2R32A

Crystal structure of human gitrl variant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
158
structure length
140
Chain Sequence
b'RMKQIEDKIEEILSKIYHIENEIARIKKLPCMAKFGPLPSKWQMAPPCVNKVSDWKLEILQNGLYLIYGQVAPNAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GCN4-pII/Tumor necrosis factor ligand superfamily member 18
publication title Assembly and structural properties of glucocorticoid-induced TNF receptor ligand: Implications for function.
pubmed doi rcsb
source organism Saccharomyces cerevisiae, homo sapiens
molecule tags Immune system
total genus 32
structure length 140
sequence length 158
ec nomenclature
pdb deposition date 2007-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2r32A01
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r32A02
5CMZA 2JG8B 2KA3A 2WWWA 1D0GA 4N90A 5L19A 1JNMA 3B94A 1HBWA 5KWRA 4OULA 2R3CA 1ALYA 1DU3D 2QDNA 3L36A 3P8MC 1S9KD 2Q7CA 5AW1B 1TNFA 2YO3A 3NFQA 1WCKA 3WD5A 1GD2E 2Z5IA 3TNUA 5AW4B 1A02J 1T2KD 2WT7A 2WPRA 1GK4A 4EOTA 4KG8A 4QQLA 3HE4A 4M3LA 3V5BA 2HEWF 4LC1A 3NMDA 3IR9A 2C9LY 4GIQA 1CSBA 1KXGA 5HBAA 5AW3B 3HE5A 2IPPA 1XU1A 4KHXA 4C7NA 4C46A 1GU4A 4GKGA 4JYBA 2JJLA 4J6GA 1U5XA 1GU5A 2XV5A 3TWIA 3A5TA 5AVWB 2RJKA 3MD0A 3L37A 1G2CB 4B86A 2WNUA 2Z5HA 1S9KE 1MUUA 1CZQA 5APQA 3M9BA 2WNVA 2RE9A 1U5YA 5AW5B 3VMXA 1RJ8A 2WPSA 1IQAA 1X8YA 5AW8B 3V56A 3M06A 3AB0A 2P2UA 4MXVA 1A8MA 2WNUC 3M0DA 2ZJCA 4I6MC 2WNVC 1C3HA 3L35A 3I5CA 5KC6A 3URFA 2JG8A 3A7OA 4MXWB 3P7KA 2TNFA 3KDPB 1C28A 3TK1A 2R32A 5AW7B 4MXWA 1OXZA 1HJBA 2Q8OA 1MFZA 2Q3IA 2Q1MA 3ALQA 2QE3A 3K51A 2JG8C 2KP8A 1NAFA 5AW0B 2Q5UA 4TSVA 4G3YC 2TUNA 5APUA 2ZXEB 4QQ2A 1DG6A 1H8AA 1PK6B 1GK6A 3LIEA 4QQOA 2JG9B 1CI6B 2BASA 3M0AA 4HYTB 1GTWA 2R30A 5APTA 3QBQA 3NTNA 4DZOA 4HT1T 3TYYA 4D7YA 3OAKA 3MI8A 2E42A 1O91A 5AVZB 1MV8A 1IO4A 3NXSA 5AW6B 3T97A 3L9JT 3VMZA 5L36A 3MGNA 4RESB 5KC5A 5APSA 4DOUA 5AVSB 2W6AA 5APWA 2QM7A 2X29A 3A3YB 5AVVB 1H88A 4XE5B 3O8ZA 1KD7A 3LKJA 2ZPXA 3FC0A 2E43A 1HWTC 5APVA 2YNYA 1A02F 5AVYB 1DH3A 3KQGA 2WTYA 1I9RA 2ZFCA 1GZLA 5AVXB 1T2KC 3LIDA 1JTZX 1S55A 3VN0A 1HUCA 4OUSA 3VMYA 2E7AA 5APXA 5TSWA 2YO2A 3VTPC 1H89A 2AZ5A 4DB5A 4KGQA 5APYA 3P32A 2Z5WA 3UIAA 4AQRD 1SP4A 5AW2B 1D2QA 2WPQA 2XU6A 5AVRB 2RJLA 4QPYA 1XU2A 3TNUB 5AVUB 5AVTB 2WT7B 4E4SA 2C9NY 1YYCA 2W27A 4AYCA 1FAVA 3HE4B 1OQEA 2HEVF 1PK6A 1OWAA 1JH5A 1RJ7A 2JG9A 1CI6A 4TWTA 1TNRA 2VRSA 1D4VB 3QD6A 4G4FA 3ME2A 2P7JA 2R5DA 3HE5B 3M91A 4C7NB 1GR3A 3B93A 2OIIA 1JUNA 1PK6C 2HEYF 4JYCA 2JG9C 3HTKA 2R5BA 3B8EB 4OUMA 5BNQA 4F3JA 4MSVA 3A2AA 1U5ZA 2N9BA 1FOSE 2WNUB 2P67A 4GT1A 2WNVB 4I2LC 3VYIA 4EN0A 5CIRA 4QQHA 2XZRA 2H7HA 3V4WA 4NN0A 2O0OA 2R6QA 1KQLA 3B9IA 3K48A 3V4QA 5AW9B 1NWQA 5AVQB 1OQDA 3IT8A 2QM8A 3SWFA 3TYJA 4AUWA 1OSGA 4QQPA 1J2JB 3M9HA 4KGGA 4RSUA 4E4DX 1FOSF 1SLQA
chains in the Genus database with same CATH superfamily
2JG8B 5CBNA 4BHPA 2V5YA 1HIXA 1N7SD 1Q8OA 2YMKA 3CJIA 5ANQA 1EZVD 2P6HA 2RR11 4HBNA 4XJ9A 5BXXA 2VZUA 4YZ3A 2WJSA 5EIYB 2K2SA 3TN92 1CAVB 4JTOA 2D5FA 3S9OA 1OLME 2UWCA 5AW4B 1J3PA 4N9HA 1GWMA 3PURA 4D3WA 2ZAAA 1RQVA 4CUCA 4KG8A 3AZZA 2DV9A 3ZXKA 2JX9A 4BISA 1KD1Q 4XABA 4B8EA 2RG4A 1OVUA 3UGHA 1N1SA 5JWPA 5B66H 3VDAA 4JRLA 4DY3A 3GBWA 1NKGA 3FWEA 4OGQB 4CEWA 3T0AA 1LGHB 5KXDA 1RE4A 3WU2H 3BCCD 4JYBA 5IATA 1GZTA 3RL0C 3WG1A 3MHZA 2E74C 5GLZA 3FJSA 2KLUA 2WNEA 2QQKA 2L9LA 1UY4A 4LO5B 1G2CB 4CDXA 1QY4A 1MUUA 1OUXA 5C33A 4YNIA 1IJDB 2WSFJ 1L0NE 5AW5B 3IPVB 2XVGA 2KSEA 1WLWA 3GZEA 3NNGA 2WT1A 1V6OA 4EJRA 3PMEA 2YFUA 4Y99C 1HF9A 2WSCJ 4RKUJ 5LZ6A 3BYWA 3E5XA 1ND2A 2ZOEB 1C3HA 2F4PA 1W9TA 1X22A 3O12A 4K8RB 1SDWA 4A41A 1AR72 4JGYC 3L75G 4Z92B 2PHDA 4UW4A 1RUJ1 1Y4WA 1Q3EA 4IV1A 3TNQA 3MPPG 1J1EC 1QOTA 2HWC2 2YIUB 1SQVK 2GU9A 2K1AA 3RVHA 2BCCE 4H13B 2WZR2 2NPSB 5APUA 1FBMA 1XYOA 1QH6A 1MS4A 3ZDVA 1HRV3 1G9BA 2G3AA 5FZBA 5FYSA 1XE0A 1W0OA 5BNOC 4Y5SA 5K5GB 2VZQA 1LNSA 2XWJB 4D6RA 4RJTA 4Y1ZA 3KYQA 3RNSA 2NYYA 4L99A 1YFXA 4Y22B 1GNYA 1GNZA 4AI2A 3NAPA 3OAKA 1PO21 1BEV3 3F89A 1LTAC 4AAPA 1M8OB 4NPRA 5BVZA 4IERA 2G8YA 2VNGA 1AL0G 1GFF2 3NXSA 1PMJX 3OA7A 1SFNA 2FMDA 3B5NB 2NP0A 2IXKA 2V72A 4UFIA 2AEYA 2Q1FA 5L73A 1Q90D 1O3SA 2WQ4A 4BXSV 4BQ1A 2XH6A 1ZYBA 4LGDE 3MIHA 4WBAA 2PHRA 1BQPA 1E79H 1ULCA 4KT0J 1BE3D 1RITA 1REFA 3AE4C 4PQ9A 1ZP0C 4FCAA 1LEMA 4Y20A 5ACA2 2YB7A 1R093 1S55A 1W28A 1R1A3 1M1JA 5CFDC 4MHRA 2O3JA 2A6ZA 3RZZA 5A7NA 4P9WA 3DYMA 3EHKA 4XACA 4F7ZA 4FPLA 1UKRA 3H1KD 2VPVA 2DTWA 3GALA 1T6AA 4WM7B 1JU3A 2J58A 5AVUB 1SLBA 5L7OA 5AVTB 3SCGA 3OGSA 3S7IA 3SH5A 1YYCA 1KDMA 5JUVA 1JOCA 1AR81 1OA2A 5FJKA 3TF5A 2DCZA 5FK8A 3VD7A 2RMZA 4JHZA 2JE9A 2IYPA 4PLNA 2W0XA 3UYJA 5A33A 5KKZB 4DXRA 3BUCA 4P08A 2JG9C 4NHMA 3W9AA 4QX3A 4FPKA 2FYUK 2HWB1 4Y1UA 3H1LG 2VBPA 2IXLA 5KTBA 1AYN3 2N1TC 1GOHA 1WLDA 3KCXA 3OCPA 1JZ8A 2TBVA 3NJXA 4BLIA 4DINB 2JKBA 3L71E 4PBOA 1OQDA 2ZZJA 1R082 5FZ4A 4FOYA 4OQ9A 1Y9GA 1S0BA 2X5IC 1AR62 1UL9A 2XDVA 2A06G 3CNAA 3S0MA 3ZLIA 2Y8KA 5FTTC 5A7QA 3WHUA 3L70J 2JE8A 4Q4X3 1D0GA 5LB6A 4Y1XA 2VZOA 2FYZA 1W2UA 4KH9A 4Y24A 2W08A 1AJOA 3SWYA 1YJNP 2JDPA 5EWSA 4BPZA 1RMU2 