3L75G

Cytochrome bc1 complex from chicken with fenamidone bound
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title FAMOXADONE AND RELATED INHIBITORS BIND LIKE METHOXY ACRYLATE INHIBITORS IN THE Qo SITE OF THE BC1 COMPL AND FIX THE RIESKE IRON-SULFUR PROTEIN IN A POSITIO CLOSE TO BUT DISTINCT FROM THAT SEEN WITH STIGMATELLIN AND OTHER "DISTAL" Qo INHIBITORS.
rcsb
molecule tags Oxidoreductase
total genus 19
structure length 81
sequence length 81
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3l75G00
1SQBG 3H1KG 3L74G 1BGYG 1NTMG 1EZVG 3H1JG 3L72G 1BE3G 3CWBG 3L73G 3CX5H 1PPJG 3CXHH 1NTKG 4D6TG 2A06G 1KB9H 1PP9G 4U3FG 5KLVG 3H1HG 2BCCG 3BCCG 3L71G 1SQVG 1SQXG 3H1IG 1NTZG 1L0NG 1SQPG 1BCCG 1L0LG 1NU1G 3H1LG 3L70G 1SQQG 3L75G 4PD4H 1KYOH 1P84H 2FYUG 2IBZG 3TGUG
chains in the Genus database with same CATH superfamily
3AEBC 3Q5SA 3AECC 5CCGD 1KQSO 1IZNB 3T97B 4LLHA 2E42A 2YKQA 3HTKB 1L0ND 3M0DC 1Q7YQ 1N8RQ 1WT6A 2HLOA 2O01H 2KNCA 1MFTA 1DX7A 3H1JE 2RN0A 4EDFA 1KB9E 3L73E 3M06A 1LTBC 2ZJSE 3SFDC 5GTIH 3VP9A 1PZQA 4B86A 1DIPA 1IFMA 4GODA 2RH0A 3LW5J 3H6PA 4IL6X 1HTLC 1K05A 1L0NG 4W7YA 2IBZG 3VMAA 1JTHB 3CXHE 4H13C 4D6TE 3CCMP 3L75J 2JEEA 3RBXA 1CI6B 2K1AA 2FFDC 1L0LD 5AVWB 4W7ZA 3EQ2A 2OYIA 1KYOH 2R44A 3H1KE 4I6MC 1BE3E 1QLED 2H43A 1FJPA 1H0TB 4XFJA 1PIXA 4WY4D 1LTJB 2A06E 2E75C 1S5LE 1VPCA 1URQB 3EWKA 1S9KD 3CD6P 1L0LG 2HPCA 4PV1B 1JM0A 3NFQA 1SFCB 3NTNA 3KZIH 5GTIE 3L73D 4K3AA 4RESB 2K88A 3AE5C 1Q81Q 1NJIQ 2GUVA 2ZYAA 1Q90D 3L71G 4GT1A 3ITKA 2G8YA 1EZVI 1ZV8A 3CX5D 2ZVOB 4OGQD 1T2KC 4WWIA 3KYQA 4AQRD 1GD2E 1M8OB 1FDOA 3G4SP 3G71P 1ZP0C 1MZ9A 1KYOE 1QVGO 1USDA 3S4RA 2M3BA 5H2FH 1XTCC 4EYYQ 2JDIH 2W27A 4I7ZC 1RF0A 2LXCB 5C39A 3OJAB 3KZIE 4M3LA 3R2PA 4C7NB 1LGHB 5CHXA 1BDDA 2FYUG 2YXRB 1AA0A 3AE1C 1FDIA 1JB0J 2M0BA 2WMMA 4H13D 1L4AC 1QX8A 1DEBA 1GZLA 1HBWA 2ZFCA 3CWBJ 1N7SA 3N7NA 5AVSB 2KNCB 1VQ9P 2Y9YA 5CCHA 1JY3N 3L71J 1S3JA 2Q5UA 1K9MQ 1W2BO 2R5DA 4PD4I 1E79H 2AEMA 1KYOD 1NAFA 4XE5B 1S4XA 5KTBA 2E75D 2ZT9C 1Y47A 2R3SA 1NU1D 1T3UA 3HD7C 1SQBD 2E76B 1BGYE 3VOPA 1HH0A 3L36A 1EDKA 4EI2A 1LJ2A 1SQVD 1SQXE 3PH0A 5AVTB 3AEFC 1RQVA 1NU1G 2WSEH 5APUA 1J1DB 3U1AA 1SQBG 3L72E 3TNUA 3A2AA 1PPJG 2QJPC 4IL6H 3B5NB 2FYUJ 3AE2C 3H1ID 1URQD 1SQVG 4TLFA 1AVOA 2D2CD 5B5EH 2C0WA 1ZRTD 2XU6A 2QM7A 1SFCD 1N7LA 1EZVG 1IC2A 4JPZB 1VF5B 2YIUC 1NTKE 1KILE 1PP9G 2A45I 3CCSP 2BCCG 5BU8B 3TGUJ 1NAYA 3D71A 4EIJA 3H1IG 2Q6QA 1JCCA 2WPVB 2A45H 2NPSC 3R4YA 1M1KQ 1RY3A 2WPQA 3RK2B 2OQQA 1LT1A 2NZ2A 4NPDA 2IX7C 2KP8A 4GOFA 4BWNA 3BCCJ 4IL6E 3U59A 1IFPA 1ZLLA 4O9BA 3LW5H 1S1CX 4AUWA 2YKOA 2V4HA 3SWFA 3OA7A 1NWQA 1VQMP 2YKPA 2I1JA 5KAFH 4H0LB 1YQ3C 1L2PA 3L70J 3VN0A 3BASA 1N73C 1JOCA 5AW9B 1RF1C 1PV3A 2DW3A 1BCCD 3RL0g 5APQA 1JY3O 1SQQE 1GW3A 5AW2B 2I1KA 1N7SB 1PP9J 3S1KA 2BCCJ 5AW1B 1YJ9P 1U7MA 1R5SA 2QVAA 1OW8A 