4UB6E

Native structure of photosystem ii (dataset-1) by a femtosecond x-ray laser
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem Q(B) protein
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
total genus 21
structure length 81
sequence length 81
chains with identical sequence e
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 4ub6E00
3KZIE 3A0HE 5KAIE 1W5CE 5KAFE 4PJ0E 5B5EE 1S5LE 4IL6E 4UB6E 2AXTE 5TISE 5B66E 5GTHE 3JCUE 3A0BE 5H2FE 3WU2E 5GTIE 4UB8E 5E79E
chains in the Genus database with same CATH superfamily
5B5EH 4OVNF 1OVRA 1QL1A 5AVQB 3RK2C 2KP8A 1SQQG 2KSJA 3A2AA 3KYQA 1L0LG 1J1DB 1AV1A 1L0NE 2MKVA 2KLVA 3GG2A 4OGQC 1FZCC 1SS1A 1HBWA 4HJGH 2V4HA 2E75D 1UIXA 2Y0EA 1SFCD 3E1IA 1GK6A 4A7PA 5APXA 2FYNB 3L37A 1X0TA 3RGUA 1URQA 1N7LA 2NPSD 3AEDC 4K3AA 1HTLC 3CCMP 3A0BE 3BATA 1ZXGA 1SQXK 1KORA 1GL2A 1DEBA 4C46A 1GD2E 1N8RQ 1W5CE 1GU5A 2WSEJ 5CCGC 2OTJP 2PAJA 4KT0J 4EYYQ 2CPBA 1NKNA 2XZRA 2JKVA 1EDKA 3GF7A 3D70A 5APUA 3M9HA 1GK4A 4D6TG 4YTPC 3I5CA 2WT7B 2H43A 1L4AB 2I8DA 3BRVB 2WITA 2WPRA 4UB8H 5E79H 1BGYJ 3KZIH 3GF3A 2C0XA 1URQD 4NPFX 3LIEA 5AW5B 1X22A 2P67A 3AE8C 2W90A 1VPCA 4MN4C 1GL2D 4AQRD 3RK2B 2KI7B 4GODA 4HB1A 3KDPB 5CCHA 3CX5E 3H1LD 5APVA 1S5LH 1NTKE 4EIJA 1HVVA 3V4QA 1IFPA 1L0NJ 2K37A 4C7NA 5KKZB 1JUNA 3M0DC 3TGUJ 2K9JB 3MUDC 1LTAC 3JCUE 2OYHA 3R2PA 3H1IJ 1KILA 1XTCC 1KN7A 1SQBD 3QH9A 4HKZH 1N86A 1SQXD 2AEMA 2NRGA 3WMM0 3GLMA 1KTMA 1NU1K 3OAKA 1T8ZA 2V7QJ 2OYIA 1LJ2A 2N9YB 1QVGO 1EXJA 1X79B 4ZKPA 5CMZA 1BCCD 1SQBG 5KAFH 3GW6A 3CX5I 5DJUB 1SQXG 3CC7P 2R5DA 3QWOC 5APTA 3P8CD 5CCHD 3KXDA 3E1RA 5GTHH 2E76C 1Y8AA 2B89A 1BCCG 2CPSA 3SWFA 2PRRA 3G71P 2E74C 3IN6A 1SQQE 3B8EB 1OW8A 4R4MA 3CL3D 3USSA 3AE7C 2QEXP 2AXTH 1IK9A 1ZLLA 2C9NY 1HGZA 2KK7A 1SQPK 2Z4EA 3I56P 1NAFA 5H2FE 3CMAP 3SWKA 2FYUJ 1NTMK 3OA7A 3CCQP 1FDMA 5KAIE 5KLIC 2M0BA 3CCRP 3Q5PA 1H0TB 3FX0A 1J1EB 3L73J 4N6JA 2KXPB 1ZR4A 2ZYDA 1JO5A 3B71A 1RE4C 1M56D 2QIWA 1LWUB 3H1KG 1T2KD 2HR3A 4CPGA 2J58A 1RQVA 1MUUA 3V2NA 1FDIA 3PJSK 4I7ZB 1Q7YQ 3H32A 1MV8A 1KB9H 3FWLA 2LR2A 2GUSA 1YQ4C 3HD7C 4YXDC 2N1TD 1FZFA 1FAVA 4K35A 1JY3N 3T97A 5CBOA 2XNDH 2QM8A 5CJ0A 3AECC 4IFFA 3H1HJ 1G1JA 2ZT9D 1SLQA 1CZQA 5C39A 2E75B 1SFCB 2NPSB 5APQA 1KYOH 3HUSC 2WSFH 3U1AA 2D2CB 2C9LY 2KUBA 3I55P 5AVUB 4AUWA 3L72D 5M1BA 2K1AA 1PP9J 3CI9A 1SQPD 2FFDC 1AQTA 1VQLP 1VDFA 4N3YB 1JM0A 2R32A 1KC8Q 3C8VA 3RK3D 1NTMD 2KLUA 2ZXEB 1S9KD 1QL2A 1JCDA 2K9JA 3H1LE 1LTSC 4Y99B 3NTNA 1OVUA 2IBZD 1EQ7A 2Y9ZA 1M57D 1GDTA 4WB4A 3OW2O 2QJKC 1NTMG 2BASA 5KLVK 1QEXA 2IFMA 1FZBA 1IFDA 1WRGA 1VQ8P 2O3JA 1Y9BA 1SQXE 1WT6A 3L75D 3CLQA 2JO1A 3RK2D 4KJMA 2Q1KA 4XA4A 3V5BA 1GL2B 2WSCJ 3H1JJ 1BCCE 3CWBJ 2YKOA 3B5NC 2G8YA 4OGQD 3L75G 3PP5A 1JY2P 3P8CE 4ZMDA 