4UB6E

Native structure of photosystem ii (dataset-1) by a femtosecond x-ray laser
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 21
structure length 81
sequence length 81
chains with identical sequence e
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 4ub6E00
5B66E 1W5CE 4UB6E 2AXTE 4UB8E 3JCUE 5TISE 5GTIE 4IL6E 5H2FE 3KZIE 3A0BE 3WU2E 5KAIE 1S5LE 5B5EE 4PJ0E 3A0HE 5E79E 5KAFE 5GTHE
chains in the Genus database with same CATH superfamily
5CCHC 1K05A 2Y9YA 1LJ2A 4L73A 1L0LG 1J1DB 3H1JD 3IN6A 1N2DC 3T97A 1YTZT 1NTMJ 3FX0A 1R5LA 2XKMA 5KAFE 1BGYE 5CJ0A 2L91A 3H1LD 4PV1B 1MFZA 2E74B 1VDFA 2JWAA 3M91A 1NTKK 1IFJA 4I6MC 2AEJA 2JKVA 4HYTB 1NAFA 3KDPB 1W5CE 2QEXP 3D6YA 2V4HA 3P32A 3M0DC 2B9BA 3Q1MA 2ZYDA 2WSCJ 1VQMP 1QLED 2HPCB 2KNCB 3VP8A 1MUUA 3SWYA 3N4XA 1LTGC 2OGUA 3HRNA 1SQPG 1FZGA 3BRVB 1SQPE 3CI9A 2POHA 3CX5D 5CCGA 1SQXJ 3M06A 1L0ND 2M3EA 4U3FD 3II6A 1X8YA 2KNCA 3EQ2A 2M3BA 1T2KD 1SVFA 3D6ZA 4LLHA 3RL0B 3PJSK 1G2CB 1RF0C 3L71J 3FWLA 1UIIA 1VQ4P 2OYIC 3CWBG 1URQB 3CWBE 3AEBC 2K9JB 1N8RQ 1N73A 1JMMA 2C9NY 3HD7D 3BATA 1KB9H 4AYCA 1MKMA 2C9LY 3AEGC 2XDJA 4NPFX 1SQQE 1CI6B 3V6IA 1L0LD 2WSEJ 3HE5B 4ZMDA 4RESB 4EIJA 3VMAA 1VQ6P 4C7NB 1SQVK 2ZAEB 2E43A 1SP4A 5TISE 3AE7C 2ZVNB 1BGYD 4R4MA 1GL2A 2W8ZA 1ZRTE 2J5UA 3NTNA 1PZQA 1YYCA 2E76C 2O3JA 2Z4EA 1RF1B 1U7MA 4OVNF 4C7NA 1S5LH 2P2UA 4BXLA 1PP9J 1CSBA 1NU1E 4AUWA 1OFCX 1MZ9A 3V4QA 3CC7P 1Q86Q 2J58A 2Y0EA 1QEXA 1RF1A 1EDLA 1N7SD 2KS1A 4IL6E 1E5WA 4GOEA 1SQPD 1OX3A 2D2CD 3E1RA 2KSJA 3L70E 1IFDA 1SQBE 2NPSD 2H88C 4UB8E 2ZXXA 2WSCH 2KLUA 1SQXG 3L73J 1VQPP 2G8YA 3ITKA 3CC2P 3C9IA 3TGUG 1SQVJ 3MHVA 1U57A 3L72J 4WY4B 1M1JC 2BCCE 4XFJA 1RHZB 2K3RA 2WSSH 3CWBD 3A0BH 3FGAD 3L71G 1X9VA 3WMM0 4ASWA 2AEFA 3D70A 1N7LA 1SQQD 4WY4A 1JY2N 1YHQP 1NTKG 2FBWC 4YTPC 1T2KC 1NTKE 3USSA 4IFFA 2W90A 3W67A 3G3ZA 3CXHH 1XTGB 2RN0A 5KLVK 1AVYA 3JSVC 1KYOE 2N1TB 2NZ2A 1P84E 1JNMA 1OZHA 4GDOA 4M3LA 1OVVA 1ZRTD 1S4XA 5AVQB 4YPCA 3A3YB 1AFOA 3AE4C 1NJIQ 1JB0J 5E79H 2WSEH 3HD7C 2VRSA 1KD1Q 1FU1A 3TYYA 1NTZE 1FS0E 1OVUA 2HG5D 3HTKB 5L8RJ 4ASVA 4LC1A 1LTJB 2FKWB 4WBAA 3CPWO 3AE6C 5B5EH 1Q82Q 1EXJA 2XU6A 3RK2D 1ZV8A 1PGJA 1KN7A 1WT6A 3RK3E 2GA1A 3D71A 3JCUH 2FXPA 1SFCA 4OH8B 3U1CA 5GTHE 2R5BA 4L74A 3Q3DA 1EDJA 3GHGB 3S1KA 3CD6P 3L70D 1KMIZ 1SQBD 2BEZF 2P67A 1OVRA 3JC22 2A06E 3BCCE 1Q7YQ 1BE3G 1LWUC 1JY2O 1SS1A 1T3UA 1BE3E 1AVOA 1IK9A 5KLVJ 3TGUD 1ZR2A 1IFPA 2FYUK 5AVXB 1K73Q 2BCCD 2P7JA 1N7SC 3H1HJ 1L4AD 1SQVG 3L72G 2D2CC 2JR8A 2WT7B 4OGQD 4GOFA 1KILA 2MKVA 1KC8Q 2NPSC 1ZP0C 3MUDA 3R2PA 4O9BA 2QE7H 1NTKD 4PD4I 3ABVC 5C39A 1LTAC 2P1JA 1USDA 4WB4A 3AE5C 2OQQA 1QX8A 2KOGA 2C0XA 1JTHB 1KYOD 1PGQA 3VMYA 2Q3EA 3WUUA 1P84D 2OTLP 2E75D 2OARA 3KZIE 2FYNC 3VOPA 