1AVOA

Proteasome activator reg(alpha)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
60
structure length
60
Chain Sequence
LRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Proteasome activator
molecule keywords 11S REGULATOR
publication title Structure of the proteasome activator REGalpha (PA28alpha).
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 60
sequence length 60
chains with identical sequence C, E, G, I, K, M
ec nomenclature
pdb deposition date 1997-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.120 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Proteasome activator pa28, N-terminal domain 1avoA00
1AVOA
chains in the Genus database with same CATH superfamily
1L0NK 1HUCA 3H1HG 1CSBA 1IK7A 4WB4A 1VQ5P 1SQPK 2MJZA 1SFCA 3II6A 5APYA 2FKWB 3BRVB 3JSVC 3VTPC 4DT0A 3USSA 5TISE 3WU2E 2K9YA 4H13C 2KLVA 3WUTA 2BEZF 3RK2C 1ZRTD 3HE4B 1BGYG 2IZ1A 1IFNA 1FDOA 3RL0g 4U3FE 3CX5E 1XTGB 1M7LA 3L74E 4D6TG 2A06E 2K88A 2OGUA 3L73E 2OTLP 2O01J 3CC2P 2WMMA 2HLOA 3U1CA 1EDIA 3L70E 1NU1G 1JUNA 2PGDA 4JF7A 3CMEP 3E1RA 1HWTC 1JTHB 3MHVA 3Q5PA 1YTZI 4JYCA 2B9BA 4GKGA 1FS0E 2IYOA 3AE4C 3A2AA 4OGQC 2WSEH 1PV3A 2A06D 1H89A 3NXSA 3GF3A 3L73D 5TISH 1FOSF 3MUDA 5C39A 1NTKE 2K37A 4LLHA 2GM4A 1AJYA 2OYHB 4KHXA 3Q5SA 2BCCG 3W67A 2Q6QA 4WY4D 5AVTB 5AW9B 3A0HH 3CCLP 1DEBA 2W90A 1KYOH 2AXTH 5AW6B 1N73C 1LT1A 1FE6A 3EWKA 4JQ0D 2L91A 5AVRB 1L2PA 3HUSA 3H1LJ 1JY3O 3V5BA 1H0TA 1J1EC 3VMZA 2E75B 2B88A 1YHQP 1LTBC 3KZIH 3AE2C 1PFIA 3C8VA 3L35A 2YO3A 5GTIH 3WMM0 3CCJP 2YIUC 2P58A 4RO0A 3Q5RA 2J5UA 3VP9A 3SWKA 1PZQA 2K9JA 2GA1A 1PPJG 4AYCA 3SFDC 1NU1K 3RK3B 1LTJC 1SQBJ 1LTTC 1M57D 2QJKB 3C1LA 1T6AA 3L72G 1EDJA 1SQQG 3H1JG 3AEBC 2WPQA 1G2CA 3M06A 2M3EA 1JCCA 1FC2C 4RJTA 1DIPA 1M1JB 3ABVC 3VYIA 2ZT9B 5KLVJ 