4PD4H 1FU1A 2BCCJ 2QVAA 2GUVA 2P7JA 3BCCD 2POHA 3M9BA 1SQQK 1LT1A 4JQ0D 1L0LK 3CXHD 4C7RA 2IYOA 4L74A 1KILE 3AEEC 1S4XA 3MIWA 5CCGD 3BCCG 2IYPA 4H0LC 1RF1C 1ZN5A 3SWYA 4L75A 1H0TA 1G2CB 2IZ1A 2MJZA 4LGDE 5AW8B 1LWUA 3RL0C 2E43A 3D6YA 3M0DA 3ZDMA 3MUDA 1YIJP 4WBAA 3RBZA 3V4WA 3H1LJ 5KLVD 2RN0A 2HG5D 1PGQA 1KQSO 2R44A 1Q81Q 2IZ0A 1LT9C 1J2JB 4LC1A 4U3FD 3HE4A 1VQ5P 3BVHA 4Y28J 3TNUA 3F89A 1NTZD 1Q82Q 1MZ9A 1HGVA 5KLVG 4PJ0E 5APYA 1VQ9P 1YTZI 4H13C 1N73B 1EDLA 4U3FG 1SFCA 1VQOP 3S9OA 1NTZG 3G3ZA 1JY3O 1M1JC 1QX8A 2NPSA 4R4LA 3L74D 1NAYA 1AA0A 2Y9YA 2ZVNB 3FXDA 1L0LD 1RF0C 1OMIA 1T6AA 1SQVJ 4GOFA 5GTIE 3L72E 3MP7B 5APSA 3L74G 3O8ZA 3MZWB 1SQPE 4ASWA 1FZAA 4RJTA 2N1TB 3AE1C 1NTME 1AVOA 1YJNP 3P32A 1S9KE 3BRTB 4EDFA 2E76D 1RE4A 2ZT9B 2IBZE 3V2PA 3RL0B 3D71A 2O1KA 2E74D 2WZ7A 3SSUA 3W67A 2BEZF 2D2CD 1YITP 4I1LA 2YIUC 1SQBK 4HH2A 3HD7A 2P2UA 1VF5C 3TK1A 3L75E 1S1CX 2V7QH 2P58A 5KTBA 4D6TD 3H32B 3A0BH 1Q86Q 2FBWC 3L36A 1RQUA 1NU1J 3B4SA 3RK3B 3T97B 3Q5SA 4JYCA 2IBZI 2KNCB 1NJIQ 1JEKA 4LLHA 1HF9A 3BCCE 2IFNA 2OARA 1Q2NA 1PIXA 1S2EA 2HODA 3CXHE 1P84D 2JP3A 2YKPA 1KYOD 2Q6QA 1BE3J 3L71D 3HD7D 1KQGB 1G2CA 1R8EA 4EI2A 1M7LA 4W7ZA 1N7SC 2I1JA 2W6AA 3CPWO 3L70D 3V2QA 2AXCA 3CCSP 3VOPA 3L72J 1NVOA 4DCKA 4RO0A 4XE5B 2XV5A 1SQPJ 1VQKP 1ZOYC 3L71G 3PHLA 4OGQB 1FZCB 4BRYB 1E5WA 3H25A 1S5LE 4IL6E 1FOSE 3MTUE 3WUTA 3CX5H 1K8AQ 3L70G 2DW3A 5KLVE 3MGNA 3E7KA 3CXHI 2OTKE 3HE5B 2YIUB 4U3FE 3CCUP 1G1IA 3G9RA 1N73A 1DH3A 4PV1C 5TJHA 5AVRB 3KHUA 3N7NA 1FZEA 1PZQA 3AE6C 4JF7A 1EC5A 2B9BA 2R5BA 2A45G 2XDJA 3L74E 1LTGC 3NFQA 4M3LA 4WY4C 1MFZA 1L0LE 2FXMA 5KJ7C 1LGHB 2N1TA 2SPZA 2YMKA 2AXTE 4DJGA 2ITAA 3B5ND 3H1KD 4H44C 3JC22 3JSVC 3AEAC 2HPCB 4UB6E 3S4RA 2WPVB 5KAIH 1PV3A 3EFGA 1NTKJ 1PGPA 2ZFCA 3G4SP 1JTHA 5AW0B 2KZJA 3A5TA 4N78D 2ZVOB 2WQYC 1IFIA 4D6TE 4H0LD 2IDBA 2IX7C 2WSCH 5CJ4A 3HE4B 3TNUB 2KNCA 2R3SA 3MD0A 1T3UA 5BVZA 5B66H 2XKMA 4IFDK 1S3JA 2W6BA 4OWFA 1M1JA 4WWIA 2WMMA 3RL0D 1LTTC 2RMZA 1FZGA 2E76B 4ASVA 2IPPA 2HYNA 3WU2E 1RF0A 1MFTA 2E42A 2E74B 2O01N 1BGYD 1ZP0C 4B86A 2KZIA 1NYHA 1P84E 1KYOE 2QG4A 3L71E 1WMKA 1SQQJ 3VP9A 4W7YA 1OFCX 5AW9B 1L0LJ 1Z56A 1DD3A 1FZCA 1KV4A 1BGYG 3L70E 1VQMP 1FJPA 4BRYA 1ZW0A 2FYUK 2H88C 1LTBC 5AVZB 1N2DC 2RKLA 5KLIB 3VMYA 1GTWA 1DEEG 4DZOA 1IZNB 3ABVC 5APWA 2P10A 1FC2C 4W80A 3IAOA 4YPCA 1L0ND 4EOTA 3CD6P 3HE5A 1KFMA 3M91A 3TGUD 4I2LC 1CSBA 3Q5RA 1SQBE 3H1ID 3NXSA 1P84I 1YI2P 2R3CA 1KYOI 3GHGC 3HTKB 5CCGA 3F5HA 2Q5UA 1NTZK 1L0NG 1EDIA 1IFJA 3HD7B 3TGUG 3A0HE 1U7MA 3C1LA 2LKMA 1IK7A 3Q1MA 1NHLA 3EWKA 3H1IG 3CCLP 2OYHC 2PFXA 4D6TJ 1KILC 2E5TA 2KIKA 3LW5J 2GM4A 1FE6A 5BU8B 1M1KQ 2JEEA 2OYIC 2ZYAA 3A3YB 1LTIC 1SP4A 3AE9C 5AVYB 3HUSB 1S5LX 1VF5D 4IL6X 2H7HA 3IR9A 2HODB 2Z5IA 1FJKA 