4UB6E

Native structure of photosystem ii (dataset-1) by a femtosecond x-ray laser
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
b'TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 21
structure length 81
sequence length 81
chains with identical sequence e
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 4ub6E00
5KAIE 5GTHE 3A0HE 2AXTE 5B66E 4PJ0E 4UB8E 1S5LE 3A0BE 4UB6E 3WU2E 5KAFE 5B5EE 3JCUE 5E79E 5H2FE 4IL6E 1W5CE 5GTIE 5TISE 3KZIE
chains in the Genus database with same CATH superfamily
1JUNA 3OA7A 1VQ8P 1FOSF 1NAFA 1FZAA 2FYNB 3CC7P 1VQ6P 5KLVG 2K9YA 3AEAC 1KB9E 1KZUB 1GU5A 5B5EH 2KK7A 2P10A 2Z5HA 3CXHE 5E79H 1JY2O 2B87A 1SQVJ 1KILC 3H1KE 2KLVA 5APYA 1EDIA 3GLMA 1FAVA 1ZOYC 1Q82Q 4ZMDA 1PL5A 5APTA 5K5GB 1NTKG 3EQ2A 3L74D 3RK3D 4IL6H 3V2PA 1EXIA 1BCCD 1T3UA 1NAYA 1PGOA 3TSIA 2ZXXA 2N9BA 1G1IA 1U7JA 5B66H 1IFJA 2FXPA 1N7SB 3H1LD 2V7QH 3I5CA 3HD7C 4RESB 1L0LD 2Y0EA 2WITA 4W80A 3M9BA 5KLIC 3AE7C 3IFMA 4Z1MH 4JBZA 1AFOA 2K1AA 2FXMA 3L35A 1FZGA 1S5LX 1BCCJ 1SQVE 4N6JA 3Q5RA 3AE5C 4C7NB 4DZOA 2NPSA 4H0LD 1KFNA 3VTPC 3U1CA 3LW5H 2M0BA 1AQTA 4K3AA 1Q2NA 1LWUA 3A2AA 5APSA 3WU2H 4W7ZA 1YTZI 5TISE 1CW5A 1QVGO 3D6ZA 2B88A 2ZT9C 1GTWA 1NTMG 4RJTA 1SFCB 1M7LA 1IK7A 2WT7B 1JTHA 2E76C 2KSJA 4D6TG 1M8OB 3HD7B 2ITAA 2Q3EA 4HH2A 4O9BA 3M9QA 2YIUC 4LLHA 1T6AA 3TYYA 2IFNA 1NYHA 4BRYA 2JKVA 1DX7A 3IR9A 1EDJA 1YTZT 2Q7CA 1Y47A 2K88A 3MP7B 3P7KA 2OYIC 5APQA 3HE5B 1RQUA 1KMIZ 1AVYA 3L74E 3RK3E 1BSHA 1LTJC 1BCCE 4OVNF 1UIIA 5KLVK 3PTZA 3RK2C 1VQKP 1JB0J 1N8RQ 1QVFO 1PPJD 4H44D 3H1LE 3CD6P 1N7LA 2CK3H 2BEQD 2FFDB 3W68A 1GW4A 4L75A 1OVVA 1OZHA 1SQPG 1K8AQ 1DEEG 1L0LE 1NTKK 1JNMA 2XU6A 3CLQA 1X8YA 2K9JA 2P7JA 3G6EP 2JP3A 3AE3C 3FGAD 1JCCA 1USDA 1R5LA 1LT9C 1E5WA 3VMAA 1SQQD 5CCHC 4KT0J 2N1TD 1N73B 2OTLP 3HTKB 1LTJB 2SPZA 1S4XA 1FZCB 1NTZD 2FXOA 1GMJA 2YO2A 1URQC 2HLOA 3VYIA 2E5YA 2AEMA 3CCQP 1J1EB 1HJBA 1LP1B 1PGPA 2E43A 1FJPA 3CWBG 4H44B 2O1KA 3L75J 1ZMEC 3RBZA 2OYOA 2AXTH 3KHUA 2YKOA 5GTIE 2JJLA 1SLQA 2Q6QA 2GA1A 2JR8A 2R3SA 5KLVD 2FYZA 1PPJE 4PJ0H 4DOJA 3GF3A 2IZ0A 3I56P 3AEDC 2YXRB 1S2EA 3Q1MA 1GZLA 3CCUP 1PZQA 2D2CC 1L2PA 4WY4D 2O3JA 1NTKD 3AECC 1G1JA 1VDFA 2PFXA 3BCCG 2A06G 3N4XA 3D6YA 1BDCA 1M1KQ 4NPDA 2WSCH 3AEFC 1SQQE 1AVOA 5B66E 1S1CX 2NPSC 1QX8A 2A45I 5KLVJ 2HYNA 3L73G 2JO1A 4WB4A 1ZV8A 1JO5A 1RQVA 1NTZE 2HFED 2QJKC 5APXA 2IX7C 2GUSA 2GUVA 3B5NB 4R4MA 1R8EA 3M0AA 3O6QA 2KYVA 4IL6X 3GHGB 4K35A 2IZ1A 1NTKJ 2OQQA 1ZR4A 2M5AA 2E42A 2P2UA 1JMBA 2O01N 1OX3A 1D7MA 5H2FH 3TF5A 1K05A 3JSVC 1JY2N 2QG4A 3BRTB 2Y0CA 1OFCX 5AVYB 1YJWP 3C1LA 4WY4B 1NTMD 1A02F 5KAIE 3H6PA 1S72P 1M57D 1LWUB 1M1JB 4D6TD 5KLVE 3V2NA 1QL1A 4QMAA 4LC1A 2WQYC 2PAJA 5APVA 3FXDA 2WSEH 2QJPB 2AEJA 1G2CB 4H13C 4M3LA 