1IC2A 1BDDA 2HODB 1NO4A 3HUSA 1NTMK 4K3AA 3Q5PA 2IBZI 1AA0A 1NTZD 2E5YA 3SSUA 1H0TB 1AQTA 1YTZI 3V2NA 5KJ7C 1FZBA 3CCQP 5APXA 1FJKA 2LR2A 3AEFC 4KHXA 3H1IJ 1PFIA 2Q5UA 3CX5E 3KYQA 2OYIB 3RK3D 2HODA 2LXCB 4DOJA 1VQ7P 2Q1KA 3B5ND 4U3FE 1H0TA 1DX7A 1NVOA 4EYYQ 3A0HH 2WTYA 2W83C 1JCCA 2Y0CA 1S72P 1YQ3C 1FE6A 3LW5J 4N78D 4CPGA 2A06D 4YXWH 2H7HA 1BE3D 2YNYA 1FC2C 3RL0g 1OWAA 5APYA 2ZVOB 3I56P 2P58A 1EQ7A 4GT1A 3RK2C 1QL1A 2B87B 2Q3IA 1X79B 3L75E 5KLVG 1RQUA 1SQVD 1GK4A 3W68A 3CMEP 1BCCG 2OYHA 1L0LE 2W27A 2E76B 3H1HG 5B66H 2QJYC 1JUNA 1ZOYC 1M56D 1G1IA 2OTKE 2QVAA 1VQNP 1VPCA 1HWTC 5BU5A 3AE8C 3VP9A 1RQVA 3L74G 4HH2A 2W6AA 2IFMA 2CK3H 1A02F 2PP6A 1OIPA 1W2EA 2JDIH 3CMAP 4D6TG 2E74D 2K1AA 4TLFA 5CMZA 5APWA 1L4AC 5AW6B 4OGQC 3H32B 1EZVI 1MFTA 2XNXA 5KKZC 1NU1J 5CCGD 1ZR4A 4RJTA 3KHUA 1RE4A 2IFNA 3U1AA 1OMIA 2O1JA 2XV5A 3AEEC 3AE3C 2RH0A 3IFMA 2KXPB 1M1JB 4A7PA 3SWFA 4B86A 3TNUB 1FZCC 2QA4P 4ZNCA 3PP5A 1JY3N 2HPCA 3GF7A 1VQOP 2FYUG 3OW2O 1VQ9P 2PGDA 3B8EB 1GK6A 2DW3A 2NRGA 1M1JA 2E42A 5AVUB 3L4FA 1KB9E 1NH4A 3FXDA 4H0LD 5TJHA 1FOSE 1GDTA 1KQLA 3RK3C 1FZEA 3B71A 1G2CA 1HUCA 4W80A 3L75D 2Z5HA 3B5NC 1GL2D 3LW5H 3TF5A 2Q6QA 1URQA 1BCCD 1MV8A 3HD7B 2K9JA 2KUBA 2ITAA 1JEKA 1NTMG 3L74D 1S5LE 1NTME 1CI6A 1M7LA 2WSFJ 3V2QA 1OW7A 3HE5A 3WU2H 4D6TD 2QM8A 4PJ0H 1QVFO 2Q7CA 1JY3O 1OW8A 4EI2A 5BU8B 3I5CA 3OAKA 3Q2YA 3TSIA 1J1DC 2XZRA 1YJWP 3S4RA 1KQSO 3CC4P 4IOIH 4R4LA 2K9YA 1LWUB 4YXDC 1USEA 1Q81Q 1QL2A 1DIPA 3CCEP 3C1LA 4I7ZC 2QJPC 1LT9B 2WPSA 4PD4H 1JY3P 3AEDC 1SLQA 1NKZB 1IFMA 3V2RA 5APSA 1N7SB 2E74C 1M1KQ 2KZJA 3OA7A 4H13D 2D2CB 1HF9A 2IBZG 1R5SA 4GODA 2FYUD 1SQXE 3H1KJ 1LTTC 2YKQA 3A0BE 3BCCJ 1FZFA 1JCDA 5CCGC 1LT9A 2NPSB 2YMYA 3TGUE 1KILE 4L76A 1S9KE 1KB9D 2JJLA 4WY4D 3NXSA 4RO0A 4GKGA 2KB7P 3SFDC 3L71E 1EDIA 1L0NK 2KK7A 4UB6H 1DH3A 4U7JA 1JO5A 1J1EC 3PH0A 2JP3A 3A7OA 3CCVP 2IX7C 2KLVA 3H1JJ 3CXHE 2KZIA 2M0BA 2IDBA 2FYNB 2QRXA 4N3YB 4W7YA 5CJ4A 2I8DA 1M8OB 3RBZA 2YIUC 1N73C 5CBNA 1FOSF 5APUA 3H1LJ 3GMAA 5E79E 3RBXA 1FDMA 2FFDB 4H0LC 1NTMD 4TT3H 1RH5B 2O01J 2SPZA 3AE2C 1FDIA 1LTIC 1IZNB 5B5EE 2QIWA 1GL2C 2A45I 3BASA 5KLIB 2N1TA 1SFCD 5KJ7A 1PPJG 3L37A 3G71P 1ZXGA 2GUVA 3VN0A 3UIAA 3JCUE 5AW4B 2FFDA 2ZYGA 1OW6A 1PP9G 1AJYA 1S1CX 1RE3A 2YXRB 1PP9E 2WSFH 2AXTH 1PGOA 2QSIA 4JYBA 2WQYC 1QGKB 1ZW0A 3U59A 2V7QJ 2M5AB 1IFIA 2RKLA 3GG2A 5H2FH 2N9YB 1T6AA 3HTKA 1K9MQ 3RK2B 1LTJA 1L0NJ 3CCMP 4U3FJ 3O6QB 2LXBA 3BRTB 2WPVB 2ZJSE 4JPZB 1HH0A 5CHXA 1EZVG 1K8AQ 3CCRP 4H44D 4N78E 1IK7A 1SQXD 3M0AA 4HJGH 2Z5IA 1PGPA 3GHGA 3O6QA 2OTJP 3H1KG 1KILD 1JMBA 3AE9C 1S9KD 1VQLP 3L73G 1CW5A 5CCHA 1VF5D 3L73E 4LGDE 2GUSA 3L71D 1SQVE 5AVZB 4C46A 2K88A 3L72E 2R32A 1HTLC 5AW0B 1JY2P 1M90Q 3N7NA 1DD3A 3EFFK 1AV1A 3L35A 