1K73Q 4BWNA 2FFDB 2A45I 1Y47A 2HPCA 2H89C 2FYUD 3H1KE 3P7KA 1X8YA 2L5GB 1JMMA 3M9QA 2FY8A 2JDIH 3L73D 1J1DC 2W83C 3L70J 2E5YA 1NH4A 3TYYA 2AEFA 1M90Q 2FYUG 3RL0g 1H89A 2QJKB 2A06D 5BU5A 3UIAA 3L4FA 2YKQA 2FYNC 1TU3F 3WUUA 3L73G 4N78E 2UWJE 1JY2N 1HUCA 1SQBJ 3M0AA 2A06G 3VYIA 3AEFC 1AJYA 3G6EP 1SQXJ 4XFJA 3B5NB 3H1HD 4AYCA 4PJ0H 2M5AA 1BCCJ 2J59M 1AFOA 5TISH 2NZ2A 5KJ7A 2M3EA 3BASA 3GMAA 1LP1A 1ZRTD 3H1HG 2QRXA 1QVFO 1BGYE 5AVSB 1RHZB 2GA1A 1L4AC 4DT0A 1W2BO 3VN0A 3V2RA 1YJWP 1AQ5A 4HYTB 2JWAA 2KS1B 3V6IA 1PP9D 1YQ3C 3LIDA 5B5EE 3D6ZA 4H0LB 1RF1B 1U57A 2ZAEB 3RK3E 1GU4A 2JJLA 1HH0A 1KQFB 1LTJC 3PLNA 1PP9G 5AW7B 3SFDC 3H1KJ 1KFNA 1FBMA 3HTKA 4WY4D 3TGUE 1HJ0A 2PGDA 3IF4A 1YYCA 1QLED 2YXRB 5KJ7D 1T3JA 3H1IE 5KKZC 1YHQP 2L91A 1A02J 1LT9B 1KB9D 1VQ7P 1JTHB 4ZNCA 1U7JA 3PH0A 3CCEP 3H1JD 3CWBD 4H44D 2KB7P 1VQPP 4H13B 2JWDA 4GDOA 2ZJSE 3MHVA 3CC4P 4GKGA 1HWTC 3NMDA 3O6QB 2QE7H 1IFNA 1W2EA 1M1JB 2WPSA 3H1JG 3CCVP 3HUSA 3CWBG 4ZKUA 1USEA 2BCCD 1OW7A 4UB8E 1VQNP 5E79E 3KZIE 1BDDA 2FFDA 3KPEA 3AE3C 2B88A 2Y0CA 1SQVK 4YXWH 2Q7CA 3CXHH 2BCCG 1YJ9P 3L35A 1GZLA 5DJTB 2FYUE 1EDJA 1FOSF 4L76A 2OGUA 3U59A 1DD4A 1PGOA 1OWAA 1E79H 1LTJB 1EZVD 3L73E 1OX3A 1NTMJ 2OQQA 1J1EC 2FXPA 3GHGA 2A06E 4L73A 3FGAD 4IL6H 1K04A 2OTLP 1JCCA 2VRSA 1EZVG 1RE3C 1LWUC 3AEGC 3JCUH 2YMYA 1VF5B 1OIPA 2K3RA 1IC2A 1NTZE 3B5NA 5AVVB 2KOGA 2KSEA 4I7ZC 2YXQB 3CC2P 3H1LG 3L75J 4TLFA 5AW4B 5KAFE 3ITKA 1K9MQ 1JY2O 1JB0J 3H1HE 2ZXXA 3VMZA 2M8RA 3AE4C 4PD4D 1NKZB 5GTHE 2AEJA 4U7JA 1AVYA 1ZRTE 1EXIA 2E75C 1BDCA 2KS1A 1JY3P 1SFCC 2QJPC 1RF1A 1SQVD 3BCCJ 4I6MC 2WTYA 1KQLA 1MKMA 1R5SA 1YTZT 3FWNA 2NPSC 1PP9E 2BEQD 2D2CC 3WUVA 1N7SB 3AEBC 1KILD 1SQVG 1UIIA 1JOCA 5H2FH 3PTZA 1S72P 1GMJA 1QGKB 4RESB 3HRNA 4GT1A 2WVRA 1L0NK 1NOHA 1LT9A 4Y99C 2N9BA 4UB6H 1PPJD 1KZUB 1M8OB 2P1JA 3VMXA 2PP6A 4KHXA 3KQGA 3N4XA 3VMAA 1LNQA 1RH5B 3CMEP 4RKUJ 1OVVA 4NPDA 1KB9E 5KLVJ 1K05A 2B87B 3EFFK 1PPJG 1ZMEC 2J5UA 1URQC 2YO3A 4PV1B 4U3FJ 2Q3EA 3H1JE 3CWBE 1CI6B 1NO4A 5K5GB 1FDOA 3LW5H 1NTZJ 3O6QA 2WPQA 1NU1D 3IFMA 2K9YA 1GL2C 5B66E 1HJBA 1USDA 3Q3DA 5AW3B 1VQ4P 2WT7A 1Q90D 1PFIA 3H6PA 2M5AB 4DOJA 2BCCE 1L4AA 1NU1G 4WY4B 2LXCB 3M06A 3L74J 3WU2H 1KB9I 2QJPB 1KD1Q 1LP1B 1BE3D 2QJYC 2QA4P 5L8RJ 1P84H 1GW4A 4IFMA 3Q2YA 3FXEA 1JNMA 4H13D 1LTJA 3TSIA 2HLOA 4H44B 1X9VA 2WSSH 5AVTB 1BE3G 3TDKA 1IO4A 4GOEA 1EZVE 1PGJA 2LXBA 3CCJP 5CBNA 3L72G 1XTGB 2I1KA 1NTKK 4GIFA 1SQPG 5CCHC 1L4AD 3AE2C 1PL5A 4JYBA 1IJDB 1D7MA 3SFEC 1FS0E 1OW6A 2QM7A 2FXOA 4WVZA 2KYVA 1URQB 2IBZG 2HFED 3A0HH 2A45H 1EZVI 4PD4E 1N73C 1GW3A 3U1CA 2JR8A 1SVFA 3K5BA 3C9IA 3W68A 2ZYGA 1R5LA 2FYZA 4OH8B 1L2PA 1N7SA 1SQVE 1VL2A 3R4YA 2XU6A 3OJAB 1BSNA 2O01H 1T2KC 2G3AA 2Y0DA 1DX7A 2K88A 2QJYB 4TT3H 2WSFJ 