2A70A 5B4XA 4BWOA 1X8MA 2V7QJ 4NHMA 1QVGO 4WBAA 3VBHC 3RG0A 1UMHA 3JCUE 3WV6A 3BIEA 1U5ZA 2ZACA 1L0NG 3GDBA 3NMBA 3PHMA 1K73Q 1E79H 1CVNA 3E1IA 4HSJA 1YLLA 4ZKPA 2DUQA 1DGLA 3NAPB 1YTZT 5H2FE 4PI2A 3RZLA 4A42A 4NHYA 1HB4A 4BH9A 3KQ4B 5AVAA 1OKQA 2ZX4A 1N7SC 3KZ4C 1T6AA 1C1LA 1L4AA 3OPZA 2IUWA 3H32B 3LWCA 5JXJA 4EN8B 4FPKA 4LKSA 1W06A 3T4HB 1UMIA 2ZYAA 2DCJA 4BQ1A 4F8AA 3CLPA 1LU1A 1ZRTE 4XXPA 5DUXA 1W8UA 3I55P 1AV1A 2WNVA 3LIGA 2B88A 3RZHA 4WWIA 5FK7A 4FFFA 5AVRB 1XTCC 4JGYA 2R32A 2A7AA 4LBNA 2DVGA 2Y6LA 4M4PA 3BCCD 5I93A 3FUQA 5APAA 4QPGC 1BE3J 1R5SA 2IYOA 2QG4A 1NAFA 4ZZ5A 3L73D 5F37A 4QPIA 4Q8KA 4ASWA 3UK9A 4AR2A 3NKTA 1VBC2 2XOMA 1LULA 3BB6A 4AAPA 2WQZC 5CFDB 3Q9OA 1W6OA 1LJ2A 4N78E 2QTWB 2AR6A 1GZWA 1WMXA 2ZOEB 3NV3A 2HYKA 2JXAA 1QJY2 3ZVXA 2M3EA 1XJAA 4YSFA 4EI2A 1XB9A 1KQGB 3POJA 3P6BA 2WR9A 1YHFA 4N6JA 5D8AC 3N7JA 4E9KA 1WCQA 1KILC 1QJX3 1AR83 4L11A 2W2IA 3VKOA 2NN8A 2VTFA 5H9SA 4UB6E 4O65A 2N1TB 2Q1ZB 2ZXQA 2ZVNB 1NU1G 3MO4A 1UU6A 4OGQC 5C4WC 2DCZA 1AR63 1MEC3 1HGZA 1W8NA 2Y6GA 1ZRIA 2DWRA 2W3JA 4B4RA 2XZRA 1ZZCA 1SLLA 4COZA 2A3WA 2XV5A 4JPZB 1QL2A 4OH8B 2EA7A 4Y24A 4QQPA 5DZFA 1ZREA 3HIFA 4A3ZA 4N8MA 4ATFA 2WWUA 3EQ2A 4YZ4A 4CEYC 5AW2B 3I2FA 1NZCA 3IT8A 4AW7A 1HQLA 1QJEA 1XYNA 1J1LA 4AEDB 3E7KA 4ZZ8A 2DCYA 1J3PA 5IWFA 2GU9A 2E7QA 3WF2A 1T3JA 2JWDA 4HVQA 2SPZA 1W2UA 3J7MA 2OVUA 5F32A 5C5TA 5DQ0A 2HODB 4V1PA 5FY4A 2VW2A 1TU3F 3GBFA 4CEWC 1KN7A 3V0AB 2RR12 4FI9A 1O5UA 2IYPA 1YJKA 4OUEA 1JOBA 4AI2A 1YWKA 5CBNA 1A8MA 4ASMB 1GSLA 1SFCA 1IJDB 3AE8C 1QJFA 4JYBA 2HLOA 3B94A 1Q86Q 4Z2AA 4XFAA 3G6EP 3HVDA 1UXZA 2ZGNA 2P4EA 1OT5A 3M91A 1BHGA 1WW6A 2E75B 1AA0A 1DZQA 3PVBB 5KXDA 3A22A 5F39A 2OARA 5BXXA 5E8AA 4N78D 1LGCA 4CUCA 1Y47A 4ZKTB 1IK7A 3VBSA 2OYHC 4TTGA 4D94A 5B66H 3K51A 3PL0A 3VKMA 3WNPA 1PX4A 2EIBA 3BIWE 5CVRA 3CXHD 2XBO2 4WVMA 1YQ3C 4ES9A 2FYNB 4IEZA 1JY2P 3PTZA 5KLVD 4D7SA 2FQPA 5JUVA 4KBZA 3WNMA 2OYIC 1IS4A 4XA4A 2HPCB 5T54A 1L0NK 2QM8A 3EFGA 4UB8E 4DMIA 1WRGA 4RR3B 3L36A 1EDJA 3KV4A 4Q4Y1 4WZCA 5DZEA 3H3LA 4K20A 1PK6A 1IS6A 3AE3C 4AF9A 3C1LA 3ZYBA 1OURA 1NVOA 5JXHA 3PH0A 1SQXJ 2BRTA 3HQRA 2BEOA 3AXEA 3GZEA 4BK5A 5E6HA 4D8MA 4DXTA 2ZS6B 2IZWA 3Q8FA 5GALA 4LT5A 5K0UA 1TG7A 1EDKA 2ARBA 3OOXA 2W6JH 4C1WA 3M9BA 3SHRA 1SQBD 3BRVB 1L7RA 2DVAA 2H0VA 3K48A 1IFJA 2QA4P 4XILA 1RHI2 2WSFH 2QFEA 4B3NA 2R061 1BBT3 4XJUA 4K35A 1RXFA 5LATA 3BN6A 4MLOA 4BQ3A 4CDQB 1JMUB 4YFWA 4JQ0D 3HQUA 1ACCA 5FOBB 2KZIA 1PO13 2PTMA 5CYYA 1JN2P 1QOOA 1S5LX 1AQ5A 3QD6A 1BJQA 4HN1A 5T50A 5T3NA 1RHI3 3HD7A 1DGRA 2VXRA 4K8FA 