3L75G

Cytochrome bc1 complex from chicken with fenamidone bound
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title FAMOXADONE AND RELATED INHIBITORS BIND LIKE METHOXY ACRYLATE INHIBITORS IN THE Qo SITE OF THE BC1 COMPL AND FIX THE RIESKE IRON-SULFUR PROTEIN IN A POSITIO CLOSE TO BUT DISTINCT FROM THAT SEEN WITH STIGMATELLIN AND OTHER "DISTAL" Qo INHIBITORS.
rcsb
total genus 19
structure length 81
sequence length 81
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3l75G00
2A06G 1EZVG 1L0NG 4PD4H 3CWBG 3TGUG 4D6TG 3L72G 1KB9H 3L74G 1SQVG 3BCCG 1PP9G 1SQPG 3CXHH 1BE3G 3L71G 2FYUG 1L0LG 3H1KG 1P84H 3CX5H 3H1JG 1NU1G 1NTKG 2BCCG 2IBZG 1SQXG 5KLVG 3H1HG 1KYOH 3L73G 4U3FG 1NTZG 3H1IG 1SQBG 1NTMG 3L70G 1BCCG 1BGYG 1SQQG 3H1LG 1PPJG 3L75G
chains in the Genus database with same CATH superfamily
1JNMA 1JM0A 1SVFA 1OW7A 5AW4B 2WPRA 2B87B 2QRXA 5B66E 3L75J 3CWBD 3RK3C 2P7JA 2L5GB 2QIWA 3L35A 3V2PA 3I5CA 4NPDA 4PV1D 3ABVC 1ZMEC 1KYOD 3HRNA 4H44C 1QLED 1JB0J 1VQPP 4H44D 4DZOA 4YXDC 1L0LE 3VOPA 1NU1E 1LJ2A 1OMIA 1KB9D 2P2UA 3VYIA 1LTSC 1GL2A 1X8YA 4JBZA 5KLVJ 2RN0A 1K9MQ 2AEMA 1HUCA 1T6AA 2H7HA 2E74C 4PD4I 3H1JG 2E5TA 2OYIA 4C46A 1SQBE 3Q5RA 1ZP0C 2MKVA 3C1LA 4LC1A 1U7MA 1NTZD 3RL0C 5KJ7A 3CPWO 1EDJA 2POHA 3WMM0 5TISE 3SFDC 3A5TA 4PJ0E 1UIXA 3GG2A 2XV5A 2V4HA 3I55P 1T3JA 3L73J 3BATA 4AYCA 3EFGA 1KD1Q 3WU2H 3FXEA 1ZRTE 5AVYB 2ZT9C 2ZT9D 3HD7A 3G9RA 1N7SC 1K8AQ 1J2JB 1BDDA 1N7SD 1VDFA 2WQYC 5APSA 5BU8B 1FZFA 3AE8C 2FY8A 1T2KC 3AE6C 3V2QA 5BU5A 3KZIH 3CLQA 1S5LX 1T2KD 3H1JE 1BSNA 2VRSA 3C8VA 1QVGO 1RE3C 2E76B 1VQ6P 1VQ7P 5AVWB 5KLVD 4JQ0D 3FGAD 1S9KE 1AJYA 4IOIH 3B5ND 4UB6H 4L73A 3AE5C 2FFDA 2FKWB 1EC5A 1LTJC 1NH4A 1DIPA 4W80A 1YITP 4PV1B 1NTMK 3H1HD 1AV1A 4U3FJ 3GHGC 4OGQD 1Q7YQ 2KNCA 2ZVOB 2MJZA 1AVOA 4EIJA 2PFXA 3B71A 1VQ8P 4HKZH 1QX8A 4IFMA 2WSEH 2WSSH 4A7PA 1MZ9A 5APQA 3D6YA 1KFNA 2WWWA 1LTTC 3TF5A 1RF1C 2GA1A 3VMAA 1HTLC 2Q6QA 1FBMA 3H1KD 3CCMP 2IFNA 4KJMA 3PJSK 1S5LH 2FYZA 2A45G 1KC8Q 1EZVG 3TYYA 1NTMJ 2D2CD 3B8EB 3O8ZA 2WSEJ 1JY3N 1YJ9P 2OTJP 3CCQP 4D6TD 1DD3A 3CC7P 3W68A 1WRGA 3AEBC 3TNUB 1GMJA 3H32A 2DW3A 1IO4A 1H88A 3H1LD 2ZXXA 2ZXEB 2ZT9B 1G2CB 2FYUK 3CCUP 4EOTA 4GOEA 1WMKA 2WPVB 1N7SB 1SFCC 4O9BA 2P67A 3AECC 4Y28J 1FOSE 4IL6E 1LTGC 1L0NK 1PP9G 1SQPG 1BE3G 1ZV8A 2HYNA 1KILE 3A0BH 5AW6B 1VQNP 5B5EE 2HPCB 5CCGC 2OYHA 1LT9C 3L70G 5H2FH 4U7JA 5CJ4A 1EZVE 1Y8AA 4KHXA 1BCCJ 2O01N 3B5NB 1U7JA 3HUSC 1YJWP 2A45I 2CK3H 3L72J 3AE3C 2Y0CA 5KLIB 1LTJB 1OW8A 2FYUJ 1KILA 1NOHA 2NPSA 3O6QA 1EDLA 1YBKA 2Q9IA 4OGQB 3GHGB 1S72P 1VQ9P 1SQVK 1L0NJ 1P84H 1PGOA 3L74J 3BRTB 1VF5C 3H1IG 1VF5D 1GW4A 1LTAC 2K9JB 1RF0C 5AW0B 2W90A 2K3RA 1PPJD 3CC4P 1PP9E 1SQPE 5CHXA 1BE3E 2IZ0A 3AEDC 1JO5A 5CBOA 3TGUD 5AVSB 3OW2O 2K37A 2B88A 1HH0A 1GDTA 3VMZA 2Z5HA 3V2NA 3GMAA 2D2CB 3PP5A 4NPFX 1NAFA 3VP9A 1L4AC 3NFQA 