1HUCA 4Y99C 3VTPC 1EXIA 3A5TA 5KLVE 3EFFK 1VQ6P 4NPFX 1T6AA 2JR8A 2ZXXA 1W5CE 3H1LD 1K04A 3GMAA 3CPWO 2WZ7A 1BCCG 3AE6C 5AVXB 3TK1A 4EOTA 1YTZI 5AVYB 2ITAA 1PGJA 5CCGC 1JY2P 3L35A 1FZCA 1LTSC 3CC4P 2N9YB 3F5HA 5KLIC 1X79B 1SQXK 3U1CA 1KORA 3L75E 3SSUA 3O8ZA 1LWUC 5KAFE 1RQUA 1S72P 2GM4A 1YHQP 5GTHH 2M5AA 1LTJA 2R3CA 1X22A 3QWOC 4I2LC 3CCEP 3GHGC 2KUBA 1VL2A 1NTZG 1SQQD 2KIKA 2Q7CA 1LTGC 2IYOA 3L74D 3CCJP 1FBMA 2QJKB 5AVZB 2OTLP 3O6QA 3M9QA 2NRGA 1VF5D 1M1JC 5KLVD 2XKMA 1KQGB 1NTKK 1SVFA 4Y28J 1AFOA 1VQPP 1R5LA 1GU4A 3CC7P 1OZHA 1NO4A 1VQOP 3KXDA 2QSIA 4WY4C 3MTUE 2QJYB 2XNXA 2JO1A 3RK2D 3IR9A 3W68A 2KLUA 1EXJA 2LXBA 3B71A 2IBZE 5GTHE 1G2CA 2HG5D 1MFZA 4GIFA 2OTKE 5BU5A 3CX5I 3E7KA 1GTWA 4DZOA 4OGQC 3B8EB 3P32A 2XV5A 1HJ0A 3NMDA 3AEDC 3H25A 1M90Q 1NTZJ 4H0LD 2PAJA 1NKZB 3H1HD 1KILA 1GL2A 5DJUB 2WWWA 4LC1A 2C9NY 2PFXA 1N7SD 3L37A 1VQ8P 4DT0A 1SQQK 5CCHD 3BRTB 2FY8A 3CWBE 3JC22 1NKNA 1FS0E 2P1JA 2W8ZA 5L8RJ 3H1HG 2WVRA 5KLVK 2VRSA 3NXSA 4L76A 1Q2NA 3MUDA 2KZJA 2Y0CA 3MP7B 2Q9IA 3II6A 1FU1A 2IZ0A 1JUNA 3V5BA 3M91A 2WITA 2Z4EA 1RE4C 3AEGC 1FZCB 1NH4A 2B88A 5AW8B 5KJ7C 5AVVB 1ZXGA 2JKVA 3TDKA 1LT9A 4U3FJ 1EDLA 1DD3A 1ZOYC 3BRVB 2B9BA 2V7QJ 1SQPJ 2M5AB 1Y8AA 3B5NA 1OVUA 3GW6A 4L73A 2AEJA 5APYA 4ASWA 1H8AA 1SS1A 3M9BA 3FXEA 4Z1MH 3H1JD 1KB9D 3WUTA 3O6QB 5AVQB 2QIWA 5TJHA 3GG2A 3HUSA 2OYHA 2AXTH 1MV8A 3ABVC 3PTZA 2OTJP 2WPRA 3CXHD 3TGUE 3LIEA 1LTJC 3H1JG 1JY3P 3TF5A 4OVNF 3L73G 1UIXA 2W83C 4D6TD 3CCVP 2W90A 1L0NJ 2AXCA 1URQC 2OARA 2CPSA 3FX0A 4YPCA 2D2CC 2R5BA 1KN7A 2K3RA 4PV1C 1SFCC 2O1JA 2WQYC 1FOSE 3H1KD 1G2CB 1BE3D 2MKVA 2A06D 4D6TG 1OMIA 3BCCE 3TSIA 3GF7A 2KK7A 1JMBA 1M7LA 4JYBA 3P8CE 3H1KG 5CBOA 1BE3G 1PPJE 1RE3A 3I55P 5CBNA 2AXTE 1L0LJ 3RL0B 1KILB 2A06G 1P84I 1GL2B 3WUUA 2POHA 3L70E 2M8RA 1LP1A 1DEEG 3HRNA 5KJ7D 1DH3A 1P84H 2H8PD 1EZVE 2KZIA 3SWYA 1CZQA 1PP9E 1BSNA 1YTZT 5TISH 3VMYA 4YXDC 2CK3H 2PRRA 3G9RA 2BEQD 5H2FE 3L73J 2WT7B 4HJGH 4JBZA 2HR3A 4PD4H 4IFMA 2Z5IA 2H7HA 4HB1A 2KLVA 1OWAA 2ZVNB 3A0BH 1VQ7P 3PJSK 4KT0J 1AQTA 2Q1KA 1X9VA 1TU3F 3S9OA 3WU2H 1LT9B 2FXOA 4R4LA 1NTME 3PP5A 1ZMEC 1JCDA 1H88A 2YIUB 1QL2A 3M0AA 4HH2A 2LKMA 2N1TA 3PHLA 1QVFO 2H88C 1GK4A 3AE7C 4PV1D 2KYVA 5TISE 2ZYDA 2FXMA 5B66H 4PD4E 3HUSB 3PRJA 2OYHB 2SPZA 4R4MA 2OYIC 2HFED 3IFMA 3VMXA 1J1DC 4JF7A 3AE9C 1BGYD 3A0BE 1XTGB 1FOSF 5APWA 1IK9A 2Q3IA 1A02J 1SQXD 3WU2E 3PLNA 4MN4C 1JO5A 2W6BA 3WMM0 1VQ4P 1NTMD 3L72D 1VF5C 3FXDA 1NU1J 5B5EE 1SQBJ 1SQXG 1RF1B 1IFDA 3M0DA 4ZKPA 3RK3B 5B66E 3L72G 1SQVJ 1NTKD 3Q2YA 3RK2C 3RL0D 1KILD 2L5GB 1NVOA 4Y99B 1GL2D 2CPBA 2Z5HA 1VQNP 2W6JH 2QE7H 1KC8Q 1LP1B 1YITP 1RHZB 5EFWB 2V7QH 1HJBA 1W2EA 2E74B 1RF0C 3H1IJ 4C7RA 2XZRA 1NTKG 4RO0A 1NGMB 3LIDA 4HYTB 4YTPC 3HE5B 2FFDA 2E76D 4IFDK 1H89A 1LWUB 4H0LC 2YO2A 3D6ZA 3JSVC 1EDJA 1WMKA 3I5CA 4TT3H 2IFNA 1CW5A 1N7SC 4UB8H 3GHGB 3H1LG 1J1EC 