3W58A 2CU5A 2C9LY 5JI7A 3TK1A 4YLZA 4JTOA 4S2GA 1EDIA 1O3SA 3M8LA 4OQ8A 1KC8Q 2QDNA 1KS4A 1S0BA 1SG3A 3RZGA 4M3CB 1X36A 5A3PA 2A45G 4PBPA 2Q1KA 4LOTA 5DUWA 5APTA 4IEXA 2YMZA 3CD6P 2YIUC 1XE0A 1CAVA 1BVVA 3OW2O 3WUUA 3I4IA 1GQGA 2CY6A 3RK3C 3ZFFC 1KQFB 2VCMA 4YARA 3SNMA 3J7HA 2HWE1 3JZVA 3ON7A 2H89C 1NU1K 4CCEA 3HT1A 2VMCA 4UW4A 2Y0CA 3KWVA 1KDMA 3NV4A 3L71D 3OPWA 3U0ZA 1HRI1 1W2TA 3ACLA 4H0LC 1QVFO 3E97A 1AJKA 1QH7A 1SFPA 1BMV1 1X33A 2JDUA 3O7OA 5KJ7D 2HBUA 1UMZA 3JCIA 4B7KA 4W4ZA 2KLVA 3WHUA 5A6ZA 4I7ZC 4HB1A 1PIV2 2R16A 4KMQA 3H1KD 4ONUA 4LA2A 2CWSA 2PHDA 1DIPA 1EXIA 1OF4A 4YZ1A 1VB2A 2ET7A 2JDKA 1UWWA 3C7HA 3VZKA 4E8DA 3B02A 1DG6A 1FPN1 1HQWA 1NLQA 1KFNA 4Q0UA 4WY4D 1LHOA 4GIFA 5JSOA 2XKMA 2QRXA 1RUF3 2OPWA 3AZWA 4QAWA 2DCTA 4YG6A 2PXJA 1K45A 2Z4FA 4H44B 2G9GA 2ZEXA 3SWKA 1H0TA 4W50A 3HRNA 3H1ID 2JIJA 4ZS2A 3RMYA 2GMPA 2RE9A 3ELNA 1WT6A 1C5HA 1FOD1 2DUPA 5KLIB 1UYZA 4IOIH 1RL3A 2W95A 3U4XA 1R1A3 3CO2A 4FOQA 2D2CC 4RGKA 3ZXDA 3OEAA 4YNIA 1NTKJ 3MIBA 1M90Q 4XAEA 1Y9BA 4N53A 2WS91 4QGMA 4RJTA 1FDOA 3UGHA 4CPBA 4XE9A 2R0HA 3AP4A 4OHXA 5IW0A 4TN7A 1QXRA 3WP3A 2A06G 4D6QA 1I5ZA 4Q0SA 1N1YA 2ZAEB 2GAUA 2P10A 2OQQA 1E5SA 3VBUB 2VMDA 5A3MA 5KAIH 3RYPA 3DGTA 4PLOA 2V4VA 2DVDA 4FXGB 1ULCA 2NPSA 3TNQA 1C4RA 3U37A 4DIQA 3KHUA 1NYWA 2BTVC 1QIQA 4LEJA 4MUVA 4XF3A 5T5LA 2IBZI 4C1XA 3L75G 3M3QA 1DF0A 3N9LA 4GWNA 1W04A 5ABJA 3FLTA 2WVRA 3WP5A 1LB2A 2W90A 3B3QE 5DMYA 5FMCA 2CAVA 3BTAA 1GUIA 3AZZA 3GCXA 3WCSA 3VGIA 4YW6A 1H9PA 3R2PA 4C0HA 2YU1A 4CCJA 1CAWA 2ZKLA 3N7NA 1IQDC 2YC2A 2W8ZA 3ILFA 3HTKB 1G7YA 1VBB3 1NA1B 3AMQA 3N7LA 4UYBA 4BU2A 3LOBA 3D6EA 4NPRA 1UYPA 5L9BA 4OLLA 2VQ0A 5FP3A 4B7EA 4D6TG 3EO6A 5H9QA 1MQTB 4KH9A 2YNYA 2WPQA 3WMM0 5I0TA 2W39A 1QNWA 4CDWB 2VBBA 3OAKA 2VPVA 3LB9A 2W46A 1XNDA 4DNYA 3D6ZA 2JEMA 5FMOL 1BEV1 2Y6JA 1WMFA 1GK6A 1VQ6P 3AE7C 2R5BA 3CZUA 3HR9A 2RJKA 3B71A 4HFSA 3DECA 2ORZA 3NAPA 1JUNA 5KBFA 1NKGA 5FMDA 4ISRA 4CDUB 3AZVA 2Y0OA 2A6WA 1A8DA 2GH2A 4C7RA 4EOTA 2VL4A 1S3JA 5L8RJ 5APUA 3TGUD 3VBFC 4X6RB 1AYM3 4KBBA 2R062 5KAFE 4Y1VA 5DXDA 5AC92 3H32A 4BHPA 5CIRA 4XFFA 1W28A 5AFEA 2CAUA 3QH6A 3BCCJ 4QU1A 2GC2A 4META 3M2MA 5A7NA 3E1RA 2PA7A 3MGNA 3PUSA 4L97A 1HXS3 1UY2A 1KYOE 1VPCA 1VQLP 1NWQA 3V5BA 1Z56A 1ENSA 3JCUH 4LLFA 3CWBD 1MZ9A 2NZ9A 3AYCA 3NJXA 1WLWA 2KNCA 3OBTA 4HBNA 2XQXA 4OHVA 2A6XA 1QOTA 1S0JA 3M9QA 4HOOA 1LTJB 1ZNPA 4JQTA 2Q8OA 5H2FH 4W6WA 4Q4V2 5CFDA 5AW3B 3ENRA 5IUQA 3HEIA 2UWBA 3KB5A 4LJHA 2HEVF 2JECA 2VCCA 2WNUC 4QXKA 1Y7BA 3HNBM 3M1HA 2P7JA 5AVWB 3ZSMA 4COVA 1LNSA 2Y0IA 1JM0A 