1DEEG 1L4AB 1L0LJ 3CXHD 1H88A 3WUTA 4H13C 4DJGA 5KKZB 3H1JG 2WVRA 1BGYJ 1X22A 3MP7B 3OJAB 1AQ5A 3G9RA 5DJTB 2WT7A 1G1JA 5APTA 1DD4A 4ZKUA 1ZLLA 1LTBC 1X0TA 2HR3A 3H1LG 3FWNA 3M0DA 3CLQA 1FBMA 1SQQK 1FZCB 1KFMA 2CPSA 3WUVA 1JTHA 4JF7A 2KIKA 4N6JA 3QH9A 2C0WA 5AW3B 4JYCA 1JOCA 1Y8AA 2ZYAA 1RY3A 3A0HE 1PP9D 4DCKA 1SQPJ 2O01H 5AW9B 2K37A 1Q90D 1KV4A 1R8EA 2MJZA 1K04A 1S3JA 3RK3B 2GM4A 3A5TA 1NU1K 5GTIH 3P8CE 3K5BA 1RF0A 3B5NB 3V2PA 1L0NG 1EZVD 1D7MA 3IF4A 2OYIA 1VQ5P 3VMXA 1SFCC 3AECC 2JWDA 4GIFA 4XA4A 3VYIA 3CWBJ 1OXZA 5AW5B 1IO4A 4WWIA 2ZT9D 2QG4A 3F89A 5B66E 3L73D 5AW7B 5BVZA 2M8RA 5KAIH 5KLVE 2W6BA 3L72D 3T97B 4JBZA 1KYOI 5AVYB 1KQFB 2IZ1A 1NGMB 1SQQJ 1BCCE 2WITA 1P84I 3CCJP 2P10A 3H1HE 3IAOA 4HKZH 4OWFA 4QMAA 4H44C 1KQGB 2B87A 2BEQD 4EOTA 4NPDA 1WMKA 4IFMA 3MIWA 3L74E 1H89A 5CBOA 4PV1D 1KILC 5AVTB 1YJNP 1BGYG 3MUDC 1VF5C 1YQ4C 4D6TE 4I7ZB 1GD2E 2QJPB 1NYHA 4K35A 3MZWB 3AEAC 2JEEA 5KAFH 2I1KA 2IYOA 2PAJA 4L75A 2AXCA 1ZN5A 2R5DA 1T3JA 3H32A 3HUSC 1UIXA 1VQKP 5AW2B 3O8ZA 3H1IG 2QJKC 4KT0J 2UWJE 3H1IE 1HBWA 3L70J 2HFED 2E75C 1DEBA 1SQBJ 1LGHB 2A45G 4Y99C 2FYUE 1J1EB 3A2AA 1NTZK 5APQA 2YKOA 3P8CD 2FXOA 3CCSP 1XTCC 1L2PA 3AE1C 3RL0D 4I1LA 3TNUA 1H8AA 2A45H 3TGUJ 4KJMA 3MTUE 2J59M 3F5HA 1EC5A 2IPPA 2YIUB 2BCCJ 1N73B 1BSHA 1URQD 3H25A 3Q5RA 1KZUB 2RMZA 1S2EA 4H0LB 2KI7B 5KLVD 5M1BA 1YBKA 1Y9BA 2FY8A 2I1JA 3H1HD 3I55P 1NTKJ 1GL2B 1IJDB 1SQQG 3S9OA 1GW4A 5DJUB 3WU2E 3CCLP 3KPEA 4PJ0E 1WRGA 2OYHC 4AQRD 4W7ZA 4BRYB 1YIJP 3EFGA 3HD7A 2ZT9C 4ZKPA 1T8ZA 3CX5I 4DZOA 4I2LC 4WVZA 2CPBA 1NTZJ 5TISH 2W6JH 1GU4A 4BRYA 1GMJA 3C8VA 4PD4E 1M57D 2KS1B 3GF3A 1NU1G 1PIXA 1QVGO 2E5TA 3SFEC 4PV1C 2H89C 2B89A 1RE4C 2R3CA 3KQGA 1NOHA 3H1ID 3LIEA 1GU5A 3M9HA 3CCUP 4XE5B 2H8PD 1LWUA 4BWNA 1NKNA 2IBZE 4DT0A 3L70G 1LNQA 2N9BA 2KYVA 1BE3J 1SQBG 1NWQA 4IL6H 4H13B 4UB6E 1CZQA 1N86A 1S5LX 1N7SA 1YI2P 1JM0A 4C7RA 4Z1MH 1EDKA 2YMKA 4UB8H 2BCCG 2WPQA 1A02J 2NPSA 3GW6A 3IR9A 3EWKA 1HGVA 3GLMA 1KORA 1LT1A 5AW1B 3RL0C 2PFXA 4IL6X 3VTPC 1E79H 1Z56A 1EXIA 2YKPA 2N1TD 5KJ7D 1NAYA 2WZ7A 4EDFA 5AVRB 3E7KA 1URQC 2Y9ZA 1FDOA 1PL5A 1LP1B 1L0LK 1LTSC 1HJBA 1KTMA 2AXTE 1YITP 1PPJE 2BASA 3H6PA 1J2JB 1KYOH 5H2FE 2Y0DA 4PD4D 1P84H 3ZDMA 1NTZG 2L5GB 3TK1A 2HYNA 1SFCB 1HVVA 1FAVA 2B88A 1LP1A 1NU1D 2IYPA 5AW8B 5K5GB 1W2BO 1TU3F 5APVA 1KB9I 1VQ8P 2ZFCA 3MD0A 1EZVE 1RF1C 2AEMA 5CCHD 2IZ0A 3V5BA 3FXEA 2IBZD 1GZLA 2M5AA 2QJYB 3BVHA 4H44B 2HLOA 1SQPK 5GTHH 3H1KE 2A06G 3BCCG 1BSNA 4MN4C 4RKUJ 1Y47A 3PRJA 2WWWA 4JQ0D 3M9BA 1KILB 3L75J 2R3SA 3QWOC 1LT9C 3SWKA 1VF5B 2O1KA 3HE4B 1BCCJ 3B4SA 4IFDK 2G3AA 5AVVB 4OGQB 2WMMA 3P7KA 1KFNA 3H1JE 3NMDA 2QM7A 3L74J 3V4WA 1BDCA 1PV3A 3HE4A 4WY4C 1L4AA 3Q5SA 3M9QA 1IFNA 2OYOA 4D6TJ 2FXMA 3H1LE 3HUSB 