3L75G

Cytochrome bc1 complex from chicken with fenamidone bound
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title FAMOXADONE AND RELATED INHIBITORS BIND LIKE METHOXY ACRYLATE INHIBITORS IN THE Qo SITE OF THE BC1 COMPL AND FIX THE RIESKE IRON-SULFUR PROTEIN IN A POSITIO CLOSE TO BUT DISTINCT FROM THAT SEEN WITH STIGMATELLIN AND OTHER "DISTAL" Qo INHIBITORS.
rcsb
molecule tags Oxidoreductase
total genus 19
structure length 81
sequence length 81
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3l75G00
3H1KG 1P84H 1EZVG 4D6TG 3CX5H 4PD4H 2FYUG 2A06G 2IBZG 1NTMG 1SQXG 5KLVG 1SQPG 3H1JG 3H1IG 1NTZG 3CXHH 1L0NG 1NTKG 1SQBG 3L75G 1BE3G 1L0LG 3L74G 4U3FG 1PPJG 1KB9H 1KYOH 1SQQG 1NU1G 3BCCG 3L72G 2BCCG 3H1HG 1PP9G 3H1LG 3L71G 3TGUG 3L73G 1BCCG 1SQVG 3L70G 1BGYG 3CWBG
chains in the Genus database with same CATH superfamily
1SQPJ 4H44B 1NTKJ 2JP3A 1HJ0A 2QVAA 3A0BH 1LTJA 1ZW0A 3SSUA 1SQPD 2IBZE 3PHLA 1NTKD 1N73B 5AW2B 3TSIA 1T3JA 3B5NC 5L8RJ 2FBWC 1L0NE 1SQBE 3FX0A 5KJ7C 1EDJA 1RE3A 2C0XA 2BCCG 1P84H 5B66E 1KC8Q 1GMJA 2KYVA 1Y47A 2E42A 2KP8A 4WY4D 2Q5UA 2IBZI 2HODB 2OYHB 1BGYJ 3CWBJ 1L0LG 2WTYA 3EWKA 3CMAP 1RHZB 3CWBD 5KLIC 3KYQA 5C39A 2GUVA 2H89C 2G8YA 3S1KA 2ZVOB 3RK3B 3GW6A 1SQPG 1JB0J 1ZV8A 1VQ9P 1NTKG 1QVGO 2ZXEB 4EDFA 3MTUE 1DEEG 2FFDB 3CXHD 3H1HE 3GG2A 5KLVJ 1HH0A 2NPSA 3AE2C 1SS1A 2ZVNB 5KLVD 3WMM0 2O3JA 3HUSB 3AE8C 1YITP 1HTLC 1P84I 4W80A 1BGYG 2D2CC 3CWBG 2P58A 2AEMA 4KHXA 5K5GB 3MIWA 1BDCA 2L91A 1Q7YQ 4WBAA 1KYOI 4BWNA 2HPCA 1HUCA 2ZT9C 1KFNA 1L4AB 1X8YA 2ZYDA 2B87B 3L35A 1JTHA 1NTMJ 1IFNA 1PIXA 3CC7P 1IFDA 2RH0A 2K37A 2O01N 1PGQA 3GHGB 1YQ4C 4B86A 2WVRA 5KLVG 1PV3A 3RBZA 1SQPE 3H1LJ 3VMYA 1NTKE 3IAOA 3H1LD 5CCHD 3T97B 2O1KA 3V2QA 3PH0A 1LP1A 2IZ1A 4L75A 3L75D 2SPZA 4WY4C 1FDIA 3CXHH 1ZRTE 2R5DA 2QIWA 2K3RA 2HLOA 3AEAC 1BGYE 1GL2A 4N6JA 2IZ0A 2NRGA 1EDKA 1NTMG 1S5LE 2XZRA 1UIIA 3LW5J 2C0WA 2YXQB 2OTLP 1W5CE 4KJMA 4YXWH 2FXOA 3H1LG 1AA0A 2B9BA 2N1TA 2QEXP 2K9YA 3HD7B 4W7ZA 1NU1J 2ZYAA 4BRYB 1T6AA 2PGDA 2RN0A 4EOTA 1Q2NA 4N78E 4PD4I 4RO0A 3H32B 1JOCA 2QM8A 1SVFA 1NAFA 3CXHI 1YI2P 3KDPB 2OYIA 2KZJA 2ZAEB 5CBNA 3L74D 1FZCB 1BCCJ 4IL6X 5BU8B 2K1AA 4NPFX 1BCCD 2KS1B 1OW8A 4JPZB 2WT7B 1W2BO 3RBXA 2AXTH 3TYYA 1RF1B 2Q3EA 4K35A 3AECC 3PRJA 3KQGA 1NTME 1G1JA 2Z5HA 1H8AA 2O1JA 4GKGA 1T8ZA 1NU1G 1R8EA 3H1LE 5CCHC 1UIXA 2V7QJ 4I1LA 4JQ0D 3LW5H 1URQA 1T2KD 2AXTE 3II6A 4H13B 4I2LC 5DJTB 2OYOA 1AQTA 3Q5SA 1N8RQ 1SFCB 1WRGA 1BSNA 1FC2C 3C9IA 2HFED 4HKZH 3H1ID 1LTJB 1ZOYC 1SQVK 1N7SC 4JF7A 4H44D 4M3LA 1MZ9A 1OW7A 1KQFB 3V5BA 5APUA 1NU1K 1WMKA 2FKWB 2J5UA 1OXZA 4GOFA 3AEBC 4DJGA 1AVOA 2YMYA 3D6ZA 1BSHA 4O9BA 2J58A 5APSA 1NU1E 4JYCA 4I6MC 1H0TA 1XTCC 1IFMA 2WWWA 1SQQJ 1FDMA 3CX5D 3TDKA 3RK3D 1SQQD 2WZ7A 3A5TA 1Q90D 3TNUA 1NHLA 1YTZT 3AE3C 3SFEC 1OW6A 1VQ6P 2KIKA 2V7QH 1NYHA 2O01J 2WPSA 2NPSB 