4AYCA 5CCHC 1ZW0A 3C1LA 1R8EA 4GKGA 4DOJA 2O3JA 3KQGA 1YJNP 1NTMK 2K9YA 2KOGA 4IOIH 4U3FE 2FXPA 2FYNC 3B5ND 2B89A 2N1TB 1SQPE 1M56D 3FWLA 3CCUP 1HGZA 1GK6A 1VQ5P 4H44B 2QRXA 4OH8B 3RK3E 4YXWH 3VMZA 1X0TA 1BSHA 3C8VA 1Y9BA 2KS1A 2P7JA 2IYPA 1IJDB 3GLMA 1OW6A 1SQQG 3A7OA 1KMIZ 2YMKA 1OW7A 3G6EP 1ZR2A 3L74G 1T8ZA 2BEZF 3CCLP 1NOHA 2IZ1A 1BCCJ 1S2EA 4UB8E 2Y9ZA 3ZDMA 5KLVG 2Y0EA 2KSEA 2YO3A 2JWDA 1L0NE 1KQLA 1U57A 2YMYA 3L75D 2QJKC 2UWJE 1KB9I 1EQ7A 5APTA 1JY2N 1EC5A 3CMEP 2GA1A 3H1LJ 2HYNA 1L4AA 1RH5B 4C46A 5KKZC 2G3AA 3CXHI 1IFJA 4ASVA 1PFIA 5CMZA 3L75G 5AW5B 1FC2C 1G1IA 2QJYC 5AW0B 2R32A 1HWTC 3JCUH 5APVA 3CX5H 1Q82Q 3QH9A 3KHUA 1L0LE 1NTZK 1ZR4A 2P58A 2E74D 3V2PA 3HD7A 5BVZA 3CC2P 4L74A 1K73Q 4H13B 3V2RA 1SQQJ 3L71E 3V2QA 3L74J 5AW4B 1Z56A 2IPPA 1S9KE 2IBZD 2Y0DA 1S5LH 2WT7A 2FFDB 5KLVJ 2M3EA 1FE6A 3FGAD 4WBAA 1FZBA 2PP6A 1KZUB 2J58A 3MD0A 2C9LY 2E75B 2K9JB 4N6JA 4JYCA 2P2UA 3VP8A 1LTIC 1OX3A 3JCUE 3CX5E 5M1BA 4DCKA 4IFFA 2XDJA 1KYOI 1E5WA 2N1TD 3A3YB 1SQPK 4H44D 2FYUE 3CWBD 1FZCC 3MHVA 2BASA 2KB7P 3CMAP 1KTMA 1U7JA 2NPSA 3P8MC 3L71D 5AW7B 3V4WA 1QGKB 2KS1B 1HVVA 3Q1MA 2WSCJ 2D2CB 2WSSH 2AEFA 1GDTA 1AJYA 4K35A 2HODB 3H1HJ 1HF9A 3RGUA 3CWBG 2P10A 3MZWB 4N78E 1OIPA 1FZEA 2YXQB 3AE8C 4I7ZB 4WVZA 2E43A 1JY2O 5APXA 1L0NK 3TYYA 3CCQP 2XNDH 2MJZA 4NPEA 4XA4A 2E5YA 4L75A 1ZN5A 1SP4A 4LGDE 1L4AB 2JJLA 1N73A 2Q3EA 4OWFA 1RF1A 1NU1E 2FYUD 3SWKA 2IDBA 2KSJA 4ZMDA 1SQBE 4PJ0H 3CLQA 1Q86Q 1FZGA 1SQVE 1QEXA 2JP3A 3CCRP 2WSFJ 2ZT9B 3KDPB 3TGUD 1L0LK 1UIIA 2JWAA 2PGDA 1PGOA 3HD7B 2J5UA 5AW6B 5CCGA 4N78D 4BRYA 2KI7B 2BCCE 1NYHA 3V4QA 1EDIA 3P7KA 2B87A 1VDFA 3H1IE 3H1JJ 1AVYA 4QMAA 3HE5A 1MUUA 1ZRTE 1USEA 1YQ4C 5CJ0A 3TGUG 4GDOA 1LWUA 3RL0C 1KILC 2QM8A 1GL2C 1JEKA 3V6IA 3BCCD 1LTTC 1G1JA 2QJPB 1NHLA 1QL1A 4PJ0E 3GHGA 3P8CD 4D6TJ 4N3YB 1N86A 1PPJD 1OVRA 1YBKA 1FAVA 1WRGA 1KQFB 3FWNA 2E5TA 3AEEC 4JQ0D 1M1JA 1KD1Q 1FJKA 3BCCG 5AVUB 3H1KJ 3IF4A 3MUDC 2WPSA 1P84E 3L70D 1BE3J 3GF3A 2OYIB 2E76C 2H89C 2L91A 3D70A 1IO4A 1EZVD 2FYUK 5KAIH 3IAOA 5AW3B 1T2KD 1GMJA 1IFIA 2QG4A 2O01J 1PP9D 3I56P 2NPSB 4WY4A 2BCCD 3Q5RA 3M9HA 2QA4P 4HKZH 1AV1A 1IK7A 1LT9C 3KPEA 3A0HH 3H32A 2HPCB 3L70G 1KFMA 2RMZA 2ZXEB 3F89A 3HE4A 1A02F 1N2DC 3B5NC 3CL3D 3B4SA 1K8AQ 1CSBA 1PGQA 1BCCE 1GW4A 4RKUJ 4BXLA 3D6YA 4GOEA 1D7MA 1M57D 1BGYG 2O01N 2O1KA 3MGNA 2IFMA 1YYCA 3WUVA 1J2JB 1BDCA 3HUSC 2OYHC 4UB6H 5E79H 2I8DA 1L4AD 4ZKUA 1P84D 2OYOA 1N73B 3H1LE 2QEXP 5KAIE 1VQLP 4U7JA 1NU1K 2WTYA 3BATA 1NTMG 1S5LX 1SQBK 4W80A 2W6AA 3OW2O 3A0HE 4PD4D 1YI2P 2OGUA 1NTZE 1PL5A 2RKLA 1SQVK 2ZT9D 3V2NA 1LNQA 3HD7D 2ZAEB 2GUSA 3T97A 3K5BA 4BRYB 3AE4C 1RE4A 1KFNA 5CJ4A 3HTKA 2B87B 3E1RA 5KLIB 2FBWC 3AEAC 3RBZA 3RK3C 5KJ7A 3L74E 1J1EB 1RE3C 5AVRB 1HGVA 4UB6E 3Q3DA 5E79E 1JMMA 1VQKP 2N9BA 2WSCH 2LR2A 3IN6A 4KJMA 3OAKA 2FYNB 2K9JA 1BGYJ 3W67A 1FDMA 3UIAA 3C9IA 