5B5EE 4EZHA 3AP4A 5C70A 5IWFA 1OI6A 3N7JA 3M3EA 3L74D 2XHKA 1QGLA 2WKKA 4BMBA 2VNOA 3NFQA 4ET7A 3CCJP 4E2SA 1OFNA 2MEV2 3M3OA 4LITA 1IZ3A 3OPZA 4P02B 1MQTC 1E5WA 1X9VA 2D6PA 1K12A 3ZDSA 2F17A 1JZ6A 3DEMA 1H0BA 3C1LA 1LHUA 3NMDA 3H3ZA 2FDHA 2ZGSA 2RHPA 2CDPA 3SQOA 3NNLA 1YXWA 3CZUA 1EV11 4E9KA 2ZACA 4BK4A 2OYIA 3TEYA 4AYUA 4LNVA 2QNKA 3OOXA 1UPSA 1VALA 3RGUA 1ZBE3 1L0NG 4QKBA 1N3PA 1NTMG 4AEDC 4WM8A 1NA1B 4LLHA 5SV5A 1S9KE 4CPBA 4OWFA 2UWJE 5J1XA 2CK3H 3TGUJ 4BA6A 5C3SA 4O65A 3RK2B 3HPNA 5DPNA 5A1LA 2J59M 1NU1K 4ZKPA 4IUGA 3V56A 3IN6A 1HRI1 1G9DA 1DX7A 4I0WB 1MVEA 4LT5A 1HH0A 4NPEA 1RUC3 4OZOA 1TME2 1N3OA 1KYOI 3L72D 1NTZJ 4W7YA 1DQ5A 2QIWA 5KLVJ 2TNFA 3KDPB 1BCCE 3MV11 3I3EA 4XFAA 2ZAHA 1OQ1A 1RF0A 1GOFA 5CZKA 3NV3A 2BCCG 1BSNA 1VQ4P 3VKMA 2HLEA 3THTA 1XYNA 3HT1A 4TSVA 3ZR5A 1SQPJ 2ZT9C 5JI7A 1O4ZA 3H42B 3A22A 4XILA 3J8F2 1RUE1 5J09A 1VRH3 4MOAA 1KILE 1SFCB 1KFNA 1IPKA 1B35C 1UOFA 5EFWB 1SFPA 1XNDA 1H2KA 4P9IA 3M0AA 3I2FA 1GMJA 4CDUC 3RZHA 4X6QB 2WPVB 1RY3A 3UESA 2XL7A 3R6SA 5LATA 1QJY3 2E42A 2Y6KA 4OHYA 5KAFH 1UZWA 1SVFA 5J3UA 4RQPB 1PO12 3IWZA 1AYM3 2C0WA 3VKFC 5KXEA 1FPN1 1V00A 2ZZQA 3EWKA 3U75A 2IFRA 1IG3A 4FBFA 1N7SC 3LA3A 4K1YA 5BV6A 5KXBA 3BN6A 3UKVA 3LCPA 3E1IA 1H88A 3LKJA 5JPMB 1HW5A 2Z42A 2Q3EA 1UOGA 1JZ3A 3CCMP 1C8M1 3G4SP 4COYA 4FTBA 2SLIA 4ISQA 1NJIQ 1H9PA 3AYCA 2KXLA 4BYYA 5J7MA 4S2FA 2VE1A 3H1YA 2PGDA 5J36A 1CAUA 3QLQA 4PCRA 1FZCB 5CJ0A 2I2SA 1URQB 3ZIXA 1L3JA 2Z79A 4UB6E 4Q4W3 2JDAA 3NL1A 3AXEA 1NCQC 3VBFC 1GDTA 4XFFA 3ITQA 2R072 3E6DA 2VR4A 4RS5B 4FT8A 2VU9A 3AKRA 2VH9A 1Q86Q 3CIHA 1Y47A 2J5UA 4AHXA 3KGZA 1V70A 5I0DA 4HKWA 2VQTA 4AYCA 1X79B 3W68A 2YU2A 2CAUA 2VBBA 3ZFEC 2C0ZA 4KNCA 1TNRA 4E2QA 4GAZA 4Q4V3 4R4LA 4Q4V2 3ZYHA 3I3MA 4LBJA 4MGIE 1BDDA 4EWAA 2ITAA 2EAKA 1OA3A 2QQNA 5ERLA 3ABVC 4GKYA 4Z8BA 4P5YA 3I59A 1VMFA 4JYCA 4KJMA 3II6A 4D6SA 4J25A 2A1XA 3PUIA 3HAGA 4CVUA 3L71G 1KYOD 1IC2A 4PD4E 1GP5A 5IHRA 5IK5A 1FJPA 2UWBA 3BCCJ 1VR3A 4UBGA 2Y6HA 4XHBA 2O0OA 2VUAA 2R6QA 4EN8B 3VBOA 4YVSB 3FUQA 3PHLA 5C5TA 4AGRA 3LFMA 4QPIA 5JSPA 5GZFA 1K9MQ 5DQ0A 1PGSA 1QH7A 1USEA 1RC6A 3CC4P 1SLQA 1RXGA 2CPSA 1QDOA 4YM3A 3ACHA 1V9U2 4AFAA 2AEJA 2RS31 1CW5A 4XAAA 1JW6A 5LW9A 2W90A 2PAMA 1CZSA 1VBE3 3CCQP 1RE3C 2ZGOA 2GMEA 2WINB 4PJYA 4UI9L 3MBWA 2KR2A 1GD2E 3ACLA 4QX5A 2BFUS 4AF9A 4QPGA 1NZCA 4PV1B 4LR4A 3J7MA 1AVBA 1F9KA 3Q8FA 3IR9A 2ZGPA 4GIQA 2WZ7A 1RUI1 1FDOA 4IL7A 2VW0A 3AEAC 3KXDA 1VF5B 2CWMA 3WNOA 4GKGA 3KZ4C 1O5LA 3CCVP 2OQ7A 3CX5I 2J1AA 4IGOA 2GNDA 5FMOL 3WP4A 2BRTA 1NU1E 4R9CA 3IDBB 4Q5OA 1LR5A 2WDBA 1RHI3 3N9QA 1XE7A 2ZKNA 3I55P 1UZ0A 4I3GA 2WNUA 1PZ9A 1CIYA 3VZOA 1LHNA 2D2CB 4LEJA 4H13D 1LULA 3VMXA 2NPSD 4CCLA 5E6HA 3POEA 1VQPP 1RJ8A 4EWEA 1AR93 1LCLA 4YZ4A 1BGYE 1XSQA 3TEWA 3TAYA 1FZBA 2MNGA 2HPCB 1PPJE 4YYOA 1JXNA 3VMAA 1IFMA 3IIIA 3T2OA 2HWF2 4K9SA 1S3JA 2PHLA 2VW2A 4MLOA 4XPVA 1C28A 4UWDA 2VCCA 1BE3J 1DGLA 3JBG2 1WMFA 4GULA 3GZTB 2WFF2 3B5ND 2DVAA 5SV8A 3F5HA 1YLLA 2PMWB 2P4EA 3VHNA 3EFGA 5J96B 5DJTB 3WINE 1S0DA 5FLIA 3WUUA 1QJEA 5FZMA 1H8AA 3DN7A 4Q29A 1WCQA 1H6YA 4FO9A 1CI6B 3VZNA 3OY8B 1CN1A 4N43C 3H1KJ 2VZRA 1OVPA 1VBA3 4LBLA 2VO5A 2XBO3 2RR13 4QX8A 4NE9A 2D43A 3ZYBA 5HPOA 1SQXD 1VBC3 4UW3A 4HFSA 1AXZA 2OYHA 5FMBA 2Y38A 4CP2A 1G9CA 5I0RA 2R042 5L9VA 5CKMA 3ZMNA 3L73G 4I09A 3ZYFA 1TMF1 1IK9A 2D40A 3E6BA 1F5FA 2WT2A 4CDWA 1XNAA 5I8SA 2JDHA 5F3IA 4RESB 4EQVA 3NWKA 5APSA 5L9BA 4W7ZA 1QIQA 1EQ7A 2J1VA 1VPHA 2EIEA 3HVDA 4XMAA 2UWAA 5BNNB 2F4LA 3OD0A 1C1FA 2ZPXA 4ASKA 1HWTC 2D3PA 4AEKA 4WVZA 3UKTA 2WTYA 1I9RA 5KJ7D 5AVXB 4JDNA 2O14A 2H0BA 2UY9A 4K3UA 2O1JA 5LBCA 4I0AA 4IE7A 1GOGA 3SITA 4Y1YA 3BVCA 1K3IA 2XQXA 4OMDA 3ZSKA 4URAA 2HKXA 2ZMNA 3KZIE 3ILNA 4BQXA 3GHGC 4RN5A 2HWD1 3K3NA 3CX5D 1F35A 1NLRA 3B9CA 2QTWB 1JCCA 3TDKA 1AUYA 1OWAA 3LEGA 3L74J 1WMXA 3H32B 4G4FA 1JO5A 1L0LE 5K8SA 3GJAA 1PIV3 4COWA 5BNPB 4OMCA 1RUJ2 4LKSA 1H4HA 4XF9A 5A6XA 2VMIA 4M0HA 1ZNPA 2HG5D 5CG9A 1GP6A 2HEYF 5GLUA 4Q1RA 4ZU5A 2R5BA 4MVTA 1VBB3 1CWPA 1G9FA 3AZWA 3E97A 4WY4C 2Q0AA 2JDNA 2B5HA 2W6BA 4OH8B 3TEXA 4P14A 2EXJA 2OGUA 2W3JA 5FMCA 4I2LC 3VYIA 3HT2A 4EN0A 5GZGA 1W3VA 2OYOA 2IWGB 3FHQA 3VDDB 2IFWA 4QGMA 3LDRA 2HYXA 4EROA 4QKFA 1U7MA 4YW2A 4O9BA 3AE9C 3CCSP 1RF1C 1C57A 1PO23 4PDWC 1M4WA 2IBZE 3FFQA 4ZU4A 4CDQA 1KQRA 5TISE 4H44C 1WD3A 3S5AA 1CAWA 2NZ9A 3BIEA 2JDUA 3H1WA 3USUB 4EYUA 2WO2A 1ACCA 1NTKE 3RYRA 2EVXA 3LB9A 4E4HA 2WZPP 1CAXB 5FBJA 4OZXA 1BK1A 1DU3D 2Z4FA 2A7AA 2RS51 1SLCA 4XFGA 4UXAA 1W8NA 3L72J 1Y9MA 2R3SA 2KD7A 5LY2A 3PUQA 5IK4A 1DDLA 2WPRA 1LECA 1CAVA 2C26A 2JR8A 2GSYA 3KGLA 3AMPA 4EDFA 3ST7A 2WAOA 5FPVA 1H8TB 2VC9A 4LPLA 2C9LY 1HJ0A 1CSBA 1NU1G 3IZOA 5HBAA 2B89A 5CFCB 5AW3B 2D3RA 1BKZA 3O1SA 2KYVA 2FBWC 3AL5A 1GYKA 4FP2A 5F5AA 1S0JA 2D93A 2XV5A 2JE7A 4TXWA 3EBRA 3JU9A 3IMMA 3U11A 3DF0A 3MIFA 1AR83 2A71A 2G9GA 3EFFK 4GB31 4JVAA 3U1CA 1PPJG 1CONA 3OBZA 4AI9A 4DMIA 4IQPA 1LRHA 3LE0A 2EICA 1AVOA 2EXIA 3IPVA 4I3PA 4L2NA 1ASJ1 1UZZA 3UL2A 1T8ZA 2HWB3 2VUDA 2W9XA 1OT5A 1J3RA 5FCCA 4MH0E 3P7KA 1VP6A 3WF2A 2V4HA 3VZLA 1JS9A 1HJFA 4I2OA 1LTJC 5FUNA 5HI0A 2YMZA 2P34A 5JZGA 