4LXLA 2KM2A 3PUAA 2RS32 4GA9A 1HRI2 1T6BX 5JOXA 1Y4WA 3HD8B 2D93A 1ND2C 3R6SA 3AFGA 5J98B 3APBA 5H9RA 4XTPA 2Z5IA 3GZUC 1VAMA 4BE3A 1OKOA 2BWAA 1ND3C 1Q90D 4KG8A 2KUBA 3CNAA 2RM23 2HWF2 4GWJA 4QHZA 2N1TA 2WUHA 1W9YA 3KVBA 4LKFA 1LECA 2WL1A 2WWWA 3NWKA 1WW4A 2WT2A 2VCBA 1SCSA 1F5FA 4AFAA 3LIDA 3L74G 3V65A 3MFCA 3WNNA 4EWDA 3ILRA 3WF4A 3D71A 3JQWA 5DG2A 1ENXA 5KKZB 3IDBB 4JZRA 4Y1XA 3RQ0A 2AH2A 4XXAA 3WNXA 1SS1A 1DZTA 4QQ2A 1W05A 2Y6FA 4KQ7A 3C7GA 4HANA 4HKOA 3MFAA 2NLRA 4IL7A 1SVFA 2HG5D 3B93A 1EUTA 3N4MA 1AFOA 1RIRA 1Y9GA 1SQPE 3CMGA 4KU8A 2WT1A 4GH4C 2QZ3A 2DF7A 1H9WA 4QB6A 2RMU3 3RYRA 5C9AC 5E79E 3LZZA 1HKDA 5LEJA 1QGKB 1DEBA 1QXPA 1QNYA 4YW7A 1MS5A 4NIDA 2HODA 2BCCG 3Q8BA 2MKVA 3VBHB 2R6QA 4UB6H 2LW8A 1CAXA 4JDMA 1LHUA 5FZFA 2BZDA 5A1FA 3NXSA 1UY0A 2RDQA 1M7LA 5C7GA 1USEA 3V0AA 3ZO0B 2A6YA 1RMU1 4URTA 1FI2A 2Y9YA 3O0XA 3P32A 4IE4A 3O1RA 3O1TA 2YO2A 4LC1A 1W6MB 4ZU5A 1SQQG 4JAAA 1DCSA 1V6KA 4E27A 1MS0A 3IDCB 2XHNA 3VBOA 4NWWA 4CXWA 3MZHA 1N7SB 3RMXA 2P1JA 2QVAA 3OUHA 5IK4A 2IWGB 3HQXA 2Y38A 3H1YA 1LTGC 2KZJA 4NRPA 1LCLA 1Y43B 2CV6A 1H2LA 2MPFA 1X79B 4H13D 3V64A 3EFFK 4FOVA 1POV1 5KLVJ 5IHRA 1IZNB 3CCRP 3VMXA 2QJVA 2AXTE 5JSPA 4INDA 5FZGA 1JYVA 1PL5A 1CX4A 3KYQA 1LOCA 1RUD2 1CZVA 5DDJ1 5J1XA 3ZXJA 3KVAA 5JSRA 4M3LA 1W03A 2X05A 1DQ2A 4QPGB 2XNDH 4UBGA 1AXZA 3OD4A 3AEGC 3V56A 3VDBA 1JMMA 5APWA 2R041 2HPCA 2I8DA 3KXDA 1JMBA 1VRH3 2I45A 3S4RA 2Z69A 1HB1A 1FX5A 3KCYA 4RR3A 3MLJA 1UPIA 1GLHA 2QQPA 4XFBA 2VUAA 3NTNA 4Q26A 4JYCA 3TYJA 4EE2A 4D7TA 3A0BE 4Z82A 1AR71 1JOCA 1S1CX 2VBPA 1RUC3 3MPPG 4CTEA 1SQXK 3J8F3 2YC0A 3I54A 1LT9C 1SQBJ 5FZ3A 5D8AB 3L70E 4IEWA 3T97B 1MVQA 4IEVA 2YKOA 1KILB 2D40A 4MHRA 1SQPD 5JMOA 4AHXA 2VQAA 1PPJD 3E6DA 1YJNP 3ZSLA 3TYYA 1JUHA 3E5QA 2DTYA 4U2AA 2RS52 4OGQB 5C4WB 3RZKA 1UU4A 1AVBA 4UI9L 2ZYDA 1R64A 3JD71 1JYWA 3U10A 3K3NA 5CISA 3PVEA 4LITA 2JICA 1SQVG 2ARXA 1E5IA 4UB8H 3KPEA 1UX6A 2ZVOB 4CVUA 2QQUA 2VMHA 1MFZA 3ZXFA 3KV5A 2WSEH 1F2NA 4R4MA 3ZXKA 1OQEA 1F4AA 4KI5M 4RESB 2ES3A 4CEYB 1PVC1 3L75J 2IDBA 1SBFA 2PN5A 1IFIA 2KA3A 1KZUB 2Y64A 4QGLA 4GB31 3NNLA 2K9JB 2WN2A 2RDSA 4M3CA 2H88C 3H8OA 3ZSJA 5FZAA 2UY9A 3OD0A 4DJGA 3O1UA 3L71J 1W6QB 2A45I 4GOEA 3NJVA 3R4YA 2B42B 4XUQA 4YTPC 3TRSB 5EFWB 2WO2A 4CEWB 3S9OA 4XFIA 5FZ4A 4AQSA 3M3OA 5F3GA 4N9HA 3POSA 3I3MA 1QJU3 3PVNA 1H8TC 1PP9G 2ENRA 1XXNA 5FZLA 5FK8A 4D6TJ 4OFGA 1NTZE 5CJ0A 4WM8C 1I5PA 4LO8A 3H1KJ 3BYWA 2QJKC 5KJ7C 2XU6A 3LEGA 3RNSA 3MW4A 1AYN3 4LIVA 1BSNA 1NCRA 1S2BA 4HPKB 3N35A 5HCHA 5FPAA 2JDZA 2VMEA 1O5LA 2ZGPA 2BOJA 2WWJA 2W92A 