2FYNB 2KK7A 4DCKA 4U7JA 1IFPA 3MGNA 2C9LY 2JWDA 1Z56A 1USDA 5M1BA 1LTGC 1VL2A 1LWUC 5APYA 2HPCB 3A2AA 1GW3A 1MUUA 3P32A 3FWNA 1T2KC 1SQQG 1OZHA 3OW2O 4EIJA 1FJPA 4BXLA 1L4AD 1JTHB 5KKZB 2H88C 3QH9A 1JMMA 2XKMA 3QWOC 4XA4A 5GTIH 4ZKUA 1KILE 2WITA 3HE4A 4H44C 1Q86Q 1N73C 3W67A 1HWTC 1VDFA 3CCUP 3CX5H 2PAJA 3FXEA 1LP1B 2Q6QA 3WUUA 3Q5RA 4OH8B 4GODA 3L73J 1OVRA 5KAIE 1Y9BA 3L73D 5GTIE 1NJIQ 1IFJA 2A06D 2O01H 4OGQB 1GL2B 5E79H 1LT9B 4HH2A 2WQYC 3MHVA 1OVVA 1PP9J 2YMKA 2Y0CA 5H2FE 3M9QA 1VQLP 3M9BA 3RK3C 3CX5E 2QE7H 4DT0A 1SQQE 2FY8A 1VQ4P 1X22A 4TLFA 2N1TB 2FFDC 4U3FJ 1NTZD 2R5BA 3GMAA 4U3FD 1JEKA 3HD7D 2I1KA 1KMIZ 4WWIA 2G3AA 5E79E 1OVUA 3CX5I 1L0NK 3L73G 1VQ8P 2CK3H 1NKNA 1MFZA 3HUSC 1QL1A 4IL6H 3AE7C 1M56D 2KI7B 4YPCA 2A06G 3MUDC 1KQSO 2OYIB 1J2JB 2IYOA 1X9VA 4WB4A 1BE3E 3KPEA 2IFNA 1PP9G 3ITKA 3GF7A 3LIEA 1L4AC 4Y28J 2GM4A 1DEBA 1N7LA 3M0DC 2RMZA 3A7OA 5AW6B 1M1JA 4XE5B 3GHGC 4IL6E 4U3FG 1KYOH 3A0BE 2Q7CA 2XDJA 3VP9A 1S2EA 2FXPA 1LNQA 1EZVI 1JY2N 3AE4C 2Y9ZA 2E74B 3EFGA 4UB6H 1PPJD 3CCJP 3TGUJ 4PD4D 1URQB 4OWFA 3BRVB 3H25A 1P84E 3FWLA 3TGUD 2M5AA 3L73E 1SQXJ 4H13D 1OMIA 1SFCD 1SQXD 1KYOE 3OAKA 3W68A 1NOHA 3AEDC 1PP9E 4D6TD 2BCCE 1LTTC 4UB6E 1L0LK 2JEEA 3NXSA 2NZ2A 1JUNA 5AW7B 1RE4A 3I55P 3V2RA 3BCCD 3BVHA 3M9HA 1HGZA 3TF5A 3HD7C 4U3FE 1M1KQ 1L0LE 1N86A 1CW5A 1SQPK 1N7SA 3E1RA 3TGUG 1NTKK 3G4SP 4EI2A 3RGUA 3U1AA 3WU2H 1H0TB 1SQXG 1GK6A 3CCSP 1RF0C 1LTBC 1KORA 2LR2A 1FZCC 2KNCA 3TNUB 2MJZA 1KQLA 2MKVA 2YKQA 3L75J 2M3BA 4PD4H 1FJKA 1AJYA 3OJAB 1VQ5P 5GTHH 1K9MQ 2NPSD 3NTNA 1RF1C 5AW1B 3WU2E 2R3SA 1EC5A 2YO3A 1RH5B 4AYCA 3CWBE 1PFIA 1TU3F 1FDOA 2PRRA 2QSIA 3UIAA 1DD3A 2P10A 3H1KJ 3N7NA 4ZKPA 4A7PA 4PD4E 1H88A 5KLVK 1HBWA 3H1KD 3TGUE 1VF5D 3IN6A 3CXHE 4H13C 4L73A 1S3JA 5AW5B 5CCGA 1SQXE 5KLVE 2D2CB 3L71J 3L75G 5AVRB 1GK4A 3HE4B 5AVUB 1LTJC 3L71D 1ZLLA 2E76B 1VQOP 3NFQA 4JYBA 3NMDA 3EFFK 2JO1A 1VQKP 1RE3C 3L74J 1MFTA 4L74A 2KLVA 1FS0E 3L4FA 5CHXA 1HF9A 1CSBA 1NTMK 2HYNA 3L70D 3WUVA 1KILA 1JCCA 2J59M 2FYUD 3H1KG 4H0LB 1FOSF 3U59A 2W83C 1JY3N 2KUBA 4OGQD 1GL2D 2OQQA 2I8DA 3RL0g 1S1CX 3E1IA 1YIJP 3L71G 5AW8B 2HG5D 2DW3A 5AVZB 1LJ2A 2QJYB 2N1TD 5B5EH 1ZP0C 3L75E 1JO5A 3C8VA 1MKMA 3L74G 4GDOA 2FYNC 1AV1A 1AFOA 1GU4A 3MP7B 1BCCG 3VTPC 3H1IJ 2Y0DA 3P7KA 1U7JA 3TK1A 3SWYA 1L2PA 5AVVB 2KLUA 2FXMA 1G2CA 4CPGA 3VMXA 1M90Q 5B5EE 4EYYQ 2OGUA 3H1KE 1VQPP 4Z1MH 2YIUC 2QJKB 2W6AA 4GOEA 1QX8A 3CC2P 2QJPB 3ABVC 2ZYGA 1M1JB 2R32A 3MUDA 2QG4A 3O6QA 3L71E 3B5NA 1CI6A 3RL0B 1GW4A 3M91A 5KJ7A 2Q1KA 3VMAA 2VRSA 4DZOA 2JWAA 3H1IG 1RQVA 3M0DA 1NWQA 3ZDMA 1PGJA 3L74E 3G71P 2E74D 4NPDA 1SLQA 2ZXXA 4DOJA 1URQD 1BCCE 2M5AB 4LC1A 2C9NY 3H1JD 1NAYA 1QL2A 3L37A 1J1DC 4OGQC 1QGKB 2W27A 3D71A 4R4MA 1EDIA 1LT9C 3CD6P 2WSCJ 1LGHB 2L5GB 2WSEJ 4AQRD 1K8AQ 1JY2O 1ZR4A 3FXDA 1FU1A 2XU6A 2N1TC 1VF5B 1PGOA 3V2PA 2IPPA 1EZVD 1GU5A 