2KXPB 1CI6B 1T8ZA 3VN0A 1J1EC 1SQVJ 3BASA 5KAIH 3EWKA 5APXA 5AW3B 2IYPA 1JCCA 1JY3P 1J1DB 1R5LA 4R4LA 1NO4A 4JYCA 1XTCC 3MUDA 1GK6A 1KYOH 2N1TA 3H1IE 3K5BA 2WPQA 2C9LY 3D70A 2IBZD 1FZCC 1NGMB 1KB9H 1BGYD 1G1JA 1KQLA 3CWBJ 1DD4A 3L71J 1FS0E 1JMMA 1LT9B 1P84I 1UIIA 1DEEG 1N73C 5GTHH 1S3JA 3G71P 3BVHA 2O01H 3HUSB 2AEFA 3IR9A 1FDIA 4DOJA 4C7NB 1ZLLA 1NYHA 5APTA 4LGDE 3GF3A 3JCUH 1RY3A 3TDKA 2GUVA 1JTHA 3P8CD 1KZUB 1NKNA 1M7LA 2ZFCA 3CC2P 1SQVD 2YO2A 1VF5B 3CXHD 1NTZG 3RBZA 1PGQA 2O01J 1FZGA 1DEBA 1FE6A 2ZYAA 3SWKA 4RJTA 3U1CA 1OX3A 2WT7B 1EQ7A 2SPZA 2BCCG 1K73Q 1SQXG 3A0HE 3FWLA 1KYOE 4GODA 3L75G 1AQ5A 1KYOI 4GIFA 1IFJA 1IJDB 1M90Q 3CL3D 2KP8A 5CCHA 2KSEA 2IX7C 1ZXGA 3BCCJ 3L71D 3RK3D 3IFMA 3CCRP 3CX5D 3V4QA 1LWUC 3SWFA 3R2PA 2QJKC 2XNDH 2YMKA 2IYOA 2WMMA 5E79H 1RQVA 4IFFA 1NTZE 4TLFA 3KQGA 3CCSP 4BXLA 2KK7A 3H6PA 1G1IA 1FZCB 4OWFA 3UIAA 4PD4E 3N4XA 1JY2O 2OTLP 1QL1A 3W67A 2KI7B 2E74D 4RKUJ 2BCCE 2Y0EA 1SQXE 1GL2C 2ZJSE 1IFIA 3L75E 1FDMA 3H1HJ 3OJAB 2A06G 4L74A 1N73B 3EFFK 2IDBA 3CMEP 1HJBA 1EDKA 3RL0D 1PV3A 3V2RA 2OYIC 3N7NA 5M1BA 3L73G 1L0LD 5AVZB 1NU1D 2QEXP 1X9VA 2RMZA 3D6ZA 3MP7B 3BCCD 2J5UA 2JDIH 3H1KJ 2O1KA 1KTMA 1SQBD 3M9BA 3WUUA 1YQ4C 5C39A 4GDOA 4D6TJ 3HD7C 4H13C 2OGUA 3GF7A 3HD7D 2WSCJ 2ZVNB 3M0DA 1URQA 2ZAEB 3E1RA 4HB1A 2A06E 3AEEC 3IAOA 2WITA 3B5NA 1E5WA 3H1LJ 3T97B 2JR8A 5AW7B 3RK3B 1NKZB 1LTJA 4JYBA 4U3FG 2H43A 3L73E 3S9OA 4W7ZA 3S4RA 4WY4A 5AVQB 3G6EP 1LWUB 2H8PD 4I1LA 4H44B 2QJKB 1M1JA 5AVXB 1CSBA 1KQSO 2FFDC 3QWOC 1OVVA 2KB7P 3H1JD 5AW5B 1LGHB 3NTNA 3Q2YA 1VQKP 2M0BA 2YIUC 2QJYC 3WU2E 2HR3A 3AE4C 3LIEA 1R8EA 3RL0g 1S9KD 3F5HA 2E74B 1Q81Q 3SWYA 3CCLP 2I1KA 1KQFB 1NTMG 3R4YA 4RO0A 3GW6A 3OA7A 1N2DC 3IF4A 3FXDA 3RL0B 3G3ZA 1OFCX 3KZIE 1OWAA 4U3FE 3HTKB 2LXBA 4ASVA 1ZR2A 5APUA 4DJGA 2FBWC 4L75A 1FJPA 4AQRD 2CPBA 2QE7H 5KAFH 5AW1B 1ZR4A 2H89C 2KLVA 3TGUJ 4UB6E 2XDJA 2B9BA 3MGNA 3P8MC 2H88C 3AE7C 2BEQD 1SFCD 1VQLP 2K88A 3QH9A 5DJTB 1NTKG 1OW6A 3HD7B 1GU5A 1LT9A 1NTME 1S4XA 1BCCG 1YQ3C 5CCGD 1USDA 4DCKA 3L72G 1FU1A 2FYUG 3TK1A 3U1AA 2C9NY 3HUSA 1Y9BA 1FJKA 1DH3A 2XKMA 3KXDA 2OYHC 4BWNA 3A3YB 2LKMA 1GZLA 2R5BA 1S5LE 3LIDA 1L0NG 3L70J 1FOSF 1Q2NA 3L74G 1BGYJ 1D7MA 1JOCA 1JCDA 2LR2A 1NJIQ 5AW9B 2FFDB 2E42A 2Q1KA 1KILC 1QEXA 2NPSC 4UB8H 2J58A 1M57D 2N9BA 1SLQA 2KNCB 1IK9A 5AW2B 4GOFA 3CMAP 1YHQP 3CXHH 1HGZA 2QJYB 1RF1B 1EZVD 2WT7A 1ZN5A 4I7ZC 1NTKE 1RE4A 1LP1B 2WZ7A 2PGDA 1KV4A 2K9YA 5APYA 1SQQG 1BCCE 4W7YA 2ZYGA 2QA4P 3L72E 2B87A 1SQVG 4GT1A 3IN6A 2OARA 1N8RQ 1L4AD 2FYUE 3SFEC 4EDFA 5GTIH 3Q5SA 1IFPA 3A0BE 3M91A 2AXTH 5H2FE 3RK2C 3MZWB 1L0NE 3RBXA 3RK2D 3CD6P 3L74E 3MTUE 3CX5H 2M3EA 1PP9D 2HFED 3KDPB 1HF9A 1SFCB 1FZEA 3CWBG 3L70D 1H89A 1GK4A 2W27A 2R5DA 3MUDC 4NPEA 4C7RA 1FZBA 1P84E 5TJHA 2N1TC 2R3SA 1N86A 2N1TD 3C9IA 1SQQE 3P8CE 1Q82Q 1N73A 4M3LA 2K1AA 1SQVE 3MIWA 2M5AB 1GU4A 