2JEEA 2XDJA 4WY4C 2HR3A 2XKMA 5AVZB 3V4WA 2FFDA 2AEMA 3GHGC 1K04A 3CMAP 1L4AD 2YMKA 1RE3A 4PV1D 2HPCA 3MP7B 2K3RA 2E42A 2QE7H 4I7ZB 2CPSA 2W27A 3I55P 1CZQA 1T3UA 1WRGA 3CL3D 2OYOA 3GW6A 3L75G 3S9OA 2WPSA 4H0LB 3CWBJ 4EIJA 2KOGA 3R4YA 1RY3A 1MUUA 4WBAA 3H1KJ 3H32A 5KJ7D 5CCGD 1VQ6P 2QJPB 1S72P 5CJ4A 1G1JA 1H8AA 1JY3N 1NTZJ 2KB7P 1KQLA 4DOJA 2XZRA 4PJ0H 1PGJA 1GL2C 5H2FE 4XA4A 1RF1B 4N6JA 1QX8A 2WITA 3HD7A 3JCUE 3KDPB 1VF5B 3M9HA 2H7HA 2Q7CA 3M0DA 4YPCA 4YXWH 2M8RA 1SQQK 2WSCH 4HH2A 4MN4C 1FZCC 2YXQB 3RK3E 4H13B 3E1IA 3L37A 3IN6A 1L4AC 2H43A 2IYPA 2J59M 1DX7A 4PV1C 2ZXXA 1AVYA 1IFIA 5B5EE 2OTJP 4U3FG 5KTBA 1LWUB 1EC5A 3L74G 1RHZB 2A06G 1Y8AA 3HTKB 3AE3C 4M3LA 3L73G 4C7RA 3SFEC 2ZVOB 1T2KD 2LXCB 3TK1A 4H44D 5KJ7C 5CCGC 3P8MC 4JBZA 1SQXJ 2C0WA 4AQRD 1NOHA 1RE4A 2NPSB 5AW5B 3S4RA 1GK4A 3FGAD 1KYOI 4UB6E 3B5NB 3U59A 1L0LJ 3TGUJ 2LR2A 3HE4A 1IFMA 4JYBA 1BCCE 4OGQB 4IFFA 2MKVA 3CCMP 3GG2A 2AEJA 1AQ5A 4IOIH 2W6JH 1NH4A 1NO4A 5APUA 2P10A 1SFCD 3B4SA 1OWAA 2AEFA 1L0NJ 2WT7B 2IFNA 1N73B 2BCCD 1PP9D 1BCCD 4Y99C 1SQPJ 2GUVA 3OW2O 1P84H 1NJIQ 1BE3E 2OTKE 1J1EB 1T2KC 1FDMA 1OVVA 3H1LE 2E74D 3CXHD 3CCUP 3M9QA 2K1AA 2OYHA 1S1CX 1GD2E 2YIUB 1YJ9P 1M1KQ 3W68A 5GTHE 4KT0J 2WPVB 2E76B 3MTUE 3H1IJ 2V7QH 1KD1Q 1BE3D 3CXHH 5APXA 2WQYC 4IL6H 4N78D 2Z5HA 3L36A 3CCSP 2KI7B 3AE6C 1VQMP 4LGDE 1SQBE 1VQ4P 3OAKA 4GOFA 3K5BA 4GODA 2D2CC 3H1JD 2FYNC 1OW7A 4ASWA 3NFQA 2POHA 2KP8A 1JNMA 4WY4B 2G3AA 2LKMA 3GHGB 5CCHC 1NTME 5KLVE 1S3JA 2QJYC 3L71E 1VL2A 3F5HA 3AEDC 2ZVNB 4BXLA 3H1HJ 2W6AA 3MD0A 5CBOA 5GTHH 1VQ8P 2KUBA 2ZJSE 2BEQD 2E74C 3BVHA 2C9NY 3L75D 3VMXA 4EDFA 1EQ7A 3CWBE 5BVZA 5KAFE 2I1KA 1M1JA 1QEXA 1OZHA 1JY2P 1Q7YQ 1IZNB 2NZ2A 2R5BA 1LT9C 1FAVA 3ZDMA 1NTMD 4DJGA 1BGYJ 3L71D 2Y0EA 1GL2B 1NTZE 3SWYA 3F89A 1PIXA 4NPEA 2OYIA 