4K3AA 3AEEC 2W6BA 1L0ND 1SQBD 4HYTB 3H1IE 2R44A 3CCEP 2A45I 1EQ7A 5CBOA 2Q3IA 1NGMB 4BRYA 5CJ0A 3V4WA 1KTMA 3VMZA 1FZFA 3A3YB 1GD2E 2OYHC 1EZVG 1SQQK 4ASVA 2KSJA 4TT3H 3E7KA 4PJ0H 2Z5IA 2E43A 3RK2B 3PLNA 2WSCH 4IOIH 3V6IA 3RK3E 2E74C 3BRTB 4WY4A 5KAFH 3A0HH 1URQC 2E5YA 2WSEH 2OTKE 1NTZJ 1S72P 2IDBA 1PGPA 4IFFA 2QRXA 2ZFCA 2WMMA 1S9KD 1KB9I 3L72J 5AW9B 1QEXA 2LKMA 2FYZA 3M0AA 1IO4A 3L72D 5DJUB 4PJ0E 2D2CD 3CPWO 1JY2P 1BDDA 1K04A 3PJSK 2E76D 4OVNF 1Q81Q 3CLQA 3VN0A 3WUTA 5KAFE 3Q5PA 5B66H 2AEFA 1ZMEC 3A0HE 1HGVA 1QVFO 3OA7A 5CMZA 1PL5A 5APXA 1KILB 2KB7P 2E75B 2H43A 3B8EB 1EZVE 3R2PA 1DX7A 3BATA 1VQ7P 4W7YA 4H0LD 1NTZG 4GIFA 4RESB 5AW0B 1QLED 3FGAD 2M0BA 4ZMDA 2AEJA 3L72G 1J1EB 4Y99B 2IX7C 3GLMA 1LTSC 1USEA 1ZRTD 1KFMA 1FZEA 1CZQA 4UB8H 1W2EA 1BGYD 1LT1A 2K9JA 1U7MA 5APQA 2A06E 5CCHA 1JY3O 3AE6C 1G2CB 4D6TJ 1DIPA 1NTZK 3KXDA 3P8CD 4I7ZB 3G6EP 1IJDB 3LIDA 3G9RA 1EXJA 2YO2A 4UB8E 1FAVA 3BCCJ 1S4XA 4PV1B 2BASA 5APTA 1KD1Q 4N78D 4IFMA 1NTZE 3PP5A 1S9KE 1PPJG 3L72E 3O6QB 3B5NB 1CI6B 3EQ2A 3USSA 1DH3A 3IR9A 2E76C 1FZAA 3RL0D 4GT1A 3P8MC 1YJNP 3CCMP 1OWAA 1E5WA 3M06A 1NTMD 4D6TG 2KXPB 2P7JA 5KLIB 3CC4P 2WSFJ 4R4LA 3GF3A 5AW4B 4H0LC 1JM0A 3BCCG 3D70A 1S5LH 2I1JA 1HVVA 2QA4P 3AEFC 1FOSE 2KOGA 2P67A 5TISH 4QMAA 5CJ4A 1PPJE 1SQXK 2YKPA 3AEGC 3K5BA 4JBZA 3JC22 2QJYC 4YTPC 1IK9A 3HE5A 2CPBA 1XTGB 1LT9A 5GTHE 1JY3P 2BEZF 2W90A 3I56P 3CL3D 1YJ9P 1N7SD 1SFCC 5EFWB 2M3EA 3V4QA 3HTKA 1SQVJ 4L76A 1VQNP 1LWUA 2JDIH 1SQVD 4C7NA 3CMEP 2IYPA 1KV4A 2WPRA 3P8CE 5TISE 2ZT9B 5APWA 4D6TE 1IZNB 5TJHA 1NU1D 3L70J 3KHUA 3PTZA 1YQ3C 3BCCE 2QJKC 1AQ5A 2R3CA 2FYUJ 2Y0EA 2QJPC 2LXBA 5AVXB 1M1JC 1ZXGA 1JMBA 3S9OA 1N73A 2WSFH 4N3YB 2LXCB 1X79B 3RL0C 4LLHA 2PP6A 1YJWP 1NKZB 1K05A 1FBMA 4ZNCA 2WPQA 3RK2D 3N4XA 3O8ZA 4WY4B 1R5LA 1SQVG 3SWKA 5AVWB 1FZBA 2XNXA 2HODA 2OYHA 1OX3A 1PZQA 3CI9A 5CCGD 2NPSC 2POHA 1SP4A 1RY3A 4ASWA 3L70G 3MD0A 1GZLA 1IFIA 2FYUG 1LTAC 1H89A 4IFDK 1FZGA 2N9BA 2E5TA 1VPCA 2H8PD 4NPEA 2FFDA 2PFXA 1T3UA 1RE4C 4HB1A 4LGDE 4XFJA 3AE1C 2B88A 1VF5C 2KZIA 1A02J 1HJBA 1KILD 2E75D 3CCQP 1GTWA 2XNDH 3HUSA 4MN4C 5KKZC 2A45G 3G3ZA 3KZIH 3F5HA 3SWFA 5AVTB 1SQVE 3CCRP 1KB9D 2K88A 1Q82Q 5APVA 2Z4EA 2YNYA 3IFMA 1GDTA 2CPSA 1L4AA 2FYUK 2HR3A 4YXDC 1X0TA 3IF4A 2B87A 2UWJE 2KSEA 1D7MA 3JCUH 5BU5A 2K9JB 3L70E 1M57D 2A45H 3H1JJ 2YXRB 3GHGA 2FYUE 3KZIE 2QM7A 2P2UA 2ZJSE 2BEQD 1KN7A 3U1CA 1GL2C 2W8ZA 3Q1MA 2OARA 1M8OB 2YKOA 3T97A 3JSVC 1FE6A 3RK2C 2RKLA 1MV8A 1JCDA 1RQUA 1EXIA 1S5LX 2JJLA 5AVQB 5BVZA 5AVSB 3HRNA 3JCUE 2GUSA 4PV1D 3MZWB 5AVYB 5CCGC 2IFMA 1N7SB 3CCLP 4RKUJ 2IBZD 1L0NJ 1K73Q 1SQBJ 2JR8A 1BE3J 1NO4A 1YBKA 1ZN5A 3B5ND 1Y8AA 3H1JG 1BE3D 4WVZA 3D6YA 1G1IA 3AE9C 5KJ7D 3I5CA 3V2NA 1KB9H 3S4RA 2YIUB 3AE5C 2Q9IA 4C46A 2OYIC 2H7HA 2KNCB 5KAIH 4KT0J 1M7LA 2M8RA 3HD7A 3VYIA 3L36A 2ITAA 3BASA 3CCVP 1KILC 3B4SA 2E75C 3VOPA 