3M91A 1NTKE 2WSFH 3JCUE 1ZW0A 3IF4A 1L0LK 2W83C 1AJYA 3PRJA 1JY3P 4W7YA 5BU5A 1GL2B 4Y99C 1VQ9P 4D6TJ 3L70G 1ZN5A 1DD3A 3NMDA 4I7ZC 1M90Q 2WPRA 3M9HA 5APWA 1SQPD 1T2KD 1ZR2A 3KDPB 4OGQB 3A7OA 5CCGC 1N7SD 1SS1A 3CX5H 3CXHI 1NGMB 1QEXA 1GK4A 3F5HA 5KKZB 3VN0A 1FDIA 3KQGA 2FYUG 3B71A 4PD4H 3D70A 3E1RA 3KZIH 2QM7A 1YITP 3H1HG 4A7PA 2BCCG 1SQXG 3I55P 1PP9G 3H32A 1NO4A 4XE5B 2N1TA 4I1LA 4D6TE 1H0TA 1PFIA 3USSA 1HJ0A 1SFCD 3R4YA 1Q90D 3CWBD 3N7NA 2OTKE 3CC4P 2Q3IA 2C0WA 2ZFCA 3HD7D 4WVZA 2AXTE 1LNQA 1S5LE 2O01J 1PGQA 2XKMA 2JWAA 1HF9A 4UB6H 4JF7A 1K04A 1SQBG 3MZWB 1KC8Q 1VL2A 3T97A 1FE6A 3MIWA 1X9VA 3L72G 3A0BE 1XTGB 2HODB 2ZJSE 1SQQK 1SQPE 3FXEA 2FY8A 1DIPA 1T8ZA 2YKPA 1KILB 2QRXA 2WSSH 3L74J 2WPVB 3AEGC 1JEKA 1RF1A 1VQ7P 1KYOD 2ZT9D 2WPQA 1L0NG 5GTHH 1NTZK 3II6A 1DD4A 3BCCD 2A06D 2E76D 1LGHB 4I6MC 2W6BA 1FDOA 2Q1KA 3H1LJ 1KN7A 2K3RA 3NTNA 2XNXA 1LTGC 5CBOA 4EOTA 1NH4A 2BEZF 1SVFA 1L0LJ 1NU1G 3L73D 1BGYG 2HPCB 1MKMA 4I2LC 2KNCA 2QJYC 3HE4B 5M1BA 4L73A 2OYHA 5KAFH 3A5TA 2W6AA 2JEEA 3VOPA 1EQ7A 1TU3F 3CX5D 5KLIB 4H0LC 1N86A 4HYTB 3CCMP 5KJ7D 3RK2D 1KFMA 3OW2O 2FYUK 5CJ4A 3S4RA 1NKNA 2KOGA 3CWBE 2QM8A 1R5SA 1SP4A 3VMXA 1QGKB 4GIFA 3L73J 1SQXK 1FBMA 1KYOI 4UB8H 2ZT9B 1Z56A 2E76B 1KQGB 3TNUB 2E75C 4DCKA 5AW4B 5CCHD 2KS1A 2YIUB 2PRRA 1CI6A 1VQMP 3U1AA 3E1IA 2POHA 1H89A 2PGDA 1OMIA 1L4AA 2IPPA 3CCEP 3PLNA 1PV3A 1EDKA 2OYIB 3VP9A 1URQD 2WPSA 1KYOE 4IOIH 3Q5PA 2J5UA 1MUUA 1S3JA 4ZNCA 3AEEC 1VF5C 3CPWO 3BCCE 3PP5A 1K73Q 1P84H 3QH9A 2KXPB 1ZP0C 3G9RA 3AE8C 3RK2B 4JQ0D 1EDLA 2E74C 2J59M 1FZEA 3L70D 5CCGA 3L73E 1LT1A 1USEA 5AVWB 1IFPA 1OW8A 1FZFA 2Z4EA 3L4FA 3M06A 3ZDMA 5AVZB 3CX5E 1KB9H 1J1DC 2R32A 1SQQJ 2N1TC 1BE3G 5CBNA 1FDMA 1MZ9A 2KB7P 5L8RJ 2W8ZA 1LT9B 4ZKUA 3B5ND 4PV1C 2RKLA 1NTMK 4OWFA 1NTZJ 2FYUD 3RL0C 3D71A 3H1JD 1N7SA 2R5BA 3L70J 1IFDA 2YMKA 1LTBC 3G3ZA 1YYCA 2DW3A 3H1HD 5B5EE 2D2CD 2BCCD 1LTSC 5E79E 1FS0E 1URQB 4GKGA 1N2DC 1SQXD 2WTYA 1UIXA 1WT6A 1PP9D 1ZRTD 3CMAP 3KYQA 2J58A 2H89C 2FBWC 4N3YB 2XZRA 2NZ2A 4C7NA 3TK1A 1OWAA 4IL6E 2XDJA 1PGJA 1LTIC 4KJMA 1QLED 2B87B 2FYUJ 3H1JJ 2O1JA 2IDBA 1VQLP 4PV1B 1RF1C 2L91A 5AVRB 1CSBA 2ZYDA 4UB6E 1SFCA 1HUCA 1SQPK 3GF7A 3RL0B 1DH3A 3G71P 2BCCJ 1OVUA 2WT7A 1J2JB 1SQXJ 2ZAEB 1SQBD 3BATA 3L70E 3L72D 4MN4C 5TISH 3GMAA 1QL2A 2Y9ZA 1GL2D 3V2RA 1GDTA 1IC2A 1IFNA 3T97B 1WRGA 4GOFA 3HE5A 1X79B 2OYHC 3AE4C 2D2CB 4B86A 1IFMA 1VQ4P 3UIAA 5AW2B 3C8VA 2H7HA 4EIJA 2LR2A 3WMM0 3WU2E 2XV5A 4OGQD 3M0DA 1EC5A 2FYUE 1HGVA 3KXDA 3H1JE 2NPSB 3QWOC 2YO3A 1NU1D 1BGYD 4N78D 2FFDA 1LTAC 1Y9BA 1EZVG 3SSUA 3H1HE 2H43A 2QJKB 1VQPP 5EFWB 2UWJE 2BCCE 4U3FG 4YTPC 1HVVA 1KB9D 1SQXE 1PP9E 1ZRTE 4EI2A 2OGUA 3RGUA 5CHXA 1JOCA 1FZBA 3PHLA 2WWWA 1GD2E 1JTHB 1KQLA 5AVSB 2KNCB 3TGUG 