4D6TJ 3A5TA 3U1AA 3FWNA 2KSJA 1NWQA 2L5GB 3MUDC 1KMIZ 4ZKUA 3RL0D 1NU1J 1RF0A 1SQVE 3G4SP 2QM8A 5AVQB 2ZXEB 2NRGA 3PRJA 1Z56A 3AEAC 1KB9E 1FZCB 1YITP 4UB8E 1LJ2A 1LP1B 1URQB 4RESB 2H8PD 3SWFA 1RF1A 4W7YA 1GW4A 3HUSC 1OMIA 3BATA 1VQPP 4U3FD 2Y0DA 3CX5D 1SQVD 3R2PA 1QVGO 3L74D 4Y28J 3BRTB 3WU2H 2I1JA 3E7KA 1DH3A 3S1KA 1KB9D 1KILB 1AQTA 2W83C 1LGHB 3IFMA 1H88A 3L70D 1K8AQ 2KZIA 2N1TB 1SQXE 1W2BO 2R3CA 4U7JA 1PP9G 1KQGB 3HRNA 1BCCG 3CX5H 1P84I 4ASVA 3FX0A 1L0LE 1VQOP 2Y0CA 1LWUA 5APVA 3HTKA 3HD7D 1NGMB 3FWLA 2FYUE 3Q2YA 5AW4B 3RL0C 1NKNA 2IX7C 4Z1MH 2Q3EA 4L76A 3KPEA 1NTKD 3PH0A 3MIWA 2YO2A 2OARA 2NPSA 4PD4E 1FOSE 2RMZA 2QG4A 3B5NA 2KXPB 1NYHA 1RE3C 2H88C 1OW6A 3VP8A 3CXHI 1BE3G 3CCQP 2QSIA 5K5GB 4R4MA 5B66E 2XNXA 3L72J 1VQKP 1SQQJ 5AW1B 1VQ7P 1AVOA 2FYUD 3AE8C 2YKQA 3BCCE 3H1LG 1JEKA 5BU8B 1MKMA 1DD3A 2XV5A 1LNQA 2V4HA 2JJLA 4LC1A 1D7MA 2P7JA 3B8EB 1K05A 3CCVP 1RQUA 2Y9ZA 3RBXA 2WT7A 1PL5A 1JMMA 1Q2NA 3BCCD 3H1IE 3HD7C 3CC7P 4ZNCA 1SQBG 5AW3B 1BDDA 5KKZC 3GLMA 3JC22 4GIFA 1KILE 3M0DC 2D2CB 2G8YA 2FYNB 3P7KA 1LTAC 2A45H 5APTA 2QA4P 2HFED 1JY2O 2OQQA 3AE7C 1QVFO 1JB0J 3P32A 1YJWP 1NTMG 1KTMA 5KLVG 3TF5A 1FJPA 2WSFH 1IFDA 1N7SB 2R32A 3L71G 2QRXA 1KORA 2QJYB 1X9VA 4A7PA 1YJNP 2SPZA 3WUUA 1MFZA 1FZBA 2HYNA 1EDKA 2WSEJ 3H1HE 3A3YB 1S5LX 3P8CE 4EOTA 3D71A 1RE4C 4W80A 2KNCB 1FBMA 1K9MQ 1LT9B 1S5LE 5KAIE 1PGOA 2P1JA 1NTZG 3MZWB 4QMAA 1EXJA 3IAOA 3L73J 4RKUJ 1EDLA 3RK2B 2E75D 1TU3F 3Q1MA 4R4LA 1YI2P 1KV4A 2J58A 1EXIA 1SQVG 4D6TE 3CPWO 3IR9A 3SSUA 2E5TA 1SQBK 5APQA 1NU1E 2KIKA 1IJDB 3L70G 1HJBA 4DCKA 5H2FH 1FZGA 1AFOA 1OXZA 3RK3D 4KJMA 2W8ZA 3CX5I 1FZAA 1GL2A 2HODB 2N9YB 3AE9C 3JCUH 3D6ZA 3HUSB 4I6MC 1NTMK 2FXPA 2M5AB 1HBWA 1QL2A 1JY2N 1KZUB 4L74A 1ZMEC 1NTKG 3AEGC 3AEEC 1NVOA 1SVFA 1SQXG 4O9BA 1USEA 2ZT9D 