5FY1A 2XG3A 2C9NY 5FAXA 2P3YA 3C7FA 4WY4C 5FXVA 3IN9A 1WD4A 1X22A 3IBMA 1GNYA 2E7TA 2OYHB 1ZBA3 3W21A 4IXLA 2WMMA 2P2UA 3TDKA 3H1IJ 1R093 5K8SA 1NHLA 1P84E 3HD7D 5AVQB 4CDXC 4XZPA 3FXDA 3SCFA 1LOBA 3L70D 2WT7B 3U14A 1LGNA 2EXJA 3AE5C 5C70A 3H1LG 1S2KA 4UBHA 4Y5SA 4XMIA 5LBBA 2ZMKA 1C8M1 2YFZA 3FWNA 3LW5J 2VNRA 3L72G 2FDKA 1GZTA 4O61A 3A4UA 5IVCA 3WQ0A 1NTKK 1LOFC 2GA1A 3OGRA 4EZ4A 4LO6B 5DN2A 4QD2A 1GZ9A 1UZ0A 1ZRCA 1RMU2 5EV7A 2ADDA 5EJZB 2MEV1 2ZFCA 1H1MA 1GMJA 1JCCA 5KTBA 3RGBA 1VMHA 4N90A 1JEKA 3USSA 5FWJA 2R0FA 5A80A 4FPHA 3UKTA 1K5MC 2R3CA 1IFNA 2RDRA 2J5UA 4LBLA 1S0DA 3MUZ1 4L99A 4NIHA 1S0CA 4AGRA 3T08A 5A1LA 2BP6A 2Y6HA 1O3RA 1L0LE 5A7QA 5FR3A 2VUJA 4P5YA 5AW0B 1QOSA 3JB4C 2I1KA 1GV9A 3SLIA 1WUVA 4JHZA 3TN92 3ZXAC 1DGWA 1LOEA 1AR91 4L92A 1NTZD 5F7UA 5FY0A 1I3HA 4OHWA 1JUIA 2OA2A 1JBCA 3CC2P 4RQPC 5FQ0B 5DDJ2 2O01N 1HJBA 3HTKA 2GNMA 1NA1A 1YTZI 2PHLA 5A3UA 1YITP 1H30A 1QQP2 2XUEA 5ACA1 3I5CA 4NUBA 2YIUB 4OWFA 1MQTA 1OFNA 3A21A 3RYKA 1RUJ2 4MN4C 3THPA 2PFWA 1GYKA 3HE4B 3ZFFB 1JB0J 4LBOA 5LRRA 5GLVA 3GJBA 2W6AA 4KWLA 3WDXA 2WZPP 4IDZA 4GULA 4CPBD 4UFJA 1AXYA 2FFDC 4XFJA 2ZMLA 3VZNA 2FZ1A 1KB9E 3F2ZA 4FOWA 3I8TA 1RUH2 2OIIA 4NHXA 4TYSA 4PLNA 5M1BA 4H0LB 2RHPA 1D2SA 5FZEA 1WMDA 1NKZB 4IQPA 3TGUJ 4CE8A 4CPGA 1W0OA 2BCCJ 2UWJE 4AI1A 1IC2A 3SEPA 2B9UA 2Y34A 4FFGA 4CDUA 2XVKA 2NPSD 1RUE1 3POFA 4I7ZB 4Y1UA 4J1XA 3SITA 4Q1RA 1QY4A 2VMIA 4XIKA 3LA2A 4DZOA 4D6RA 3B00A 3WDUA 3HT2A 1IPJA 1VPHA 4K1ZA 3Q2YA 3M0DA 1UW8A 1E5WA 2W9XA 1OW7A 1PIXA 4QXHA 4V2VA 4HMZA 4MGZE 2EF6A 3CWBJ 2B4KA 5FZ7A 4RHV1 1COV3 1RH5B 1CJDA 3MW2A 4A7KA 3B5NA 2D6PA 3DL3A 3T4VA 3H9AA 5E1RA 3FWEA 3NNFA 5JMCA 4Q1PA 1PVC2 1PO23 3GJAA 1DYKA 5AVVB 1K8AQ 3VN4A 3OJAB 1UZZA 1QEXA 1BE3E 3VKLA 4GB32 5C3OA 5AW5B 2JB4A 4BQ5A 1JOJA 4YM0A 3VV1A 3CJIC 5FLJA 3HAGA 3ZYPA 2D2CB 1HF9A 1L0LD 1V6NA 4AEMA 4GJZA 1AZDA 4BK4A 1GWKA 4H7LA 1D4M3 3G4SP 3EB7A 3LPFA 2C9AA 3BCWA 4NE9A 1ZMEC 3UKVA 1OF3A 2H43A 2QEXP 3H8RA 5J3UA 4PQQA 3B4SA 5AW4B 5KAFH 2D3PA 3ETPA 2X5IB 3CL3D 1KILE 4P9JA 4YGDA 1M1JC 4L8QA 2YYOA 4AE2A 2HYXA 4U7JA 3OBZA 3UJOA 1BGYE 2ETEA 1L4AC 1RE4C 2BEZF 4NAOA 1KYOH 5BU5A 3S57A 5FYUA 3WY6A 2BW8A 1L3JA 1NX9A 1W39A 2BFUS 5FPZA 3V4QA 2W08A 3KGZA 4Q4X2 2KSJA 5CADA 2BYVE 1OH4A 3N9MA 5FTTC 2WJSA 4JGYC 2IC1A 1VMJA 1KB9D 3GHNA 1WA4A 2BJSA 5FYSA 3TNUB 4I0BA 4RS5C 1HX6A 5KHJA 5CKMA 3VHOA 4LNVA 1DQ6A 2VZSA 3AMMA 4Q4X3 4Y5TA 4XUPA 1ZOYC 1RVF1 1ZBE1 4KGQA 4MGIE 3ZFEC 4Q4Y3 3PJYA 2XKPA 1SQVJ 2WZR1 3U1XA 2FCUA 3L4FA 1IO4A 3EMRA 5FO7B 4I02A 5T52A 3GBWA 4AVBA 1IS5A 4CCLA 