2B8MA 4CCDA 4NPDA 3SH4A 4B4PA 3I49A 2JG8C 3ZXDA 5CU1A 1LAJA 2E7QA 1DFQA 3KHBA 5D8AB 3O0VA 1TVGA 1J83A 4NPFX 2AYHA 3A0BH 1HLCA 1XPWA 1DG6A 1S0GA 1LTEA 4FPGA 1F8VA 1LENA 4RHV1 1YIPA 1EDLA 2ZAEB 1W0NA 1CD3G 3LW5J 2FMYA 1Q2NA 3BB6A 1W8OA 2R16A 2ZMLA 2WWUA 2XL9A 5JVVA 1LTBC 4J1WA 3QBQA 2QUOA 1LP1A 3L75D 1APNA 1USDA 3GF3A 3RZJA 4Y22A 4U3FD 4V2WA 4EZ4A 1IG0A 4L97A 3L9JT 4P5HA 4LA3A 2R0HA 4OGQC 5KAIE 1L4AA 3ILFA 3FFZA 5T52A 3WDUA 1JY2O 2E32A 1K5JA 1EV13 4A4AA 5JR2A 4XTPA 1ZRTE 5A3PA 3SFEC 3ZFFA 4FPJA 5A7OA 4FPFA 1KB9D 4XHXA 4B4QA 2E75B 4X8PA 4YW5A 4N78D 4HETA 1LNQA 1LHVA 3CJIB 1YI7A 1BYHA 2Y26A 1MZ6A 5CKNA 2D6LX 4NHKA 1CPNA 2J1UA 3T2TA 4PF1A 1GUIA 3VP8A 4QU1A 2DUQA 5CVRA 3I3DA 5FV3A 1JYCA 1LOCA 3UK9A 5AW2B 5JPNB 5LA0A 5FP3A 4GWIA 2DUPA 1PZQA 1HRI2 2RM22 3HQXA 5JXJA 2JECA 2PXJA 1L0LG 2CV6A 4QB2A 3T1MA 2DTYA 2C9NY 3KHCA 4WM7A 4UW6A 2R063 5IYYA 2VNRA 1PK6A 2CSGA 3A0NA 3FBMA 3WG2A 5LA9A 2VRSA 3QD6A 1W2BO 1Y43B 3TNPB 2YIUC 4NWWA 4CEWB 4H13C 3KSCA 4GKXA 2NPSC 1ULPA 3AJYA 4SBVA 1ZXGA 1Z56A 1IQDC 1ENRA 2DFCA 5CB7A 3WDVA 4HB1A 2ZHMA 3M8LA 4A6OA 3H1JG 5CCGA 1QU0A 1QMJA 4CP9A 4Q4Y3 4DEQA 5ABJB 3SLIA 2WUHA 1RUE2 2A6XA 2C1FA 4CDXB 2B45X 2LW8A 3H8OA 3ZX7A 4IESA 1DHKB 2XJUA 5F37A 2IBZG 1MPXA 3JQXA 2FD8A 1JODA 1QQP3 3R4YA 1KQLA 4URTA 3VBUB 3LWCA 4D69A 3B5NC 1ND2B 4AR2A 5FZLA 4AUWA 4MGQA 4XJUA 1OW6A 2XR4A 5K0UA 2ADDA 2D98A 4N53A 4N90A 1M06G 4JGZC 3NV1A 4Q0PA 4ZKUA 2OA2A 1FPN2 5KWRA 4QB6A 1LODA 1VQ5P 4IV1B 1YQ8A 1YJ9P 1NGMB 3KV6A 4R52A 3CU7A 4O61A 3FX0A 2ZGLA 4LBNA 2B42B 1E5RA 4W80A 4NIGA 2WQYC 1HB1A 4BE3A 2RS13 1C8M2 4XFIA 1FNZA 1MVQA 2WIIB 3OBAA 1I6XA 5A1AA 3QCWA 3MW2A 4AAXA 3FGAD 3VKOA 2WZEA 4FAGA 4YVWA 4C8DA 2PHXA 2A06D 1J59A 2V7QH 3RGBA 2HYNA 3HE5A 1N73C 1SQQK 2BWAA 3NAPB 3WG4A 4AL9A 3S7EA 4GD4A 1RVF3 1NCRA 1UQXA 4ARYA 2Z69A 3I2KA 1F5JA 3O5SA 2WT0A 1OHFA 4MZUA 4YZ5A 4EN7B 1CQ9A 4KL1A 4B86A 1SQXJ 3P5BA 5KJ7C 1XYPA 5KKZC 1D2SA 1ZZ8A 2WNVA 4QDSA 1OPOA 4PJ0H 4N7UA 1DEEG 3AEBC 3JZVA 4NO4A 5H2FH 5F5QA 4BK5A 4GWMA 2ZKLA 4COUA 4Y20B 2R7EB 1OOPA 3WCRA 2QG4A 2OTLP 4CUGA 4MXWB 3N9NA 4KWKA 4META 1M1JB 2JDYA 5FY4A 1WGPA 5F1RA 1AL23 1RUD1 4QXBA 4KQ7A 2HYKA 1G9AA 3LSEA 4WVWA 1NTMD 5E79H 2QE3A 2O1KA 2LM3A 1P84E 3OJBA 5L7OB 5CCHC 3IN9A 2TUNA 4DY5A 4XVHA 5LEKA 1DQ2A 3VOPA 1FE6A 3L70E 3LEIA 1VBD3 5F3GA 3AEEC 5DUVA 2BZDA 1H2NA 5A33B 2RS32 4QKNA 1S2KA 1G1JA 2AACA 1I5ZA 3NTNA 2ZHLA 4D7YA 1IS6A 3I56P 2RMU1 4A45A 1I1EA 3MI8A 1O91A 3UGGA 3T97B 2FDIA 2YY1A 5GTIE 1HQNA 3O1PA 4CXWA 4TT3H 2Q8DA 5A80A 1AR71 5FXZA 2VCAA 4HG6B 1OD3A 1O59A 3PU3A 1RUI3 2CYFA 2IDBA 1QVFO 1UW8A 3MF6A 1S2EA 2VOTA 3OTFA 1TZOA 3SHRA 1NA1C 3BIWE 1N1VA 5C6CA 3KQGA 2B46X 5C9AA 3RK2C 3LIDA 2YBKA 2WA4A 3VMYA 1KRIA 4JQ0D 3CXHE 2WWSA 2JEMA 1R8EA 3JCUH 4HLTA 1HGZA 3OUIA 3RMYA 5B2GB 5FPUA 2K9YA 1RUOA 5FZ8A 5A70A 4QD2A 4DXZA 3S5QA 4DZGA 1JZ5A 2WQZC 4GH4A 4HK9A 3RG0A 5LWBA 1NTZE 4HKOA 5IVVA 5KLVE 3KPEA 4KWUA 2WITA 4AE2A 4IDZA 1NVOA 3AE6C 1VLNA 3JD73 4QM9A 2E76B 2OYIB 1PP9E 4D94A 3CL3D 4FVVA 1JUHA 5JXGA 1SFCC 2G4IA 2L91A 1X33A 1SQPE 1TG7A 3WUTA 4WM8B 2D7FA 2A73B 1LGNA 2GUSA 1BVP1 5AC93 5F39A 3RZLA 1QXJA 4Y4RA 4GALA 3FX3A 1NHLA 3T0DA 4RQPC 3OEBA 4FXGB 3MGUA 4DPNA 2VZPA 3IFMA 3KLSA 1W9SA 3KQ4B 3H3LA 4YVSA 1ZN5A 3IAPA 1H2LA 4DQAA 2FZ2A 4K21A 2ZGKA 1VB2A 4LQRA 5E8AA 4L76A 1TMF2 1NKZB 4UFHA 3B94A 2AUYA 2PRRA 2UYBA 2M3EA 1KC8Q 1SEFA 3ZSLA 4DT0A 5C4WA 2A45G 1FXZA 4GODA 4NAMA 1EDJA 1ULGA 4Q0VA 2SPZA 4IETA 4KBBA 4CSWA 5FP9A 2GC1A 2R1BA 2Y33A 4IL6X 4ATFA 5LA2A 3ATGA 2H6BA 3KCYA 4KU7A 4YGBA 1T2KD 1NLQA 3O1VA 2P2KA 1FZCC 5FZIA 1SACA 1URQC 4WVVA 4XXPA 5GTHH 1N7LA 2YHJA 3V5BA 1PX3A 2CAVA 5CG8A 1MEC1 5CEHA 5HCHA 4CPGA 2ZTNA 1LOGA 2PYTA 3C3VA 1QJU2 2G9ZA 1QJX3 2FQPA 2A70A 5H9QA 2WYSA 4RS5C 1FU1A 5B4NA 4XZUG 5DUWA 4OI0A 4J6GA 1COV3 2HWD3 2AEZA 4XZPA 3AXDA 1EZVE 4RO0A 4SLIA 5FXWA 2W2IA 5TJHA 4XBQA 2BW8A 3VHPA 4YWAA 1CZQA 1NQDA 3PRJA 4RFRB 3L75J 5IVFA 4GA9A 3AZXA 2VULA 3JSVC 3WEZA 3GCWA 3D3AA 4U3FJ 3I2IA 5IAVA 1AQTA 3DKQA 3VBSA 3RDIA 3AB0A 4ZXKA 3RL0D 5LBBA 2JDZA 3LOIA 4DRVA 1URXA 1HXS1 5A3TA 2HPCA 1PVC3 4AG4A 5FO8B 5I8TA 4RYDA 1CAUB 1GWLA 2JDKA 2OTKE 2YKOA 3BCCE 3WW1A 1HJBA 3DL3A 4W65A 3U07A 2YG0A 4CYDA 1KFUL 2CU5A 4GMP3 4LBOA 1L7LA 3NSTA 2KP8A 1X9TA 1W8ZA 3A0HH 4X8NA 3I2DA 3MYXA 2HLOA 3I3BA 3D82A 4QQOA 2WRAA 3ZYPA 1EC5A 4ES9A 1UMIA 4YSFA 2BASA 1SQVD 2BNMA 2DCTA 2ZMKA 4B29A 1ZX5A 1KGYA 3LA2A 5HCFA 3EO6A 3C9IA 1C8NA 3I59B 2RS53 3IKWA 3HNYM 4YZ1A 2CY6A 3MO4A 5FDBA 1NUKA 4DCKA 4PV1C 5AVZB 5GLVA 2WSUA 2DCYA 1EXIA 3FN9A 4Q26A 1TME1 5DDJ1 1KN7A 2FFDA 1WUVA 4A44A 3GNEA 3MGNA 1UPIA 2QJYC 1E5SA 1RGSA 1QXPA 2QQLA 4XJAA 4PBPA 1W6PA 3VBOB 1FMD3 2ZHKA 5A3NA 1L2PA 2PQQA 4ZS3A 1DQ1A 4QPIB 3OGRA 5DG2A 2XGXA 3AE5C 3V2PA 1VL2A 3HR9A 3FHAA 1R5SA 3MUDA 3G9RA 1U5IA 1Y7BA 3TOJA 3CJXA 2D2CC 3GF6A 1XBFA 3RK3D 4FTSA 5IVEA 4HVQA 1S0FA 5GLWA 5D1IA 5FK7A 3RYKA 5KHKA 2OUJA 4PIZA 4UAPA 5FYTA 4E8DA 4GB32 3L73D 4AVAA 5FYZA 4IGQA 1KMIZ 4YPJA 3RYPA 4LOSA 4A7ZA 1W9FA 3UT0A 1NTZG 1YIFA 4XC9A 3HQRA 1ASJ2 4UFJA 4HVOA 3L4FA 4QPGB 1IFNA 5HV4A 2FDGA 5DMYA 1D4M1 2AR6A 1PP9G 2POHA 1D4VB 1OH3A 2ZYAA 3T08A 4WZFA 