3AE5C 3L71J 3II6A 2OYOA 1KMIZ 2W6JH 1A02F 2N1TC 1OXZA 2Q3IA 5AVXB 1BSHA 2RH0A 3P8MC 4PD4I 3A7OA 3S1KA 2C0WA 1JMBA 4NPEA 3CX5D 2CK3H 1PPJE 1YBKA 2ZT9C 1RE3A 1NTKD 2B87A 3TF5A 4QMAA 1IFMA 4Z1MH 2O1JA 1RY3A 3GHGB 4JBZA 5AW1B 1CI6A 3EQ2A 2Z5HA 4O9BA 1N7SD 2Q9IA 4C7NB 1NTKG 1ZR2A 5CHXA 2OYHB 1NU1E 1VQ6P 1KILB 2W27A 2WSEH 3RBXA 2XNXA 4JPZB 4BXLA 5EFWB 4WY4A 3RK3C 2OYIB 5AW6B 5AW2B 1DIPA 1H8AA 5TISE 1NWQA 3VTPC 2FKWB 1OZHA 1NGMB 4IOIH 1H88A 2H8PD 1BE3E 2O01J 3PRJA 1SQQD 2W8ZA 4PV1D 1CW5A 2QSIA 5GTIH 2YNYA 5AVWB 1ZV8A 3VP8A 2YO2A 2M3BA 2WWWA
chains in the Genus database with same CATH topology
3KZIE 3A0HE 5KAIE 1W5CE 5KAFE 4PJ0E 5B5EE 1S5LE 4IL6E 4UB6E 2AXTE 5TISE 5B66E 5GTHE 3JCUE 3A0BE 5H2FE 3WU2E 5GTIE 4UB8E 5E79E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZI E;  3A0H E;  5KAI E;  1W5C E;  5KAF E;  4PJ0 E;  5B5E E;  1S5L E;  4IL6 E;  4UB6 E;  2AXT E;  5TIS E;  5B66 E;  5GTH E;  3JCU E;  3A0B E;  5H2F E;  3WU2 E;  5GTI E;  4UB8 E;  5E79 E; 
#chains in the Genus database with same CATH topology
 5B5E H;  4OVN F;  1OVR A;  1QL1 A;  5AVQ B;  3RK2 C;  2KP8 A;  1SQQ G;  2KSJ A;  3A2A A;  3KYQ A;  1L0L G;  1J1D B;  1AV1 A;  1L0N E;  2MKV A;  2KLV A;  3GG2 A;  4OGQ C;  1FZC C;  1SS1 A;  1HBW A;  4HJG H;  2V4H A;  2E75 D;  1UIX A;  2Y0E A;  1SFC D;  3E1I A;  1GK6 A;  4A7P A;  5APX A;  2FYN B;  3L37 A;  1X0T A;  3RGU A;  1URQ A;  1N7L A;  2NPS D;  3AED C;  4K3A A;  1HTL C;  3CCM P;  3A0B E;  3BAT A;  1ZXG A;  1SQX K;  1KOR A;  1GL2 A;  1DEB A;  4C46 A;  1GD2 E;  1N8R Q;  1W5C E;  1GU5 A;  2WSE J;  5CCG C;  2OTJ P;  2PAJ A;  4KT0 J;  4EYY Q;  2CPB A;  1NKN A;  2XZR A;  2JKV A;  1EDK A;  3GF7 A;  3D70 A;  5APU A;  3M9H A;  1GK4 A;  4D6T G;  4YTP C;  3I5C A;  2WT7 B;  2H43 A;  1L4A B;  2I8D A;  3BRV B;  2WIT A;  2WPR A;  4UB8 H;  5E79 H;  1BGY J;  3KZI H;  3GF3 A;  2C0X A;  1URQ D;  4NPF X;  3LIE A;  5AW5 B;  1X22 A;  2P67 A;  3AE8 C;  2W90 A;  1VPC A;  4MN4 C;  1GL2 D;  4AQR D;  3RK2 B;  2KI7 B;  4GOD A;  4HB1 A;  3KDP B;  5CCH A;  3CX5 E;  3H1L D;  5APV A;  1S5L H;  1NTK E;  4EIJ A;  1HVV A;  3V4Q A;  1IFP A;  1L0N J;  2K37 A;  4C7N A;  5KKZ B;  1JUN A;  3M0D C;  3TGU J;  2K9J B;  3MUD C;  1LTA C;  3JCU E;  2OYH A;  3R2P A;  3H1I J;  1KIL A;  1XTC C;  1KN7 A;  1SQB D;  3QH9 A;  4HKZ H;  1N86 A;  1SQX D;  2AEM A;  2NRG A;  3WMM 0;  3GLM A;  1KTM A;  1NU1 K;  3OAK A;  1T8Z A;  2V7Q J;  2OYI A;  1LJ2 A;  2N9Y B;  1QVG O;  1EXJ A;  1X79 B;  4ZKP A;  5CMZ A;  1BCC D;  1SQB G;  5KAF H;  3GW6 A;  3CX5 I;  5DJU B;  1SQX G;  3CC7 P;  2R5D A;  3QWO C;  5APT A;  3P8C D;  5CCH D;  3KXD A;  3E1R A;  5GTH H;  2E76 C;  1Y8A A;  2B89 A;  1BCC G;  2CPS A;  3SWF A;  2PRR A;  3G71 P;  2E74 C;  3IN6 A;  1SQQ E;  3B8E B;  1OW8 A;  4R4M A;  3CL3 D;  3USS A;  3AE7 C;  2QEX P;  2AXT H;  1IK9 A;  1ZLL A;  2C9N Y;  1HGZ A;  2KK7 A;  1SQP K;  2Z4E A;  3I56 P;  1NAF A;  5H2F E;  3CMA P;  3SWK A;  2FYU J;  1NTM K;  3OA7 A;  3CCQ P;  1FDM A;  5KAI E;  5KLI C;  2M0B A;  3CCR P;  3Q5P A;  1H0T B;  3FX0 A;  1J1E B;  3L73 J;  4N6J A;  2KXP B;  1ZR4 A;  2ZYD A;  1JO5 A;  3B71 A;  1RE4 C;  1M56 D;  2QIW A;  1LWU B;  3H1K G;  1T2K D;  2HR3 A;  4CPG A;  2J58 A;  1RQV A;  1MUU A;  3V2N A;  1FDI A;  3PJS K;  4I7Z B;  1Q7Y Q;  3H32 A;  1MV8 A;  1KB9 H;  3FWL A;  2LR2 A;  2GUS A;  1YQ4 C;  3HD7 C;  4YXD C;  2N1T D;  1FZF A;  1FAV A;  4K35 A;  1JY3 N;  3T97 A;  5CBO A;  2XND H;  2QM8 A;  5CJ0 A;  3AEC C;  4IFF A;  3H1H J;  1G1J A;  2ZT9 D;  1SLQ A;  1CZQ A;  5C39 A;  2E75 B;  1SFC B;  2NPS B;  5APQ A;  1KYO H;  3HUS C;  2WSF H;  3U1A A;  2D2C B;  2C9L Y;  2KUB A;  3I55 P;  5AVU B;  4AUW A;  3L72 D;  5M1B A;  2K1A A;  1PP9 J;  3CI9 A;  1SQP D;  2FFD C;  1AQT A;  1VQL P;  1VDF A;  4N3Y B;  1JM0 A;  2R32 A;  1KC8 Q;  3C8V A;  3RK3 D;  1NTM D;  2KLU A;  2ZXE B;  1S9K D;  1QL2 A;  1JCD A;  2K9J A;  3H1L E;  1LTS C;  4Y99 B;  3NTN A;  1OVU A;  2IBZ D;  1EQ7 A;  2Y9Z A;  1M57 D;  1GDT A;  4WB4 A;  3OW2 O;  2QJK C;  1NTM G;  2BAS A;  5KLV K;  1QEX A;  2IFM A;  1FZB A;  1IFD A;  1WRG A;  1VQ8 P;  2O3J A;  1Y9B A;  1SQX E;  1WT6 A;  3L75 D;  3CLQ A;  2JO1 A;  3RK2 D;  4KJM A;  2Q1K A;  4XA4 A;  3V5B A;  1GL2 B;  2WSC J;  3H1J J;  1BCC E;  3CWB J;  2YKO A;  3B5N C;  2G8Y A;  4OGQ D;  3L75 G;  3PP5 A;  1JY2 P;  3P8C E;  4ZMD A;  4PD4 H;  1FU1 A;  2BCC J;  2QVA A;  2GUV A;  2P7J A;  3BCC D;  2POH A;  3M9B A;  1SQQ K;  1LT1 A;  4JQ0 D;  1L0L K;  3CXH D;  4C7R A;  2IYO A;  4L74 A;  1KIL E;  3AEE C;  1S4X A;  3MIW A;  5CCG D;  3BCC G;  2IYP A;  4H0L C;  1RF1 C;  1ZN5 A;  3SWY A;  4L75 A;  1H0T A;  1G2C B;  2IZ1 A;  2MJZ A;  4LGD E;  5AW8 B;  1LWU A;  3RL0 C;  2E43 A;  3D6Y A;  3M0D A;  3ZDM A;  3MUD A;  1YIJ P;  4WBA A;  3RBZ A;  3V4W A;  3H1L J;  5KLV D;  2RN0 A;  2HG5 D;  1PGQ A;  1KQS O;  2R44 A;  1Q81 Q;  2IZ0 A;  1LT9 C;  1J2J B;  4LC1 A;  4U3F D;  3HE4 A;  1VQ5 P;  3BVH A;  4Y28 J;  3TNU A;  3F89 A;  1NTZ D;  1Q82 Q;  1MZ9 A;  1HGV A;  5KLV G;  4PJ0 E;  5APY A;  1VQ9 P;  1YTZ I;  4H13 C;  1N73 B;  1EDL A;  4U3F G;  1SFC A;  1VQO P;  3S9O A;  1NTZ G;  3G3Z A;  1JY3 O;  1M1J C;  1QX8 A;  2NPS A;  4R4L A;  3L74 D;  1NAY A;  1AA0 A;  2Y9Y A;  2ZVN B;  3FXD A;  1L0L D;  1RF0 C;  1OMI A;  1T6A A;  1SQV J;  4GOF A;  5GTI E;  3L72 E;  3MP7 B;  5APS A;  3L74 G;  3O8Z A;  3MZW B;  1SQP E;  4ASW A;  1FZA A;  4RJT A;  2N1T B;  3AE1 C;  1NTM E;  1AVO A;  1YJN P;  3P32 A;  1S9K E;  3BRT B;  4EDF A;  2E76 D;  1RE4 A;  2ZT9 B;  