1L0LK 5AVRB 4ZKUA 2Y9ZA 1NU1K 3A2AA 1GW3A 1JY2P 1CZQA 2E75C 2RH0A 2E75D 1PZQA 3H1ID 1YTZT 3HE4B 4HYTB 4N78D 5CBNA 3L37A 3VMXA 4Z1MH 2M8RA 3USSA 2YKOA 5KAIE 1SQBK 1HJ0A 1H0TB 2Q3EA 3Q5PA 3CWBE 2AXCA 3L71E 3RK3E 2IFMA 2IPPA 3D71A 1HGVA 2KS1B 2J59M 1DX7A 2QJPC 1L0LJ 5BVZA 3E1IA 1NU1J 2KOGA 2Q7CA 2HG5D 1E79H 2E5YA 3CI9A 2ZYDA 3BCCG 3PRJA 3WUVA 1S2EA 1L4AB 1KB9E 3T97A 5TISH 4PJ0H 4K3AA 1K05A 2YKPA 2P10A 1KB9I 1MUUA 1J1EB 1USEA 2W6BA 3L36A 1OVUA 5CJ0A 1M1KQ 3FX0A 4ZKPA 4Y99C 5AVVB 1LTIC 3E7KA 1LWUA 3RK2B 1SQBJ 5EFWB 4I2LC 1ZOYC 5GTHE 2YKQA 5CCHC 3CCVP 1PGPA 2FXMA 5CCHD 5KLVG 2OTKE 4PV1C 4N3YB 1JMBA 2QG4A 2JWDA 2JKVA 4OVNF 3JCUE 1EXIA 3BRVB 2XU6A 4BRYB 1A02F 4OH8B 3H1HG 2FXPA 2Z4EA 2N1TB 2YXQB 1QL2A 4KT0J 1NHLA 1VL2A 1GL2D 3CCJP 2B89A 4MN4C 3BCCE 3HE5B 1Q86Q 3VMYA 3HTKA 1YTZI 3KYQA 1LT1A 2E75B 3H1JJ 1W2BO 3TNUA 3ZDMA 5KJ7C 1QVFO 2P1JA 2WSCH 5KJ7D 3H1KG 1G2CA 4PD4D 2YO3A 2R44A 4IL6X 2QM8A 5KLVE 4HH2A 4K35A 1N7SA 2W83C 3AEGC 2BCCD 1SQXD 1X22A 3I56P 4D6TG 4ZMDA 1JTHB 3L75D 2HODB 2BASA 2L91A 2RKLA 1HBWA 5E79E 3WUTA 3KHUA 2HPCA 4YXWH 3H1HE 1K04A 4CPGA 4EYYQ 1RE3A 4H13D 4XA4A 2QJPB 1RH5B 4AUWA 3H1LG 1VPCA 3LW5H 5APWA 2E43A 1IK7A 4YTPC 1PGJA 1YIJP 2YMYA 1ZRTD 2G8YA 1M56D 1BDCA 3M0DC 1URQC 5DJUB 4Y99B 3CCEP 2XZRA 1URQD 3AEAC 3GHGA 2KLUA 3B5NC 1T3UA 3F89A 3AEFC 3LW5J 3H1KE 1S1CX 4JPZB 5KLIC 5AW8B 1PL5A 1YYCA 4WY4C 4OGQC 2K9JA 4IL6H 4WY4D 2IZ1A 4D6TE 4WVZA 1FZAA 1M1JC 1IC2A 1RF1A 2I8DA 2A06D 1NWQA 5B5EH 3EQ2A 2W6AA 1LP1A 1OVRA 1AVYA 3VTPC 2WVRA 1OZHA 1GL2B 3H1LE 2A45H 3L73D 4ZNCA 2V7QH 5KKZC 1QGKB 5K5GB 1L2PA 2G3AA 1CI6A 4TT3H 2OYIB 3MHVA 1M8OB 1Z56A 2PAJA 1PPJG 2D2CC 2KZIA 1IFMA 1W5CE 2NZ2A 3TGUG 2Y0DA 4HJGH 5APVA 3P32A 1SQPK 2KIKA 2W8ZA 1NTKK 4YPCA 2V7QJ 2JJLA 1SFCA 3V4WA 1VQOP 1J1DC 1PFIA 2WPSA 1IZNB 1GD2E 3ITKA 4WWIA 2P58A 1X79B 1BSHA 1Y47A 1AA0A 4H13B 1H8AA 5CCGA 3V6IA 1JY2N 2CPSA 3NMDA 4U3FD 4IFDK 2C0WA 2QSIA 1VQMP 1SS1A 2M5AA 1XTGB 1IFDA 2IBZG 1KMIZ 1PP9J 1SQPJ 4C7NA 1BE3J 1NAYA 1YI2P 1BGYG 1NTKJ 3VP8A 1PPJE 1URQB 1JUNA 4JF7A 3HE4A 3TGUE 3KPEA 1EZVI 2Y9YA 2UWJE 2C0XA 2R3CA 1NVOA 1RQUA 1KN7A 5KTBA 1H0TA 4WY4B 1KILD 2NPSD 1SQQK 1LNQA 1RF0A 1NTMD 3II6A 1EXJA 2O1JA 3PH0A 1M1JB 2YXRB 2YIUB 1CW5A 5KAFE 1FC2C 1IFNA 2KS1A 4I6MC 2W6JH 3JSVC 1KQGB 2XNXA 3M9HA 2FYNC 4H0LC 4H0LD 3H1IJ 3AE1C 2Q3IA 1L4AA 2PRRA 5KKZB 1FAVA 3NXSA 2ITAA 3L4FA 5L8RJ 1RE4C 2IBZE 3L70E 3M0AA 1BGYE 2IBZI 1KORA 2M3BA 2QM7A 2QVAA 3SSUA 1W2EA 4WBAA 1SQQJ 5AVTB 3RGUA 1FDOA 1VQ5P 4GKGA 2KZJA 2JO1A 2KYVA 1VQ4P 2Q5UA 1SQPD 1BE3D 1AFOA 5AVUB 2JWAA 1NTKD 2LXCB 3B4SA 1FZCA 3H32B 2HLOA 1OIPA 1BCCD 4BRYA 3L71G 3PTZA 1HWTC 1N7LA 3L72D 3OAKA 3A0HH 3M06A 2O3JA 2FYUD 3GLMA 4N6JA 1MV8A 2GM4A 4UB8E 3Q3DA 4N78E 3TSIA 4DT0A 3V5BA 5B66H 4L76A 4WB4A 1L0ND 3CXHE 3HE5A 3A7OA 1U57A 1OXZA 3L74D 1PIXA 3CXHI 3U59A 3G4SP 2OYHB 1NTZK 1SP4A 2I1JA 1LTBC 