1YJ9P 1NHLA 2R44A 2QJKB 3MGNA 2XNDH 5AVSB 2E75B 4Y99B 3NFQA 1PPJD 3G4SP 1HJ0A 3VMZA 3R4YA 2H43A 3CL3D 2LKMA 3TDKA 2O01N 3RGUA 1FZCA 3KZIH 2YO2A 2YXQB 5GTIE 1FJPA 1FZAA 2N1TC 1HGZA 1VL2A 2FFDC 2KP8A 1RE3C 2Q9IA 1GW3A 2FYUJ 3G6EP 3LIDA 4U3FG 1L0NE 2ZXEB 1U7JA 3PHLA 1ZMEC 2PRRA 5KLIC 3CX5H 2V7QH 4HB1A 1LTJC 1Q2NA 3CXHI 2YO3A 5KAIE 3P8MC 2WPRA 4Y28J 3PLNA 3H1KD 2FYZA 4NPEA 5KTBA 3E1IA 2JO1A 3BCCD 3B5NA 2OYHB 1SQBK 3KXDA 2ZT9B 1GTWA 5EFWB 3GHGC 3PTZA 1SQXK 2E76D 5AVWB 3L36A 3L75G 2KSEA
chains in the Genus database with same CATH topology
5B66E 1W5CE 4UB6E 2AXTE 4UB8E 3JCUE 5TISE 5GTIE 4IL6E 5H2FE 3KZIE 3A0BE 3WU2E 5KAIE 1S5LE 5B5EE 4PJ0E 3A0HE 5E79E 5KAFE 5GTHE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B66 E;  1W5C E;  4UB6 E;  2AXT E;  4UB8 E;  3JCU E;  5TIS E;  5GTI E;  4IL6 E;  5H2F E;  3KZI E;  3A0B E;  3WU2 E;  5KAI E;  1S5L E;  5B5E E;  4PJ0 E;  3A0H E;  5E79 E;  5KAF E;  5GTH E; 
#chains in the Genus database with same CATH topology
 5CCH C;  1K05 A;  2Y9Y A;  1LJ2 A;  4L73 A;  1L0L G;  1J1D B;  3H1J D;  3IN6 A;  1N2D C;  3T97 A;  1YTZ T;  1NTM J;  3FX0 A;  1R5L A;  2XKM A;  5KAF E;  1BGY E;  5CJ0 A;  2L91 A;  3H1L D;  4PV1 B;  1MFZ A;  2E74 B;  1VDF A;  2JWA A;  3M91 A;  1NTK K;  1IFJ A;  4I6M C;  2AEJ A;  2JKV A;  4HYT B;  1NAF A;  3KDP B;  1W5C E;  2QEX P;  3D6Y A;  2V4H A;  3P32 A;  3M0D C;  2B9B A;  3Q1M A;  2ZYD A;  2WSC J;  1VQM P;  1QLE D;  2HPC B;  2KNC B;  3VP8 A;  1MUU A;  3SWY A;  3N4X A;  1LTG C;  2OGU A;  3HRN A;  1SQP G;  1FZG A;  3BRV B;  1SQP E;  3CI9 A;  2POH A;  3CX5 D;  5CCG A;  1SQX J;  3M06 A;  1L0N D;  2M3E A;  4U3F D;  3II6 A;  1X8Y A;  2KNC A;  3EQ2 A;  2M3B A;  1T2K D;  1SVF A;  3D6Z A;  4LLH A;  3RL0 B;  3PJS K;  1G2C B;  1RF0 C;  3L71 J;  3FWL A;  1UII A;  1VQ4 P;  2OYI C;  3CWB G;  1URQ B;  3CWB E;  3AEB C;  2K9J B;  1N8R Q;  1N73 A;  1JMM A;  2C9N Y;  3HD7 D;  3BAT A;  1KB9 H;  4AYC A;  1MKM A;  2C9L Y;  3AEG C;  2XDJ A;  4NPF X;  1SQQ E;  1CI6 B;  3V6I A;  1L0L D;  2WSE J;  3HE5 B;  4ZMD A;  4RES B;  4EIJ A;  3VMA A;  1VQ6 P;  4C7N B;  1SQV K;  2ZAE B;  2E43 A;  1SP4 A;  5TIS E;  3AE7 C;  2ZVN B;  1BGY D;  4R4M A;  1GL2 A;  2W8Z A;  1ZRT E;  2J5U A;  3NTN A;  1PZQ A;  1YYC A;  2E76 C;  2O3J A;  2Z4E A;  1RF1 B;  1U7M A;  4OVN F;  4C7N A;  1S5L H;  2P2U A;  4BXL A;  1PP9 J;  1CSB A;  1NU1 E;  4AUW A;  1OFC X;  1MZ9 A;  3V4Q A;  3CC7 P;  1Q86 Q;  2J58 A;  2Y0E A;  1QEX A;  1RF1 A;  1EDL A;  1N7S D;  2KS1 A;  4IL6 E;  1E5W A;  4GOE A;  1SQP D;  1OX3 A;  2D2C D;  3E1R A;  2KSJ A;  3L70 E;  1IFD A;  1SQB E;  2NPS D;  2H88 C;  4UB8 E;  2ZXX A;  2WSC H;  2KLU A;  1SQX G;  3L73 J;  1VQP P;  2G8Y A;  3ITK A;  3CC2 P;  3C9I A;  3TGU