4IFDK 1XTCC 3LIEA 1EXJA 2YNYA 2LKMA 3B8EB 2MJZA 5TJHA 2C9NY 4DT0A 1N73A 2Q9IA 4L76A 4BRYB 1L4AC 4TT3H 1FZCA 1NTMJ 1YQ4C 1BGYJ 5KJ7A 3L75G 1X22A 2JDIH 2K37A 2WZ7A 3PJSK 3HRNA 2W27A 2FYNC 4IFMA 1LP1A 4C46A 3LIDA 4GT1A 3L72E 2KZJA 1JY3O 3AE9C 5AVTB 4JYBA 1RY3A 3MTUE 2IBZG 4H13B 2K9JB 4ASVA 1VQOP 2R3CA 4AYCA 3AE1C 3GW6A 5DJTB 1DEBA 3P8MC 2C9LY 1KILD 1MFZA 3SWFA 3SWKA 4GOEA 1HTLC 1WMKA 4L74A 3CCRP 1SQPJ 5AVQB 1JY2P 4Y99B 1N7SC 1NTME 1NU1E 1BGYE 4N78E 4I7ZB 1YI2P 2LXCB 2I1KA 3JC22 1MFTA 5GTIH 3TDKA 3AE2C 1FOSE 1NWQA 3Q5SA 2WSCJ 1RE3A 1GU4A 1PIXA 4BWNA 4AUWA 2W90A 2C0XA 1BE3D 3CMEP 3CCJP 4ZKPA 2QEXP 3A0HH 4EDFA 2MKVA 2QSIA 1Q86Q 1YQ3C 4RKUJ 2HG5D 4WWIA 3HUSA 3W67A 3BRVB 4HJGH 4PJ0E 3B5NA 1W2EA 5AW1B 5AW8B 4KHXA 2NRGA 1SFCC 3GHGA 1Q7YQ 3RK3C 3IAOA 2QA4P 3MGNA 3CWBJ 1Q81Q 3H1IG 3V5BA 3F89A 1BE3J 2OARA 4LGDE 3NXSA 1HGZA 3L71G 3O8ZA 1NKZB 3L36A 2OTJP 4DJGA 4U7JA 1H8AA 4HKZH 4AQRD 2N9YB 3G4SP 4WY4A 2WMMA 2A45H 1KILE 2QVAA 2M3EA 1M1JA 2WSEJ 1LJ2A 3M0DC 3V4QA 2M3BA 2WSFJ 2FFDC 3OAKA 2LXBA 1FU1A 3RK3B 5KAIH 1NOHA 3H1KG 1KQFB 3NFQA 2FKWB 5AW6B 1G2CA 3BCCJ 5H2FE 1ZXGA 2R44A 4NPFX 2Y9YA 4JPZB 4PD4D 1RF0A 1CZQA 3O6QB 2AXCA 3Q2YA 3SWYA 1BE3E 1T3JA 1KTMA 3CCLP 4NPEA 3MHVA 3CL3D 5DJUB 2M5AB 2E75D 3GG2A 1GL2A 3CI9A 3V4WA 3C9IA 4XFJA 2BASA 1N73C 2RN0A 4HB1A 3H25A 3JCUH 1RHZB 3MUDA 2E5TA 2H8PD 2YMYA 1EZVD 1FZCC 2KI7B 2RH0A 5KJ7C 2QJYB 2KUBA 1W2BO 4U3FD 1RE4A 1AA0A 3WUVA 3SFDC 1VF5D 4YXDC 1KORA 1KQSO 4H0LB 2XNDH 2ZVOB 1J1EC 1W5CE 3PH0A 2JWDA 1IK9A 3TGUD 3VP8A 2E74D 1IFIA 5CMZA 3RBXA 1SQVG 3FWLA 3V6IA 3CX5I 4H44C 1SQBK 4R4LA 2A06E 5KTBA 4JYCA 3FWNA 3ABVC 3BVHA 2G8YA 3L75D 5BU8B 4PD4I 1YHQP 4U3FJ 3S1KA 2I1JA 3OJAB 3RL0g 1FC2C 2ZVNB 5C39A 4PV1D 2E75B 2Y0DA 3E7KA 3VMZA 1L0NK 1JCDA 1MV8A 2PP6A 2V4HA 3S9OA 3TGUJ 3RL0D 2ZYGA 1U7MA 3CXHH 3AEBC 3V2QA 3WUUA 1EZVI 2IBZD 2V7QJ 3ITKA 1NU1K 1YBKA 1KV4A 3Q3DA 4PD4E 1RE3C 1IZNB 1S9KD 3KZIE 1VF5B 3L74G 3P8CD 1BCCG 2GM4A 4Y28J 2KSEA 2WVRA 1AQ5A 4EYYQ 1K9MQ 1S5LH 2H88C 3L37A 2E74B 1NHLA 2HODA 3H1LG 3HUSC 4OH8B 1EZVE 3EFGA 1U57A 1KILA 3LW5J 3CCSP 1FJKA 1L0LG 3B5NC 2ZYAA 4U3FE 1BSNA 3P32A 2AEFA 2NPSD 3B4SA 3CCVP 1OVRA 1J1DB 3GHGC 3H32B 3A0BH 2N1TB 1HBWA 3WUTA 3TGUE 1H0TB 2B89A 3A0HE 5APUA 5AW7B 1ZLLA 3EFFK 4GODA 1OW6A 1JY3N 3H1HJ 2I8DA 5AW0B 2HPCA 3VMYA 3FX0A 5BVZA 2IBZI 3HD7A 1PP9J 1IJDB 3HE4A 2ZXEB 2L5GB 3L75E 1Y8AA 2YXQB 1A02J 4WY4C 1GW3A 3K5BA 4BXLA 5AVUB 3HUSB 3KPEA 2M8RA 1LWUC 1M1JC 4YPCA 2O01H 4IFFA 3IN6A 1SQVK 1YJ9P 4C7RA 3H1ID 2IYOA 2KZIA 5GTHE 3AE6C 1L0ND 3L71D 1P84D 2IBZE 4ASWA 2QJPC 5AW5B 4CPGA 3A3YB 2VRSA 3BASA 4WBAA 4GDOA 1SQBJ 1RF1B 1E79H 1S9KE 1RF0C 2P67A 3EWKA 3P8CE 2KIKA 3L72J 1LTTC 2KP8A 2HR3A 5CJ0A 3TNUA 5KAFE 1GL2C 2KLUA 4H13D 2CPBA 1PPJG 3H1IJ 1H88A 