3QH9A 1FZCA 3TNUB 2QEXP 1UIIA 2E43A 3GF7A 5B5EH 1G1IA 5AW7B 1URQA 5DJTB 1MFTA 4W7ZA 1JTHA 1OFCX 1LTGC 2JKVA 4AUWA 1USDA 1YQ4C 2FYUG 1Q86Q 2E75C 1NTZK 1IFPA 2IBZE 4H0LD 1FZEA 3CCEP 4BRYB 3OA7A 5E79E 2O01N 2O01H 1A02F 2KK7A 3WUVA 1KILA 4H44C 2JP3A 4UB6H 2N1TA 1SQVK 4YXDC 3M9BA 4BWNA 3RK3C 1JCDA 4EYYQ 4HKZH 1GTWA 2A45G 2B87B 3T97B 5AVWB 1RQVA 3BCCG 2IBZD 1LTJB 5CBNA 5EFWB 1VF5D 5CHXA 3H32B 3AE5C 3H1LD 2UWJE 3AE1C 1M1JC 2A45I 4IFDK 4OH8B 3V4QA 1SFCC 4I1LA 4H13D 1NTKK 2JDIH 1N7LA 3H6PA 1PGPA 3CCRP 2WSCJ 2CK3H 1VQLP 1SQXK 4CPGA 4I7ZC 2OYIC 2ZYGA 1S9KE 4DZOA 1GU4A 4HB1A 2I8DA 3PP5A 5AVUB 2P2UA 1SQBD 1RF0C 1XTCC 2FYUK 5M1BA 3KQGA 1VQNP 2NPSD 2LXBA 4IFMA 5AW2B 1X0TA 4HYTB 3B5ND 2Q3IA 1GW3A 3H1KE 1ZRTE 1S9KD 1RF1C 4HJGH 5KLVD 1IC2A 1LTSC 1HH0A 5AVSB 2YKPA 1VF5C 2YKOA 5AVYB 4OVNF 1IO4A 3IF4A 1VQ9P 2PFXA 3MGNA 1U7JA 1N2DC 3CWBD 3B71A 2R5DA 2YNYA 3D6YA 1Y9BA 5APWA 3H1KD 1QL1A 5CCHA 1N7SA 3CLQA 2Q9IA 4EI2A 1ZR2A 3NTNA 2FXOA 1LWUC 1NTZD 1L4AB 3RBZA 3G9RA 4PV1B 3O6QB 1IK9A 1YQ3C 5L8RJ 3A0HE 5KAFH 1KYOE 2C0XA 2AXTE 4K3AA 4WVZA 2PAJA 1RH5B 1SS1A 3LIEA 2JWDA 2Z5IA 2NPSC 2E5YA 2KNCA 1LT9A 2BCCJ 1PP9J 4L75A 3KZIE 3B5NC 1BCCJ 1Q82Q 2E76D 1NAFA 3PJSK 5GTIE 2VRSA 2KS1B 2QM7A 2V7QJ 2FXMA 4YTPC 1Y47A 1KYOD 3C9IA 1ZW0A 3VN0A 1J1DC 1MV8A 3HE5B 1VPCA 3TGUE 3V2PA 3V2QA 1KB9H 2O1KA 4UB8H 5AW8B 1PGQA 5KLIC 1EZVE 3M91A 1SQXD 1BE3J 3ITKA 2FFDC 2HODA 1YIJP 1JM0A 3CI9A 2IBZG 3TSIA 1LTIC 4K35A 1OVUA 2M5AA 1YBKA 1L0NE 1L0LD 3TGUD 3KXDA 1CI6B 4Y99B 4ZKPA 1ZXGA 2JWAA 3A7OA 3H1JJ 2WWWA 3V6IA 2KSEA 1JMBA 1SQPE 1HJ0A 2IDBA 1YTZT 4H44B 4NPFX 1ZV8A 1HF9A 1S4XA 4XE5B 1A02J 1EZVD 2IBZI 1OIPA 1GU5A 3TNUA 3RGUA 4XFJA 2E76C 4PD4D 3TYYA 2QVAA 1DEEG 1S2EA 3I5CA 1GL2D 5CJ0A 2M0BA 2W6BA 1FDIA 1J2JB 1L0ND 1N73A 2JO1A 2IZ0A 3Q3DA 4C7NB 1ZN5A 3L75J 4BRYA 