G;  1SQV J;  3MHV A;  1U57 A;  3L72 J;  4WY4 B;  1M1J C;  2BCC E;  4XFJ A;  1RHZ B;  2K3R A;  2WSS H;  3CWB D;  3A0B H;  3FGA D;  3L71 G;  1X9V A;  3WMM 0;  4ASW A;  2AEF A;  3D70 A;  1N7L A;  1SQQ D;  4WY4 A;  1JY2 N;  1YHQ P;  1NTK G;  2FBW C;  4YTP C;  1T2K C;  1NTK E;  3USS A;  4IFF A;  2W90 A;  3W67 A;  3G3Z A;  3CXH H;  1XTG B;  2RN0 A;  5KLV K;  1AVY A;  3JSV C;  1KYO E;  2N1T B;  2NZ2 A;  1P84 E;  1JNM A;  1OZH A;  4GDO A;  4M3L A;  1OVV A;  1ZRT D;  1S4X A;  5AVQ B;  4YPC A;  3A3Y B;  1AFO A;  3AE4 C;  1NJI Q;  1JB0 J;  5E79 H;  2WSE H;  3HD7 C;  2VRS A;  1KD1 Q;  1FU1 A;  3TYY A;  1NTZ E;  1FS0 E;  1OVU A;  2HG5 D;  3HTK B;  5L8R J;  4ASV A;  4LC1 A;  1LTJ B;  2FKW B;  4WBA A;  3CPW O;  3AE6 C;  5B5E H;  1Q82 Q;  1EXJ A;  2XU6 A;  3RK2 D;  1ZV8 A;  1PGJ A;  1KN7 A;  1WT6 A;  3RK3 E;  2GA1 A;  3D71 A;  3JCU H;  2FXP A;  1SFC A;  4OH8 B;  3U1C A;  5GTH E;  2R5B A;  4L74 A;  3Q3D A;  1EDJ A;  3GHG B;  3S1K A;  3CD6 P;  3L70 D;  1KMI Z;  1SQB D;  2BEZ F;  2P67 A;  1OVR A;  3JC2 2;  2A06 E;  3BCC E;  1Q7Y Q;  1BE3 G;  1LWU C;  1JY2 O;  1SS1 A;  1T3U A;  1BE3 E;  1AVO A;  1IK9 A;  5KLV J;  3TGU D;  1ZR2 A;  1IFP A;  2FYU K;  5AVX B;  1K73 Q;  2BCC D;  2P7J A;  1N7S C;  3H1H J;  1L4A D;  1SQV G;  3L72 G;  2D2C C;  2JR8 A;  2WT7 B;  4OGQ D;  4GOF A;  1KIL A;  2MKV A;  1KC8 Q;  2NPS C;  1ZP0 C;  3MUD A;  3R2P A;  4O9B A;  2QE7 H;  1NTK D;  4PD4 I;  3ABV C;  5C39 A;  1LTA C;  2P1J A;  1USD A;  4WB4 A;  3AE5 C;  2OQQ A;  1QX8 A;  2KOG A;  2C0X A;  1JTH B;  1KYO D;  1PGQ A;  3VMY A;  2Q3E A;  3WUU A;  1P84 D;  2OTL P;  2E75 D;  2OAR A;  3KZI E;  2FYN C;  3VOP A;  1IC2 A;  1BDD A;  2HOD B;  1NO4 A;  3HUS A;  1NTM K;  4K3A A;  3Q5P A;  2IBZ I;  1AA0 A;  1NTZ D;  2E5Y A;  3SSU A;  1H0T B;  1AQT A;  1YTZ I;  3V2N A;  5KJ7 C;  1FZB A;  3CCQ P;  5APX A;  1FJK A;  2LR2 A;  3AEF C;  4KHX A;  3H1I J;  1PFI A;  2Q5U A;  3CX5 E;  3KYQ A;  2OYI B;  3RK3 D;  2HOD A;  2LXC B;  4DOJ A;  1VQ7 P;  2Q1K A;  3B5N D;  4U3F E;  1H0T A;  1DX7 A;  1NVO A;  4EYY Q;  3A0H H;  2WTY A;  2W83 C;  1JCC A;  2Y0C A;  1S72 P;  1YQ3 C;  1FE6 A;  3LW5 J;  4N78 D;  4CPG A;  2A06 D;  4YXW H;  2H7H A;  1BE3 D;  2YNY A;  1FC2 C;  3RL0 g;  1OWA A;  5APY A;  2ZVO B;  3I56 P;  2P58 A;  1EQ7 A;  4GT1 A;  3RK2 C;  1QL1 A;  2B87 B;  2Q3I A;  1X79 B;  3L75 E;  5KLV G;  1RQU A;  1SQV D;  1GK4 A;  3W68 A;  3CME P;  1BCC G;  2OYH A;  1L0L E;  2W27 A;  2E76 B;  3H1H G;  5B66 H;  2QJY C;  1JUN A;  1ZOY C;  1M56 D;  1G1I A;  2OTK E;  2QVA A;  1VQN P;  1VPC A;  1HWT C;  5BU5 A;  3AE8 C;  3VP9 A;  1RQV A;  3L74 G;  4HH2 A;  2W6A A;  2IFM A;  2CK3 H;  1A02 F;  2PP6 A;  1OIP A;  1W2E A;  2JDI H;  3CMA P;  4D6T G;  2E74 D;  