2IBZ E;  3V2P A;  3RL0 B;  3D71 A;  2O1K A;  2E74 D;  2WZ7 A;  3SSU A;  3W67 A;  2BEZ F;  2D2C D;  1YIT P;  4I1L A;  2YIU C;  1SQB K;  4HH2 A;  3HD7 A;  2P2U A;  1VF5 C;  3TK1 A;  3L75 E;  1S1C X;  2V7Q H;  2P58 A;  5KTB A;  4D6T D;  3H32 B;  3A0B H;  1Q86 Q;  2FBW C;  3L36 A;  1RQU A;  1NU1 J;  3B4S A;  3RK3 B;  3T97 B;  3Q5S A;  4JYC A;  2IBZ I;  2KNC B;  1NJI Q;  1JEK A;  4LLH A;  1HF9 A;  3BCC E;  2IFN A;  2OAR A;  1Q2N A;  1PIX A;  1S2E A;  2HOD A;  3CXH E;  1P84 D;  2JP3 A;  2YKP A;  1KYO D;  2Q6Q A;  1BE3 J;  3L71 D;  3HD7 D;  1KQG B;  1G2C A;  1R8E A;  4EI2 A;  1M7L A;  4W7Z A;  1N7S C;  2I1J A;  2W6A A;  3CPW O;  3L70 D;  3V2Q A;  2AXC A;  3CCS P;  3VOP A;  3L72 J;  1NVO A;  4DCK A;  4RO0 A;  4XE5 B;  2XV5 A;  1SQP J;  1VQK P;  1ZOY C;  3L71 G;  3PHL A;  4OGQ B;  1FZC B;  4BRY B;  1E5W A;  3H25 A;  1S5L E;  4IL6 E;  1FOS E;  3MTU E;  3WUT A;  3CX5 H;  1K8A Q;  3L70 G;  2DW3 A;  5KLV E;  3MGN A;  3E7K A;  3CXH I;  2OTK E;  3HE5 B;  2YIU B;  4U3F E;  3CCU P;  1G1I A;  3G9R A;  1N73 A;  1DH3 A;  4PV1 C;  5TJH A;  5AVR B;  3KHU A;  3N7N A;  1FZE A;  1PZQ A;  3AE6 C;  4JF7 A;  1EC5 A;  2B9B A;  2R5B A;  2A45 G;  2XDJ A;  3L74 E;  1LTG C;  3NFQ A;  4M3L A;  4WY4 C;  1MFZ A;  1L0L E;  2FXM A;  5KJ7 C;  1LGH B;  2N1T A;  2SPZ A;  2YMK A;  2AXT E;  4DJG A;  2ITA A;  3B5N D;  3H1K D;  4H44 C;  3JC2 2;  3JSV C;  3AEA C;  2HPC B;  4UB6 E;  3S4R A;  2WPV B;  5KAI H;  1PV3 A;  3EFG A;  1NTK J;  1PGP A;  2ZFC A;  3G4S P;  1JTH A;  5AW0 B;  2KZJ A;  3A5T A;  4N78 D;  2ZVO B;  2WQY C;  1IFI A;  4D6T E;  4H0L D;  2IDB A;  2IX7 C;  2WSC H;  5CJ4 A;  3HE4 B;  3TNU B;  2KNC A;  2R3S A;  3MD0 A;  1T3U A;  5BVZ A;  5B66 H;  2XKM A;  4IFD K;  1S3J A;  2W6B A;  4OWF A;  1M1J A;  4WWI A;  2WMM A;  3RL0 D;  1LTT C;  2RMZ A;  1FZG A;  2E76 B;  4ASV A;  2IPP A;  2HYN A;  3WU2 E;  1RF0 A;  1MFT A;  2E42 A;  2E74 B;  2O01 N;  1BGY D;  1ZP0 C;  4B86 A;  2KZI A;  1NYH A;  1P84 E;  1KYO E;  2QG4 A;  3L71 E;  1WMK A;  1SQQ J;  3VP9 A;  4W7Y A;  1OFC X;  5AW9 B;  1L0L J;  1Z56 A;  1DD3 A;  1FZC A;  1KV4 A;  1BGY G;  3L70 E;  1VQM P;  1FJP A;  4BRY A;  1ZW0 A;  2FYU K;  2H88 C;  1LTB C;  5AVZ B;  1N2D C;  2RKL A;  5KLI B;  3VMY A;  1GTW A;  1DEE G;  4DZO A;  1IZN B;  3ABV C;  5APW A;  2P10 A;  1FC2 C;  4W80 A;  3IAO A;  4YPC A;  1L0N D;  4EOT A;  3CD6 P;  3HE5 A;  1KFM A;  3M91 A;  3TGU D;  4I2L C;  1CSB A;  3Q5R A;  1SQB E;  3H1I D;  3NXS A;  1P84 I;  1YI2 P;  2R3C A;  1KYO I;  3GHG C;  3HTK B;  5CCG A;  3F5H A;  2Q5U A;  1NTZ K;  1L0N G;  1EDI A;  1IFJ A;  3HD7 B;  3TGU G;  3A0H E;  1U7M A;  3C1L A;  2LKM A;  1IK7 A;  3Q1M A;  1NHL A;  3EWK A;  3H1I G;  3CCL P;  2OYH C;  2PFX A;  4D6T J;  1KIL C;  2E5T