3SFEC 3CXHD 5AVVB 1L4AD 3MUDC 1NJIQ 3MD0A 2RMZA 1RH5B 1L0NJ 3L71J 4TLFA 3H1KD 4OGQC 2OYIA 1RE4C 2Z5IA 2OYHB 1OXZA 1OW7A 5KKZC 2G3AA 3HTKA 2P1JA 1LTJA 1JM0A 1KD1Q 1M56D 3R2PA 1NU1J 5AW9B 1HWTC 1SQQG 4UB8E 5CCGD 1GK6A 1KYOH 1IO4A 1BDDA 1P84I 3CC2P 1SQBE 1NTZG 2IYPA 5AW3B 2IFMA 3H1KJ 1AV1A 2B9BA 2QE7H 2Q5UA 2P58A 1LT9A 3H1IE 1X0TA 4RO0A 5CCHA 2QIWA 2KS1B 1KB9I 1SQVD 1CI6B 2A45G 1OIPA 4XA4A 1L0NE 3L71E 2W6JH 1HH0A 1P84E 2CPSA 1L4AB 1VQNP 1YIJP 2YKQA 5AVXB 1T2KC 1JMMA 1VQ5P 1YJNP 1VPCA 4YXWH 3U59A 2R5DA 1URQA 1NVOA 3H1JG
chains in the Genus database with same CATH topology
5KAIE 5GTHE 3A0HE 2AXTE 5B66E 4PJ0E 4UB8E 1S5LE 3A0BE 4UB6E 3WU2E 5KAFE 5B5EE 3JCUE 5E79E 5H2FE 4IL6E 1W5CE 5GTIE 5TISE 3KZIE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAI E;  5GTH E;  3A0H E;  2AXT E;  5B66 E;  4PJ0 E;  4UB8 E;  1S5L E;  3A0B E;  4UB6 E;  3WU2 E;  5KAF E;  5B5E E;  3JCU E;  5E79 E;  5H2F E;  4IL6 E;  1W5C E;  5GTI E;  5TIS E;  3KZI E; 
#chains in the Genus database with same CATH topology
 1JUN A;  3OA7 A;  1VQ8 P;  1FOS F;  1NAF A;  1FZA A;  2FYN B;  3CC7 P;  1VQ6 P;  5KLV G;  2K9Y A;  3AEA C;  1KB9 E;  1KZU B;  1GU5 A;  5B5E H;  2KK7 A;  2P10 A;  2Z5H A;  3CXH E;  5E79 H;  1JY2 O;  2B87 A;  1SQV J;  1KIL C;  3H1K E;  2KLV A;  5APY A;  1EDI A;  3GLM A;  1FAV A;  1ZOY C;  1Q82 Q;  4ZMD A;  1PL5 A;  5APT A;  5K5G B;  1NTK G;  3EQ2 A;  3L74 D;  3RK3 D;  4IL6 H;  3V2P A;  1EXI A;  1BCC D;  1T3U A;  1NAY A;  1PGO A;  3TSI A;  2ZXX A;  2N9B A;  1G1I A;  1U7J A;  5B66 H;  1IFJ A;  2FXP A;  1N7S B;  3H1L D;  2V7Q H;  3I5C A;  3HD7 C;  4RES B;  1L0L D;  2Y0E A;  2WIT A;  4W80 A;  3M9B A;  5KLI C;  3AE7 C;  3IFM A;  4Z1M H;  4JBZ A;  1AFO A;  2K1A A;  2FXM A;  3L35 A;  1FZG A;  1S5L X;  1BCC J;  1SQV E;  4N6J A;  3Q5R A;  3AE5 C;  4C7N B;  4DZO A;  2NPS A;  4H0L D;  1KFN A;  3VTP C;  3U1C A;  3LW5 H;  2M0B A;  1AQT A;  4K3A A;  1Q2N A;  1LWU A;  3A2A A;  5APS A;  3WU2 H;  4W7Z A;  1YTZ I;  5TIS E;  1CW5 A;  1QVG O;  3D6Z A;  2B88 A;  2ZT9 C;  1GTW A;  1NTM G;  4RJT A;  1SFC B;  1M7L A;  1IK7 A;  2WT7 B;  1JTH A;  2E76 C;  2KSJ A;  4D6T G;  1M8O B;  3HD7 B;  2ITA A;  2Q3E A;  4HH2 A;  4O9B A;  3M9Q A;  2YIU C;  4LLH A;  1T6A A;  3TYY A;  2IFN A;  1NYH A;  4BRY A;  2JKV A;  1DX7 A;  3IR9 A;  1EDJ A;  1YTZ T;  2Q7C A;  1Y47 A;  2K88 A;  3MP7 B;  3P7K A;  2OYI C;  5APQ A;  3HE5 B;  1RQU A;  1KMI Z;  1AVY A;  3L74 E;  3RK3 E;  1BSH A;  1LTJ C;  1BCC E;  4OVN F;  1UII A;  5KLV K;  3PTZ A;  3RK2 C;  1VQK P;  1JB0 J;  1N8R Q;  1QVF O;  1PPJ D;  4H44 D;  3H1L E;  3CD6 P;  1N7L A;  2CK3 H;  2BEQ D;  2FFD B;  3W68 A;  1GW4 A;  4L75 A;  1OVV A;  1OZH A;  1SQP G;  1K8A Q;  1DEE G;  1L0L E;  1NTK K;  1JNM