2K1A A;  4TLF A;  5CMZ A;  5APW A;  1L4A C;  5AW6 B;  4OGQ C;  3H32 B;  1EZV I;  1MFT A;  2XNX A;  5KKZ C;  1NU1 J;  5CCG D;  1ZR4 A;  4RJT A;  3KHU A;  1RE4 A;  2IFN A;  3U1A A;  1OMI A;  2O1J A;  2XV5 A;  3AEE C;  3AE3 C;  2RH0 A;  3IFM A;  2KXP B;  1M1J B;  4A7P A;  3SWF A;  4B86 A;  3TNU B;  1FZC C;  2QA4 P;  4ZNC A;  3PP5 A;  1JY3 N;  2HPC A;  3GF7 A;  1VQO P;  2FYU G;  3OW2 O;  1VQ9 P;  2PGD A;  3B8E B;  1GK6 A;  2DW3 A;  2NRG A;  1M1J A;  2E42 A;  5AVU B;  3L4F A;  1KB9 E;  1NH4 A;  3FXD A;  4H0L D;  5TJH A;  1FOS E;  1GDT A;  1KQL A;  3RK3 C;  1FZE A;  3B71 A;  1G2C A;  1HUC A;  4W80 A;  3L75 D;  2Z5H A;  3B5N C;  1GL2 D;  3LW5 H;  3TF5 A;  2Q6Q A;  1URQ A;  1BCC D;  1MV8 A;  3HD7 B;  2K9J A;  2KUB A;  2ITA A;  1JEK A;  1NTM G;  3L74 D;  1S5L E;  1NTM E;  1CI6 A;  1M7L A;  2WSF J;  3V2Q A;  1OW7 A;  3HE5 A;  3WU2 H;  4D6T D;  2QM8 A;  4PJ0 H;  1QVF O;  2Q7C A;  1JY3 O;  1OW8 A;  4EI2 A;  5BU8 B;  3I5C A;  3OAK A;  3Q2Y A;  3TSI A;  1J1D C;  2XZR A;  1YJW P;  3S4R A;  1KQS O;  3CC4 P;  4IOI H;  4R4L A;  2K9Y A;  1LWU B;  4YXD C;  1USE A;  1Q81 Q;  1QL2 A;  1DIP A;  3CCE P;  3C1L A;  4I7Z C;  2QJP C;  1LT9 B;  2WPS A;  4PD4 H;  1JY3 P;  3AED C;  1SLQ A;  1NKZ B;  1IFM A;  3V2R A;  5APS A;  1N7S B;  2E74 C;  1M1K Q;  2KZJ A;  3OA7 A;  4H13 D;  2D2C B;  1HF9 A;  2IBZ G;  1R5S A;  4GOD A;  2FYU D;  1SQX E;  3H1K J;  1LTT C;  2YKQ A;  3A0B E;  3BCC J;  1FZF A;  1JCD A;  5CCG C;  1LT9 A;  2NPS B;  2YMY A;  3TGU E;  1KIL E;  4L76 A;  1S9K E;  1KB9 D;  2JJL A;  4WY4 D;  3NXS A;  4RO0 A;  4GKG A;  2KB7 P;  3SFD C;  3L71 E;  1EDI A;  1L0N K;  2KK7 A;  4UB6 H;  1DH3 A;  4U7J A;  1JO5 A;  1J1E C;  3PH0 A;  2JP3 A;  3A7O A;  3CCV P;  2IX7 C;  2KLV A;  3H1J J;  3CXH E;  2KZI A;  2M0B A;  2IDB A;  2FYN B;  2QRX A;  4N3Y B;  4W7Y A;  5CJ4 A;  2I8D A;  1M8O B;  3RBZ A;  2YIU C;  1N73 C;  5CBN A;  1FOS F;  5APU A;  3H1L J;  3GMA A;  5E79 E;  3RBX A;  1FDM A;  2FFD B;  4H0L C;  1NTM D;  4TT3 H;  1RH5 B;  2O01 J;  2SPZ A;  3AE2 C;  1FDI A;  1LTI C;  1IZN B;  5B5E E;  2QIW A;  1GL2 C;  2A45 I;  3BAS A;  5KLI B;  2N1T A;  1SFC D;  5KJ7 A;  1PPJ G;  3L37 A;  3G71 P;  1ZXG A;  2GUV A;  3VN0 A;  3UIA A;  3JCU E;  5AW4 B;  2FFD A;  2ZYG A;  1OW6 A;  1PP9 G;  1AJY A;  1S1C X;  1RE3 A;  2YXR B;  1PP9 E;  2WSF H;  2AXT H;  1PGO A;  2QSI A;  4JYB A;  2WQY C;  1QGK B;  1ZW0 A;  3U59 A;  2V7Q J;  2M5A B;  1IFI A;  2RKL A;  3GG2 A;  5H2F H;  2N9Y B;  1T6A A;  3HTK A;  1K9M Q;  3RK2 B;  1LTJ A;  1L0N J;  3CCM P;  4U3F J;  3O6Q B;  2LXB A;  3BRT B;  2WPV B;  2ZJS E;  4JPZ B;  1HH0 A;  5CHX A;  1EZV G;  1K8A Q;  3CCR P;  4H44 D;  4N78 E;  1IK7 A;  1SQX D;  3M0A A;  4HJG H;  2Z5I A;  1PGP A;  3GHG A;  