3VBHA 4YM2A 3I59B 4WZFA 3GZTB 2A6ZA 2NYYA 1MFTA 3FC0A 1LGHB 4IEOA 4HXCA 4JKKA 1Q8VA 1LT1A 1HRV2 3AMNA 1J2JB 5H9PA 2WKKA 3K77A 3ZR5A 4MGKE 3NL1A 2HWD3 4BQ4A 1W6MA 4XABA 2FYUD 4F83A 2O01H 1VQPP 4Y22B 5AW8B 1EZVI 2OQ6A 5E88A 3LAGA 1Q8QA 1QF3A 2L9LA 1YIJP 3SWYA 2XL7A 5A1AA 2BU9A 1N7SA 2VZ3A 4FVVA 3VBFB 1N86A 4U3FG 1D4VB 4H13C 5IFTA 2UU8A 5I0DA 5IVFA 4EWEA 4HSLA 4R9BA 1QLED 5J36A 5KLVK 1X9VA 1F35A 3I3EA 1J84A 5E79H 1NY71 3TBDA 4MADA 5L36A 3GNEA 4MVTA 2W1UA 1BVP1 1UD1A 1AR92 1SLIA 3H1HG 1C28A 2D7FA 5CBLA 3LDKA 2PHUA 1RY3A 1H2MA 1KJLA 1LGBA 2NMNA 3CX5E 5TJHA 2CGOA 3VOPA 1W9FA 2JD4A 1GR3A 1US2A 3K46A 3A23A 1O8SA 1BGYD 1X8YA 3K75B 2JENA 4RFRB 4LUKA 1OUXA 1U7JA 1VQNP 1YYCA 5ACA2 2PHRA 3ZYRA 2D3SA 1VBD3 4LR4A 1OFSA 1BDDA 3Q1MA 2HWE3 4XDOA 3KT4A 3VN0A 2ATFA 5JVVA 1OVRA 2WNUB 1NT0A 2KP8A 2ZHMA 2XONA 1OBNA 5GLZA 2WITA 2E33A 1HBWA 3IZOA 4COWA 5FLIA 3M7AA 2DCKA 1SQBK 3EWKA 1ND2B 3L72J 5FO9B 3T97A 2EAKA 1KILA 4PDWC 2QQVA 3KCXA 4DZGA 5GZGA 3FLPA 2AXTH 1ND3B 3J7NA 1XNBA 1CW5A 4IESA 2OGUA 1EV11 5KXCA 1RUE2 1JHNA 1W8OA 3F89A 4UW6A 1LTBC 5C4WA 4BRYB 4YW1A 1FPN3 1VBE2 1C5IA 4IEPA 3AKQA 1VAVA 4AYCA 2H8PD 5GZEA 1T6GC 1W2OA 1UIIA 3MICA 5F9TA 2E5YA 3ROUA 3D3AA 2HR3A 1NLRA 3USUB 5FYZA 4IV1C 1CAUA 5LCWL 2VUDA 4HETA 1RQUA 4GKXA 1W6PA 5I8TA 5APSA 2KR2A 3NV1A 3ZM8A 4RHV2 4C8DA 2VO5A 1TME3 1IHMA 5A7PA 3ITQA 4JKMA 3A0BH 4CEYA 2P3JA 5A3NA 2PHXA 4D0QA 1QWRA 1FXZA 4QU2A 4GH4B 1NH4A 3AEAC 4XJ9A 5LWBA 2K9JA 5F2WA 2R1DA 5C9AB 3RK3E 1US3A 2VOVA 4O7XA 5FUIA 2C6SA 2WS93 3BALA 4AAXA 2WYSA 4JRAA 2HWC1 5AFBA 3BASA 1V9U1 1VBA2 1W6QA 2C5DA 1NLSA 2E74D 4MGYE 1Z7S3 1CJPA 2PLV3 4Y3OA 1X9PA 5FYTA 1VQMP 3BVHA 2AZ5A 3UGFA 4HZFA 3B8EB 1CZQA 3BGAA 3QCWA 3QH7A 3LA7A 4OI0A 4AUWA 3FJSA 1EAH2 3CX5D 2LR2A 2ZT9D 4NRMA 3U07A 3H1JD 5C8WA 1GL2D 1NOVA 4YVWC 1V0AA 2Q1MA 2XJQA 3HE5A 2DFCA 3WINE 3WXPA 4HPKA 4NVPA 2P1BA 1Q8OA 1GZLA 5BNPA 4AGVA 1FJPA 3DN7A 1BLZA 2NPIA 4YW3A 3CI9A 5KHIA 1U57A 5FIXA 1G2CB 5FZOB 3CJXA 2VNOA 2VOXA 2ZGSA 5BNOC 1QDOA 1X82A 3AC0A 2E42A 4LTAA 3B01A 1FOSF 2IFRA 1VJ2A 3MD0A 3HD7C 2PQSA 3MIDA 3DPRC 3BATA 5EYYA 2OYHA 2AXCA 2VULA 2YMYA 3NQHA 2YBKA 4HVRA 3FX3A 3G7DA 1GWLA 3JU9A 5IVYA 1RUG3 2PAMA 4K6BA 4FXKB 4BA6A 4XF1A 1N1SA 2VG9A 2XLGA 2PAJA 4AG4A 1U0AA 3FHIB 3CU7A 1ZBE2 1MPXA 2JE9A 4YW5A 1CIWA 2XVLA 4MZUA 3I7DA 3NW4A 4BJ0A 1SEFA 3S6PA 4X8PA 2N9YB 1J1TA 2WABA 4PJYA 2O1QA 1NCQC 1PX3A 3SFDC 3AMPA 1BEV3 1NTKE 3HPNA 2JWPA 5CU1A 2FBEA 5C71A 3VHRA 4LHNA 1KV4A 3WUTA 3AYAA 1JH5A 5FREA 1ALYA 3IAQA 1VP6A 1FS0E 3ZOIA 1LT9B 3CCVP 3BOWA 1BDCA 3UESA 1W99A 2G8YA 