1R5SA 1AQTA 2N9YB 1MKMA 1X0TA 5CMZA 1ZW0A 2OYOA 2R32A 2Z5IA 5GTIE 3AE2C 3P7KA 1SQXK 1KILB 1A02J 2NPSB 3O6QB 1P84D 1TU3F 2WSFH 2AXTE 1Q90D 3MD0A 4PD4H 4QMAA 1YJNP 1HVVA 2GUSA 1SQQD 2HODA 2KSJA 4LLHA 2OQQA 3PLNA 1L0LG 1KFMA 1NU1G 4RESB 2PP6A 3CX5E 4I7ZB 3H25A 3M9QA 1MFZA 4R4MA 2WTYA 2BEZF 3AE9C 2FYNB 3S1KA 3CX5I 2KUBA 4H0LB 1EDIA 2NRGA 4B86A 4XE5B 1GTWA 3FWNA 1NTZJ 4EI2A 1JEKA 3Q1MA 4ASWA 2JEEA 2AEJA 2JP3A 2WSFJ 4XFJA 1JY3O 1WT6A 5KLVK 2E76C 2YNYA 1SQBG 3PHLA 3JC22 2E76D 1RHZB 2BCCJ 1MFTA 2FXOA 1SQXJ
chains in the Genus database with same CATH topology
2A06G 1EZVG 1L0NG 4PD4H 3CWBG 3TGUG 4D6TG 3L72G 1KB9H 3L74G 1SQVG 3BCCG 1PP9G 1SQPG 3CXHH 1BE3G 3L71G 2FYUG 1L0LG 3H1KG 1P84H 3CX5H 3H1JG 1NU1G 1NTKG 2BCCG 2IBZG 1SQXG 5KLVG 3H1HG 1KYOH 3L73G 4U3FG 1NTZG 3H1IG 1SQBG 1NTMG 3L70G 1BCCG 1BGYG 1SQQG 3H1LG 1PPJG 3L75G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A06 G;  1EZV G;  1L0N G;  4PD4 H;  3CWB G;  3TGU G;  4D6T G;  3L72 G;  1KB9 H;  3L74 G;  1SQV G;  3BCC G;  1PP9 G;  1SQP G;  3CXH H;  1BE3 G;  3L71 G;  2FYU G;  1L0L G;  3H1K G;  1P84 H;  3CX5 H;  3H1J G;  1NU1 G;  1NTK G;  2BCC G;  2IBZ G;  1SQX G;  5KLV G;  3H1H G;  1KYO H;  3L73 G;  4U3F G;  1NTZ G;  3H1I G;  1SQB G;  1NTM G;  3L70 G;  1BCC G;  1BGY G;  1SQQ G;  3H1L G;  1PPJ G;  3L75 G; 
#chains in the Genus database with same CATH topology
 1JNM A;  1JM0 A;  1SVF A;  1OW7 A;  5AW4 B;  2WPR A;  2B87 B;  2QRX A;  5B66 E;  3L75 J;  3CWB D;  3RK3 C;  2P7J A;  2L5G B;  2QIW A;  3L35 A;  3V2P A;  3I5C A;  4NPD A;  4PV1 D;  3ABV C;  1ZME C;  1KYO D;  3HRN A;  4H44 C;  1QLE D;  1JB0 J;  1VQP P;  4H44 D;  4DZO A;  4YXD C;  1L0L E;  3VOP A;  1NU1 E;  1LJ2 A;  1OMI A;  1KB9 D;  2P2U A;  3VYI A;  1LTS C;  1GL2 A;  1X8Y A;  4JBZ A;  5KLV J;  2RN0 A;  1K9M Q;  2AEM A;  1HUC A;  1T6A A;  2H7H A;  2E74 C;  4PD4 I;  3H1J G;  2E5T A;  2OYI A;  4C46 A;  1SQB E;  3Q5R A;  1ZP0 C;  2MKV A;  3C1L A;  4LC1 A;  1U7M A;  1NTZ D;  3RL0 C;  5KJ7 A;  3CPW O;  1EDJ A;  2POH A;  3WMM 0;  5TIS E;  3SFD C;  3A5T A;  4PJ0 E;  1UIX A;  3GG2 A;  2XV5 A;  2V4H A;  3I55 P;  1T3J A;  3L73 J;  3BAT A;  4AYC A;  3EFG A;  1KD1 Q;  3WU2 H;  3FXE A;  1ZRT E;  5AVY B;  2ZT9 C;  2ZT9 D;  3HD7 A;  3G9R A;  1N7S C;  1K8A Q;  1J2J B;  1BDD A;  1N7S D;  1VDF A;  2WQY C;  5APS A;  5BU8 B;  1FZF A;  3AE8 C;  2FY8 A;  1T2K C;  3AE6 C;  3V2Q A;  5BU5 A;  3KZI H;  3CLQ A;  1S5L X;  1T2K D;  3H1J E;  1BSN A;  2VRS A;  3C8V A;  1QVG O;  1RE3 C;  2E76 B;  1VQ6 P;  1VQ7 P;  5AVW B;  5KLV D;  4JQ0 D;  3FGA D;  1S9K E;  1AJY A;  4IOI H;  3B5N D;  4UB6 H;  4L73 A;  3AE5 C;  2FFD A;  2FKW B;  1EC5 A;  1LTJ C;  1NH4 A;  1DIP A;  4W80 A;  1YIT P;  4PV1 B;  1NTM K;  3H1H D;  1AV1 A;  4U3F J;  3GHG C;  4OGQ D;  1Q7Y Q;  2KNC A;  2ZVO B;  2MJZ A;  1AVO A;  4EIJ A;  2PFX A;  3B71 A;  1VQ8 