1BHGA 4L75A 1O8SA 1ODMA 3NJZA 3VD5A 4JDOA 3TRSB 1BE3E 1W5CE 3MIWA 1W6NA 3RZMA 4CRQA 3VKNA 2WS91 2QEXP 4CCOA 1J1TA 3Q9OA 2HODA 1PMIA 2HJIA 3MW4A 2BP6A 2ATFA 1U5ZA 1ZRDA 5FZGA 1W6MA 2FYNB 2WNUB 2KOGA 2M8RA 1H1MA 4JKLA 3NJYA 4EE2A 4RHV2 3GDBA 1WA6X 2FYUD 2K88A 2JB8A 2I8DA 3H1KE 3R2PA 1PMHX 3MUY1 3MF9A 1DIWA 3V4QA 3D4KA 3QH7A 4QXCA 3OJAB 2VZ3A 1GQGA 1J2JB 1SZBA 4FPCA 2BNNA 2MKVA 1OF4A 4AFDA 1GZ9A 3O7OA 4XTMA 2WWWA 3GG2A 1ENQA 4L73A 1L0NK 5BNNC 1K05A 5FWJA 4IV3A 4CEYA 4NOTA 4QPWA 1DQ6A 5EJ3A 4BQ4A 2EAAA 1JI6A 2WYFA 4AI8A 1IKPA 1W8HA 1JEKA 3AZVA 4LO6B 4NVPA 1XJAA 3JCIA 4LO7A 3WD5A 4DJGA 3V2NA 5A6QA 3TNUA 4W8JA 3N7NA 2BEQD 2GC0A 3QWOC 4TLGA 5JIUA 3WQBA 2OW4A 3CKHA 2E74B 1RUF1 2ADEA 4AZZA 1FOD1 1NTMJ 1DYKA 3CHXA 3ES4A 2QQOA 5GM0A 3LFIA 4ZMDA 1V6NA 2QVSB 1DYPA 3O1TA 3HD7A 5KHGA 1SG3A 5FZAA 1Z7S3 2OYHB 3HNMA 4D6QA 1DD3A 2XDJA 1EZVG 4U36A 1BBT3 1W8UA 2PHFA 5LBFA 5LRSA 3PTZA 1YYNA 1O3TA 3ZOIA 1UYZA 5DZEA 4CDWB 2BJSA 5BNPC 5GALA 2Z5HA 1V9U1 1EAH3 1YQ2A 3BRVB 1GLHA 2JJ6A 4QHBA 4YGDA 3L74E 3HD8B 4P9YA 4NIIA 3VN4A 3AKSA 2WPSA 2GN3A 1X8YA 1CJPA 4LOTA 3WVJA 3FHIB 1UU4A 4XDQA 2OYZA 2CGPA 3M0DA 2CL2A 1H2MA 3D6EA 3BCCG 4KG0A 5IT6A 3VDDC 3NW4A 1ZR4A 4UFKA 1DZQA 5BNOB 5D21A 4QT6A 5G04L 4G9SB 4NHYA 2Q8OA 4BIFA 1G6NA 1FAYA 5HXVA 4ZZ8A 3GCXA 5I0UA 4IL6E 3LGRA 3MIEA 3AMMA 3NQHA 1QHDA 1UWWA 4XQDA 1SLLA 4LULA 1WW6A 2CHHA 1QKQA 1ZVFA 4IGPA 4K6BA 4U7JA 3M3CA 1KB9H 1AQ5A 3WP6A 1JY3O 2YXQB 1SBFA 2FCUA 3SISA 5J98B 4XF3A 2PN5A 1DGRA 5A7WA 4HYTB 1GTWA 2R30A 2O01N 1EXJA 5APTA 4CCJA 1RUG1 4D7TA 2W91A 1W2OA 2ID4A 2QJPB 3MP7B 4RA0A 1KQGB 1MV8A 2ZT9D 3L72E 2W6JH 4XCBA 1KV4A 3FWLA 1H8TC 3MEPA 1XOYA 1OVRA 1VAKA 1SFYA 4HONA 2PLV1 4RGAA 1KEXA 3VHOA 2PA7A 3VMZA 1ZRFA 4N8MA 2Y0IA 1CX1A 5CFCC 1B09A 4COZA 1RUH3 2J1TA 1WCDJ 3IBMA 2BUKA 4YM1A 2BGCA 2WSEH 3JBG1 5DG1A 2E9QA 2YXSA 1M57D 3O8ZA 3PLNA 3ZXJA 1ZRCA 2DVDA 2HWE3 2NN8A 3AE3C 3VL8A 1S5LH 3AP5A 1FYUA 2YNYA 2PAEA 3POFA 2P3JA 1DH3A 4N6JA 1CAWB 2IXJA 2FBEA 4PJ0E 2E76D 5CJ4A 3CDZB 3POWA 1T2KC 2D6NA 4ZS2A 2EXHA 1ZBA1 4MV2A 1D7MA 1H89A 3VD4A 5F3CA 2JICA 2YGMA 2VAUA 3P6BA 2IZ1A 3ASIA 1W04A 1AV1A 4FPEA 4NJ4A 4QHZA 2VNVA 4MX3A 1S72P 1PGW1 1WLCA 4RR3A 1HQWA 3VLBB 2RJLA 1A34A 4ASVA 2Y0DA 1AF9A 1Q43A 1KILA 4GOFA 2R041 5H9SA 4EWDA 3TN93 2QCSB 4HL0A 4E4SA 3POSA 5FYCA 5C5UA 3CCUP 1BE3G 4Q1PA 2RVAA 1O3QA 4TWTA 4K35A 2N1TB 2HR3A 3CF6E 4QB1A 5H9PA 1ND3A 3JC22 4YM2A 3M91A 3J7NA 3WUCA 1RUD2 5D8AC 4KU8A 4ZNCA 4JQTA 2W5FA 4HXCA 3HTKA 2GA1A 1UYYA 3H1KG 1WCSA 1FS0E 1MS1A 2OS2A 4PQQA 1YQ3C 5ABJA 3HEIA 1BLZA 1PM7A 3CD6P 3VZMA 5DAVA 4HANA 5FMDA 2H7HA 2JDIH 2J42A 4XFCA 4LBKA 1SHWB 4LO4B 1N2DC 1SQBD 2XXZA 2RMU2 4QQPA 3VBUA 4KGGA 3EJKA 3AYDA 3VDBA 1VAVA 2RDQA 1E5IA 4LBQD 4I30A 4NPMA 1PGJA 1VDFA 1AXKA 1VQ9P 1AR73 5CKQA 3GYDA 2LS6A 2E26A 5FIXA 3T0BA 5JZGB 4N9IA 3H1JD 3HOBA 3L36A 1WLTA 2ZGNA 3H6PA 2A3XA 3LIGA 1YJLA 1ZV8A 1YRZA 3WNPA 2E75C 1POQA 3C7HA 2HWC3 1KYOE 1MZEA 3CJIC 5FZ1A 2WZR3 2OQQA 2PELA 2WT7A 2X53S 1YQ4C 1NZIA 3AEFC 5F2WA 3WOGA 5DUXA 2ZCWA 3USSA 3ZN6A 4YGEA 4I7ZC 5FLJA 2VTFA 2Q5TA 3THDA 5K7PA 4H0LB 1KXGA 5IVBA 1LHOA 3VBRA 1YFUA 1V6KA 1LP1B 1J1DB 4D7SA 4QX1A 4C1XA 1SQVJ 3LA7A 3L74G 1PV3A 3ILRA 1PM4A 4OVNF 2VZ1A 3VBHA 1L4AB 2QSIA 4CEWC 2YU1A 1RE4C 3RK3C 2PTMA 4UF0A 1EUUA 3HN1A 4BM8A 4K7JA 1ZA7A 4TYSA 4YFZA 1PNFA 2WN2A 3HRNA 4M4PA 3ZXFA 3ZFFB 4MXVA 4CDXC 1IHMA 3X29B 1HRV1 5FMOS 4UB8E 3MZHA 1MZFA 2VUJA 2XJTA 1LOFA 1UD1A 2VVEA 3I5CA 1W6OA 5KC6A 1RB8G 2A5ZA 3WXPA 1OPMA 3CCLP 5ACA3 3ELNA 1ZZBA 2B9BA 3MIBA 1QX8A 1GANA 2QQPA 5ISLA 4MXWA 1HN0A 1ND2C 2OTJP 2Q1KA 4OHZA 1GL2B 5IK8A 2K0GA 4DS0A 1YHFA 1HX6A 4B1LA 2WZ8A 4H7MA 1OKOA 2VOVA 2VQAA 3G6EP 4R8HA 4BQ3A 3L73J 1PK6B 3N36A 2JKVA 4IV1C 2XONA 5LBEA 4BXFA 3JUUA 4Y3OA 3M4FA 3FXEA 3L72G 4NROA 3DCQA 4D6TD 2PFWA 3KHUA 5AVPA 4NMIA 3CWBD 3GGLA 1JOBA 4UFMA 1XRUA 4CP9B 2P3YA 3POYA 2H0VA 1LGBA 3T97A 3BATA 2J7MA 3CI9A 3KV5A 3H1HD 3VZJA 3AKQA 5L36A 4Q8LA 3ZYJB 5EYXA 3NAPC 2E31A 4FOVA 2W6AA 1MEC3 1Q8SA 1MEC2 3RWKX 2N9YB 2DF7A 4N3YB 2Y64A 2E6VA 3BU0A 3Q5RA 4L0PA 5JOYA 1OF3A 1R083 4XAEA 4CU6A 2O8OA 2QQUA 2XNDH 4BRYB 5K0UB 2FYUJ 1AR63 4N53B 3Q8CA 1ENSA 4R9AA 1GZLA 2DU1A 3KT7A 4YLZA 2VVDA 3GZAA 4OUSA 1HUCA 3EMRA 5LASA 3VP9A 5JI9A 1SQXE 2JXAA 5A1FA 2VTXJ 3ZYGA 2E5YA 1RMU3 3I97A 3P32A 2KLVA 4L74A 1S5LX 1SP4A 4DUVA 1K45A 3CLPA 2Y60A 2FDJA 4IE4A 3PNAA 3HUSA 5F2SA 1GKBA 2MEV3 1M1JC 5I0TA 3N9PA 5C39A 4H55A 1HXS2 3HNBM 3P3PA 1FAVA 2VUCA 4BOWA 1GBGA 1RJ7A 1J1LA 4CCCA 4FOQA 1KQFB 3CC7P 1AJKA 4YVWB 1SBEA 2BEOA 3HE5B 5L7OC 1EDIA 2ES3A 1PGL1 3KT4A 3AVSA 3WUDA 5EJZB 4BQ2A 1DEBA 4LA2A 3POBA 1NCRB 2IXHA 2W94A 3ZFGA 3Q8BA 3N35A 4C90A 4M4RA 4Q4X1 3IB3A 3R4UA 2IFMA 1VQ7P 1V6MA 5FY1A 1R1ZA 1KITA 2PQSA 1LJ2A 1Y8AA 3FLPA 3W5NA 3RSJA 1LWUA 4YW4A 3AE2C 2WNVB 5LEJA 3I4IA 4XUTA 1LKNA 4HOOA 2YYOA 4RD7A 1NOVA 4EIJA 4YM0A 4LHLA 1YFWA 3CX5E 3VDCA 2YKQA 3WNLA 1VB4A 5GLTA 3NKGA 3UNPA 3ZSEA 2RM21 3AEDC 1Y9BA 2PFXA 1OOPB 1NE6A 2UY8A 4WY4D 4CE8A 2KA3A 1QEXA 5L19A 1TME3 1JNMA 2W46A 5DDJ2 5DAXA 3MICA 2FXOA 4UBHA 2R1DA 4XDPA 1YUDA 3KB5A 5FZKA 4HVRA 3KV4A 1LT9A 1BJQA 3E1RA 4HH2A 1LOAA 5JXIA 2IZ0A 5DAWA 