4M01A 3AECC 2C26A 3LA3A 5JLVA 5LK7B 2BWCA 2DVBA 1VBC1 1VALA 2WNEA 1BK1A 3R4SA 3ZDVA 1UKGA 5FDBA 4QB1A 2Q30A 1OH3A 2XJVA 2WZ8A 2VVFA 3M70A 3OEBA 1AR81 1P84H 1RUI3 2GP5A 1NAYA 3GXUA 4Q0QA 3RK3D 2V5DA 2ZHKA 3BKZA 2DURA 4PQ9A 2J1EA 1MEC1 2WC2A 3J26N 2NP0A 3AE2C 2PMWB 2AEMA 2NZ2A 1CQ9A 1JY3O 2Q8CA 3RWNA 4M00A 5IJRA 3VMAA 2VH9A 5E16A 1TMF2 4AZZA 5C6CA 5JI9A 2OQ7A 5L19A 4XQ4A 2RKLA 1D7PM 1YJ9P 1ULOA 4HKWA 1FJKA 2E76D 3IFMA 3SFEC 5HPOA 1DH3A 5FQ0A 4O9BA 2DTWA 4LMFA 1KS5A 1RUNA 4AVCA 2GMMA 1B09A 2LROA 1K04A 4YGCA 4QKBA 1G9BA 3UJQA 4IE5A 2ID4A 5FPBA 3CXHI 1GMMA 2YFUA 1FMD2 4IEQA 4U36A 3HE4A 3ZFFA 5AW6B 4RKUJ 4XAAA 4Y33A 1WLCA 4A3XA 3I3BA 1H8TB 1FATA 1R082 2DDUA 1S5LE 4AK3A 1WZXA 5BVZA 3FLRA 1YI7A 2P58A 4MGTA 4WM8B 4KG0A 3KHCA 5JPMB 2BNOA 5FY5A 1DYPA 2QJKB 1IQAA 1UU5A 3QWOC 2NPSC 3AE1C 2JDIH 4BWNA 3K4AA 4P9XA 5JPNB 4PI0A 2KYVA 3WOGA 4LIUA 2D6LX 1H4GA 1R083 1EV12 1JHJA 3T0BA 5ABJC 2RR11 5F3EA 1SQPG 1G6NA 3CIHA 2O8QA 5CCHD 4WY4B 4OMDA 5FOJB 5I91A 1DU3D 4CCNA 3PUQA 4XYXA 4V2WA 4ASKA 2B8MA 2E9QA 2JIGA 4J6GA 5AVYB 4E2GA 4XJAA 2W52A 5GLUA 4WVZA 4RGAA 4CUGA 4Z92B 3AX4A 2W1QA 5FCCA 2IBZG 3I2JA 4CDXB 4W6YA 3MUDA 3TNPB 1LODA 4JCKA 4H14A 5BU8B 1OWAA 1JZ4A 4FSJA 3ME2A 2V09A 4A45A 2V7QH 3A3YB 1F4HA 3T2PA 1ZX5A 4AI9A 1H1AA 1W8ZA 5J48A 4WB4A 4LORA 1CI6B 1IOAA 1PGJA 4GKYA 1KB9H 1YQ5A 4IETA 3N4XA 3C8XA 4WM7C 4COYA 2YMKA 3OYWA 5T5OA 4H3WA 4DXSA 1GQHA 3CCSP 4NOTA 1JZ8A 4AFMA 3H1HJ 1XU1A 2HWC2 4LHLA 4S2HA 1DQ0A 1XYPA 3MZWB 4IERA 4Y1ZA 3RDIA 4GWIA 4E2SA 4EROA 2SLIA 5I0RA 1SCRA 5L7OC 3SKVA 4ZNCA 4DUXA 2XWBB 4IV3C 4EDFA 1H1IA 2X5IA 4OUMA 2Y9ZA 1WWYA 1YFWA 1APNA 4GQ7A 2QDRA 1T2KD 1UNBA 1K5MB 1GP5A 4UFKA 2JE7A 3ZN6B 4PV1D 1TNFA 1UOGA 3HJRA 1W9TA 1POV3 4YGEA 4DRRA 2E43A 1HJFA 1R1ZA 2WSUA 4DUVA 1FT9A 3RBXA 1EQ7A 1UY1A 2WAAA 3C3VA 1PO11 1PGPA 2G1MA 4QB2A 1N3QA 2GM4A 1X8EA 2EVXA 2BGPA 2OW4A 4AVVA 1SPPA 2GNDA 3W67A 1RHI1 3D6YA 3TNUA 3KF5A 3B5ND 4RQPB 4Q0VA 1T2XA 4DY5A 4K9SA 1V6MA 1YCIA 2VVDA 5FZ9A 3ZPYA 2R043 3RK2D 3L70G 3GMAA 2YY1A 3MF9A 2WINB 1SACA 2IPPA 2FXPA 2ZAAA 3S1KA 5DPNA 2KSEA 2JDPA 5A7SA 3T3YA 2TUNA 4AHWA 3OGJA 5FMOS 1HW5A 1MZEA 1NE4A 2OUHA 3GLMA 4JGZC 2AEFA 4I0AA 1W5CE 4ET7A 2B39A 4DPNA 3WG3A 4IE0A 1W2NA 2FFDB 4QPYA 2FYUJ 4XBLA 1GU4A 3HMYA 4ZPIA 3RVHA 5IVVA 3I59A 2JB8A 5G05L 2M3BA 3VZJA 5A6YA 1A78A 5FUPA 2VZRA 2XL9A 2A73B 4ASLA 5T55A 1REFA 5B5EE 3IIAA 1REEA 2RS13 5GJ6A 1QDCA 1V6JA 4Y22A 1QJX2 1AR82 3WNKA 2L91A 3W59A 1EC5A 2Q5UA 1BXHA 3VBFA 1FAVA 1WLDA 2J1VA 1VB4A 2JKVA 1AR62 1MEC2 1NTMJ 2ZX2A 4YZ5A 3CXHE 4KL1A 3ZLIA 4E4SA 2WFF3 