P;  4HKZ H;  1QX8 A;  4IFM A;  2WSE H;  2WSS H;  4A7P A;  1MZ9 A;  5APQ A;  3D6Y A;  1KFN A;  2WWW A;  1LTT C;  3TF5 A;  1RF1 C;  2GA1 A;  3VMA A;  1HTL C;  2Q6Q A;  1FBM A;  3H1K D;  3CCM P;  2IFN A;  4KJM A;  3PJS K;  1S5L H;  2FYZ A;  2A45 G;  1KC8 Q;  1EZV G;  3TYY A;  1NTM J;  2D2C D;  3B8E B;  3O8Z A;  2WSE J;  1JY3 N;  1YJ9 P;  2OTJ P;  3CCQ P;  4D6T D;  1DD3 A;  3CC7 P;  3W68 A;  1WRG A;  3AEB C;  3TNU B;  1GMJ A;  3H32 A;  2DW3 A;  1IO4 A;  1H88 A;  3H1L D;  2ZXX A;  2ZXE B;  2ZT9 B;  1G2C B;  2FYU K;  3CCU P;  4EOT A;  4GOE A;  1WMK A;  2WPV B;  1N7S B;  1SFC C;  4O9B A;  2P67 A;  3AEC C;  4Y28 J;  1FOS E;  4IL6 E;  1LTG C;  1L0N K;  1PP9 G;  1SQP G;  1BE3 G;  1ZV8 A;  2HYN A;  1KIL E;  3A0B H;  5AW6 B;  1VQN P;  5B5E E;  2HPC B;  5CCG C;  2OYH A;  1LT9 C;  3L70 G;  5H2F H;  4U7J A;  5CJ4 A;  1EZV E;  1Y8A A;  4KHX A;  1BCC J;  2O01 N;  3B5N B;  1U7J A;  3HUS C;  1YJW P;  2A45 I;  2CK3 H;  3L72 J;  3AE3 C;  2Y0C A;  5KLI B;  1LTJ B;  1OW8 A;  2FYU J;  1KIL A;  1NOH A;  2NPS A;  3O6Q A;  1EDL A;  1YBK A;  2Q9I A;  4OGQ B;  3GHG B;  1S72 P;  1VQ9 P;  1SQV K;  1L0N J;  1P84 H;  1PGO A;  3L74 J;  3BRT B;  1VF5 C;  3H1I G;  1VF5 D;  1GW4 A;  1LTA C;  2K9J B;  1RF0 C;  5AW0 B;  2W90 A;  2K3R A;  1PPJ D;  3CC4 P;  1PP9 E;  1SQP E;  5CHX A;  1BE3 E;  2IZ0 A;  3AED C;  1JO5 A;  5CBO A;  3TGU D;  5AVS B;  3OW2 O;  2K37 A;  2B88 A;  1HH0 A;  1GDT A;  3VMZ A;  2Z5H A;  3V2N A;  3GMA A;  2D2C B;  3PP5 A;  4NPF X;  1NAF A;  3VP9 A;  1L4A C;  3NFQ A;  2KXP B;  1CI6 B;  1T8Z A;  3VN0 A;  1J1E C;  1SQV J;  3BAS A;  5KAI H;  3EWK A;  5APX A;  5AW3 B;  2IYP A;  1JCC A;  1JY3 P;  1J1D B;  1R5L A;  4R4L A;  1NO4 A;  4JYC A;  1XTC C;  3MUD A;  1GK6 A;  1KYO H;  2N1T A;  3H1I E;  3K5B A;  2WPQ A;  2C9L Y;  3D70 A;  2IBZ D;  1FZC C;  1NGM B;  1KB9 H;  1BGY D;  1G1J A;  1KQL A;  3CWB J;  1DD4 A;  3L71 J;  1FS0 E;  1JMM A;  1LT9 B;  1P84 I;  1UII A;  1DEE G;  1N73 C;  5GTH H;  1S3J A;  3G71 P;  3BVH A;  2O01 H;  3HUS B;  2AEF A;  3IR9 A;  1FDI A;  4DOJ A;  4C7N B;  1ZLL A;  1NYH A;  5APT A;  4LGD E;  3GF3 A;  3JCU H;  1RY3 A;  3TDK A;  2GUV A;  1JTH A;  3P8C D;  1KZU B;  1NKN A;  1M7L A;  2ZFC A;  3CC2 P;  1SQV D;  2YO2 A;  1VF5 B;  3CXH D;  1NTZ G;  3RBZ A;  1PGQ A;  2O01 J;  1FZG A;  1DEB A;  1FE6 A;  2ZYA A;  3SWK A;  4RJT A;  3U1C A;  1OX3 A;  2WT7 B;  1EQ7 A;  2SPZ A;  2BCC G;  1K73 Q;  1SQX G;  3A0H E;  3FWL A;  1KYO E;  4GOD A;  3L75 G;  1AQ5 A;  1KYO I;  4GIF A;  1IFJ A;  1IJD B;  1M90 Q;  3CL3 D;  2KP8 A;  5CCH A;  2KSE A;  2IX7 C;  1ZXG A;  3BCC J;  3L71 D;  3RK3 D;  3IFM A;  3CCR P;  3CX5 D;  3V4Q A;  1LWU C;  3SWF A;  3R2P A;  2QJK C;  2XND H;  2YMK A;  2IYO A;  2WMM A;  5E79 H;  1RQV A;  4IFF A;  1NTZ E;  4TLF A;  3KQG A;  3CCS P;  4BXL A;  2KK7 A;  3H6P A;  1G1I A;  1FZC B;  4OWF