3O6Q A;  2OTJ P;  3H1K G;  1KIL D;  1JMB A;  3AE9 C;  1S9K D;  1VQL P;  3L73 G;  1CW5 A;  5CCH A;  1VF5 D;  3L73 E;  4LGD E;  2GUS A;  3L71 D;  1SQV E;  5AVZ B;  4C46 A;  2K88 A;  3L72 E;  2R32 A;  1HTL C;  5AW0 B;  1JY2 P;  1M90 Q;  3N7N A;  1DD3 A;  3EFF K;  1AV1 A;  3L35 A;  1DEE G;  1L4A B;  1L0L J;  3CXH D;  1H88 A;  3WUT A;  4H13 C;  4DJG A;  5KKZ B;  3H1J G;  2WVR A;  1BGY J;  1X22 A;  3MP7 B;  3OJA B;  1AQ5 A;  3G9R A;  5DJT B;  2WT7 A;  1G1J A;  5APT A;  1DD4 A;  4ZKU A;  1ZLL A;  1LTB C;  1X0T A;  2HR3 A;  3H1L G;  3FWN A;  3M0D A;  3CLQ A;  1FBM A;  1SQQ K;  1FZC B;  1KFM A;  2CPS A;  3WUV A;  1JTH A;  4JF7 A;  2KIK A;  4N6J A;  3QH9 A;  2C0W A;  5AW3 B;  4JYC A;  1JOC A;  1Y8A A;  2ZYA A;  1RY3 A;  3A0H E;  1PP9 D;  4DCK A;  1SQP J;  2O01 H;  5AW9 B;  2K37 A;  1Q90 D;  1KV4 A;  1R8E A;  2MJZ A;  1K04 A;  1S3J A;  3RK3 B;  2GM4 A;  3A5T A;  1NU1 K;  5GTI H;  3P8C E;  3K5B A;  1RF0 A;  3B5N B;  3V2P A;  1L0N G;  1EZV D;  1D7M A;  3IF4 A;  2OYI A;  1VQ5 P;  3VMX A;  1SFC C;  3AEC C;  2JWD A;  4GIF A;  4XA4 A;  3VYI A;  3CWB J;  1OXZ A;  5AW5 B;  1IO4 A;  4WWI A;  2ZT9 D;  2QG4 A;  3F89 A;  5B66 E;  3L73 D;  5AW7 B;  5BVZ A;  2M8R A;  5KAI H;  5KLV E;  2W6B A;  3L72 D;  3T97 B;  4JBZ A;  1KYO I;  5AVY B;  1KQF B;  2IZ1 A;  1NGM B;  1SQQ J;  1BCC E;  2WIT A;  1P84 I;  3CCJ P;  2P10 A;  3H1H E;  3IAO A;  4HKZ H;  4OWF A;  4QMA A;  4H44 C;  1KQG B;  2B87 A;  2BEQ D;  4EOT A;  4NPD A;  1WMK A;  4IFM A;  3MIW A;  3L74 E;  1H89 A;  5CBO A;  4PV1 D;  1KIL C;  5AVT B;  1YJN P;  1BGY G;  3MUD C;  1VF5 C;  1YQ4 C;  4D6T E;  4I7Z B;  1GD2 E;  2QJP B;  1NYH A;  4K35 A;  3MZW B;  3AEA C;  2JEE A;  5KAF H;  2I1K A;  2IYO A;  2PAJ A;  4L75 A;  2AXC A;  1ZN5 A;  2R5D A;  1T3J A;  3H32 A;  3HUS C;  1UIX A;  1VQK P;  5AW2 B;  3O8Z A;  3H1I G;  2QJK C;  4KT0 J;  2UWJ E;  3H1I E;  1HBW A;  3L70 J;  2HFE D;  2E75 C;  1DEB A;  1SQB J;  1LGH B;  2A45 G;  4Y99 C;  2FYU E;  1J1E B;  3A2A A;  1NTZ K;  5APQ A;  2YKO A;  3P8C D;  2FXO A;  3CCS P;  1XTC C;  1L2P A;  3AE1 C;  3RL0 D;  4I1L A;  3TNU A;  1H8A A;  2A45 H;  3TGU J;  4KJM A;  3MTU E;  2J59 M;  3F5H A;  1EC5 A;  2IPP A;  2YIU B;  2BCC J;  1N73 B;  1BSH A;  1URQ D;  3H25 A;  3Q5R A;  1KZU B;  2RMZ A;  1S2E A;  4H0L B;  2KI7 B;  5KLV D;  5M1B A;  1YBK A;  1Y9B A;  2FY8 A;  2I1J A;  3H1H D;  3I55 P;  1NTK J;  1GL2 B;  1IJD B;  1SQQ G;  3S9O A;  1GW4 A;  5DJU B;  3WU2 E;  3CCL P;  3KPE A;  4PJ0 E;  1WRG A;  2OYH C;  4AQR D;  4W7Z A;  4BRY B;  1YIJ P;  3EFG A;  3HD7 A;  2ZT9 C;  4ZKP A;  1T8Z A;  3CX5 I;  4DZO A;  4I2L C;  4WVZ A;  2CPB A;  1NTZ J;  5TIS H;  2W6J H;  1GU4 A;  4BRY A;  1GMJ A;  3C8V A;  4PD4 E;  1M57 D;  2KS1 B;  3GF3 