3ZIWA 3POGA 2K3RA 1OFSA 3BI3A 2XWBB 3AZYA 4QDRA 2XKPA 4H44D 4FPHA 4KMQA 1QNWA 3J8F3 3LEMA 4WWIA 2OKXA 1W90A 1IFIA 1VQNP 3Q5SA 3H1ID 2KM2A 2LXBA 1YI9A 4NPLA 3BASA 4BWNA 1XU1A 1A8DA 1GU4A 3M7AA 1D7PM 1OURA 1UAIA 1X8MA 1S1CX 2OVUA 1RUC1 1PO13 3ZYIB 3NMBA 1D4M2 2E76C 3OG2A 2OYIC 3ZN4A 1MS0A 3WW3A 2D6KA 2FKWB 4NRQA 4ONUA 3KS7A 2FDFA 4Y4YA 3Q3DA 4GZ9A 2C5DA 4KWJA 2WS92 4WM8C 1VRH1 2ZJCA 2B9VA 3EYPA 1O3RA 4PHZA 1J84A 2X09A 2EIBA 5C9AB 1JUIA 1XNTA 1NX9A 3D0JA 3P1IA 1JBCA 3VUOA 1VIWB 1F4HA 1AX1A 1QDCA 1O5UA 2QBXA 1DBNA 3B02A 1QJY1 4HPKA 3RBXA 2AXTE 1LESA 2M3BA 5FYBA 3D70A 4XIKA 1ZM1A 2ARBA 1AYM1 3WDWA 2Y34A 1H1IA 2H6CA 3AK0A 1RF0C 2R073 1E5HA 4GH4B 4Y1VA 3NO8A 3WP5A 5FRAA 3VGIA 2GC3A 4LMFA 1KJLA 3WR0A 2YC4A 4HZFA 5FXXA 3PUSA 3ZMOA 1REEA 3C7GA 4W6XA 2MJZA 4DFSA 1LT1A 1PGPA 2NMNA 1IO4A 4IFMA 3GBFA 4JCKA 4FP3A 3I2OA 3SWKA 5FAXA 2D6OX 1L0LK 3ZR6A 2ET7A 5FOBB 1UNBA 5FZ9A 4XF4A 1RUF2 4R4MA 5I8YA 1FOD2 4Q4W1 2UURA 2IZWA 3U14A 1FZAA 2VXRA 1ZREA 4TTGA 4UYBA 2QQIA 4ISRA 3A3YB 4LHNA 4ASMB 1UIIA 4QGLA 3EQEA 5M1BA 4IOIH 4ES8A 4QX2A 3WQ1A 2NLRA 4DIQA 2IUWA 2ZFCA 2O01H 3A7QA 3VKLA 4OHVA 3GJBA 1HGVA 5EHDA 1X50A 3ZPYA 5C4WB 4OGQD 1STMA 1V9U3 3KT1A 2M5AA 1JY2N 2AZ5A 2JENA 2XLFA 1SQBJ 3L75E 2FCTA 4ZZ5A 3RL0g 4U3FE 4DUXA 1YEWA 3PVNA 1PZ7A 3DPRA 2XVKA 1K5MA 1UOJA 2GDFA 5C8CA 4FPOB 1UZVA 1NTKK 3H1JJ 2V4VA 2BU9A 2HEVF 1N3QA 2GP5A 2KXPB 1UU5A 5T5OA 1BCXA 2WABA 2PAKA 4PD4H 1W39A 3Q5PA 2AGSA 4XA4A 4FI9A 2VY0A 4FQ4A 1RYYA 1R5LA 2D6MA 3R4DB 1KB9E 4LO8A 3RPQA 2E7TA 3OF1A 4IE5A 1AX2A 3WG3A 1RF1B 1JU4A 4N78E 2GNMA 1MS5A 1PHMA 4XJ8A 2R0FA 4Z1VA 1POV0 3E5QA 1RH5B 1ZRRA 2KK7A 2KS1A 2FXMA 3CBNA 3QH9A 3V4WA 4V1PA 1RQUA 3VBSB 1H8VA 3P8CD 3HN3A 5CBOA 1PP9D 3T3YA 3OGVA 1RUG2 2XPJA 1OSGA 4U2AA 1IS4A 4PI0A 4L8QA 4RSUA 1YBKA 1HV0A 1BCCG 3H8RA 5DAPA 2ZX4A 4CU7A 2FXPA 2PLV2 3VBOC 2HWF3 3AECC 3A4UA 1HBWA 4QPIC 4ITCA 1JCDA 1ALYA 1S5LE 1DLCA 4YZ2A 2Q7CA 4FFHA 3IM0A 1TNFA 3LDBA 3AL6A 3JBG3 2WFF3 5HCAA 1WCKA 1RHI1 2OARA 2AENA 3I7DA 2IX7C 3NV2A 1Q8VA 1N1TA 2GNTA 1A02J 4CTEA 1W6QA 1ZZCA 2P6CA 1NKNA 3HE4A 1DYOA 4LC1A 1AR91 1JM0A 2BV4A 5EXOA 1ZBA3 1RTVA 3D8CA 4EV0A 1JZ7A 1ZBA2 4YG6A 2IPPA 5KR7A 3GLMA 3WNXA 4YW1A 3VD3A 4QPGC 4CUBA 2AXCA 4LKEA 1JZ2A 4LHSA 1PGW2 3F2ZA 2R043 1PVXA 5FZDA 3IF4A 2WNOA 2FFDB 1SQQD 3W67A 4D6TJ 3WW2A 5B66E 2KIKA 4DUWA 5JOXA 4NRMA 3PMSA 3RBZA 1W6PB 3CWBJ 3H25A 4QGNA 3WU2E 1LTJB 4MGSA 1WT6A 1Q56A 4JGYA 1X82A 1QOSA 1EPWA 1BDCA 3M9QA 3H1HJ 2FYNC 2WNUC 2JDMA 2ETEA 2KNCA 1XXNA 4P9XA 2OZ6A 3S6PA 4XFJA 5F32A 3GF7A 3PTYA 2XJRA 2A06E 1VBA1 2XBO1 3S30A 4AFCA 2PHTA 2BEZF 4P9LA 2P3IA 5CCGD 4XW3A 1KS4A 5JIAA 1VBC1 3U37A 2BOIA 1MFZA 1QJU1 4ZXEA 5BNOA 2OX0A 3DYPA 2I45A 1KQSO 2H8PD 2Q8CA 4YXWH 3BRTB 4ZPIA 3RZGA 1QWRA 3M3QA 3G3ZA 4PIYA 5DN2A 3SSUA 4A7KA 5FPZA 4EN6B 1RHZB 3RRDA 1W6NB 1RUJ3 1P8JA 3ABZA 5K4LA 2HODB 1LB2A 5CADA 5CCHD 2V09A 3K75B 4UW5A 1W6MB 4IEOA 3UJQA 2J1SA 4XCAA 5FO9B 3WUVA 3OUJA 4O9GA 2R44A 5E89A 2OYHC 4GDOA 1NTME 3A21A 4Z2WA 3ES1A 3Q8AA 1FJKA 5L9RA 3K4ZA 4A42A 4PF5A 3NNFA 4CDWC 5CFDA 1S0EA 1OBNA 1KD7A 3PJSK 3KZIH 3M3IA 2HH9A 1JMUB 4KWLA 2WSSH 3B3QE 1HN1A 2EALA 5FO7B 3PUHA 4ATEA 1PIV1 4IV3B 4U3FG 4MG2A 4CEYB 1E57A 5TSWA 1GZWB 3AP9A 4LBMA 2W1UA 1OIPA 1WW4A 5EFUA 4CUAA 3B5LB 4NRPA 5FZOA 3K46A 4PI2A 3O6QA 1VBB1 4PLMA 2SBAA 4ZKTB 3TNUB 1YQ6A 4QM8A 4KBZA 4B7EA 4WBBA 3O0WA 1HRV2 2V7QJ 1KB9I 2VTXA 3RK2D 1BVVA 2JG9A 3MFCA 3HD7B 2IXIA 5JOWA 3CC2P 2K37A 2GALA 4NUBA 3AFGA 4XQWA 3AX4A 1GR3A 2N1TA 4R4XA 1SDDB 1IFPA 4IEZA 4D8MA 1BEV2 5A3LA 1YFYA 4CP0A 3UV9A 3PH0A 3H7YA 1LHWA 2EIDA 4LUMA 1IFJA 3MLLA 4OUMA 1H30A 3H1IJ 1ONAA 4L11A 4UT5A 2BNOA 1FNYA 2DWRA 1UOBA 4IXLA 2Y0CA 5TISH 2KI7B 4C7RA 1BGYG 2X5IA 4JGZB 3G6JB 5CIRA 5E88A 2QJPC 3K4DA 2DBIA 5B4XA 5AVQB 4MO3M 4XETA 3RJRA 4CCMA 1SFCD 2XG3A 4A3XA 4NAOA 2P17A 3T4VA 5FZHA 4FTEA 3GMAA 2O1QA 1R092 4FPYA 4QWNA 1SQ4A 2B9UA 1R1A2 1O4TA 1MQTA 3ZXEA 2R3CA 4QKDA 2DFBA 5FYUA 2WO7A 1POV1 5C8WA 3ZSMA 4B4RA 4CDQC 3IAOA 2NZ2A 2VMEA 2I1KA 1N73B 1WD4A 2Y9ZA 4S2HA 4GWJA 1I5PA 1CPMA 5FWEA 4MHUA 3ZSJA 2ZXQA 1SLAA 4DNYA 3ZVXA 2YUEA 1W05A 2C9KA 1IS5A 1WMEA 2QA4P 5A7WB 1HB3A 2BGOA 2DUOA 2G19A 2WMMA 3AEGC 1WWYA 3ACIA 1U0AA 5FPBA 4AEDA 3V0AA 3JQWA 1Q5OA 4C7NA 2ZYDA 4J1XA 1EPZA 3UKNA 1YITP 1MZ5A 4AQ2A 1AYN2 3B71A 1URQD 3DECA 1PL5A 1GW3A 2RE9A 2DDUA 1GU3A 3ZXGA 2Q1ZB 3F95A 1PGL2 1FV3A 5FQ0A 5T5PA 1IFDA 2WVRA 2ZEXA 2B87A 4CCEA 3ACFA 4Q4X2 2VXJA 1OC1A 3BPZA 1J3QA 2WBKA 4BB3A 4FOWA 1QLED 4GWNA 4NIHA 2VMGA 3T2QA 1OX3A 2KZIA 4XOGA 3TK1A 1T6BX 3IIAA 2A3YA 1UKGA 5JOZA 3MIDA 4JZRA 1GQPA 3ON7A 1B35A 4RR3B 1KILB 1GL2A 3D6ZA 2Q5UA 3DUIA 4G3YC 4CDUA 1HRI3 2RM23 4ZONA 3C8VA 2ZEZA 5JZGC 1EP0A 3U10A 4IEUA 1TE1B 1PNGA 3POIA 4LKFA 1MZ9A 1XSRA 3S57A 4AQSA 1ND3B 3PL0A 2GH8A 3LD8A 5GZCA 5KAIH 1YO8A 1ZMEC 5T55A 4R4ZA 3KVAA 1NQJA 2C0XA 1VJ2A 3L2YA 4UFLA 3SFDC 3HTKB 4YFWA 4Z07A 1ZBE2 3OBRA 2QJKB 1N7SA 4XYXA 4LIUA 1VMJA 3B7MA 1NTZK 3DXTA 5EP9A 5A7SA 5AW6B 5KLVK 4H0LC 4YGCA 1RUE3 3LF7A 4AGGA 1J1DC 2MHFA 5KC5A 3WHTA 3I2HA 3IMNA 1Q7YQ 1BMV1 1Q8QA 3BALA 5KAFE 1MS8A 4W50A 1NT0A 1O8PA 3IDEA 2WSFH 5C3PA 3O1RA 1SQPK 1EUTA 4PV1D 