A;  2XU6 A;  3CLQ A;  1X8Y A;  2K9J A;  2P7J A;  3G6E P;  2JP3 A;  3AE3 C;  3FGA D;  1JCC A;  1USD A;  1R5L A;  1LT9 C;  1E5W A;  3VMA A;  1SQQ D;  5CCH C;  4KT0 J;  2N1T D;  1N73 B;  2OTL P;  3HTK B;  1LTJ B;  2SPZ A;  1S4X A;  1FZC B;  1NTZ D;  2FXO A;  1GMJ A;  2YO2 A;  1URQ C;  2HLO A;  3VYI A;  2E5Y A;  2AEM A;  3CCQ P;  1J1E B;  1HJB A;  1LP1 B;  1PGP A;  2E43 A;  1FJP A;  3CWB G;  4H44 B;  2O1K A;  3L75 J;  1ZME C;  3RBZ A;  2OYO A;  2AXT H;  3KHU A;  2YKO A;  5GTI E;  2JJL A;  1SLQ A;  2Q6Q A;  2GA1 A;  2JR8 A;  2R3S A;  5KLV D;  2FYZ A;  1PPJ E;  4PJ0 H;  4DOJ A;  3GF3 A;  2IZ0 A;  3I56 P;  3AED C;  2YXR B;  1S2E A;  3Q1M A;  1GZL A;  3CCU P;  1PZQ A;  2D2C C;  1L2P A;  4WY4 D;  2O3J A;  1NTK D;  3AEC C;  1G1J A;  1VDF A;  2PFX A;  3BCC G;  2A06 G;  3N4X A;  3D6Y A;  1BDC A;  1M1K Q;  4NPD A;  2WSC H;  3AEF C;  1SQQ E;  1AVO A;  5B66 E;  1S1C X;  2NPS C;  1QX8 A;  2A45 I;  5KLV J;  2HYN A;  3L73 G;  2JO1 A;  4WB4 A;  1ZV8 A;  1JO5 A;  1RQV A;  1NTZ E;  2HFE D;  2QJK C;  5APX A;  2IX7 C;  2GUS A;  2GUV A;  3B5N B;  4R4M A;  1R8E A;  3M0A A;  3O6Q A;  2KYV A;  4IL6 X;  3GHG B;  4K35 A;  2IZ1 A;  1NTK J;  2OQQ A;  1ZR4 A;  2M5A A;  2E42 A;  2P2U A;  1JMB A;  2O01 N;  1OX3 A;  1D7M A;  5H2F H;  3TF5 A;  1K05 A;  3JSV C;  1JY2 N;  2QG4 A;  3BRT B;  2Y0C A;  1OFC X;  5AVY B;  1YJW P;  3C1L A;  4WY4 B;  1NTM D;  1A02 F;  5KAI E;  3H6P A;  1S72 P;  1M57 D;  1LWU B;  1M1J B;  4D6T D;  5KLV E;  3V2N A;  1QL1 A;  4QMA A;  4LC1 A;  2WQY C;  2PAJ A;  5APV A;  3FXD A;  2WSE H;  2QJP B;  2AEJ A;  1G2C B;  4H13 C;  4M3L A;  3M91 A;  1NTK E;  2WSF H;  3JCU E;  1ZW0 A;  3IF4 A;  1L0L K;  2W83 C;  1AJY A;  3PRJ A;  1JY3 P;  4W7Y A;  5BU5 A;  1GL2 B;  4Y99 C;  1VQ9 P;  4D6T J;  3L70 G;  1ZN5 A;  1DD3 A;  3NMD A;  4I7Z C;  1M90 Q;  2WPR A;  3M9H A;  5APW A;  1SQP D;  1T2K D;  1ZR2 A;  3KDP B;  4OGQ B;  3A7O A;  5CCG C;  1N7S D;  1SS1 A;  3CX5 H;  3CXH I;  1NGM B;  1QEX A;  1GK4 A;  3F5H A;  5KKZ B;  3VN0 A;  1FDI A;  3KQG A;  2FYU G;  3B71 A;  4PD4 H;  3D70 A;  3E1R A;  3KZI H;  2QM7 A;  1YIT P;  3H1H G;  4A7P A;  2BCC G;  1SQX G;  3I55 P;  1PP9 G;  3H32 A;  1NO4 A;  4XE5 B;  2N1T A;  4I1L A;  4D6T E;  1H0T A;  1PFI A;  3USS A;  1HJ0 A;  1SFC D;  3R4Y A;  1Q90 D;  3CWB D;  3N7N A;  2OTK E;  3CC4 P;  2Q3I A;  2C0W A;  2ZFC A;  3HD7 D;  4WVZ A;  2AXT E;  1LNQ A;  1S5L E;  2O01 J;  1PGQ A;  2XKM A;  2JWA A;  1HF9 A;  4UB6 H;  4JF7 A;  1K04 A;  1SQB G;  3MZW B;  1KC8 Q;  1VL2 A;  3T97 A;  1FE6 A;  3MIW A;  1X9V A;  3L72 G;  3A0B E;  1XTG B;  2HOD B;  2ZJS E;  1SQQ K;  1SQP E;  3FXE A;  2FY8 A;  1DIP A;  1T8Z A;  2YKP A;  1KIL B;  2QRX A;  2WSS H;  3L74 J;  2WPV B;  3AEG C;  1JEK A;  1RF1 A;  