A;  1NU1 G;  1PIX A;  1QVG O;  2E5T A;  3SFE C;  4PV1 C;  2H89 C;  2B89 A;  1RE4 C;  2R3C A;  3KQG A;  1NOH A;  3H1I D;  3LIE A;  1GU5 A;  3M9H A;  3CCU P;  4XE5 B;  2H8P D;  1LWU A;  4BWN A;  1NKN A;  2IBZ E;  4DT0 A;  3L70 G;  1LNQ A;  2N9B A;  2KYV A;  1BE3 J;  1SQB G;  1NWQ A;  4IL6 H;  4H13 B;  4UB6 E;  1CZQ A;  1N86 A;  1S5L X;  1N7S A;  1YI2 P;  1JM0 A;  4C7R A;  4Z1M H;  1EDK A;  2YMK A;  4UB8 H;  2BCC G;  2WPQ A;  1A02 J;  2NPS A;  3GW6 A;  3IR9 A;  3EWK A;  1HGV A;  3GLM A;  1KOR A;  1LT1 A;  5AW1 B;  3RL0 C;  2PFX A;  4IL6 X;  3VTP C;  1E79 H;  1Z56 A;  1EXI A;  2YKP A;  2N1T D;  5KJ7 D;  1NAY A;  2WZ7 A;  4EDF A;  5AVR B;  3E7K A;  1URQ C;  2Y9Z A;  1FDO A;  1PL5 A;  1LP1 B;  1L0L K;  1LTS C;  1HJB A;  1KTM A;  2AXT E;  1YIT P;  1PPJ E;  2BAS A;  3H6P A;  1J2J B;  1KYO H;  5H2F E;  2Y0D A;  4PD4 D;  1P84 H;  3ZDM A;  1NTZ G;  2L5G B;  3TK1 A;  2HYN A;  1SFC B;  1HVV A;  1FAV A;  2B88 A;  1LP1 A;  1NU1 D;  2IYP A;  5AW8 B;  5K5G B;  1W2B O;  1TU3 F;  5APV A;  1KB9 I;  1VQ8 P;  2ZFC A;  3MD0 A;  1EZV E;  1RF1 C;  2AEM A;  5CCH D;  2IZ0 A;  3V5B A;  3FXE A;  2IBZ D;  1GZL A;  2M5A A;  2QJY B;  3BVH A;  4H44 B;  2HLO A;  1SQP K;  5GTH H;  3H1K E;  2A06 G;  3BCC G;  1BSN A;  4MN4 C;  4RKU J;  1Y47 A;  3PRJ A;  2WWW A;  4JQ0 D;  3M9B A;  1KIL B;  3L75 J;  2R3S A;  3QWO C;  1LT9 C;  3SWK A;  1VF5 B;  2O1K A;  3HE4 B;  1BCC J;  3B4S A;  4IFD K;  2G3A A;  5AVV B;  4OGQ B;  2WMM A;  3P7K A;  1KFN A;  3H1J E;  3NMD A;  2QM7 A;  3L74 J;  3V4W A;  1BDC A;  1PV3 A;  3HE4 A;  4WY4 C;  1L4A A;  3Q5S A;  3M9Q A;  1IFN A;  2OYO A;  4D6T J;  2FXM A;  3H1L E;  3HUS B;  1YJ9 P;  1NHL A;  2R44 A;  2QJK B;  3MGN A;  2XND H;  5AVS B;  2E75 B;  4Y99 B;  3NFQ A;  1PPJ D;  3G4S P;  1HJ0 A;  3VMZ A;  3R4Y A;  2H43 A;  3CL3 D;  2LKM A;  3TDK A;  2O01 N;  3RGU A;  1FZC A;  3KZI H;  2YO2 A;  2YXQ B;  5GTI E;  1FJP A;  1FZA A;  2N1T C;  1HGZ A;  1VL2 A;  2FFD C;  2KP8 A;  1RE3 C;  2Q9I A;  1GW3 A;  2FYU J;  3G6E P;  3LID A;  4U3F G;  1L0N E;  2ZXE B;  1U7J A;  3PHL A;  1ZME C;  2PRR A;  5KLI C;  3CX5 H;  2V7Q H;  4HB1 A;  1LTJ C;  1Q2N A;  3CXH I;  2YO3 A;  5KAI E;  3P8M C;  2WPR A;  4Y28 J;  3PLN A;  3H1K D;  2FYZ A;  4NPE A;  5KTB A;  3E1I A;  2JO1 A;  3BCC D;  3B5N A;  2OYH B;  1SQB K;  3KXD A;  2ZT9 B;  1GTW A;  5EFW B;  3GHG C;  3PTZ A;  1SQX K;  2E76 D;  5AVW B;  3L36 A;  3L75 G;  2KSE A; 
#chains in the Genus database with same CATH homology
 5B66 E;  1W5C E;  4UB6 E;  2AXT E;  4UB8 E;  3JCU E;  5TIS E;  5GTI E;  4IL6 E;  5H2F E;  3KZI E;  3A0B E;  3WU2 E;  5KAI E;  1S5L E;  5B5E E;  4PJ0 E;  3A0H E;  5E79 E;  5KAF E;  5GTH E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...