2J22A 4QWNA 5KLVE 4AQ2A 5BNNC 1LWUC 1BGYJ 1HIXA 4HG6B 5FZMA 3VZMA 5BNQA 3CCJP 4FCAA 1PIV1 1RUF1 2K46A 2LXCB 1CSBA 2Q4SA 4QX1A 3VYIA 1TZOA 1Z78A 1M06G 2QQKA 4Y20B 1NTZG 5JR2A 4LUMA 3ZIWA 1CZTA 5M0TA 3O0VA 3SXWA 3SEEA 3CJIB 4IW3A 2C4XA 3KZIH 4LBJA 4PCRA 2AC1A 4GALA 4DXRA 4M0HA 1M4WA 2BQPA 1ZLLA 2J1AA 3THTA 4XQWA 1VQOP 5A32B 3T2OA 1B35C 3FL7A 5I0SA 3J4UH 1F15A 3UV9A 3UGGA 3SC7X 1OI6A 4OULA 1LTAC 1CZSA 5JOYA 2WNUA 3RFRA 1NXMA 3KQGA 4TT3H 1SQPK 1BCCJ 2BUKA 2FMYA 3OY8B 3E5UA 4H7MA 4UXAA 4BQ2A 1SQBE 1M1JB 2ZXXA 2VNVA 3VBOC 2R7EB 1S72P 4MX3A 3IKWA 1HH0A 3WF1A 1ND2A 2IXIA 2W0XA 2WO1A 3LIHA 4QKDA 2VZTA 2J42A 1UZWA 2AEJA 1ND3A 2FHRA 5E89A 5DABA 2WDBA 2EIGA 3PURA 3ZSEA 5IAXA 1IFDA 5HBAA 2A06E 3CX5H 2PRRA 4XACA 4BRYA 4QX2A 1UQXA 4QMAA 4TWTA 3P3PA 2QZ2A 2A75A 3AEFC 2C0WA 2BDRA 4W7ZA 1ZM1A 1IS3A 1IKQA 2FDGA 2BGOA 4JGYB 3USUA 3CCMP 1N3OA 2GSYA 2QKDA 4URAA 4RS5B 4UW5A 4XVHA 4PBOA 3I2KA 2A3YA 3L75E 1C8M3 1VBB1 2R073 2XXZA 4PF5A 4CCKA 2Y26A 3ZFEB 1OOPC 4UFIA 4Q4W3 1KD1Q 2CL2A 1PGSA 5KXBA 3DKWA 4GH4A 1OLME 3WVJA 3PVOA 2XH6A 3ABZA 3D5OA 3MIWA 4CRQA 3AE6C 2FDFA 2E74C 1IFMA 1GZWB 2VMFA 5CJ4A 3L71E 5LRSA 1QHDA 1I9RA 1WCSA 4LQRA 4LK6A 1G86A 4R8HA 1L0LG 1ST8A 3H1JJ 1LEMA 3FZ3A 5FZIA 2MEV3 3LPGA 4C90A 1F5JA 2D6OX 2WO7A 1UZVA 2IFMA 2ZT9C 2JJLA 4LBQA 3VBRC 4D6TE 1GL2C 2L5GB 3GF6A 3H1KE 1O8PA 4RYDA 1CX1A 1N73A 1KQRA 5LY1A 1AVYA 3MYXA 4Z8BA 5IK8A 3B9IA 4HVOA 4QT6A 2WN3A 1F31A 3WU2E 3AL5A 3AXDA 1DQ5A 5CA6A 1NZIA 3PUIA 3PTYA 4H13B 3MPBA 4NROA
chains in the Genus database with same CATH topology
4AHYA 2VNRA 1G2CA 1BBT2 1FZFA 2UURA 2JKBA 1O3TA 2D6MA 1FAYA 1AYN1 3GHGA 2QM7A 2NM1A 3H1WA 4ATEA 1SDWA 4MH0E 4AFBA 4FAGA 2HFED 3A4UA 4K1YA 3WQ0A 1NTKK 1LOFC 5AVXB 4QPGA 4FBFA 1RJ7A 4LO6B 3JUUA 5BYNA 2OPKA 1AL23 1PO12 1LR5A 4Q4V3 4QD2A 5IK5A 2DVFA 4I09A 4EJRA 1BMV2 1V6OA 4AI0A 1XE8A 3NV2A 3E5XA 2BFUL 1GZ9A 4XF0A 1S0GA 3H7YA 5BY5A 1FMD1 2R30A 1ZRCA 2WSCH 1HXS1 1RMU2 5EV7A 1NTMK 4LO7A 2MEV1 1CAWB 2D6KA 5AC91 1YJLA 3AKPA 2ZFCA 4AXOA 1H1MA 4JC1A 1JCCA 5KTBA 3ZIXA 4GMP0 1V9U2 2XBO1 1DIWA 4N43A 3VP8A 3ES4A 4N90A 2FMDA 1AX2A 3FFZA 3AKTA 4BIFA 3NVCA 3USSA 1TNRA 2RS33 1HRI3 1R081 1ZZ6A 2R0FA 4XQDA 4FPHA 1R091 2ZHLA 3UKTA 1IKPA 3FFQA 3RI9A 1K5MC 4RSUA 2R3CA 4BIOA 1IFNA 2FYZA 2P2KA 4LBLA 5L73A 4QQOA 3N7MA 1YO8A 1S0DA 1SFCC 1FPN2 4L99A 2O1JA 4BLIA 1KFUL 3AYDA 2DU1A 1S0CA 4AGRA 5T5PA 5D8AA 3WUDA 5JIUA 3N7KA 4HK9A 1O3RA 1MS9A 2UWCA 1BYHA 4IFFA 3H1MA 2HWF3 4AQTA 2YZ4A 2VUJA 2N7GA 4N7UA 5AW0B 1QOSA 2XGXA 2HWC3 3JB4C 5BNNA 2A45H 1LWUA 2I1JA 1FZBA 2WPSA 3IR9A 4YM3A 