3VP8A 1KZUB 2AXCA 2GA1A 2WPVB 1U57A 3H32A 3B71A 4AUWA 4RJTA 5H2FH 1RF0A 2JKVA 1IK7A 3H6PA 3R4YA 1OIPA 2IBZG 1KB9E 1J1EC 4Y99C 2P1JA 1FZCA 1VQMP 1P84D 3H1HJ 1L0NG 3SFDC 1SQBG 1E79H 2N9YB 1BE3G 2KS1A 3H1HD 2XV5A 3Q2YA 2WT7A 2OTJP 4C7RA 1YHQP 1KYOD 1J1DB 1KQGB 1N2DC 1YTZI 1RF1A 3HE5B 2BCCJ 3H1JE 3HTKB 1EDLA 1DD4A 1PP9D 2BCCD 5AW3B 1LWUB 3Q3DA 2Y9YA 4C7NB 3F89A 1WT6A 1IC2A 1YYCA 1ZR2A 1NH4A 1NVOA 1L0LJ 1OFCX 2V4HA 4I7ZC 1A02F 2W6JH 2ZT9D 1JNMA 1L0LD 2B89A 3C1LA 4HJGH 1AVYA 1R5SA 1LTIC 1SFCA 3H1HG 4PV1C 1SQBK 5KTBA 2WSSH
chains in the Genus database with same CATH topology
3H1KG 1P84H 1EZVG 4D6TG 3CX5H 4PD4H 2FYUG 2A06G 2IBZG 1NTMG 1SQXG 5KLVG 1SQPG 3H1JG 3H1IG 1NTZG 3CXHH 1L0NG 1NTKG 1SQBG 3L75G 1BE3G 1L0LG 3L74G 4U3FG 1PPJG 1KB9H 1KYOH 1SQQG 1NU1G 3BCCG 3L72G 2BCCG 3H1HG 1PP9G 3H1LG 3L71G 3TGUG 3L73G 1BCCG 1SQVG 3L70G 1BGYG 3CWBG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1K G;  1P84 H;  1EZV G;  4D6T G;  3CX5 H;  4PD4 H;  2FYU G;  2A06 G;  2IBZ G;  1NTM G;  1SQX G;  5KLV G;  1SQP G;  3H1J G;  3H1I G;  1NTZ G;  3CXH H;  1L0N G;  1NTK G;  1SQB G;  3L75 G;  1BE3 G;  1L0L G;  3L74 G;  4U3F G;  1PPJ G;  1KB9 H;  1KYO H;  1SQQ G;  1NU1 G;  3BCC G;  3L72 G;  2BCC G;  3H1H G;  1PP9 G;  3H1L G;  3L71 G;  3TGU G;  3L73 G;  1BCC G;  1SQV G;  3L70 G;  1BGY G;  3CWB G; 
#chains in the Genus database with same CATH topology
 1SQP J;  4H44 B;  1NTK J;  2JP3 A;  1HJ0 A;  2QVA A;  3A0B H;  1LTJ A;  1ZW0 A;  3SSU A;  1SQP D;  2IBZ E;  3PHL A;  1NTK D;  1N73 B;  5AW2 B;  3TSI A;  1T3J A;  3B5N C;  5L8R J;  2FBW C;  1L0N E;  1SQB E;  3FX0 A;  5KJ7 C;  1EDJ A;  1RE3 A;  2C0X A;  2BCC G;  1P84 H;  5B66 E;  1KC8 Q;  1GMJ A;  2KYV A;  1Y47 A;  2E42 A;  2KP8 A;  4WY4 D;  2Q5U A;  2IBZ I;  2HOD B;  2OYH B;  1BGY J;  3CWB J;  1L0L G;  2WTY A;  3EWK A;  3CMA P;  1RHZ B;  3CWB D;  5KLI C;  3KYQ A;  5C39 A;  2GUV A;  2H89 C;  2G8Y A;  3S1K A;  2ZVO B;  3RK3 B;  3GW6 A;  1SQP G;  1JB0 J;  1ZV8 A;  1VQ9 P;  1NTK G;  1QVG O;  2ZXE B;  4EDF A;  3MTU E;  1DEE G;  2FFD B;  3CXH D;  3H1H E;  3GG2 A;  5KLV J;  1HH0 A;  2NPS A;  3AE2 C;  1SS1 A;  2ZVN B;  5KLV D;  3WMM 0;  2O3J A;  3HUS B;  3AE8 C;  1YIT P;  1HTL C;  1P84 I;  4W80 A;  1BGY G;  2D2C C;  3CWB G;  2P58 A;  2AEM A;  4KHX A;  5K5G B;  3MIW A;  1BDC A;  2L91 A;  1Q7Y Q;  4WBA A;  1KYO I;  4BWN A;  2HPC A;  1HUC A;  2ZT9 C;  1KFN A;  1L4A B;  1X8Y A;  2ZYD A;  2B87 B;  3L35 A;  1JTH A;  1NTM J;  1IFN A;  1PIX A;  3CC7 P;  1IFD A;  2RH0 A;  2K37 A;  2O01 N;  1PGQ A;  3GHG B;  1YQ4 C;  4B86 A;  2WVR A;  5KLV G;  1PV3 A;  3RBZ A;  1SQP E;  3H1L J;  3VMY A;  1NTK E;  3IAO A;  3H1L D;  5CCH D;  3T97 B;  2O1K A;  3V2Q A;  3PH0 A;  1LP1 A;  2IZ1 A;  4L75 A;  3L75 D;  2SPZ A;  4WY4 C;  1FDI A;  3CXH H;  1ZRT E;  2R5D A;  2QIW A;  2K3R A;  2HLO A;  3AEA C;  1BGY E;  