A;  3UIA A;  4PD4 E;  3N4X A;  1JY2 O;  2OTL P;  1QL1 A;  3W67 A;  2KI7 B;  2E74 D;  4RKU J;  2BCC E;  2Y0E A;  1SQX E;  1GL2 C;  2ZJS E;  1IFI A;  3L75 E;  1FDM A;  3H1H J;  3OJA B;  2A06 G;  4L74 A;  1N73 B;  3EFF K;  2IDB A;  3CME P;  1HJB A;  1EDK A;  3RL0 D;  1PV3 A;  3V2R A;  2OYI C;  3N7N A;  5M1B A;  3L73 G;  1L0L D;  5AVZ B;  1NU1 D;  2QEX P;  1X9V A;  2RMZ A;  3D6Z A;  3MP7 B;  3BCC D;  2J5U A;  2JDI H;  3H1K J;  2O1K A;  1KTM A;  1SQB D;  3M9B A;  3WUU A;  1YQ4 C;  5C39 A;  4GDO A;  4D6T J;  3HD7 C;  4H13 C;  2OGU A;  3GF7 A;  3HD7 D;  2WSC J;  2ZVN B;  3M0D A;  1URQ A;  2ZAE B;  3E1R A;  4HB1 A;  2A06 E;  3AEE C;  3IAO A;  2WIT A;  3B5N A;  1E5W A;  3H1L J;  3T97 B;  2JR8 A;  5AW7 B;  3RK3 B;  1NKZ B;  1LTJ A;  4JYB A;  4U3F G;  2H43 A;  3L73 E;  3S9O A;  4W7Z A;  3S4R A;  4WY4 A;  5AVQ B;  3G6E P;  1LWU B;  2H8P D;  4I1L A;  4H44 B;  2QJK B;  1M1J A;  5AVX B;  1CSB A;  1KQS O;  2FFD C;  3QWO C;  1OVV A;  2KB7 P;  3H1J D;  5AW5 B;  1LGH B;  3NTN A;  3Q2Y A;  1VQK P;  2M0B A;  2YIU C;  2QJY C;  3WU2 E;  2HR3 A;  3AE4 C;  3LIE A;  1R8E A;  3RL0 g;  1S9K D;  3F5H A;  2E74 B;  1Q81 Q;  3SWY A;  3CCL P;  2I1K A;  1KQF B;  1NTM G;  3R4Y A;  4RO0 A;  3GW6 A;  3OA7 A;  1N2D C;  3IF4 A;  3FXD A;  3RL0 B;  3G3Z A;  1OFC X;  3KZI E;  1OWA A;  4U3F E;  3HTK B;  2LXB A;  4ASV A;  1ZR2 A;  5APU A;  4DJG A;  2FBW C;  4L75 A;  1FJP A;  4AQR D;  2CPB A;  2QE7 H;  5KAF H;  5AW1 B;  1ZR4 A;  2H89 C;  2KLV A;  3TGU J;  4UB6 E;  2XDJ A;  2B9B A;  3MGN A;  3P8M C;  2H88 C;  3AE7 C;  2BEQ D;  1SFC D;  1VQL P;  2K88 A;  3QH9 A;  5DJT B;  1NTK G;  1OW6 A;  3HD7 B;  1GU5 A;  1LT9 A;  1NTM E;  1S4X A;  1BCC G;  1YQ3 C;  5CCG D;  1USD A;  4DCK A;  3L72 G;  1FU1 A;  2FYU G;  3TK1 A;  3U1A A;  2C9N Y;  3HUS A;  1Y9B A;  1FJK A;  1DH3 A;  2XKM A;  3KXD A;  2OYH C;  4BWN A;  3A3Y B;  2LKM A;  1GZL A;  2R5B A;  1S5L E;  3LID A;  1L0N G;  3L70 J;  1FOS F;  1Q2N A;  3L74 G;  1BGY J;  1D7M A;  1JOC A;  1JCD A;  2LR2 A;  1NJI Q;  5AW9 B;  2FFD B;  2E42 A;  2Q1K A;  1KIL C;  1QEX A;  2NPS C;  4UB8 H;  2J58 A;  1M57 D;  2N9B A;  1SLQ A;  2KNC B;  1IK9 A;  5AW2 B;  4GOF A;  3CMA P;  1YHQ P;  3CXH H;  1HGZ A;  2QJY B;  1RF1 B;  1EZV D;  2WT7 A;  1ZN5 A;  4I7Z C;  1NTK E;  1RE4 A;  1LP1 B;  2WZ7 A;  2PGD A;  1KV4 A;  2K9Y A;  5APY A;  1SQQ G;  1BCC E;  4W7Y A;  2ZYG A;  2QA4 P;  3L72 E;  2B87 A;  1SQV G;  4GT1 A;  3IN6 A;  2OAR A;  1N8R Q;  1L4A D;  2FYU E;  3SFE C;  4EDF A;  5GTI H;  3Q5S A;  1IFP A;  3A0B E;  3M91 A;  2AXT H;  5H2F E;  3RK2 C;  3MZW B;  1L0N E;  3RBX A;  3RK2 D;  3CD6 P;  3L74 E;  3MTU E;  3CX5 H;  2M3E A;  1PP9 D;  2HFE D;  3KDP B;  1HF9 A;  1SFC B;  1FZE A;  3CWB G;  3L70 D;  1H89 A;  1GK4 A;  2W27 A;  2R5D A;  3MUD C;  4NPE A;  4C7R A;  1FZB A;  1P84 E;  5TJH A;  2N1T C;  2R3S A;  1N86 