1FNYA 2I1KA 1GV9A 2A70A 3RPQA 3SLIA 4DS0A 1U5IA 4BWOA 3ATGA 1WUVA 2ZX0A 4EN6B 1X8MA 4M3CE 2B7YA 4NHMA 4WBAA 3VBHC 1LT9A 2YDEA 4FPOB 1Q43A 3TN92 3RG0A 3ZXAC 2VW1A 5HI0A 1DGWA 3GZAA 1TME2 1NOHA 1LOEA 1AR91 1NCRC 1E57A 2X8KA 2CGPA 1FV2A 3WV6A 4L92A 2BVVA 3MGUA 3VBSC 4B4PA 1U5ZA 3O8ZA 1FOD2 3P7KA 1I3HA 4AVAA 2JX9A 4OHWA 4PDWB 1JUIA 2ZACA 2OA2A 3H8UA 1JBCA 2ZKNA 1N3PA 3PHMA 1XQNA 1CGPA 4RQPC 2YUEA 1CVNA 3EXUA 5FQ0B 4Q4V1 1ULDA 5DDJ2 3WW4A 3E1IA 4HSJA 1YLLA 1HJBA 1S0IA 3HTKA 4H55A 2GNMA 4ZKPA 3VKFC 2DUQA 1DGLA 1NA1A 3NAPB 3E6CC 1J1DB 5EJ3A 1GICA 1YTZI 1RTVA 2PHLA 2YXSA 1YTZT 3M4FA 4P9YA 3ZXEA 3V0BB 2WS92 2RM21 1H30A 1QQP2 5ACA1 3I5CA 4GMP3 1B35A 3WHTA 5EZWA 1MQTA 1OFNA 1ZZBA 3KT7A 5F6KA 3RYKA 4D3WA 4YZ3A 1MVEA 1RUJ2 4LBKA 3THPA 2PFWA 1X7NA 1NTZK 5AVAA 1FOD3 4BH9A 1OKQA 1GYKA 2RS31 2ZX4A 1N7SC 3HE4B 3KZ4C 3VLBB 1C1LA 3ZFFB 4LBOA 1L4AA 5LRRA 4IV1B 5GLVA 3OPZA 1S9KD 1Z7S2 3H32B 4KWLA 2W6AA 3WDXA 2Q0AA 3LWCA 4XFHA 4QM8A 2WZPP 1AHSA 4FPKA 2PLV2 4EN8B 1T3UA 3OTFA 3O5SA 2N9BA 3B5LB 3CF6E 1N73C 4WVMB 4GULA 2GZWA 1FZCC 2PHFA 4YW2A 4EN0A 1PK6C 2DCJA 1AXYA 2FFDC 3ZXLA 2ZMLA 2C0XA 4BQ1A 3VZNA 2ZX3A 4F8AA 3CLPA 2HWF1 4XMAA 1LU1A 2FZ1A 2O0OA 4FOWA 4XXPA 1QKQA 1RUF2 3I8TA 5DUXA 1RUH2 2OIIA 5C8CA 4TYSA 4AVSA 2YKPA 2WNVA 4PLNA 4X8NA 4JDOA 1XE7A 2RHPA 2ZGQA 4P5HA 5A33B 1D2SA 3AFKA 1WMDA 1NKZB 4IQPA 1J58A 5AVRB 1XTCC 4JGYA 2R32A 3WW2A 4CEWA 5C33A 1W0OA 2A7AA 2K2SA 4LBNA 5GLWA 1YNAA 2DVGA 1XNCA 4AI1A 4XOGA 1IC2A 2P37A 3ZFGB 2B9UA 4CDUA 2XVKA 2NPSD 5I93A 2XNXA 1RUE1 3FUQA 4R4ZA 3EHKA 4J1XA 4GXLA 4Q1RA 4Y1UA 1QY4A 3SITA 2VMIA 4XIKA 5JOZA 2RMU1 3LA2A 4QPGC 3RS6A 5KHKA 1UPSA 5K0UC 1NAFA 3VDDC 4DZOA 3NKGA 2ZGOA 1JXNA 1PGL2 1R1A2 4QPIA 4B8EA 3H6PA 4Q8KA 3B00A 3WDUA 3HT2A 3UK9A 4MV2A 1IPJA 3NKTA 1VBC2 4K1ZA 2WWSA 2D97A 2ZGUA 1LULA 2WLQA 2XHKA 5J37A 2PELA 3M0DA 3VHNA 1UW8A 1E5WA 5HCFA 3BB6A 2MJZA 2WQZC 2YKQA 4HMZA 5CFDB 3Q9OA 4MGZE 3KMHA 4GMP1 4AQ6A 1W6OA 2EF6A 5GKAC 1F8VA 4N78E 3CL1A 4YGBA 2AR6A 1GZWA 2ZOEB 4WBBA 3NV3A 4NN0A 1RUG2 4RHV1 4PIXA 2HYKA 2JXAA 2ZJCA 1COV3 1QJY2 3ZVXA 2BASA 4WM8A 1URQA 1CJDA 2GNBA 4YSFA 3MW2A 5KJ7A 4A7KA 4P9WA 3MLKA 3B5NA 1OOPA 2D6PA 2VGDA 3DL3A 4YVWB 5BUVA 3H9AA 4KWKA 5E1RA 3FWEA 5JMCA 1HDKA 4Q1PA 1PVC2 4YZ2A 1YHFA 1RF1B 4N6JA 1PO23 1RUD3 3MF6A 4YM1A 5D8AC 1W2EA 3N7JA 1EPWA 2EAAA 2YV8A 3FBYA 1DYKA 1EY2A 2PHWA 1VR3A 4E9KA 4FPCA 5AVVB 2ZMNA 1KILC 5CCHC 3VN4A 3OJAB 1UZZA 2C0ZA 1IK9A 3VKLA 4GB32 1VAKA 3V2RA 1QJX3 5AW5B 5IK7A 1AR83 4L11A 1JOJA 4YVSC 4YM0A 3VKOA 3VV1A 2NN8A 4DB5A 3CJIC 5FLJA 3HAGA 5H9SA 1W6NA