1GL2 A;  4N6J A;  2IZ0 A;  2NRG A;  1EDK A;  1NTM G;  1S5L E;  2XZR A;  1UII A;  3LW5 J;  2C0W A;  2YXQ B;  2OTL P;  1W5C E;  4KJM A;  4YXW H;  2FXO A;  3H1L G;  1AA0 A;  2B9B A;  2N1T A;  2QEX P;  2K9Y A;  3HD7 B;  4W7Z A;  1NU1 J;  2ZYA A;  4BRY B;  1T6A A;  2PGD A;  2RN0 A;  4EOT A;  1Q2N A;  4N78 E;  4PD4 I;  4RO0 A;  3H32 B;  1JOC A;  2QM8 A;  1SVF A;  1NAF A;  3CXH I;  1YI2 P;  3KDP B;  2OYI A;  2KZJ A;  2ZAE B;  5CBN A;  3L74 D;  1FZC B;  1BCC J;  4IL6 X;  5BU8 B;  2K1A A;  4NPF X;  1BCC D;  2KS1 B;  1OW8 A;  4JPZ B;  2WT7 B;  1W2B O;  3RBX A;  2AXT H;  3TYY A;  1RF1 B;  2Q3E A;  4K35 A;  3AEC C;  3PRJ A;  3KQG A;  1NTM E;  1G1J A;  2Z5H A;  1H8A A;  2O1J A;  4GKG A;  1T8Z A;  1NU1 G;  1R8E A;  3H1L E;  5CCH C;  1UIX A;  2V7Q J;  4I1L A;  4JQ0 D;  3LW5 H;  1URQ A;  1T2K D;  2AXT E;  3II6 A;  4H13 B;  4I2L C;  5DJT B;  2OYO A;  1AQT A;  3Q5S A;  1N8R Q;  1SFC B;  1WRG A;  1BSN A;  1FC2 C;  3C9I A;  2HFE D;  4HKZ H;  3H1I D;  1LTJ B;  1ZOY C;  1SQV K;  1N7S C;  4JF7 A;  4H44 D;  4M3L A;  1MZ9 A;  1OW7 A;  1KQF B;  3V5B A;  5APU A;  1NU1 K;  1WMK A;  2FKW B;  2J5U A;  1OXZ A;  4GOF A;  3AEB C;  4DJG A;  1AVO A;  2YMY A;  3D6Z A;  1BSH A;  4O9B A;  2J58 A;  5APS A;  1NU1 E;  4JYC A;  4I6M C;  1H0T A;  1XTC C;  1IFM A;  2WWW A;  1SQQ J;  1FDM A;  3CX5 D;  3TDK A;  3RK3 D;  1SQQ D;  2WZ7 A;  3A5T A;  1Q90 D;  3TNU A;  1NHL A;  1YTZ T;  3AE3 C;  3SFE C;  1OW6 A;  1VQ6 P;  2KIK A;  2V7Q H;  1NYH A;  2O01 J;  2WPS A;  2NPS B;  2FYN B;  2KK7 A;  4DCK A;  4U7J A;  1IFP A;  3MGN A;  2C9L Y;  2JWD A;  1Z56 A;  1USD A;  5M1B A;  1LTG C;  1VL2 A;  1LWU C;  5APY A;  2HPC B;  3A2A A;  1GW3 A;  1MUU A;  3P32 A;  3FWN A;  1T2K C;  1SQQ G;  1OZH A;  3OW2 O;  4EIJ A;  1FJP A;  4BXL A;  1L4A D;  1JTH B;  5KKZ B;  2H88 C;  3QH9 A;  1JMM A;  2XKM A;  3QWO C;  4XA4 A;  5GTI H;  4ZKU A;  1KIL E;  2WIT A;  3HE4 A;  4H44 C;  1Q86 Q;  1N73 C;  3W67 A;  1HWT C;  1VDF A;  3CCU P;  3CX5 H;  2PAJ A;  3FXE A;  1LP1 B;  2Q6Q A;  3WUU A;  3Q5R A;  4OH8 B;  4GOD A;  3L73 J;  1OVR A;  5KAI E;  1Y9B A;  3L73 D;  5GTI E;  1NJI Q;  1IFJ A;  2A06 D;  2O01 H;  4OGQ B;  1GL2 B;  5E79 H;  1LT9 B;  4HH2 A;  2WQY C;  3MHV A;  1OVV A;  1PP9 J;  2YMK A;  2Y0C A;  5H2F E;  3M9Q A;  1VQL P;  3M9B A;  3RK3 C;  3CX5 E;  2QE7 H;  4DT0 A;  1SQQ E;  2FY8 A;  1VQ4 P;  1X22 A;  4TLF A;  2N1T B;  2FFD C;  4U3F J;  1NTZ D;  2R5B A;  3GMA A;  4U3F D;  1JEK A;  3HD7 D;  2I1K A;  1KMI Z;  4WWI A;  2G3A A;  5E79 E;  1OVU A;  3CX5 I;  1L0N K;  3L73 G;  1VQ8 P;  2CK3 H;  1NKN A;  1MFZ A;  3HUS C;  1QL1 A;  4IL6 H;  3AE7 C;  1M56 D;  2KI7 B;  4YPC A;  2A06 G;  3MUD C;  1KQS O;  2OYI B;  1J2J B;  2IYO A;  1X9V A;  4WB4 A;  1BE3 E;  3KPE A;  2IFN A;  1PP9 G;  3ITK A;  3GF7 A;  3LIE A;  1L4A C;  4Y28 J;  2GM4 A;  1DEB A;  1N7L A;  3M0D C;  2RMZ A;  3A7O A;  5AW6 B;  1M1J A;  4XE5 B;  3GHG C;  4IL6 E;  4U3F G;  1KYO H;  3A0B E;  2Q7C A;  2XDJ A;  3VP9 A;  1S2E A;  2FXP A;  1LNQ A;  1EZV I;  1JY2 N;  3AE4 C;  2Y9Z A;  2E74 B;  3EFG A;  4UB6 H;  1PPJ D;  3CCJ P;  3TGU J;  4PD4 D;  1URQ B;  4OWF A;  3BRV B;  3H25 A;  1P84 E;  3FWL A;  3TGU D;  2M5A A;  3L73 E;  1SQX J;  4H13 D;  1OMI A;  1SFC D;  1SQX D;  1KYO E;  3OAK A;  3W68 A;  1NOH A;  3AED C;  1PP9 E;  4D6T D;  2BCC E;  1LTT C;  4UB6 E;  1L0L K;  2JEE A;  3NXS A;  2NZ2 A;  1JUN A;  5AW7 B;  1RE4 A;  3I55 P;  3V2R A;  3BCC D;  3BVH A;  3M9H A;  1HGZ A;  3TF5 A;  3HD7 C;  4U3F E;  1M1K Q;  1L0L E;  1N86 A;  1CW5 A;  1SQP K;  1N7S A;  3E1R A;  3TGU G;  1NTK K;  3G4S P;  4EI2 A;  3RGU A;  3U1A A;  3WU2 H;  1H0T B;  1SQX G;  1GK6 A;  3CCS P;  1RF0 C;  1LTB C;  1KOR A;  2LR2 A;  1FZC C;  2KNC A;  3TNU B;  2MJZ A;  1KQL A;  2MKV A;  2YKQ A;  3L75 J;  2M3B A;  4PD4 H;  1FJK A;  1AJY A;  3OJA B;  1VQ5 P;  5GTH H;  1K9M Q;  2NPS D;  3NTN A;  1RF1 C;  5AW1 B;  3WU2 E;  2R3S A;  1EC5 A;  2YO3 A;  1RH5 B;  4AYC A;  3CWB E;  1PFI A;  1TU3 F;  1FDO A;  2PRR A;  2QSI A;  3UIA A;  1DD3 A;  2P10 A;  3H1K J;  3N7N A;  4ZKP A;  4A7P A;  4PD4 E;  1H88 A;  5KLV K;  1HBW A;  3H1K D;  3TGU E;  1VF5 D;  3IN6 A;  3CXH E;  4H13 C;  4L73 A;  1S3J A;  5AW5 B;  5CCG A;  1SQX E;  5KLV E;  2D2C B;  3L71 J;  3L75 G;  5AVR B;  1GK4 A;  3HE4 B;  5AVU B;  1LTJ C;  3L71 D;  1ZLL A;  2E76 B;  1VQO P;  3NFQ A;  4JYB A;  3NMD A;  3EFF K;  2JO1 A;  1VQK P;  1RE3 C;  3L74 J;  1MFT A;  4L74 A;  2KLV A;  1FS0 E;  3L4F A;  5CHX A;  1HF9 A;  1CSB A;  1NTM K;  2HYN A;  3L70 D;  3WUV A;  1KIL A;  1JCC A;  2J59 M;  2FYU D;  3H1K G;  4H0L B;  1FOS F;  3U59 A;  2W83 C;  1JY3 N;  2KUB A;  4OGQ D;  1GL2 D;  2OQQ A;  2I8D A;  3RL0 g;  1S1C X;  3E1I A;  1YIJ P;  3L71 G;  5AW8 B;  2HG5 D;  2DW3 A;  5AVZ B;  1LJ2 A;  2QJY B;  2N1T D;  5B5E H;  1ZP0 C;  3L75 E;  1JO5 A;  3C8V A;  1MKM A;  3L74 G;  4GDO A;  2FYN C;  1AV1 A;  1AFO A;  1GU4 A;  3MP7 B;  1BCC G;  3VTP C;  3H1I J;  2Y0D A;  3P7K A;  1U7J A;  3TK1 A;  3SWY A;  1L2P A;  5AVV B;  2KLU A;  2FXM A;  1G2C A;  4CPG A;  3VMX A;  1M90 Q;  5B5E E;  4EYY Q;  2OGU A;  3H1K E;  1VQP P;  4Z1M H;  2YIU C;  2QJK B;  2W6A A;  4GOE A;  1QX8 A;  3CC2 P;  2QJP B;  3ABV C;  2ZYG A;  1M1J B;  2R32 A;  3MUD A;  2QG4 A;  3O6Q A;  3L71 E;  3B5N A;  1CI6 A;  3RL0 B;  1GW4 A;  3M91 A;  5KJ7 A;  2Q1K A;  3VMA A;  2VRS A;  4DZO A;  2JWA A;  3H1I G;  1RQV A;  3M0D A;  1NWQ A;  3ZDM A;  1PGJ A;  3L74 E;  3G71 P;  2E74 D;  4NPD A;  1SLQ A;  2ZXX A;  4DOJ A;  1URQ D;  1BCC E;  2M5A B;  4LC1 A;  2C9N Y;  3H1J D;  1NAY A;  1QL2 A;  3L37 A;  1J1D C;  4OGQ C;  1QGK B;  2W27 A;  3D71 A;  4R4M A;  1EDI A;  1LT9 C;  3CD6 P;  2WSC J;  1LGH B;  2L5G B;  2WSE J;  4AQR D;  1K8A Q;  1JY2 O;  1ZR4 A;  3FXD A;  