2P67A 2E74C 1JTHA 3CI9A 1JNMA 1FZAA 1SQXJ 2C0XA 3E1IA 4I1LA 1M1JB 1NTZD 2IBZI 1FZFA 1CI6A 1NTMJ 1T3JA 3L72J 1YJWP 4ZNCA 1AQ5A 3USSA 3TNUB 5APSA 1DD4A 1H0TA 2NPSD 4A7PA 4WY4B 1URQA 2A45G 3H32B 1GU5A 4CPGA 1NTKJ 1SFCA 5K5GB 1IFNA 2HODA 5DJTB 3HE4B 3BVHA 1OVVA 3H1HE 2N1TC 4RJTA 2WSFH 3N4XA 3MIWA 4H44C 4KHXA 3AE3C 5KKZB 4OGQB 2WSEJ 2KXPB 3L4FA 3EFGA 4U3FD 2K37A 1KB9H 2YNYA 4DJGA 3Q5PA 4WB4A 1SQPD 2J59M 1SLQA 1LTAC 3VYIA 1YIJP 3SFEC 3RK3D 1KV4A 1X8YA 3CXHH 4U3FG 1PGPA 3G3ZA 1SQPG 2FYZA 1OFCX 4C7NA 1OXZA 2FKWB 1MKMA 2ZYGA
chains in the Genus database with same CATH topology
1SQBG 3H1KG 3L74G 1BGYG 1NTMG 1EZVG 3H1JG 3L72G 1BE3G 3CWBG 3L73G 3CX5H 1PPJG 3CXHH 1NTKG 4D6TG 2A06G 1KB9H 1PP9G 4U3FG 5KLVG 3H1HG 2BCCG 3BCCG 3L71G 1SQVG 1SQXG 3H1IG 1NTZG 1L0NG 1SQPG 1BCCG 1L0LG 1NU1G 3H1LG 3L70G 1SQQG 3L75G 4PD4H 1KYOH 1P84H 2FYUG 2IBZG 3TGUG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQB G;  3H1K G;  3L74 G;  1BGY G;  1NTM G;  1EZV G;  3H1J G;  3L72 G;  1BE3 G;  3CWB G;  3L73 G;  3CX5 H;  1PPJ G;  3CXH H;  1NTK G;  4D6T G;  2A06 G;  1KB9 H;  1PP9 G;  4U3F G;  5KLV G;  3H1H G;  2BCC G;  3BCC G;  3L71 G;  1SQV G;  1SQX G;  3H1I G;  1NTZ G;  1L0N G;  1SQP G;  1BCC G;  1L0L G;  1NU1 G;  3H1L G;  3L70 G;  1SQQ G;  3L75 G;  4PD4 H;  1KYO H;  1P84 H;  2FYU G;  2IBZ G;  3TGU G; 
#chains in the Genus database with same CATH topology
 3AEB C;  3Q5S A;  3AEC C;  5CCG D;  1KQS O;  1IZN B;  3T97 B;  4LLH A;  2E42 A;  2YKQ A;  3HTK B;  1L0N D;  3M0D C;  1Q7Y Q;  1N8R Q;  1WT6 A;  2HLO A;  2O01 H;  2KNC A;  1MFT A;  1DX7 A;  3H1J E;  2RN0 A;  4EDF A;  1KB9 E;  3L73 E;  3M06 A;  1LTB C;  2ZJS E;  3SFD C;  5GTI H;  3VP9 A;  1PZQ A;  4B86 A;  1DIP A;  1IFM A;  4GOD A;  2RH0 A;  3LW5 J;  3H6P A;  4IL6 X;  1HTL C;  1K05 A;  1L0N G;  4W7Y A;  2IBZ G;  3VMA A;  1JTH B;  3CXH E;  4H13 C;  4D6T E;  3CCM P;  3L75 J;  2JEE A;  3RBX A;  1CI6 B;  2K1A A;  2FFD C;  1L0L D;  5AVW B;  4W7Z A;  3EQ2 A;  2OYI A;  1KYO H;  2R44 A;  3H1K E;  4I6M C;  1BE3 E;  1QLE D;  2H43 A;  1FJP A;  1H0T B;  4XFJ A;  1PIX A;  4WY4 D;  1LTJ B;  2A06 E;  2E75 C;  1S5L E;  1VPC A;  1URQ B;  3EWK A;  1S9K D;  3CD6 P;  1L0L G;  2HPC A;  4PV1 B;  1JM0 A;  3NFQ A;  1SFC B;  3NTN A;  3KZI H;  5GTI E;  3L73 D;  4K3A A;  4RES B;  2K88 A;  3AE5 C;  1Q81 Q;  1NJI Q;  2GUV A;  2ZYA A;  1Q90 D;  3L71 G;  4GT1 A;  3ITK A;  2G8Y A;  1EZV I;  1ZV8 A;  3CX5 D;  2ZVO B;  4OGQ D;  1T2K C;  4WWI A;  3KYQ A;  4AQR D;  1GD2 E;  1M8O B;  1FDO A;  3G4S P;  3G71 P;  1ZP0 C;  1MZ9 A;  1KYO E;  1QVG O;  1USD A;  3S4R A;  2M3B A;  5H2F H;  1XTC C;  4EYY Q;  2JDI H;  2W27 A;  4I7Z C;  1RF0 A;  2LXC B;  5C39 A;  3OJA B;  3KZI E;  4M3L A;  3R2P A;  4C7N B;  1LGH B;  5CHX A;  1BDD A;  2FYU G;  2YXR B;  1AA0 A;  3AE1 C;  1FDI A;  1JB0 J;  2M0B A;  2WMM A;  4H13 D;  1L4A C;  