3FC0A 2E43A 5GKAC 5EYYA 2R061 1A3KA 3HMYA 2YKPA 1L4AC 1NTKG 1YTZI 1RUC2 4IEVA 1SQVE 4LJHA 4C0BA 3KQRA 2WSCH 5LCWL 3HQUA 1NCQA 5CA6A 1WW5A 3VBFA 4BRYA 5JXHA 1VF5D 3FZ3A 1PP9J 1FPN3 3OYWA 3ZFFC 4KGQA 3NV4A 1GV9A 3ZFEA 2ARCA 4M3CA 5EPAA 3H1LD 1G8WA 4YG3A 1HB4A 1K42A 4Q4Y1 1UY1A 3WF3A 5CAZA 1VRH2 2WT7B 4K20A 5J48A 2D2CD 5FOJB 2YXRB 5A3OA 4AHZA 3THPA 1EDKA 3ZN6B 1C8M3 1GL2C 1QQP1 1AX0A 5IJRA 4WVMA 2RH0A 2PP6A 2A3WA 4W4ZA 2QKDA 1FI2A 4TN7A 3VBRB 4LBQA 4E27A 1ZLLA 3GXUA 4RFT0 1UX6A 2WA3A 5BYNA 4WM7C 2H43A 1QJY2 1PK6C 5EQUA 1XTCC 3E1F1 3ZDMA 3AM2A 3RK3E 1VQ8P 4AFBA 1AYM2 3SCFA 5BNQA 3OSDA 4MSVA 2ZHNA 4P9GA 2FCVA 2N9BA 1FOSE 3VBHB 3D5OA 2QDRA 3L73E 2RJ2A 4XMIA 4UF0B 4PT6A 2ENRA 2LROA 5FYVA 4AI1A 2HFED 1SLIA 4OYUA 1C5IA 1JOJA 3WQ7A 5CCGC 1OMIA 3K48A 1UIKA 3ZYRA 1SQQJ 4E4ZA 4IEXA 5A3UA 1KS5A 4B1MA 2RS11 4RGKA 5JMCA 1D0HA 4E4DX 1TQ5A 1W6OB 2A45H 5CISA 3WNNA 4OQ8A 1RE3A 2Y6GA 4INDA 5IFTA 2P58A 4K1ZA 1JYTA 1S1AA 4A6SA 1NY71 4YW3A 4M01A 4Q4W2 4XUNA 4AK3A 4JQRA 1FDIA 3J7HA 4PLOA 5AW1B 5D2AA 1RVF1 5K0UC 1DIPA 1L0ND 4R9DA 4N53C 1AFOA 2BWCA 1S4CA 5FR3A 2P1BA 2J1RA 2ZABA 3LDKA 4QXHA 2WWJA 2GUVA 3MLJA 2XUEA 3JXSA 2AC1A 2FYUE 1V0AA 4EOTA 3I54A 5H9RA 4QAWA 2QQVA 3LPFA 4QQLA 3WF0A 2WFPA 2DVGA 4GMP0 4A3ZA 4XUQA 3RQ0A 1VE0A 3H7JA 2RS33 3T2PA 5JSOA 4Y26A 3I2JA 3BTZA 4CU9A 5T3NA 3INAA 1UY3A 3RMXA 1GU5A 4CZSA 5IUQA 5A32A 5AVWB 4YVWC 2BCCD 5FUPA 4AW7A 2IXCA 1SQBK 1AL21 1OVSA 2I07B 1QJZA 5JDBA 2RV9A 1IKQA 1NCRC 1V6IA 1GICA 1NE4A 2X8KA 4GOEA 3C2UA 4I6MC 2WNVC 1DCSA 3LSDA 1P84H 1VBD1 4AVSA 3AP6A 3LAGA 3WV6A 3V0BA 3AE1C 3N3HA 1JTHB 2VZVA 4COVA 2EIGA 3DYOA 1FDMA 4OHXA 1UCXA 4CXYA 1RUNA 1QL1A 3PIGA 3H1MA 1VBE2 2WN3A 5F7UA 2HBTA 1K8AQ 3UGFA 1OOPC 4DEVA 4K3AA 4N43A 4I0BA 3TGUE 2XNXA 2JIGA 1RIRA 1NAFA 3HUSB 3BTAA 1HB2A 2ZGMA 2GMPA 2B88A 1MS3A 2D3SA 2N7GA 2ZXEB 2ZX2A 1M90Q 4AFMA 4EI2A 3CPWO 1U12A 5JCTA 4HSLA 1JMBA 3A0KA 3BU7A 5CHXA 5GTIH 4AVTA 2FZ1A 1M7LA 1GNHA 3DV8A 2QJYB 1W0PA 2ZYGA 4AQTA 2LKMA 5F9TA 1L7QA 3ZFGB 1MFTA 2R49A 5AFBA 1K73Q 1WA4A 1WMKA 1RHI2 4DXTA 1BZWA 2P37A 5F5CA 1JY3N 4S2DA 2KSJA 3BCWA 3SCHA 1LWUB 1Y3TA 1VAMA 2OZJA 2WL1A 4K8FA 2ZX0A 4OI1A 2AREA 3P3NA 5AFEA 1OA4A 1BK0A 1AR92 4AVCA 2QM7A 1NAEA 2ZEYA 2YDEA 1SQVG 3CXHH 4AHWA 4IE0A 4YW6A 5AVVB 4CA9A 3N7KA 4XE5B 2W68A 1T2XA 3RWNA 3T1LA 4JRAA 3HD7D 1MR5A 3OW2O 1SLTA 2CTVA 3MIGA 3ZKYA 3POJA 5CBLA 2BPA2 1TMF3 2VOWA 3WNMA 3IAQA 3GHGA 2Y6LA 2E7AA 5APXA 3JD71 3PP5A 2YO2A 5FZEA 1CZTA 1W8WA 3EXUA 4DB5A 1LT9B 5FP8A 1VQLP 1UX7A 4BCUA 5A3WA 2WPQA 3B69A 2KB7P 5C9AC 3L71D 4QPYA 1JMMA 3AE7C 1OLQA 4AHYA 3O1UA 3CQOA 2IVJA 5AC91 5DZFA 2ET1A 2QE7H 5M0TA 1YQCA 4F83A 1VBA2 2XJQA 2XBO2 2RR12 5DAQA 2D97A 5FYHA 1LEDA 4WY4A 4Y5TA 3FBYA 1KORA 1XNKA 1VBC2 2GMMA 1QJU3 5KHHA 1NOHA 4GH4C 5T54A 1XE8A 3H8UA 4Y28J 2OIIA 1PX4A 1JUNA 5T5JA 2RKLA 2VJXA 3PLQA 3SC7X 1K04A 3QACA 1W2TA 2G9FA 2K9JA 4ORFA 4DO0A 1W9YA 3FUOA 4OHWA 1UIXA 1RF1A 4XXAA 4PDWA 2W87A 4XUPA 2QQJA 4MGKE 3HJRA 1FC2C 1S2BA 3CZJA 4AGVA 4F8AA 2I1JA 1W3XA 2QZ2A 1O4YA 5CYYA 4BH9A 4RGGA 3TYJA 1JYXA 3THCA 3W59A 2PAJA 3M9HA 2CWSA 1FOSF 3WDYA 2QQWA 1SPPA 1L7RA 2IVIB 4BZ4A 1VPCA 3SXWA 3GHMA 1F31A 3UJOA 3OPWA 2ZGRA 1UXZA 1VQOP 1QJX1 2XKOA 1RL3A 4YVSC 3P8MC 4HPKB 1S9KD 2B7YA 4XJWA 2FYUG 4DXSA 1OW7A 1COV1 2CDOA 2VZSA 2JKXA 2Y6FA 2MPFA 1AVYA 3V65A 3L70G 2ZVNB 2D44A 4XEZA 3AMQA 5C4WC 4M3CE 2ZBJA 3A23A 4ZY9A 5FPAA 1HKDA 3BKZA 1W2NA 1AA0A 1LOEA 4M3LA 3NNJA 3O14A 2RN0A 2VD7A 4JX0A 1AZDA 2ORZA 3U0ZA 1PIV2 2NM1A 4PD4I 2W83C 2H89C 1BCCD 1SQBE 1YIJP 3MV01 4KHXA 3CCEP 3LQCA 5FPXA 3ZN5A 1W06A 2E75D 2QJVA 2JJLA 1VBB2 1PVC1 3S4RA 4ZU7A 3ZM8A 1SMVA 2XUMA 3KD4A 3W5MA 3A5TA 3MD0A 2XJSA 2V73A 3D71A 4P00B 1O7FA 4JV4A 3H1JE 1LTGC 1GZCA 2WSEJ 4IEYA 3WP3A 3EB7A 2YC2A 1KILD 2WLQA 5CNAA 4W6YA 3W58A 5FP4A 1VF5C 3TB0A 4JDMA 3W20A 2WR9A 4GMP1 2XQRA 3FMGA 5C7GA 1PO22 1PGOA 1LTJA 3M06A 2P2UA 1DQ0A 4Y33A 1BSHA 3PVBB 4IEWA 5LK5A 2WLPA 4QHOA 2JG8A 3R0RA 2Y9YA 3A7OA 2M5AB 3MDPA 2ZX1A 5HXMA 3TGUG 2B39A 3VBSC 1WKYA 3RZKA 5IW0A 3HWJA 4GB33 1OXZA 5FY0A 4TLFA 2DVFA 3BOWA 3BODA 5F5IA 4HN1A 2CGOA 3ORJA 4Q27A 3DPRB 1TEIA 1K5MB 5I0SA 5C8CB 4R9BA 2AEFA 1ASJ3 2UYAA 3ZXAC 3O0XA 4JKKA 3ENRA 5A6ZA 5KLVG 1JYNA 1GK6A 3CCRP 4K40A 3WLUA 2VZTA 4S2GA 4H7LA 1FMD1 3H1LJ 3OBTA 5IVYA 1POV3 1DD4A 3S1KA 3H0OA 1ZZ9A 2BOJA 2Q4SA 1SQPG 4DZOA 3AP7A 3WSOA 3ITKA 3A0BE 3FE5A 5I93A 1IOAA 3CO2A 5KLIB 1YHQP 3MW3A 1VRBA 2M0BA 2BDRA 1AR82 1JYVA 1JHJA 1IPSA 3TSIA 5FZFA 2KS1B 1US2A 1G2CA 2VL4A 1MKMA 4RHV3 2GP3A 3SEEA 5AVSB 5A3MA 5APWA 2YBPA 3M1HA 2P5BA 4LE3A 2W92A 1DGRN 3MLKA 3ZXLA 1UZYA 4JBZA 5FY7A 3ZO0B 2FFDC 4AEMA 1YJKA 2BVVA 4BWOA 2HWB2 2YGLA 3FL7A 4O9EA 2RDRA 1CX4A 4M0NA 2ZVOB 2O8QA 4LHKA 4D6TE 5FLHA 1W9WA 2OT7A 1H0TB 3PTRB 1Z78A 4PD4D 3MUDC 1ULDA 3OGJA 3CMAP 3CWBE 5APYA 2Z5WA 2ARXA 1GZWA 2XKMA 1YC61 1GP4A 2XU6A 4Q8KA 4ZHNA 5IFPA 3N9MA 3WW4A 3T30A 5EZWA 4A2UA 3H1HE 5A7PA 2BVBA 2JIJA 1LTSC 2NPSA 2XMLA 3GM8A 1W6QB 2W8ZA 3WCSA 3KM5A 3HE4B 1EYBA 3RL0B 2GH2A 5GJ6A 3I3QA 1L0NJ 2CPBA 4N7IA 1O6UA 2R5DA 4BQYA 1U7JA 1JOPA 1KFMA 2ARAA 3NJVA 2RDSA 2XHNA 2VECA 3M70A 4QDQA 3PHMA 1PFIA 2Y0EA 2Q9IA 4NIDA 