A;  2KIK A;  3LW5 J;  2GM4 A;  1FE6 A;  5BU8 B;  1M1K Q;  2JEE A;  2OYI C;  2ZYA A;  3A3Y B;  1LTI C;  1SP4 A;  3AE9 C;  5AVY B;  3HUS B;  1S5L X;  1VF5 D;  4IL6 X;  2H7H A;  3IR9 A;  2HOD B;  2Z5I A;  1FJK A;  1K73 Q;  4BWN A;  2FFD B;  2A45 I;  1Y47 A;  2HPC A;  2H89 C;  2FYU D;  3H1K E;  3P7K A;  1X8Y A;  2L5G B;  1JMM A;  3M9Q A;  2FY8 A;  2JDI H;  3L73 D;  1J1D C;  2W83 C;  3L70 J;  2E5Y A;  1NH4 A;  3TYY A;  2AEF A;  1M90 Q;  2FYU G;  3RL0 g;  1H89 A;  2QJK B;  2A06 D;  5BU5 A;  3UIA A;  3L4F A;  2YKQ A;  2FYN C;  1TU3 F;  3WUU A;  3L73 G;  4N78 E;  2UWJ E;  1JY2 N;  1HUC A;  1SQB J;  3M0A A;  2A06 G;  3VYI A;  3AEF C;  1AJY A;  3G6E P;  1SQX J;  4XFJ A;  3B5N B;  3H1H D;  4AYC A;  4PJ0 H;  2M5A A;  1BCC J;  2J59 M;  1AFO A;  5TIS H;  2NZ2 A;  5KJ7 A;  2M3E A;  3BAS A;  3GMA A;  1LP1 A;  1ZRT D;  3H1H G;  2QRX A;  1QVF O;  1BGY E;  5AVS B;  1RHZ B;  2GA1 A;  1L4A C;  4DT0 A;  1W2B O;  3VN0 A;  3V2R A;  1YJW P;  1AQ5 A;  4HYT B;  2JWA A;  2KS1 B;  3V6I A;  1PP9 D;  1YQ3 C;  3LID A;  5B5E E;  3D6Z A;  4H0L B;  1RF1 B;  1U57 A;  2ZAE B;  3RK3 E;  1GU4 A;  2JJL A;  1HH0 A;  1KQF B;  1LTJ C;  3PLN A;  1PP9 G;  5AW7 B;  3SFD C;  3H1K J;  1KFN A;  1FBM A;  3HTK A;  4WY4 D;  3TGU E;  1HJ0 A;  2PGD A;  3IF4 A;  1YYC A;  1QLE D;  2YXR B;  5KJ7 D;  1T3J A;  3H1I E;  5KKZ C;  1YHQ P;  2L91 A;  1A02 J;  1LT9 B;  1KB9 D;  1VQ7 P;  1JTH B;  4ZNC A;  1U7J A;  3PH0 A;  3CCE P;  3H1J D;  3CWB D;  4H44 D;  2KB7 P;  1VQP P;  4H13 B;  2JWD A;  4GDO A;  2ZJS E;  3MHV A;  3CC4 P;  4GKG A;  1HWT C;  3NMD A;  3O6Q B;  2QE7 H;  1IFN A;  1W2E A;  1M1J B;  2WPS A;  3H1J G;  3CCV P;  3HUS A;  3CWB G;  4ZKU A;  1USE A;  2BCC D;  1OW7 A;  4UB8 E;  1VQN P;  5E79 E;  3KZI E;  1BDD A;  2FFD A;  3KPE A;  3AE3 C;  2B88 A;  2Y0C A;  1SQV K;  4YXW H;  2Q7C A;  3CXH H;  2BCC G;  1YJ9 P;  3L35 A;  1GZL A;  5DJT B;  2FYU E;  1EDJ A;  1FOS F;  4L76 A;  2OGU A;  3U59 A;  1DD4 A;  1PGO A;  1OWA A;  1E79 H;  1LTJ B;  1EZV D;  3L73 E;  1OX3 A;  1NTM J;  2OQQ A;  1J1E C;  2FXP A;  3GHG A;  2A06 E;  4L73 A;  3FGA D;  4IL6 H;  1K04 A;  2OTL P;  1JCC A;  2VRS A;  1EZV G;  1RE3 C;  1LWU C;  3AEG C;  3JCU H;  2YMY A;  1VF5 B;  1OIP A;  2K3R A;  1IC2 A;  1NTZ E;  3B5N A;  5AVV B;  2KOG A;  2KSE A;  4I7Z C;  2YXQ B;  3CC2 P;  3H1L G;  3L75 J;  4TLF A;  5AW4 B;  5KAF E;  3ITK A;  1K9M Q;  1JY2 O;  1JB0 J;  3H1H E;  2ZXX A;  3VMZ A;  2M8R A;  3AE4 C;  4PD4 D;  1NKZ B;  5GTH E;  2AEJ A;  4U7J A;  1AVY A;  1ZRT E;  1EXI A;  2E75 C;  1BDC A;  2KS1 A;  1JY3 P;  1SFC C;  2QJP C;  1RF1 A;  1SQV D;  3BCC J;  4I6M C;  2WTY A;  1KQL A;  1MKM A;  1R5S A;  1YTZ T;  3FWN A;  2NPS C;  1PP9 E;  2BEQ D;  2D2C C;  3WUV A;  1N7S B;  3AEB C;  