1QX8 A;  1DEB A;  1GZL A;  1HBW A;  2ZFC A;  3CWB J;  1N7S A;  3N7N A;  5AVS B;  2KNC B;  1VQ9 P;  2Y9Y A;  5CCH A;  1JY3 N;  3L71 J;  1S3J A;  2Q5U A;  1K9M Q;  1W2B O;  2R5D A;  4PD4 I;  1E79 H;  2AEM A;  1KYO D;  1NAF A;  4XE5 B;  1S4X A;  5KTB A;  2E75 D;  2ZT9 C;  1Y47 A;  2R3S A;  1NU1 D;  1T3U A;  3HD7 C;  1SQB D;  2E76 B;  1BGY E;  3VOP A;  1HH0 A;  3L36 A;  1EDK A;  4EI2 A;  1LJ2 A;  1SQV D;  1SQX E;  3PH0 A;  5AVT B;  3AEF C;  1RQV A;  1NU1 G;  2WSE H;  5APU A;  1J1D B;  3U1A A;  1SQB G;  3L72 E;  3TNU A;  3A2A A;  1PPJ G;  2QJP C;  4IL6 H;  3B5N B;  2FYU J;  3AE2 C;  3H1I D;  1URQ D;  1SQV G;  4TLF A;  1AVO A;  2D2C D;  5B5E H;  2C0W A;  1ZRT D;  2XU6 A;  2QM7 A;  1SFC D;  1N7L A;  1EZV G;  1IC2 A;  4JPZ B;  1VF5 B;  2YIU C;  1NTK E;  1KIL E;  1PP9 G;  2A45 I;  3CCS P;  2BCC G;  5BU8 B;  3TGU J;  1NAY A;  3D71 A;  4EIJ A;  3H1I G;  2Q6Q A;  1JCC A;  2WPV B;  2A45 H;  2NPS C;  3R4Y A;  1M1K Q;  1RY3 A;  2WPQ A;  3RK2 B;  2OQQ A;  1LT1 A;  2NZ2 A;  4NPD A;  2IX7 C;  2KP8 A;  4GOF A;  4BWN A;  3BCC J;  4IL6 E;  3U59 A;  1IFP A;  1ZLL A;  4O9B A;  3LW5 H;  1S1C X;  4AUW A;  2YKO A;  2V4H A;  3SWF A;  3OA7 A;  1NWQ A;  1VQM P;  2YKP A;  2I1J A;  5KAF H;  4H0L B;  1YQ3 C;  1L2P A;  3L70 J;  3VN0 A;  3BAS A;  1N73 C;  1JOC A;  5AW9 B;  1RF1 C;  1PV3 A;  2DW3 A;  1BCC D;  3RL0 g;  5APQ A;  1JY3 O;  1SQQ E;  1GW3 A;  5AW2 B;  2I1K A;  1N7S B;  1PP9 J;  3S1K A;  2BCC J;  5AW1 B;  1YJ9 P;  1U7M A;  1R5S A;  2QVA A;  1OW8 A;  1HUC A;  4Y99 C;  3VTP C;  1EXI A;  3A5T A;  5KLV E;  3EFF K;  1VQ6 P;  4NPF X;  1T6A A;  2JR8 A;  2ZXX A;  1W5C E;  3H1L D;  1K04 A;  3GMA A;  3CPW O;  2WZ7 A;  1BCC G;  3AE6 C;  5AVX B;  3TK1 A;  4EOT A;  1YTZ I;  5AVY B;  2ITA A;  1PGJ A;  5CCG C;  1JY2 P;  3L35 A;  1FZC A;  1LTS C;  3CC4 P;  2N9Y B;  3F5H A;  5KLI C;  1X79 B;  1SQX K;  3U1C A;  1KOR A;  3L75 E;  3SSU A;  3O8Z A;  1LWU C;  5KAF E;  1RQU A;  1S72 P;  2GM4 A;  1YHQ P;  5GTH H;  2M5A A;  1LTJ A;  2R3C A;  1X22 A;  3QWO C;  4I2L C;  3CCE P;  3GHG C;  2KUB A;  1VL2 A;  1NTZ G;  1SQQ D;  2KIK A;  2Q7C A;  1LTG C;  2IYO A;  3L74 D;  3CCJ P;  1FBM A;  2QJK B;  5AVZ B;  2OTL P;  3O6Q A;  3M9Q A;  2NRG A;  1VF5 D;  1M1J C;  5KLV D;  2XKM A;  1KQG B;  1NTK K;  1SVF A;  4Y28 J;  1AFO A;  1VQP P;  1R5L A;  1GU4 A;  3CC7 P;  1OZH A;  1NO4 A;  1VQO P;  3KXD A;  2QSI A;  4WY4 C;  3MTU E;  2QJY B;  2XNX A;  2JO1 A;  3RK2 D;  3IR9 A;  3W68 A;  2KLU A;  1EXJ A;  2LXB A;  3B71 A;  2IBZ E;  5GTH E;  1G2C A;  2HG5 D;  1MFZ A;  4GIF A;  2OTK E;  5BU5 A;  3CX5 I;  3E7K A;  1GTW A;  4DZO A;  4OGQ C;  3B8E B;  3P32 A;  2XV5 A;  1HJ0 A;  3NMD A;  3AED C;  3H25 A;  1M90 Q;  1NTZ J;  4H0L D;  2PAJ A;  1NKZ B;  3H1H D;  1KIL A;  1GL2 A;  5DJU B;  2WWW A;  4LC1 A;  2C9N Y;  2PFX A;  1N7S D;  3L37 A;  1VQ8 P;  4DT0 A;  1SQQ K;  5CCH D;  3BRT B;  2FY8 A;  3CWB E;  3JC2 2;  1NKN A;  1FS0 E;  2P1J A;  2W8Z A;  5L8R J;  3H1H G;  2WVR A;  5KLV K;  2VRS A;  3NXS A;  4L76 A;  1Q2N A;  3MUD A;  2KZJ A;  2Y0C A;  3MP7 B;  2Q9I A;  3II6 A;  1FU1 A;  2IZ0 A;  1JUN A;  3V5B A;  3M91 A;  2WIT A;  2Z4E A;  1RE4 C;  3AEG C;  1FZC B;  1NH4 A;  2B88 A;  5AW8 B;  5KJ7 C;  5AVV B;  1ZXG A;  2JKV A;  3TDK A;  1LT9 A;  4U3F J;  1EDL A;  1DD3 A;  1ZOY C;  3BRV B;  2B9B A;  2V7Q J;  1SQP J;  2M5A B;  1Y8A A;  3B5N A;  1OVU A;  3GW6 A;  4L73 A;  2AEJ A;  5APY A;  4ASW A;  1H8A A;  1SS1 A;  3M9B A;  3FXE A;  4Z1M H;  3H1J D;  1KB9 D;  3WUT A;  3O6Q B;  5AVQ B;  2QIW A;  5TJH A;  3GG2 A;  3HUS A;  2OYH A;  2AXT H;  1MV8 A;  3ABV C;  3PTZ A;  2OTJ P;  2WPR A;  3CXH D;  3TGU E;  3LIE A;  1LTJ C;  3H1J G;  1JY3 P;  3TF5 A;  4OVN F;  3L73 G;  1UIX A;  2W83 C;  4D6T D;  3CCV P;  2W90 A;  1L0N J;  2AXC A;  1URQ C;  2OAR A;  2CPS A;  3FX0 A;  4YPC A;  2D2C C;  2R5B A;  1KN7 A;  2K3R A;  4PV1 C;  1SFC C;  2O1J A;  2WQY C;  1FOS E;  3H1K D;  1G2C B;  1BE3 D;  2MKV A;  2A06 D;  4D6T G;  1OMI A;  3BCC E;  3TSI A;  3GF7 A;  2KK7 A;  1JMB A;  1M7L A;  4JYB A;  3P8C E;  3H1K G;  5CBO A;  1BE3 G;  1PPJ E;  1RE3 A;  3I55 P;  5CBN A;  2AXT E;  1L0L J;  3RL0 B;  1KIL B;  2A06 G;  1P84 I;  1GL2 B;  3WUU A;  2POH A;  3L70 E;  2M8R A;  1LP1 A;  1DEE G;  3HRN A;  5KJ7 D;  1DH3 A;  1P84 H;  2H8P D;  1EZV E;  2KZI A;  3SWY A;  1CZQ A;  1PP9 E;  1BSN A;  1YTZ T;  5TIS H;  3VMY A;  4YXD C;  2CK3 H;  2PRR A;  3G9R A;  2BEQ D;  5H2F E;  3L73 J;  2WT7 B;  4HJG H;  4JBZ A;  2HR3 A;  4PD4 H;  4IFM A;  2Z5I A;  2H7H A;  4HB1 A;  2KLV A;  1OWA A;  2ZVN B;  3A0B H;  1VQ7 P;  3PJS K;  4KT0 J;  1AQT A;  2Q1K A;  1X9V A;  1TU3 F;  3S9O A;  3WU2 H;  1LT9 B;  2FXO A;  4R4L A;  1NTM E;  3PP5 A;  1ZME C;  1JCD A;  1H88 A;  2YIU B;  1QL2 A;  3M0A A;  4HH2 A;  2LKM A;  2N1T A;  3PHL A;  1QVF O;  2H88 C;  1GK4 A;  3AE7 C;  4PV1 D;  2KYV A;  5TIS E;  2ZYD A;  2FXM A;  5B66 H;  4PD4 E;  3HUS B;  3PRJ A;  2OYH B;  2SPZ A;  4R4M A;  2OYI C;  2HFE D;  3IFM A;  3VMX A;  1J1D C;  4JF7 A;  3AE9 C;  1BGY D;  3A0B E;  1XTG B;  1FOS F;  5APW A;  1IK9 A;  2Q3I A;  1A02 J;  1SQX D;  3WU2 E;  3PLN A;  4MN4 C;  1JO5 A;  2W6B A;  3WMM 0;  1VQ4 P;  1NTM D;  3L72 D;  1VF5 C;  3FXD A;  1NU1 J;  5B5E E;  1SQB J;  1SQX G;  1RF1 B;  1IFD A;  3M0D A;  4ZKP A;  3RK3 B;  5B66 E;  3L72 G;  1SQV J;  1NTK D;  3Q2Y A;  3RK2 C;  3RL0 D;  1KIL D;  2L5G B;  1NVO A;  4Y99 B;  1GL2 D;  2CPB A;  2Z5H A;  1VQN P;  2W6J H;  2QE7 H;  1KC8 Q;  1LP1 B;  1YIT P;  1RHZ B;  5EFW B;  2V7Q H;  1HJB A;  1W2E A;  2E74 B;  1RF0 C;  3H1I J;  4C7R A;  2XZR A;  1NTK G;  4RO0 A;  1NGM B;  3LID A;  4HYT B;  4YTP C;  3HE5 B;  2FFD A;  2E76 D;  4IFD K;  1H89 A;  1LWU B;  4H0L C;  2YO2 A;  3D6Z A;  3JSV C;  1EDJ A;  1WMK A;  