A;  2N1T D;  3C9I A;  1SQQ E;  3P8C E;  1Q82 Q;  1N73 A;  4M3L A;  2K1A A;  1SQV E;  3MIW A;  2M5A B;  1GU4 A;  1L0L K;  5AVR B;  4ZKU A;  2Y9Z A;  1NU1 K;  3A2A A;  1GW3 A;  1JY2 P;  1CZQ A;  2E75 C;  2RH0 A;  2E75 D;  1PZQ A;  3H1I D;  1YTZ T;  3HE4 B;  4HYT B;  4N78 D;  5CBN A;  3L37 A;  3VMX A;  4Z1M H;  2M8R A;  3USS A;  2YKO A;  5KAI E;  1SQB K;  1HJ0 A;  1H0T B;  2Q3E A;  3Q5P A;  3CWB E;  2AXC A;  3L71 E;  3RK3 E;  2IFM A;  2IPP A;  3D71 A;  1HGV A;  2KS1 B;  2J59 M;  1DX7 A;  2QJP C;  1L0L J;  5BVZ A;  3E1I A;  1NU1 J;  2KOG A;  2Q7C A;  2HG5 D;  1E79 H;  2E5Y A;  3CI9 A;  2ZYD A;  3BCC G;  3PRJ A;  3WUV A;  1S2E A;  1L4A B;  1KB9 E;  3T97 A;  5TIS H;  4PJ0 H;  4K3A A;  1K05 A;  2YKP A;  2P10 A;  1KB9 I;  1MUU A;  1J1E B;  1USE A;  2W6B A;  3L36 A;  1OVU A;  5CJ0 A;  1M1K Q;  3FX0 A;  4ZKP A;  4Y99 C;  5AVV B;  1LTI C;  3E7K A;  1LWU A;  3RK2 B;  1SQB J;  5EFW B;  4I2L C;  1ZOY C;  5GTH E;  2YKQ A;  5CCH C;  3CCV P;  1PGP A;  2FXM A;  5CCH D;  5KLV G;  2OTK E;  4PV1 C;  4N3Y B;  1JMB A;  2QG4 A;  2JWD A;  2JKV A;  4OVN F;  3JCU E;  1EXI A;  3BRV B;  2XU6 A;  4BRY B;  1A02 F;  4OH8 B;  3H1H G;  2FXP A;  2Z4E A;  2N1T B;  2YXQ B;  1QL2 A;  4KT0 J;  1NHL A;  1VL2 A;  1GL2 D;  3CCJ P;  2B89 A;  4MN4 C;  3BCC E;  3HE5 B;  1Q86 Q;  3VMY A;  3HTK A;  1YTZ I;  3KYQ A;  1LT1 A;  2E75 B;  3H1J J;  1W2B O;  3TNU A;  3ZDM A;  5KJ7 C;  1QVF O;  2P1J A;  2WSC H;  5KJ7 D;  3H1K G;  1G2C A;  4PD4 D;  2YO3 A;  2R44 A;  4IL6 X;  2QM8 A;  5KLV E;  4HH2 A;  4K35 A;  1N7S A;  2W83 C;  3AEG C;  2BCC D;  1SQX D;  1X22 A;  3I56 P;  4D6T G;  4ZMD A;  1JTH B;  3L75 D;  2HOD B;  2BAS A;  2L91 A;  2RKL A;  1HBW A;  5E79 E;  3WUT A;  3KHU A;  2HPC A;  4YXW H;  3H1H E;  1K04 A;  4CPG A;  4EYY Q;  1RE3 A;  4H13 D;  4XA4 A;  2QJP B;  1RH5 B;  4AUW A;  3H1L G;  1VPC A;  3LW5 H;  5APW A;  2E43 A;  1IK7 A;  4YTP C;  1PGJ A;  1YIJ P;  2YMY A;  1ZRT D;  2G8Y A;  1M56 D;  1BDC A;  3M0D C;  1URQ C;  5DJU B;  4Y99 B;  3CCE P;  2XZR A;  1URQ D;  3AEA C;  3GHG A;  2KLU A;  3B5N C;  1T3U A;  3F89 A;  3AEF C;  3LW5 J;  3H1K E;  1S1C X;  4JPZ B;  5KLI C;  5AW8 B;  1PL5 A;  1YYC A;  4WY4 C;  4OGQ C;  2K9J A;  4IL6 H;  4WY4 D;  2IZ1 A;  4D6T E;  4WVZ A;  1FZA A;  1M1J C;  1IC2 A;  1RF1 A;  2I8D A;  2A06 D;  1NWQ A;  5B5E H;  3EQ2 A;  2W6A A;  1LP1 A;  1OVR A;  1AVY A;  3VTP C;  2WVR A;  1OZH A;  1GL2 B;  3H1L E;  2A45 H;  3L73 D;  4ZNC A;  2V7Q H;  5KKZ C;  1QGK B;  5K5G B;  1L2P A;  2G3A A;  1CI6 A;  4TT3 H;  2OYI B;  3MHV A;  1M8O B;  1Z56 A;  2PAJ A;  1PPJ G;  2D2C C;  2KZI A;  1IFM A;  1W5C E;  2NZ2 A;  3TGU G;  2Y0D A;  4HJG H;  5APV A;  3P32 A;  1SQP K;  2KIK A;  2W8Z A;  1NTK K;  4YPC A;  2V7Q J;  2JJL A;  1SFC A;  3V4W A;  1VQO P;  1J1D C;  1PFI A;  2WPS A;  1IZN B;  1GD2 E;  3ITK A;  4WWI A;  2P58 A;  1X79 