1VQ7 P;  1KYO D;  2ZT9 D;  2WPQ A;  1L0N G;  5GTH H;  1NTZ K;  3II6 A;  1DD4 A;  3BCC D;  2A06 D;  2E76 D;  1LGH B;  4I6M C;  2W6B A;  1FDO A;  2Q1K A;  3H1L J;  1KN7 A;  2K3R A;  3NTN A;  2XNX A;  1LTG C;  5CBO A;  4EOT A;  1NH4 A;  2BEZ F;  1SVF A;  1L0L J;  1NU1 G;  3L73 D;  1BGY G;  2HPC B;  1MKM A;  4I2L C;  2KNC A;  2QJY C;  3HE4 B;  5M1B A;  4L73 A;  2OYH A;  5KAF H;  3A5T A;  2W6A A;  2JEE A;  3VOP A;  1EQ7 A;  1TU3 F;  3CX5 D;  5KLI B;  4H0L C;  1N86 A;  4HYT B;  3CCM P;  5KJ7 D;  3RK2 D;  1KFM A;  3OW2 O;  2FYU K;  5CJ4 A;  3S4R A;  1NKN A;  2KOG A;  3CWB E;  2QM8 A;  1R5S A;  1SP4 A;  3VMX A;  1QGK B;  4GIF A;  3L73 J;  1SQX K;  1FBM A;  1KYO I;  4UB8 H;  2ZT9 B;  1Z56 A;  2E76 B;  1KQG B;  3TNU B;  2E75 C;  4DCK A;  5AW4 B;  5CCH D;  2KS1 A;  2YIU B;  2PRR A;  1CI6 A;  1VQM P;  3U1A A;  3E1I A;  2POH A;  1H89 A;  2PGD A;  1OMI A;  1L4A A;  2IPP A;  3CCE P;  3PLN A;  1PV3 A;  1EDK A;  2OYI B;  3VP9 A;  1URQ D;  2WPS A;  1KYO E;  4IOI H;  3Q5P A;  2J5U A;  1MUU A;  1S3J A;  4ZNC A;  3AEE C;  1VF5 C;  3CPW O;  3BCC E;  3PP5 A;  1K73 Q;  1P84 H;  3QH9 A;  2KXP B;  1ZP0 C;  3G9R A;  3AE8 C;  3RK2 B;  4JQ0 D;  1EDL A;  2E74 C;  2J59 M;  1FZE A;  3L70 D;  5CCG A;  3L73 E;  1LT1 A;  1USE A;  5AVW B;  1IFP A;  1OW8 A;  1FZF A;  2Z4E A;  3L4F A;  3M06 A;  3ZDM A;  5AVZ B;  3CX5 E;  1KB9 H;  1J1D C;  2R32 A;  1SQQ J;  2N1T C;  1BE3 G;  5CBN A;  1FDM A;  1MZ9 A;  2KB7 P;  5L8R J;  2W8Z A;  1LT9 B;  4ZKU A;  3B5N D;  4PV1 C;  2RKL A;  1NTM K;  4OWF A;  1NTZ J;  2FYU D;  3RL0 C;  3D71 A;  3H1J D;  1N7S A;  2R5B A;  3L70 J;  1IFD A;  2YMK A;  1LTB C;  3G3Z A;  1YYC A;  2DW3 A;  3H1H D;  5B5E E;  2D2C D;  2BCC D;  1LTS C;  5E79 E;  1FS0 E;  1URQ B;  4GKG A;  1N2D C;  1SQX D;  2WTY A;  1UIX A;  1WT6 A;  1PP9 D;  1ZRT D;  3CMA P;  3KYQ A;  2J58 A;  2H89 C;  2FBW C;  4N3Y B;  2XZR A;  2NZ2 A;  4C7N A;  3TK1 A;  1OWA A;  4IL6 E;  2XDJ A;  1PGJ A;  1LTI C;  4KJM A;  1QLE D;  2B87 B;  2FYU J;  3H1J J;  2O1J A;  2IDB A;  1VQL P;  4PV1 B;  1RF1 C;  2L91 A;  5AVR B;  1CSB A;  2ZYD A;  4UB6 E;  1SFC A;  1HUC A;  1SQP K;  3GF7 A;  3RL0 B;  1DH3 A;  3G71 P;  2BCC J;  1OVU A;  2WT7 A;  1J2J B;  1SQX J;  2ZAE B;  1SQB D;  3BAT A;  3L70 E;  3L72 D;  4MN4 C;  5TIS H;  3GMA A;  1QL2 A;  2Y9Z A;  1GL2 D;  3V2R A;  1GDT A;  1IC2 A;  1IFN A;  3T97 B;  1WRG A;  4GOF A;  3HE5 A;  1X79 B;  2OYH C;  3AE4 C;  2D2C B;  4B86 A;  1IFM A;  1VQ4 P;  3UIA A;  5AW2 B;  3C8V A;  2H7H A;  4EIJ A;  2LR2 A;  3WMM 0;  3WU2 E;  2XV5 A;  4OGQ D;  3M0D A;  1EC5 A;  2FYU E;  1HGV A;  3KXD A;  3H1J E;  2NPS B;  3QWO C;  2YO3 A;  1NU1 D;  1BGY D;  4N78 D;  2FFD A;  1LTA C;  1Y9B A;  1EZV G;  3SSU A;  3H1H E;  2H43 A;  