1KIL D;  1SQV G;  1UII A;  1JOC A;  5H2F H;  3PTZ A;  1S72 P;  1GMJ A;  1QGK B;  4RES B;  3HRN A;  4GT1 A;  2WVR A;  1L0N K;  1NOH A;  1LT9 A;  4Y99 C;  2N9B A;  4UB6 H;  1PPJ D;  1KZU B;  1M8O B;  2P1J A;  3VMX A;  2PP6 A;  4KHX A;  3KQG A;  3N4X A;  3VMA A;  1LNQ A;  1RH5 B;  3CME P;  4RKU J;  1OVV A;  4NPD A;  1KB9 E;  5KLV J;  1K05 A;  2B87 B;  3EFF K;  1PPJ G;  1ZME C;  2J5U A;  1URQ C;  2YO3 A;  4PV1 B;  4U3F J;  2Q3E A;  3H1J E;  3CWB E;  1CI6 B;  1NO4 A;  5K5G B;  1FDO A;  3LW5 H;  1NTZ J;  3O6Q A;  2WPQ A;  1NU1 D;  3IFM A;  2K9Y A;  1GL2 C;  5B66 E;  1HJB A;  1USD A;  3Q3D A;  5AW3 B;  1VQ4 P;  2WT7 A;  1Q90 D;  1PFI A;  3H6P A;  2M5A B;  4DOJ A;  2BCC E;  1L4A A;  1NU1 G;  4WY4 B;  2LXC B;  3M06 A;  3L74 J;  3WU2 H;  1KB9 I;  2QJP B;  1KD1 Q;  1LP1 B;  1BE3 D;  2QJY C;  2QA4 P;  5L8R J;  1P84 H;  1GW4 A;  4IFM A;  3Q2Y A;  3FXE A;  1JNM A;  4H13 D;  1LTJ A;  3TSI A;  2HLO A;  4H44 B;  1X9V A;  2WSS H;  5AVT B;  1BE3 G;  3TDK A;  1IO4 A;  4GOE A;  1EZV E;  1PGJ A;  2LXB A;  3CCJ P;  5CBN A;  3L72 G;  1XTG B;  2I1K A;  1NTK K;  4GIF A;  1SQP G;  5CCH C;  1L4A D;  3AE2 C;  1PL5 A;  4JYB A;  1IJD B;  1D7M A;  3SFE C;  1FS0 E;  1OW6 A;  2QM7 A;  2FXO A;  4WVZ A;  2KYV A;  1URQ B;  2IBZ G;  2HFE D;  3A0H H;  2A45 H;  1EZV I;  4PD4 E;  1N73 C;  1GW3 A;  3U1C A;  2JR8 A;  1SVF A;  3K5B A;  3C9I A;  3W68 A;  2ZYG A;  1R5L A;  2FYZ A;  4OH8 B;  1L2P A;  1N7S A;  1SQV E;  1VL2 A;  3R4Y A;  2XU6 A;  3OJA B;  1BSN A;  2O01 H;  1T2K C;  2G3A A;  2Y0D A;  1DX7 A;  2K88 A;  2QJY B;  4TT3 H;  2WSF J;  3AE5 C;  3L71 J;  3II6 A;  2OYO A;  1KMI Z;  2W6J H;  1A02 F;  2N1T C;  1OXZ A;  2Q3I A;  5AVX B;  1BSH A;  2RH0 A;  3P8M C;  4PD4 I;  3A7O A;  3S1K A;  2C0W A;  1JMB A;  4NPE A;  3CX5 D;  2CK3 H;  1PPJ E;  1YBK A;  2ZT9 C;  1RE3 A;  1NTK D;  2B87 A;  3TF5 A;  4QMA A;  1IFM A;  4Z1M H;  2O1J A;  1RY3 A;  3GHG B;  4JBZ A;  5AW1 B;  1CI6 A;  3EQ2 A;  2Z5H A;  4O9B A;  1N7S D;  2Q9I A;  4C7N B;  1NTK G;  1ZR2 A;  5CHX A;  2OYH B;  1NU1 E;  1VQ6 P;  1KIL B;  2W27 A;  2WSE H;  3RBX A;  2XNX A;  4JPZ B;  4BXL A;  5EFW B;  4WY4 A;  3RK3 C;  2OYI B;  5AW6 B;  5AW2 B;  1DIP A;  1H8A A;  5TIS E;  1NWQ A;  3VTP C;  2FKW B;  1OZH A;  1NGM B;  4IOI H;  1H88 A;  2H8P D;  1BE3 E;  2O01 J;  3PRJ A;  1SQQ D;  2W8Z A;  4PV1 D;  1CW5 A;  2QSI A;  5GTI H;  2YNY A;  5AVW B;  1ZV8 A;  3VP8 A;  2YO2 A;  2M3B A;  2WWW A; 
#chains in the Genus database with same CATH homology
 3KZI E;  3A0H E;  5KAI E;  1W5C E;  5KAF E;  4PJ0 E;  5B5E E;  1S5L E;  4IL6 E;  4UB6 E;  2AXT E;  5TIS E;  5B66 E;  5GTH E;  3JCU E;  3A0B E;  5H2F E;  3WU2 E;  5GTI E;  4UB8 E;  5E79 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...