B;  1BSH A;  1Y47 A;  1AA0 A;  4H13 B;  1H8A A;  5CCG A;  3V6I A;  1JY2 N;  2CPS A;  3NMD A;  4U3F D;  4IFD K;  2C0W A;  2QSI A;  1VQM P;  1SS1 A;  2M5A A;  1XTG B;  1IFD A;  2IBZ G;  1KMI Z;  1PP9 J;  1SQP J;  4C7N A;  1BE3 J;  1NAY A;  1YI2 P;  1BGY G;  1NTK J;  3VP8 A;  1PPJ E;  1URQ B;  1JUN A;  4JF7 A;  3HE4 A;  3TGU E;  3KPE A;  1EZV I;  2Y9Y A;  2UWJ E;  2C0X A;  2R3C A;  1NVO A;  1RQU A;  1KN7 A;  5KTB A;  1H0T A;  4WY4 B;  1KIL D;  2NPS D;  1SQQ K;  1LNQ A;  1RF0 A;  1NTM D;  3II6 A;  1EXJ A;  2O1J A;  3PH0 A;  1M1J B;  2YXR B;  2YIU B;  1CW5 A;  5KAF E;  1FC2 C;  1IFN A;  2KS1 A;  4I6M C;  2W6J H;  3JSV C;  1KQG B;  2XNX A;  3M9H A;  2FYN C;  4H0L C;  4H0L D;  3H1I J;  3AE1 C;  2Q3I A;  1L4A A;  2PRR A;  5KKZ B;  1FAV A;  3NXS A;  2ITA A;  3L4F A;  5L8R J;  1RE4 C;  2IBZ E;  3L70 E;  3M0A A;  1BGY E;  2IBZ I;  1KOR A;  2M3B A;  2QM7 A;  2QVA A;  3SSU A;  1W2E A;  4WBA A;  1SQQ J;  5AVT B;  3RGU A;  1FDO A;  1VQ5 P;  4GKG A;  2KZJ A;  2JO1 A;  2KYV A;  1VQ4 P;  2Q5U A;  1SQP D;  1BE3 D;  1AFO A;  5AVU B;  2JWA A;  1NTK D;  2LXC B;  3B4S A;  1FZC A;  3H32 B;  2HLO A;  1OIP A;  1BCC D;  4BRY A;  3L71 G;  3PTZ A;  1HWT C;  1N7L A;  3L72 D;  3OAK A;  3A0H H;  3M06 A;  2O3J A;  2FYU D;  3GLM A;  4N6J A;  1MV8 A;  2GM4 A;  4UB8 E;  3Q3D A;  4N78 E;  3TSI A;  4DT0 A;  3V5B A;  5B66 H;  4L76 A;  4WB4 A;  1L0N D;  3CXH E;  3HE5 A;  3A7O A;  1U57 A;  1OXZ A;  3L74 D;  1PIX A;  3CXH I;  3U59 A;  3G4S P;  2OYH B;  1NTZ K;  1SP4 A;  2I1J A;  1LTB C;  1R5S A;  1AQT A;  2N9Y B;  1MKM A;  1X0T A;  5CMZ A;  1ZW0 A;  2OYO A;  2R32 A;  2Z5I A;  5GTI E;  3AE2 C;  3P7K A;  1SQX K;  1KIL B;  1A02 J;  2NPS B;  3O6Q B;  1P84 D;  1TU3 F;  2WSF H;  2AXT E;  1Q90 D;  3MD0 A;  4PD4 H;  4QMA A;  1YJN P;  1HVV A;  2GUS A;  1SQQ D;  2HOD A;  2KSJ A;  4LLH A;  2OQQ A;  3PLN A;  1L0L G;  1KFM A;  1NU1 G;  4RES B;  2PP6 A;  3CX5 E;  4I7Z B;  3H25 A;  3M9Q A;  1MFZ A;  4R4M A;  2WTY A;  2BEZ F;  3AE9 C;  2FYN B;  3S1K A;  3CX5 I;  2KUB A;  4H0L B;  1EDI A;  2NRG A;  4B86 A;  4XE5 B;  1GTW A;  3FWN A;  1NTZ J;  4EI2 A;  1JEK A;  3Q1M A;  4ASW A;  2JEE A;  2AEJ A;  2JP3 A;  2WSF J;  4XFJ A;  1JY3 O;  1WT6 A;  5KLV K;  2E76 C;  2YNY A;  1SQB G;  3PHL A;  3JC2 2;  2E76 D;  1RHZ B;  2BCC J;  1MFT A;  2FXO A;  1SQX J; 
#chains in the Genus database with same CATH homology
 2A06 G;  1EZV G;  1L0N G;  4PD4 H;  3CWB G;  3TGU G;  4D6T G;  3L72 G;  1KB9 H;  3L74 G;  1SQV G;  3BCC G;  1PP9 G;  1SQP G;  3CXH H;  1BE3 G;  3L71 G;  2FYU G;  1L0L G;  3H1K G;  1P84 H;  3CX5 H;  3H1J G;  1NU1 G;  1NTK G;  2BCC G;  2IBZ G;  1SQX G;  5KLV G;  3H1H G;  1KYO H;  3L73 G;  4U3F G;  1NTZ G;  3H1I G;  1SQB G;  1NTM G;  3L70 G;  1BCC G;  1BGY G;  1SQQ G;  3H1L G;  1PPJ G;  3L75 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...