2QJK B;  1VQP P;  5EFW B;  2UWJ E;  2BCC E;  4U3F G;  4YTP C;  1HVV A;  1KB9 D;  1SQX E;  1PP9 E;  1ZRT E;  4EI2 A;  2OGU A;  3RGU A;  5CHX A;  1JOC A;  1FZB A;  3PHL A;  2WWW A;  1GD2 E;  1JTH B;  1KQL A;  5AVS B;  2KNC B;  3TGU G;  4IFD K;  1XTC C;  3LIE A;  1EXJ A;  2YNY A;  2LKM A;  3B8E B;  2MJZ A;  5TJH A;  2C9N Y;  4DT0 A;  1N73 A;  2Q9I A;  4L76 A;  4BRY B;  1L4A C;  4TT3 H;  1FZC A;  1NTM J;  1YQ4 C;  1BGY J;  5KJ7 A;  3L75 G;  1X22 A;  2JDI H;  2K37 A;  2WZ7 A;  3PJS K;  3HRN A;  2W27 A;  2FYN C;  4IFM A;  1LP1 A;  4C46 A;  3LID A;  4GT1 A;  3L72 E;  2KZJ A;  1JY3 O;  3AE9 C;  5AVT B;  4JYB A;  1RY3 A;  3MTU E;  2IBZ G;  4H13 B;  2K9J B;  4ASV A;  1VQO P;  2R3C A;  4AYC A;  3AE1 C;  3GW6 A;  5DJT B;  1DEB A;  3P8M C;  2C9L Y;  1KIL D;  1MFZ A;  3SWF A;  3SWK A;  4GOE A;  1HTL C;  1WMK A;  4L74 A;  3CCR P;  1SQP J;  5AVQ B;  1JY2 P;  4Y99 B;  1N7S C;  1NTM E;  1NU1 E;  1BGY E;  4N78 E;  4I7Z B;  1YI2 P;  2LXC B;  2I1K A;  3JC2 2;  1MFT A;  5GTI H;  3TDK A;  3AE2 C;  1FOS E;  1NWQ A;  3Q5S A;  2WSC J;  1RE3 A;  1GU4 A;  1PIX A;  4BWN A;  4AUW A;  2W90 A;  2C0X A;  1BE3 D;  3CME P;  3CCJ P;  4ZKP A;  2QEX P;  3A0H H;  4EDF A;  2MKV A;  2QSI A;  1Q86 Q;  1YQ3 C;  4RKU J;  2HG5 D;  4WWI A;  3HUS A;  3W67 A;  3BRV B;  4HJG H;  4PJ0 E;  3B5N A;  1W2E A;  5AW1 B;  5AW8 B;  4KHX A;  2NRG A;  1SFC C;  3GHG A;  1Q7Y Q;  3RK3 C;  3IAO A;  2QA4 P;  3MGN A;  3CWB J;  1Q81 Q;  3H1I G;  3V5B A;  3F89 A;  1BE3 J;  2OAR A;  4LGD E;  3NXS A;  1HGZ A;  3L71 G;  3O8Z A;  1NKZ B;  3L36 A;  2OTJ P;  4DJG A;  4U7J A;  1H8A A;  4HKZ H;  4AQR D;  2N9Y B;  3G4S P;  4WY4 A;  2WMM A;  2A45 H;  1KIL E;  2QVA A;  2M3E A;  1M1J A;  2WSE J;  1LJ2 A;  3M0D C;  3V4Q A;  2M3B A;  2WSF J;  2FFD C;  3OAK A;  2LXB A;  1FU1 A;  3RK3 B;  5KAI H;  1NOH A;  3H1K G;  1KQF B;  3NFQ A;  2FKW B;  5AW6 B;  1G2C A;  3BCC J;  5H2F E;  1ZXG A;  2R44 A;  4NPF X;  2Y9Y A;  4JPZ B;  4PD4 D;  1RF0 A;  1CZQ A;  3O6Q B;  2AXC A;  3Q2Y A;  3SWY A;  1BE3 E;  1T3J A;  1KTM A;  3CCL P;  4NPE A;  3MHV A;  3CL3 D;  5DJU B;  2M5A B;  2E75 D;  3GG2 A;  1GL2 A;  3CI9 A;  3V4W A;  3C9I A;  4XFJ A;  2BAS A;  1N73 C;  2RN0 A;  4HB1 A;  3H25 A;  3JCU H;  1RHZ B;  3MUD A;  2E5T A;  2H8P D;  2YMY A;  1EZV D;  1FZC C;  2KI7 B;  2RH0 A;  5KJ7 C;  2QJY B;  2KUB A;  1W2B O;  4U3F D;  1RE4 A;  1AA0 A;  3WUV A;  3SFD C;  1VF5 D;  4YXD C;  1KOR A;  1KQS O;  4H0L B;  2XND H;  2ZVO B;  1J1E C;  1W5C E;  3PH0 A;  2JWD A;  1IK9 A;  3TGU D;  3VP8 A;  2E74 D;  1IFI A;  5CMZ A;  3RBX A;  1SQV G;  3FWL A;  3V6I A;  3CX5 I;  4H44 C;  1SQB K;  4R4L A;  2A06 E;  5KTB A;  4JYC A;  3FWN A;  3ABV C;  3BVH A;  2G8Y A;  3L75 D;  5BU8 B;  4PD4 I;  1YHQ P;  4U3F J;  3S1K A;  2I1J A;  3OJA B;  3RL0 g;  1FC2 C;  2ZVN B;  5C39 A;  4PV1 D;  2E75 B;  2Y0D A;  3E7K A;  3VMZ A;  1L0N K;  1JCD A;  1MV8 A;  2PP6 A;  2V4H A;  3S9O A;  3TGU J;  3RL0 D;  2ZYG A;  1U7M A;  3CXH H;  3AEB C;  3V2Q A;  3WUU A;  1EZV I;  2IBZ D;  2V7Q J;  3ITK A;  1NU1 K;  1YBK A;  1KV4 A;  3Q3D A;  4PD4 E;  1RE3 C;  1IZN B;  1S9K D;  3KZI E;  1VF5 B;  3L74 G;  3P8C D;  1BCC G;  2GM4 A;  4Y28 J;  2KSE A;  2WVR A;  1AQ5 A;  4EYY Q;  1K9M Q;  1S5L H;  2H88 C;  3L37 A;  2E74 B;  1NHL A;  2HOD A;  3H1L G;  3HUS C;  4OH8 B;  1EZV E;  3EFG A;  1U57 A;  1KIL A;  3LW5 J;  3CCS P;  1FJK A;  1L0L G;  3B5N C;  2ZYA A;  4U3F E;  1BSN A;  3P32 A;  2AEF A;  2NPS D;  3B4S A;  3CCV P;  1OVR A;  1J1D B;  3GHG C;  3H32 B;  3A0B H;  2N1T B;  1HBW A;  3WUT A;  3TGU E;  1H0T B;  2B89 A;  3A0H E;  5APU A;  5AW7 B;  1ZLL A;  3EFF K;  4GOD A;  1OW6 A;  1JY3 N;  3H1H J;  2I8D A;  5AW0 B;  2HPC A;  3VMY A;  3FX0 A;  5BVZ A;  2IBZ I;  3HD7 A;  1PP9 J;  1IJD B;  3HE4 A;  2ZXE B;  2L5G B;  3L75 E;  1Y8A A;  2YXQ B;  1A02 J;  4WY4 C;  1GW3 A;  3K5B A;  4BXL A;  5AVU B;  3HUS B;  3KPE A;  2M8R A;  1LWU C;  1M1J C;  4YPC A;  2O01 H;  4IFF A;  3IN6 A;  1SQV K;  1YJ9 P;  4C7R A;  3H1I D;  2IYO A;  2KZI A;  5GTH E;  3AE6 C;  1L0N D;  3L71 D;  1P84 D;  2IBZ E;  4ASW A;  2QJP C;  5AW5 B;  4CPG A;  3A3Y B;  2VRS A;  3BAS A;  4WBA A;  4GDO A;  1SQB J;  1RF1 B;  1E79 H;  1S9K E;  1RF0 C;  2P67 A;  3EWK A;  3P8C E;  2KIK A;  3L72 J;  1LTT C;  2KP8 A;  2HR3 A;  5CJ0 A;  3TNU A;  5KAF E;  1GL2 C;  2KLU A;  4H13 D;  2CPB A;  1PPJ G;  3H1I J;  1H88 A;  3SFE C;  3CXH D;  5AVV B;  1L4A D;  3MUD C;  1NJI Q;  3MD0 A;  2RMZ A;  1RH5 B;  1L0N J;  3L71 J;  4TLF A;  3H1K D;  4OGQ C;  2OYI A;  1RE4 C;  2Z5I A;  2OYH B;  1OXZ A;  1OW7 A;  5KKZ C;  2G3A A;  3HTK A;  2P1J A;  1LTJ A;  1JM0 A;  1KD1 Q;  1M56 D;  3R2P A;  1NU1 J;  5AW9 B;  1HWT C;  1SQQ G;  4UB8 E;  5CCG D;  1GK6 A;  1KYO H;  1IO4 A;  1BDD A;  1P84 I;  3CC2 P;  1SQB E;  1NTZ G;  2IYP A;  5AW3 B;  2IFM A;  3H1K J;  1AV1 A;  2B9B A;  2QE7 H;  2Q5U A;  2P58 A;  1LT9 A;  3H1I E;  1X0T A;  4RO0 A;  5CCH A;  2QIW A;  2KS1 B;  1KB9 I;  1SQV D;  1CI6 B;  2A45 G;  1OIP A;  4XA4 A;  1L0N E;  3L71 E;  2W6J H;  1HH0 A;  1P84 E;  2CPS A;  1L4A B;  1VQN P;  1YIJ P;  2YKQ A;  5AVX B;  1T2K C;  1JMM A;  1VQ5 P;  1YJN P;  1VPC A;  4YXW H;  3U59 A;  2R5D A;  1URQ A;  1NVO A;  3H1J G; 
#chains in the Genus database with same CATH homology
 5KAI E;  5GTH E;  3A0H E;  2AXT E;  5B66 E;  4PJ0 E;  4UB8 E;  1S5L E;  3A0B E;  4UB6 E;  3WU2 E;  5KAF E;  5B5E E;  3JCU E;  5E79 E;  5H2F E;  4IL6 E;  1W5C E;  5GTI E;  5TIS E;  3KZI E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...