4FXKB 3OUHA 4F3JA 3WY6A 4Y99B 1JY2P 1RINA 2JO1A 4CP1A 3B5NA 3J26N 2JB4A 3KWVA 4QQHA 3Q2YA 1EV12 1KFXL 4JGYB 4JGZA 1W03A 5AW9B 1NWQA 4OLLA 2JWDA 5FFOC 2BQPA 2BCCJ 2W1SA 2KNCB 5JR7B 2YPJA 5BU8B 2QM8A 2GAUA 3E5UA 1IZNB 5GZDA 1ZRIA 5DZGA 1J1EB 2BFUL 2K9ZA 4FSJA 2E51A 1NU1D 3ZKUA 5IVJA 4MN4C 3J9SA 2JWPA 1XTGB 1Z7S1 5FZ7A 1UYXA 4I7ZB 2A75A 5F6KA 1Y9QA 3C7OA 1JZ4A 1BBT1 4C91A 4C0HA 1BMV2 3WQ0A 1HJGA 3U78A 1CZVA 2A6YA 1BGYD 1KTMA 2Z5IA 1WRGA 4IV3C 4CEYC 2R062 1N73A 3C7FA 1PPJD 1EAH1 2PHWA 1SQBG 4YPCA 3PJYA 4YG0A 1SS1A 3SEPA 2DU0A 2QZ3A 3H8XA 3RK3B 2E63A 3RS6A 5E1RA 4C46A 5KJ7A 4E2GA 4JC1A 4M3CF 3OEAA 5C3QA 4Q4Y2 3DGTA 2A6WA 5KHIA 4GJYA 1X8EA 4IFDK 1WBFA 2VMHA 3HD7C 2A6VA 1DZTA 2IBZI 4MUVA 4YTPC 4CCNA 2YFZA 2Q6QA 5BPXA 3WT3A 5APQA 1QQP2 2Q8EA 3Q1MA 1SCSA 2P1JA 1QF3A 3AMNA 2G1MA 1OLRA 3UETA 4BIOA 1IQAA 1UMZA 2ZGTA 1ZR2A 1W8TA 5CFDB 4HKLA 4IL6H 4DOJA 3WDXA 4H14A 4BJ0A 3H1IE 2RDNA 3RI8A 4Y5Z0 5FY5A 5JSRA 4Z2AA 1X7NA 1S0IA 3U1XA 5C3OA 1NH4A 5CCHA 5DXDA 2ZGQA 5FY8A 3M2MA 2R32A 5AW7B 3FLRA 1JYIA 3M0DC 5H2FE 5FZOB 4XIOA 2ILMA 4FFGA 4JF7A 3O6QB 2WQ8A 3ALQA 3H50A 3K51A 1BXHA 3V2RA 4X6RB 1WCUA 3NRUA 4CPBD 2B4KA 1US3A 4A7YA 2RS12 5C71A 4ARXA 4QMAA 4HK8A 5BU5A 1RUH1 1UY0A 1SQXK 2JG9B 1IK7A 5LRRA 4P9JA 5DJUB 5KBFA 4IE6A 4JPZB 1NY72 3L71J 5E79E 1W8FA 5LA1A 2HWE1 4JHTA 4HT1T 1RVF2 1RUD3 3N9OA 2W1WA 1F2NA 2FY8A 1AXYA 1FZEA 2V5DA 2VM9A 4I1LA 4FFIA 2WAAA 2ZX3A 4AOCA 2XOMA 4Q0UA 3V2QA 1GMMA 1W2EA 2X5IB 3U59A 4OI2A 1NA1A 4L9BA 3LZZA 3TBDA 1CGPA 2X05A 4YRDA 5FKBA 1YNAA 2XVLA 3LPGA 4LORA 1L0LD 3E7KA 4AWDA 3VL9A 1HVVA 2OQ6A 1UN1A 3AMHA 3TN91 4D6TG 2W1QA 2NRGA 4GIFA 2LR2A 1UXXX 1NAYA 2P3KA 1A02F 2RMU3 3AVRA 4LIVA 3CWBG 3R05A 5FY9A 3NKTA 1ULEA 3LEKA 3BGAA 2VCBA 4AQ6A 2VOXA 3TEZA 1MQTB 4LTAA 4MGYE 2YBSA 1AL22 3W21A 3H1HG 2VOKA 5T50A 3AJZA 3CLQA 1LU1A 3OGGA 2C6SA 3UIAA 1D2QA 3U1AA 5FXVA 3SH3A 2ORXA 1H1AA 3SKVA 2W27A 1FATA 1OUSA 1FT9A 2IBZD 1VBD2 1OQEA 1IGOA 1SFCA 2NQYA 1C4RA 3JCUE 4RR3C 5FYYA 1X36A 1KILC 1NTKD 4AEDB 3V0AB 4XUOA 4C7NB 4I02A 4XFBA 5HCBA 3GBGA 3BTYA 1UYPA 1UIJA 3LW5H 2ERFA 3N9LA 4C1WA 3AE8C 1U57A 1LTTC 1H6XA 1SBDA 1ZA4A 4NHXA 4RQPA 1R64A 3K3OA 1ND3C 2VVFA 3SKJE 2P67A 4A7PA 2VMCA 1BCCJ 5FZ0A 3VV1A 1RUI2 1QVGO 2XZRA 1N47A 3MUZ1 4Q0QA 2IFNA 3B00A 4HSJA 2QJKC 5HV0A 3B9IA 3BOPA 2UU8A 2AEMA 4BDVB 2W47A 2HWC1 5FQ0B 3IT8A 1M56D 1QGKB 1NXMA 4XE9A 2WZR1 2B87B 3KF3A 5ABJC 3EQ2A 1CESA 1ODNA 2CGNA 5CMZA 2GNBA 3IDAA 4H2AA 2KZJA 3SNMA 2DCKA 3BTXA 1KYOH 2ZT9B 4L92A 2XB6C 2PHUA 5FP7A 3RFRA 4OULA 1FZGA 5EJ1B 5FYMA 1FZCA 1ZOYC 3VBUC 1B35B 1URQA 4AI3A 2YO3A 2TEPA 1FV2A 3MZWB 1BEV1 4QX7A 3ZPOA 2C9AA 4CDUB 1OXCA 2H88C 1DQ4A 1KDKA 2E53A 4RS5A 5FJHA 2YV8A 1GK4A 3ECQA 4YW7A 3MFAA 2QVAA 5GZEA 3P8CE 3JD72 4BMEA 3C7EA 2E5TA 4GXLA 3PDQA 1PGQA 5IVCA 2LALA 1N7SB 1Q8PA 4XDOA 4OFGA 4BXLA 1U5XA 2ZGUA 5GTHE 3V6IA 3OB8A 3Q8EA 1T6GC 5ACA1 2RJKA 1WMDA 1QJFA 3J4UH 4NHLA 1R091 5AC92 3VBRC 4UB8H 4HKZH 1AHSA 1R1A1 1LOBA 4XF1A 1W2AX 1U5YA 1XNCA 4RL7A 3I2GA 1TU3F 1F4AA 1UMHA 2C4XA 5AW8B 4BLJA 3H1IG 2GN7A 2O01J 3N4MA 3L2HA 5A6YA 3T09A 3VBHC 1A8MA 3GZUC 1SCRA 3K4AA 4XJZA 1C1LA 3O1OA 3JB4C 2A45I 2D5HA 1NCQB 4OVEA 3VBFB 2QQMA 3JB8A 5FUIA 1UU6A 2P10A 4MADA 1JB0J 3OYWB 3MHVA 4QX0A 5C3RA 1JTHA 1X9PA 3ZFEB 4M3CB 2QRXA 2Q3IA 1LOFC 1ZZ7A 4WV8A 3V64A 3CEWA 1SQQE 5AW0B 4QQ2A 2IC1A 1ZRTD 3G7DA 1H9WA 4IEQA 3D6YA 3ETPA 5F3EA 3LIEA 4AVVA 1AYN1 3PU8A 4HJGH 1HXS3 1OVVA 4WVMB 2W39A 2ZXXA 2YROA 1LTIC 2FHRA 3DKWA 4LBQB 1QJX2 4Z82A 1Z0HA 1CIWA 1OH4A 1CVNA 5ANNA 1R081 3A0HE 1M1KQ 5FPLA 3QOPA 3WF4A 2Q30A 1COV2 1AR61 2HWD2 1A78A 2EA7A 3ACGA 1EY2A 1NXD1 2W52A 2X10A 1YI2P 1RMU1 4AI0A 3WMM0 3N7MA 4B3NA 4EYYQ 2HBUA 3H9AA 2MEV1 1VQKP 5B5EH 2E74D 2Y0OA 1PVC2 3HBKA 1V6LA 5AVYB 1NO4A 1P84I 3APBA 5T5LA 4FAHA 1Q82Q 2QFEA 2LRPA 3VZKA 1JTZX 3ETQA 5APAA 3VN0A 3B4SA 1UO9A 5DDJ3 2IYOA 3AC0A 3D0SA 2BERA 3GW6A 4XBLA 1XC6A 1F15A 1OLMA 5JMOA 2K46A 3WX5A 1OW8A 3KF5A 4CCKA 5AVRB 1OZHA 3U4XA 1NU1J 1A6CA 1ZBE1 4BU2A 3NVCA 2GZWA 4LE4A 5LY1A 3FWNA 1HQLA 1LGCA 5DABA 3FXDA 1JH5A 5DUUA 1CI6A 1N8RQ 5I91A 1J58A 3OY8A 3B01A 4E8CA 1XB9A 3HIFA 2F6BA 4ASWA 4JTNA 2P7JA 1BGYJ 2Z4EA 1DZRA 1GWKA 3LIHA 3HUSC 2RS52 5FZ3A 1LJ7A 3WZ1A 2KUBA 1JHNA 3CX5H 1QNYA 1IPJA 5A32B 1DP0A 3KV9A 2JD9A 3PVOA 2NPIA 5IK7A 5FYIA 4QXKA 1D4M3 3GHNA 5EV7A 1FMD2 3ZFGC 2JD4A 4CXXA 1WZXA 3WF1A 3N4XA 1RXFA 3PUAA 3CXHI 5K9YA 4JAAA 4HN0A 5BNNA 1LWUC 1OD5A 3SWFA 5L8RJ 2WSVA 3J8F1 2FDKA 4LLOA 1T3JA 2OPKA 2WS93 1VQMP 1YJWP 5KHJA 1DF0A 3V0BB 2JEEA 1ULFA 3SMHA 1X0TA 4BQ5A 1NLSA 2ZEWA 3IDCB 1UF2C 5J37A 2QDNA 4DRRA 1FX5A 4LK6A 2E33A 4N43B 4UOJA 3CL1A 4FFFA 2OPWA 4NIAA 1NG0A 3H3UA 4AXOA 2DVBA 3MTUE 2EF6A 3AYEA 2BBAA 1PO11 4OCTA 2GM4A 1OFCX 5FREA 5JLVA 1YWKA 1LT9C 4MGTA 4Z1MH 1Q81Q 4CU8A 2HEWF 2BGPA 2YC0A 1ULOA 3H32A 2I74A 2VMDA 5LK7B 5BNPA 4XURA 1IS3A 5AVAA 2VQ0A 5BY5A 2L5GB 4QU2A 2WO1A 4FQZA 5JAXA 4YXDC 3CMEP 2DBNA 2YPDA 1CR7A 2CNAA 1YTZT 3AKTA 3TWIA 1P84D 3MPBA 3R4SA 4IFFA 4LKDA 3L37A 4XQ4A 1NYHA 4MYEA 2VCMA 5BUVA 4HMZA 3U4SA 3M9BA 3KMHA 1MACA 1RUF3 3L70D 1FOD3 4V2VA 1V6JA 3VDDA 1WW7A 2NMOA 2Z2SB 2R071 1N1YA 2AXTH 4W6WA 1UY2A 