3I5C A;  4TT3 H;  2IFN A;  1CW5 A;  1N7S C;  4UB8 H;  3GHG B;  3H1L G;  1J1E C;  4AYC A;  5CCH C;  1ZW0 A;  3C1L A;  1R8E A;  4GKG A;  4DOJ A;  2O3J A;  3KQG A;  1YJN P;  1NTM K;  2K9Y A;  2KOG A;  4IOI H;  4U3F E;  2FXP A;  2FYN C;  3B5N D;  2B89 A;  2N1T B;  1SQP E;  1M56 D;  3FWL A;  3CCU P;  1HGZ A;  1GK6 A;  1VQ5 P;  4H44 B;  2QRX A;  4OH8 B;  3RK3 E;  4YXW H;  3VMZ A;  1X0T A;  1BSH A;  3C8V A;  1Y9B A;  2KS1 A;  2P7J A;  2IYP A;  1IJD B;  3GLM A;  1OW6 A;  1SQQ G;  3A7O A;  1KMI Z;  2YMK A;  1OW7 A;  3G6E P;  1ZR2 A;  3L74 G;  1T8Z A;  2BEZ F;  3CCL P;  1NOH A;  2IZ1 A;  1BCC J;  1S2E A;  4UB8 E;  2Y9Z A;  3ZDM A;  5KLV G;  2Y0E A;  2KSE A;  2YO3 A;  2JWD A;  1L0N E;  1KQL A;  1U57 A;  2YMY A;  3L75 D;  2QJK C;  2UWJ E;  1KB9 I;  1EQ7 A;  5APT A;  1JY2 N;  1EC5 A;  3CME P;  2GA1 A;  3H1L J;  2HYN A;  1L4A A;  1RH5 B;  4C46 A;  5KKZ C;  2G3A A;  3CXH I;  1IFJ A;  4ASV A;  1PFI A;  5CMZ A;  3L75 G;  5AW5 B;  1FC2 C;  1G1I A;  2QJY C;  5AW0 B;  2R32 A;  1HWT C;  3JCU H;  5APV A;  3CX5 H;  1Q82 Q;  3QH9 A;  3KHU A;  1L0L E;  1NTZ K;  1ZR4 A;  2P58 A;  2E74 D;  3V2P A;  3HD7 A;  5BVZ A;  3CC2 P;  4L74 A;  1K73 Q;  4H13 B;  3V2R A;  1SQQ J;  3L71 E;  3V2Q A;  3L74 J;  5AW4 B;  1Z56 A;  2IPP A;  1S9K E;  2IBZ D;  2Y0D A;  1S5L H;  2WT7 A;  2FFD B;  5KLV J;  2M3E A;  1FE6 A;  3FGA D;  4WBA A;  1FZB A;  2PP6 A;  1KZU B;  2J58 A;  3MD0 A;  2C9L Y;  2E75 B;  2K9J B;  4N6J A;  4JYC A;  2P2U A;  3VP8 A;  1LTI C;  1OX3 A;  3JCU E;  3CX5 E;  5M1B A;  4DCK A;  4IFF A;  2XDJ A;  1KYO I;  1E5W A;  2N1T D;  3A3Y B;  1SQP K;  4H44 D;  2FYU E;  3CWB D;  1FZC C;  3MHV A;  2BAS A;  2KB7 P;  3CMA P;  1KTM A;  1U7J A;  2NPS A;  3P8M C;  3L71 D;  5AW7 B;  3V4W A;  1QGK B;  2KS1 B;  1HVV A;  3Q1M A;  2WSC J;  2D2C B;  2WSS H;  2AEF A;  1GDT A;  1AJY A;  4K35 A;  2HOD B;  3H1H J;  1HF9 A;  3RGU A;  3CWB G;  2P10 A;  3MZW B;  4N78 E;  1OIP A;  1FZE A;  2YXQ B;  3AE8 C;  4I7Z B;  4WVZ A;  2E43 A;  1JY2 O;  5APX A;  1L0N K;  3TYY A;  3CCQ P;  2XND H;  2MJZ A;  4NPE A;  4XA4 A;  2E5Y A;  4L75 A;  1ZN5 A;  1SP4 A;  4LGD E;  1L4A B;  2JJL A;  1N73 A;  2Q3E A;  4OWF A;  1RF1 A;  1NU1 E;  2FYU D;  3SWK A;  2IDB A;  2KSJ A;  4ZMD A;  1SQB E;  4PJ0 H;  3CLQ A;  1Q86 Q;  1FZG A;  1SQV E;  1QEX A;  2JP3 A;  3CCR P;  2WSF J;  2ZT9 B;  3KDP B;  3TGU D;  1L0L K;  1UII A;  2JWA A;  2PGD A;  1PGO A;  3HD7 B;  2J5U A;  5AW6 B;  5CCG A;  4N78 D;  4BRY A;  2KI7 B;  2BCC E;  1NYH A;  3V4Q A;  1EDI A;  3P7K A;  2B87 A;  1VDF A;  3H1I E;  3H1J J;  1AVY A;  4QMA A;  3HE5 A;  1MUU A;  1ZRT E;  1USE A;  1YQ4 C;  5CJ0 A;  3TGU G;  4GDO A;  1LWU A;  3RL0 C;  1KIL C;  2QM8 A;  1GL2 C;  1JEK A;  3V6I A;  3BCC D;  1LTT C;  1G1J A;  2QJP B;  1NHL A;  1QL1 A;  4PJ0 E;  3GHG A;  3P8C D;  4D6T J;  4N3Y B;  1N86 A;  1PPJ D;  1OVR A;  1YBK