1FU1 A;  2XU6 A;  2N1T C;  1VF5 B;  1PGO A;  3V2P A;  2IPP A;  1EZV D;  1GU5 A;  4K3A A;  3AEE C;  2W6B A;  1L0N D;  1SQB D;  4HYT B;  3H1I E;  2R44 A;  3CCE P;  2A45 I;  1EQ7 A;  5CBO A;  2Q3I A;  1NGM B;  4BRY A;  5CJ0 A;  3V4W A;  1KTM A;  3VMZ A;  1FZF A;  3A3Y B;  1GD2 E;  2OYH C;  1EZV G;  1SQQ K;  4ASV A;  2KSJ A;  4TT3 H;  3E7K A;  4PJ0 H;  2Z5I A;  2E43 A;  3RK2 B;  3PLN A;  2WSC H;  4IOI H;  3V6I A;  3RK3 E;  2E74 C;  3BRT B;  4WY4 A;  5KAF H;  3A0H H;  1URQ C;  2E5Y A;  2WSE H;  2OTK E;  1NTZ J;  1S72 P;  2IDB A;  1PGP A;  4IFF A;  2QRX A;  2ZFC A;  2WMM A;  1S9K D;  1KB9 I;  3L72 J;  5AW9 B;  1QEX A;  2LKM A;  2FYZ A;  3M0A A;  1IO4 A;  3L72 D;  5DJU B;  4PJ0 E;  2D2C D;  3CPW O;  1JY2 P;  1BDD A;  1K04 A;  3PJS K;  2E76 D;  4OVN F;  1Q81 Q;  3CLQ A;  3VN0 A;  3WUT A;  5KAF E;  3Q5P A;  5B66 H;  2AEF A;  1ZME C;  3A0H E;  1HGV A;  1QVF O;  3OA7 A;  5CMZ A;  1PL5 A;  5APX A;  1KIL B;  2KB7 P;  2E75 B;  2H43 A;  3B8E B;  1EZV E;  3R2P A;  1DX7 A;  3BAT A;  1VQ7 P;  4W7Y A;  4H0L D;  1NTZ G;  4GIF A;  4RES B;  5AW0 B;  1QLE D;  3FGA D;  2M0B A;  4ZMD A;  2AEJ A;  3L72 G;  1J1E B;  4Y99 B;  2IX7 C;  3GLM A;  1LTS C;  1USE A;  1ZRT D;  1KFM A;  1FZE A;  1CZQ A;  4UB8 H;  1W2E A;  1BGY D;  1LT1 A;  2K9J A;  1U7M A;  5APQ A;  2A06 E;  5CCH A;  1JY3 O;  3AE6 C;  1G2C B;  4D6T J;  1DIP A;  1NTZ K;  3KXD A;  3P8C D;  4I7Z B;  3G6E P;  1IJD B;  3LID A;  3G9R A;  1EXJ A;  2YO2 A;  4UB8 E;  1FAV A;  3BCC J;  1S4X A;  4PV1 B;  2BAS A;  5APT A;  1KD1 Q;  4N78 D;  4IFM A;  1NTZ E;  3PP5 A;  1S9K E;  1PPJ G;  3L72 E;  3O6Q B;  3B5N B;  1CI6 B;  3EQ2 A;  3USS A;  1DH3 A;  3IR9 A;  2E76 C;  1FZA A;  3RL0 D;  4GT1 A;  3P8M C;  1YJN P;  3CCM P;  1OWA A;  1E5W A;  3M06 A;  1NTM D;  4D6T G;  2KXP B;  2P7J A;  5KLI B;  3CC4 P;  2WSF J;  4R4L A;  3GF3 A;  5AW4 B;  4H0L C;  1JM0 A;  3BCC G;  3D70 A;  1S5L H;  2I1J A;  1HVV A;  2QA4 P;  3AEF C;  1FOS E;  2KOG A;  2P67 A;  5TIS H;  4QMA A;  5CJ4 A;  1PPJ E;  1SQX K;  2YKP A;  3AEG C;  3K5B A;  4JBZ A;  3JC2 2;  2QJY C;  4YTP C;  1IK9 A;  3HE5 A;  2CPB A;  1XTG B;  1LT9 A;  5GTH E;  1JY3 P;  2BEZ F;  2W90 A;  3I56 P;  3CL3 D;  1YJ9 P;  1N7S D;  1SFC C;  5EFW B;  2M3E A;  3V4Q A;  3HTK A;  1SQV J;  4L76 A;  1VQN P;  1LWU A;  2JDI H;  1SQV D;  4C7N A;  3CME P;  2IYP A;  1KV4 A;  2WPR A;  3P8C E;  5TIS E;  2ZT9 B;  5APW A;  4D6T E;  1IZN B;  5TJH A;  1NU1 D;  3L70 J;  3KHU A;  3PTZ A;  1YQ3 C;  3BCC E;  2QJK C;  1AQ5 A;  2R3C A;  2FYU J;  2Y0E A;  2QJP C;  2LXB A;  5AVX B;  1M1J C;  1ZXG A;  1JMB A;  3S9O A;  1N73 A;  2WSF H;  4N3Y B;  2LXC B;  1X79 B;  3RL0 C;  4LLH A;  2PP6 A;  1YJW P;  1NKZ B;  1K05 A;  1FBM A;  4ZNC A;  2WPQ A;  3RK2 D;  3N4X A;  3O8Z A;  4WY4 B;  1R5L A;  1SQV G;  3SWK A;  5AVW B;  1FZB A;  2XNX A;  2HOD A;  2OYH A;  1OX3 A;  1PZQ A;  3CI9 A;  5CCG D;  2NPS C;  2POH A;  1SP4 A;  1RY3 A;  4ASW A;  3L70 G;  3MD0 A;  1GZL A;  1IFI A;  2FYU G;  1LTA C;  1H89 A;  4IFD K;  1FZG A;  2N9B A;  2E5T A;  1VPC A;  2H8P D;  4NPE A;  2FFD A;  2PFX A;  1T3U A;  1RE4 C;  4HB1 A;  4LGD E;  4XFJ A;  3AE1 C;  2B88 A;  1VF5 C;  2KZI A;  1A02 J;  1HJB A;  1KIL D;  2E75 D;  3CCQ P;  1GTW A;  2XND H;  3HUS A;  4MN4 C;  5KKZ C;  2A45 G;  3G3Z A;  3KZI H;  3F5H A;  3SWF A;  5AVT B;  1SQV E;  3CCR P;  1KB9 D;  2K88 A;  1Q82 Q;  5APV A;  2Z4E A;  2YNY A;  3IFM A;  1GDT A;  2CPS A;  1L4A A;  2FYU K;  2HR3 A;  4YXD C;  1X0T A;  3IF4 A;  2B87 A;  2UWJ E;  2KSE A;  1D7M A;  3JCU H;  5BU5 A;  2K9J B;  3L70 E;  1M57 D;  2A45 H;  3H1J J;  2YXR B;  3GHG A;  2FYU E;  3KZI E;  2QM7 A;  2P2U A;  2ZJS E;  2BEQ D;  1KN7 A;  3U1C A;  1GL2 C;  2W8Z A;  3Q1M A;  2OAR A;  1M8O B;  2YKO A;  3T97 A;  3JSV C;  1FE6 A;  3RK2 C;  2RKL A;  1MV8 A;  1JCD A;  1RQU A;  1EXI A;  1S5L X;  2JJL A;  5AVQ B;  5BVZ A;  5AVS B;  3HRN A;  3JCU E;  2GUS A;  4PV1 D;  3MZW B;  5AVY B;  5CCG C;  2IFM A;  1N7S B;  3CCL P;  4RKU J;  2IBZ D;  1L0N J;  1K73 Q;  1SQB J;  2JR8 A;  1BE3 J;  1NO4 A;  1YBK A;  1ZN5 A;  3B5N D;  1Y8A A;  3H1J G;  1BE3 D;  4WVZ A;  3D6Y A;  1G1I A;  3AE9 C;  5KJ7 D;  3I5C A;  3V2N A;  1KB9 H;  3S4R A;  2YIU B;  3AE5 C;  2Q9I A;  4C46 A;  2OYI C;  2H7H A;  2KNC B;  5KAI H;  4KT0 J;  1M7L A;  2M8R A;  3HD7 A;  3VYI A;  3L36 A;  2ITA A;  3BAS A;  3CCV P;  1KIL C;  3B4S A;  2E75 C;  3VOP A;  3VP8 A;  1KZU B;  2AXC A;  2GA1 A;  2WPV B;  1U57 A;  3H32 A;  3B71 A;  4AUW A;  4RJT A;  5H2F H;  1RF0 A;  2JKV A;  1IK7 A;  3H6P A;  3R4Y A;  1OIP A;  2IBZ G;  1KB9 E;  1J1E C;  4Y99 C;  2P1J A;  1FZC A;  1VQM P;  1P84 D;  3H1H J;  1L0N G;  3SFD C;  1SQB G;  1E79 H;  2N9Y B;  1BE3 G;  2KS1 A;  3H1H D;  2XV5 A;  3Q2Y A;  2WT7 A;  2OTJ P;  4C7R A;  1YHQ P;  1KYO D;  1J1D B;  1KQG B;  1N2D C;  1YTZ I;  1RF1 A;  3HE5 B;  2BCC J;  3H1J E;  3HTK B;  1EDL A;  1DD4 A;  1PP9 D;  2BCC D;  5AW3 B;  1LWU B;  3Q3D A;  2Y9Y A;  4C7N B;  3F89 A;  1WT6 A;  1IC2 A;  1YYC A;  1ZR2 A;  1NH4 A;  1NVO A;  1L0L J;  1OFC X;  2V4H A;  4I7Z C;  1A02 F;  2W6J H;  2ZT9 D;  1JNM A;  1L0L D;  2B89 A;  3C1L A;  4HJG H;  1AVY A;  1R5S A;  1LTI C;  1SFC A;  3H1H G;  4PV1 C;  1SQB K;  5KTB A;  2WSS H; 
#chains in the Genus database with same CATH homology
 3H1K G;  1P84 H;  1EZV G;  4D6T G;  3CX5 H;  4PD4 H;  2FYU G;  2A06 G;  2IBZ G;  1NTM G;  1SQX G;  5KLV G;  1SQP G;  3H1J G;  3H1I G;  1NTZ G;  3CXH H;  1L0N G;  1NTK G;  1SQB G;  3L75 G;  1BE3 G;  1L0L G;  3L74 G;  4U3F G;  1PPJ G;  1KB9 H;  1KYO H;  1SQQ G;  1NU1 G;  3BCC G;  3L72 G;  2BCC G;  3H1H G;  1PP9 G;  3H1L G;  3L71 G;  3TGU G;  3L73 G;  1BCC G;  1SQV G;  3L70 G;  1BGY G;  3CWB G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...