3ROUA 3L35A 4UB6H 1GQHA 2N1TD 1SQXG 5FKCA 1OKQA 1LU2A 3URFA 2WC2A 3GHGB 1G7YA 3USUA 1NTMK 1L0LJ 4Q4V1 1SQQG 3BPSA 1CAXA 5IAXA 1QXRA 2VGDA 1VQ6P 2Q1MA 2XJVA 2OUHA 5F8PA 3C8XA 1DGWA 2ZA9A 2BBVA 2XLGA 1G86A 5FBZA 5FZ6A 5E16A 2LUWA 2LXCB 1YQ5A 3J7LA 2Y6JA 4JKMA 3OD4A 1DGWX 4WY4B 3LOBA 1G1IA 3O1MA 1EZVI 1H8TA 3HBZA 4YARA 1NYWA 4NR1A 4Q2FA 2XLAA 3AKPA 1Z7S2 1QL2A 2JWAA 3QH6A 3NNMA 3N7LA 3K2OA 3CXHD 1GW4A 1BBT2 5CFCA 3K5BA 3TYYA 3K77A 3TGUD 1DLLA 4OI4A 1XQNA 1MS9A 2K9JB 4LXLA 3VD9A 1NTKJ 4PDWB 3FLTA 1EAH2 3G71P 1GSLA 1KJRA 2BYVE 1CJDA 4H44B 4OUEA 1AJYA 1XNBA 1ZZ6A 1JYWA 2VG9A 4DOUA 4M00A 3PIJA 2WO3A 2X29A 1NTZD 1VBE1 2DYCA 3VHRA 5KLVD 4PIXA 3DXUA 1I3HA 4GJZA 1W99A 2DURA 1RUG3 5APVA 1SPPB 2XJPA 2J1EA 3KCCA 2J22A 3PVEA 4H0LD 2DW3A 3WNKA 1HTLC 1SQPD 1T3UA 1HV1A 1S4XA 4WB4A 2PLV3 4TZDA 4O7XA 1WBLA 3VTPC 4XF0A 4LLFA 2VBDA 4Q0SA 2OXBA 3RI9A 4XBNA 1H0TA 4AQRD 1JY3P 3PJQA 3BVHA 2JP3A 1S0CA 1XU2A 1ZW0A 1L4AD 2EXKA 2ZJSE 2ZS6B 4LUKA 4NWVA 2DCJA 2BTVC 5D8AA 5KXCA 1KZUB 3OPTA 1QOOA 3T4HB 1REDA 4H3WA 3WDTA 3VB9A 1YCIA 4IW3A 3ME2A 3DPRC 1K5MC 2VW1A 5C8CC 4LK7A 2YMYA 5F6LB 3B93A 4IEPA 2GC2A 2YZ4A 2C24A 3RJ2X 2W95A 2AH2A 4MGZE 3B8EB 3AFKA 1ST8A 4AVBA 1H4GA 2HWF1 3I8TA 1PIXA 3A2AA 4KI5M 2VQUA 1FZFA 3KVBA 1VMHA 4BQWA 4ASLA 4GT1A 1RUH2 1C5HA 1GL2D 1JN2P 1N86A 2VMFA 2LTNA 4GQ7A 5G05L 3H1LE 4XFHA 3E6CC 4WZCA 2WFF1 4NN0A 1HDKA 3AYAA 2V4AA 4D0QA 4AEJA 5KLIC 3CMGA 2HWE2 4CDQB 4I01A 4B7KA 1ENXA 5FZCA 4EN9B 1PZ8A
chains in the Genus database with same CATH topology
2JG8B 5K0UA 2KA3A 4BZ4A 2D98A 4N53A 4N90A 4BHPA 1M06G 1VPCA 4JGZC 3SXWA 3NV1A 5L19A 1TME3 4Q0PA 1JNMA 1F31A 3GHMA 3UJOA 2V5YA 5DDJ2 3MICA 4ZKUA 2OA2A 2ZGRA 1HIXA 1FPN2 4UBHA 1N7SD 1Q8OA 1QJX1 5KWRA 3CJIA 2R1DA 1LODA 1YUDA 2XKOA 3KB5A 2RR11 4HBNA 4XJ9A 1RL3A 4YVSC 4IV1B 4HVRA 5BXXA 3P8MC 4HPKB 1LT9A 1S9KD 2B7YA 4R52A 1BJQA 3CU7A 4HH2A 4XJWA 4YZ3A 2WJSA 1LOAA 1COV1 2ZGLA 4LBNA 3ZIWA 2B42B 2K2SA 3TN92 1CAVB 2MPFA 4JTOA 3V65A 2D5FA 1OFSA 2D44A 2XWBB 4W80A 3AMQA 3AZYA 4XEZA 5C4WC 2UWCA 4M3CE 5AW4B 1J3PA 2XKPA 4N9HA 2ZBJA 4D3WA 4FPHA 1QNWA 3J8F3 2ZAAA 4BE3A 1HKDA 2RS13 4KG8A 1C8M2 3AZZA 4XFIA 1FNZA 1MVQA 2WIIB 2DV9A 1LOEA 3ZXKA 2JX9A 4M3LA 1I6XA 3O14A 3QCWA 1AZDA 1IFIA 3MW2A 4B8EA 3U0ZA 1PIV2 1N1SA 3VKOA 2KM2A 2NM1A 5JWPA 4FAGA 1YI9A 4YVWA 2PHXA 4JRLA 4DY3A 1J59A 3GBWA 3BASA 2HYNA 3HE5A 1XU1A 4KHXA 1N73C 3FWEA 4CEWA 1SQQK 1A8DA 2BWAA 3NAPB 3WG4A 1LGHB 1GU4A 3M7AA 3ZN5A 5FPXA 5KXDA 1RE4A 1UAIA 3S7EA 1X8MA 4JYBA 2QJVA 2OVUA 2JJLA 1RVF3 1VBB2 1PVC1 1NCRA 1RUC1 3RL0C 3WG1A 2Z69A 4ZU7A 1F5JA 1SMVA 2XUMA 3O5SA 2WT0A 3KD4A 3A5TA 1OHFA 3MD0A 2XJSA 2V73A 1PO13 3FJSA 4MZUA 5GLZA 4YZ5A 2WNEA 3ZYIB 1O7FA 4JV4A 4EN7B 1LTGC 4LO5B 1G2CB 1CQ9A 4KL1A 4B86A 1D4M2 4CDXA 1GZCA 4IEYA 5KJ7C 1QY4A 3WP3A 1MUUA 5C33A 1XYPA 2OYIC 1KILD 4YNIA 1IJDB 3ZN4A 1D2SA 1MS0A 1ZZ8A 2WNVA 2D6KA 3WW3A 2WLQA 5CNAA 4W6YA 3W58A 5AW5B 2FKWB 3IPVB 2XVGA 1OPOA 4N7UA 4ONUA 3TB0A 1WLWA 4JDMA 3KS7A 4GMP1 2WT1A 1V6OA 3FMGA 3JZVA 4NO4A 3PMEA 4EJRA 1PO22 4Y99C 4Y4YA 1LTJA 3M06A 2C5DA 4KWJA 5F5QA 2P2UA 1DQ0A 3E5XA 2WS92 4WM8C 4GWMA 1VRH1 2ZKLA 2ZJCA 4COUA 3PVBB 1ND2A 1O3RA 2ZOEB 4IEWA 1C3HA 2F4PA 5LK5A 4Y20B 1OOPA 2WLPA 3O12A 5C9AB 1JUIA 3WCRA 1SDWA 2JG8A 3R0RA 3A7OA 1AR72 4MXWB 4JGYC 3MDPA 3D0JA 2ZX1A 4KWKA 4META 1M1JB 2B39A 3VBSC 4Z92B 1JBCA 2PHDA 4UW4A 3VUOA 1VIWB 1WGPA 5F1RA 1RUJ1 1AX1A 3HWJA 1QDCA 1O5UA 4GB33 1OXZA 1AL23 1RUD1 3UKTA 4TLFA 1Q3EA 1DBNA 4IV1A 2DVFA 3BOWA 3B02A 1QJY1 3BODA 4HPKA 4KQ7A 2HYKA 3TNQA 3MPPG 1G9AA 1J1EC 4HN1A 3LSEA 1LESA 2CGOA 4WVWA 2M3BA 2QE3A 2O1KA 4Q27A 1QOTA 2HWC2 2LM3A 4XIKA 3DPRB 3OJBA 1SQVK 1ZM1A 2GU9A 1TEIA 1AYM1 1K5MB 2ARBA 3WDWA 5L7OB 5I0SA 5CCHC 2WZR2 3IN9A 5C8CB 1H1IA 2TUNA 2H6CA 4R9BA 2NPSB 5APUA 3AK0A 4DY5A 1ASJ3 2UYAA 1RF0C 2R073 3O0XA 3ZXAC 5LEKA 1FBMA 4GH4B 3ENRA 1XYOA 1QH6A 1MS4A 1DQ2A 3VOPA 1GK6A 1HRV3 1G9BA 4Y1VA 3NO8A 4K40A 3WP5A 5FRAA 3VGIA 2GC3A 1VBD3 3WLUA 1W0OA 4H7LA 4S2GA 5BNOC 1FMD1 3OBTA 5DUVA 2XWJB 1KJLA 3WR0A 1H2NA 4HZFA 5A33B 2RS32 1POV3 4Y1ZA 3KYQA 3RNSA 1S2KA 2NYYA 4L99A 1G1JA 3ZMOA 1REEA 4W6XA 3H0OA 2MJZA 1I5ZA 1YFXA 4Y22B 1ZZ9A 3NTNA 2Q4SA 1GNZA 4AI2A 4DZOA 2ZHLA 3AP7A 4DFSA 4D7YA 1IS6A 3NAPA 3OAKA 1PO21 1BEV3 2RMU1 1I1EA 3MI8A 1O91A 1LTAC 3FE5A 5I93A 1IOAA 2NMNA 4NPRA 1IO4A 2YY1A 3CO2A 4IFMA 5BVZA 3GBFA 4IERA 3MW3A 2VNGA 1AL0G 1GFF2 4JCKA 3NXSA 1SFNA 3OA7A 2FMDA 4FP3A 3B5NB 1AR82 1HQNA 5FAXA 2D6OX 2NP0A 2IXKA 1L0LK 2ET7A 3TSIA 5FOBB 1AR71 4XF4A 1G2CA 1RUF2 5GKAC 4RHV3 5I8YA 1FOD2 5AVSB 4Q4W1 2UURA 5L73A 5APWA 3M1HA 5A3MA 4LE3A 1O3SA 1RUI3 2IZWA 1DGRN 1FZAA 2CYFA 2VXRA 2WQ4A 3MLKA 1ZREA 4BQ1A 2XH6A 3ZXLA 1ZYBA 1UZYA 4ISRA 3A3YB 4LGDE 1UW8A 3MF6A 3MIHA 4WBAA 4LHNA 2PHRA 3ZO0B 4ASMB 4QGLA 3EQEA 1BQPA 2FFDC 3OTFA 4AEMA 1ULCA 1YJKA 2BVVA 4BWOA 2HWB2 2YGLA 4ES8A 4O9EA 1CX4A 3SHRA 3WQ1A 1NA1C 1RITA 2NLRA 3BIWE 1REFA 1N1VA 4M0NA 5C6CA 3KQGA 2ZFCA 2O01H 4PQ9A 3VKLA 4FCAA 4OHVA 1LEMA 2B46X 4Y20A 5ACA2 5C9AA 3RK2C 1HGVA 1R093 1X50A 3LIDA 1S55A 2O8QA 4LHKA 3ZPYA 2WA4A 5FLHA 5C4WB 3VMYA 1KRIA 1V9U3 3KT1A 1R1A3 1JY2N 1M1JA 1Z78A 2AZ5A 5CFDC 2JENA