A;  1FAV A;  1WRG A;  1KQF B;  3FWN A;  2E5T A;  3AEE C;  4JQ0 D;  1M1J A;  1KD1 Q;  1FJK A;  3BCC G;  5AVU B;  3H1K J;  3IF4 A;  3MUD C;  2WPS A;  1P84 E;  3L70 D;  1BE3 J;  3GF3 A;  2OYI B;  2E76 C;  2H89 C;  2L91 A;  3D70 A;  1IO4 A;  1EZV D;  2FYU K;  5KAI H;  3IAO A;  5AW3 B;  1T2K D;  1GMJ A;  1IFI A;  2QG4 A;  2O01 J;  1PP9 D;  3I56 P;  2NPS B;  4WY4 A;  2BCC D;  3Q5R A;  3M9H A;  2QA4 P;  4HKZ H;  1AV1 A;  1IK7 A;  1LT9 C;  3KPE A;  3A0H H;  3H32 A;  2HPC B;  3L70 G;  1KFM A;  2RMZ A;  2ZXE B;  3F89 A;  3HE4 A;  1A02 F;  1N2D C;  3B5N C;  3CL3 D;  3B4S A;  1K8A Q;  1CSB A;  1PGQ A;  1BCC E;  1GW4 A;  4RKU J;  4BXL A;  3D6Y A;  4GOE A;  1D7M A;  1M57 D;  1BGY G;  2O01 N;  2O1K A;  3MGN A;  2IFM A;  1YYC A;  3WUV A;  1J2J B;  1BDC A;  3HUS C;  2OYH C;  4UB6 H;  5E79 H;  2I8D A;  1L4A D;  4ZKU A;  1P84 D;  2OYO A;  1N73 B;  3H1L E;  2QEX P;  5KAI E;  1VQL P;  4U7J A;  1NU1 K;  2WTY A;  3BAT A;  1NTM G;  1S5L X;  1SQB K;  4W80 A;  2W6A A;  3OW2 O;  3A0H E;  4PD4 D;  1YI2 P;  2OGU A;  1NTZ E;  1PL5 A;  2RKL A;  1SQV K;  2ZT9 D;  3V2N A;  1LNQ A;  3HD7 D;  2ZAE B;  2GUS A;  3T97 A;  3K5B A;  4BRY B;  3AE4 C;  1RE4 A;  1KFN A;  5CJ4 A;  3HTK A;  2B87 B;  3E1R A;  5KLI B;  2FBW C;  3AEA C;  3RBZ A;  3RK3 C;  5KJ7 A;  3L74 E;  1J1E B;  1RE3 C;  5AVR B;  1HGV A;  4UB6 E;  3Q3D A;  5E79 E;  1JMM A;  1VQK P;  2N9B A;  2WSC H;  2LR2 A;  3IN6 A;  4KJM A;  3OAK A;  2FYN B;  2K9J A;  1BGY J;  3W67 A;  1FDM A;  3UIA A;  3C9I A;  2P67 A;  2E74 C;  1JTH A;  3CI9 A;  1JNM A;  1FZA A;  1SQX J;  2C0X A;  3E1I A;  4I1L A;  1M1J B;  1NTZ D;  2IBZ I;  1FZF A;  1CI6 A;  1NTM J;  1T3J A;  3L72 J;  1YJW P;  4ZNC A;  1AQ5 A;  3USS A;  3TNU B;  5APS A;  1DD4 A;  1H0T A;  2NPS D;  4A7P A;  4WY4 B;  1URQ A;  2A45 G;  3H32 B;  1GU5 A;  4CPG A;  1NTK J;  1SFC A;  5K5G B;  1IFN A;  2HOD A;  5DJT B;  3HE4 B;  3BVH A;  1OVV A;  3H1H E;  2N1T C;  4RJT A;  2WSF H;  3N4X A;  3MIW A;  4H44 C;  4KHX A;  3AE3 C;  5KKZ B;  4OGQ B;  2WSE J;  2KXP B;  3L4F A;  3EFG A;  4U3F D;  2K37 A;  1KB9 H;  2YNY A;  4DJG A;  3Q5P A;  4WB4 A;  1SQP D;  2J59 M;  1SLQ A;  1LTA C;  3VYI A;  1YIJ P;  3SFE C;  3RK3 D;  1KV4 A;  1X8Y A;  3CXH H;  4U3F G;  1PGP A;  3G3Z A;  1SQP G;  2FYZ A;  1OFC X;  4C7N A;  1OXZ A;  2FKW B;  1MKM A;  2ZYG A; 
#chains in the Genus database with same CATH homology
 1SQB G;  3H1K G;  3L74 G;  1BGY G;  1NTM G;  1EZV G;  3H1J G;  3L72 G;  1BE3 G;  3CWB G;  3L73 G;  3CX5 H;  1PPJ G;  3CXH H;  1NTK G;  4D6T G;  2A06 G;  1KB9 H;  1PP9 G;  4U3F G;  5KLV G;  3H1H G;  2BCC G;  3BCC G;  3L71 G;  1SQV G;  1SQX G;  3H1I G;  1NTZ G;  1L0N G;  1SQP G;  1BCC G;  1L0L G;  1NU1 G;  3H1L G;  3L70 G;  1SQQ G;  3L75 G;  4PD4 H;  1KYO H;  1P84 H;  2FYU G;  2IBZ G;  3TGU G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...