1M90Q 4PJ0E 2Q5UA 1SQPD 4PD4H 2WVRA 1X22A 3EFFK 1NTMJ 1ZP0C 4OWFA 1SFCB 3L71J 3KYQA 5CMZA 1FZFA 5B66H 4ZMDA 1URQD 2ZFCA 4N3YB 1R5SA 3G3ZA 2B87A 2FYZA 3T97A 3O8ZA 2WTYA 3H25A 2OYIB 1JOCA 1HGZA 4L73A 2JR8A 2RH0A 1E5WA 1LTJA 2HG5D 3H1ID 1T3JA 2Q1KA 1GDTA 4JPZB 1KILD 2E74B 3FXDA 3CWBG 1GK6A 2N1TD 3VMYA 3H1KG 2GUSA 1Q90D 1WT6A 3FXEA 4WY4A 1OX3A 1X79B 1FJKA 4TT3H 2FY8A 3GHGA 1OVRA 4U3FJ 1SQVJ 1SP4A 3BASA 1E79H 3L74J 1BGYE 2KZJA 2QIWA 3TDKA 1U7MA 3V2RA 2AXCA 1W2EA 3EQ2A 1ZLLA 3H1HD 3L70J 4WWIA 1N8RQ 3P8CD 1UIXA 1KFNA 2RN0A 1HVVA 3D70A 1URQC 2IPPA 3EFGA 5TJHA 3GMAA 1IFJA 3PTZA 4NPDA 1VDFA 2XU6A 3A0BE 3AEFC 3VMAA 4I2LC 2BASA 1AA0A 2YMYA 3G71P 3KHUA 1BGYD 3LW5H 1NTKJ 1H0TB 2WPRA 5KLVK 1KB9I 4GT1A 1NKZB 4B86A 1P84E 4D6TD 2XNDH 1S5LH 5KAIH 1KILC 5AVVB 3PLNA 2KLUA 1BDCA 2N1TC 3VOPA 2OYHC 1NU1D 1X8YA 3AECC 2IFMA 1QGKB 5BU5A 1SLQA 4TLFA 2BCCE 1PP9E 2FYUJ 2K9JB 1GMJA 5APSA 1L4AA 4IL6X 1LP1A 3O6QA 1ZOYC 1L0LG 3TGUG 2C9LY 1BSNA 1J1DB 1P84D 1N86A 1Q81Q 2D2CD 3CXHE 3A0BH 4IL6E 1G2CB 3L4FA 3RL0B 1YYCA 3QWOC 5AW0B 1EZVG 5KJ7A 5CCGA 4GDOA 1KC8Q 2ZAEB 5KLIB 3LIDA 2KYVA 5CCHD 1N7SD 1HTLC 1W5CE 3BCCJ 2FFDB 2O1JA 1R5LA 2KS1A 2Z4EA 2WSFJ 2ITAA 1L0NG 4N78E 2PRRA 3NMDA 2HPCB 1PPJE 1KFMA 1EZVI 1T8ZA 1JY3P 1QLED 3HE5A 2QJKC 2R44A 1GZLA 1CW5A 1SQPG 4PD4I 1AV1A 1FU1A 3L72E 1SQQE 3H1JE 5AVXB 1BSHA 3PHLA 4C46A 3M0AA 1HGVA 2ZT9C 3N4XA 1WMKA 2M3BA 1R8EA 2ZYAA 3OJAB 2FBWC 3G6EP 2N9BA 1PPJD 3RK2D 5E79H 1CI6A 1ZR4A 3H1IG 3I56P 3UIAA 2P67A 1NAYA 3HD7B 4GOEA 3V2NA 3L72D 1SQQD 4H0LC 2O3JA 3L75E 5KKZB 1L0LK 2QJPC 3CC4P 2CPBA 1JO5A 1M56D 1KN7A 1N7SC 1KQFB 2RKLA 3CD6P 1MZ9A 1U57A 1KQSO 1M8OB 1DD4A 5DJUB 2H89C 2PP6A 3LW5J 2WZ7A 4C7NA 2R3SA 2YXRB 1NHLA 1OW8A 3N7NA 4OGQD 1K73Q 2DW3A 2Y9YA 2B89A 2ZYDA 2WSSH
chains in the Genus database with same CATH topology
1AVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AVO A; 
#chains in the Genus database with same CATH topology
 1L0N K;  1HUC A;  3H1H G;  1CSB A;  1IK7 A;  4WB4 A;  1VQ5 P;  1SQP K;  2MJZ A;  1SFC A;  3II6 A;  5APY A;  2FKW B;  3BRV B;  3JSV C;  3VTP C;  4DT0 A;  3USS A;  5TIS E;  3WU2 E;  2K9Y A;  4H13 C;  2KLV A;  3WUT A;  2BEZ F;  3RK2 C;  1ZRT D;  3HE4 B;  1BGY G;  2IZ1 A;  1IFN A;  1FDO A;  3RL0 g;  4U3F E;  3CX5 E;  1XTG B;  1M7L A;  3L74 E;  4D6T G;  2A06 E;  2K88 A;  2OGU A;  3L73 E;  2OTL P;  2O01 J;  3CC2 P;  2WMM A;  2HLO A;  3U1C A;  1EDI A;  3L70 E;  1NU1 G;  1JUN A;  2PGD A;  4JF7 A;  3CME P;  3E1R A;  1HWT C;  1JTH B;  3MHV A;  3Q5P A;  1YTZ I;  4JYC A;  2B9B A;  4GKG A;  1FS0 E;  2IYO A;  3AE4 C;  3A2A A;  4OGQ C;  2WSE H;  1PV3 A;  2A06 D;  1H89 A;  3NXS A;  3GF3 A;  3L73 D;  5TIS H;  1FOS F;  3MUD A;  5C39 A;  1NTK E;  2K37 A;  4LLH A;  2GM4 A;  1AJY A;  2OYH B;  4KHX A;  3Q5S A;  2BCC G;  3W67 A;  2Q6Q A;  4WY4 D;  5AVT B;  5AW9 B;  3A0H H;  3CCL P;  1DEB A;  2W90 A;  1KYO H;  2AXT H;  5AW6 B;  1N73 C;  1LT1 A;  1FE6 A;  3EWK A;  4JQ0 D;  2L91 A;  5AVR B;  1L2P A;  3HUS A;  3H1L J;  1JY3 O;  3V5B A;  1H0T A;  1J1E C;  3VMZ A;  2E75 B;  2B88 A;  1YHQ P;  1LTB C;  3KZI H;  3AE2 C;  1PFI A;  3C8V A;  3L35 A;  2YO3 A;  5GTI H;  3WMM 0;  3CCJ P;  2YIU C;  2P58 A;  4RO0 A;  3Q5R A;  2J5U A;  3VP9 A;  3SWK A;  1PZQ A;  2K9J A;  2GA1 A;  1PPJ G;  4AYC A;  3SFD C;  1NU1 K;  3RK3 B;  1LTJ C;  1SQB J;  1LTT C;  1M57 D;  2QJK B;  3C1L A;  1T6A A;  3L72 G;  1EDJ A;  1SQQ G;  3H1J G;  3AEB C;  2WPQ A;  1G2C A;  3M06 A;  2M3E A;  1JCC A;  1FC2 C;  4RJT A;  1DIP A;  1M1J B;  3ABV C;  3VYI A;  2ZT9 B;  5KLV J;  2JEE A;  2XDJ A;  4WY4 C;  2HR3 A;  2XKM A;  5AVZ B;  3V4W A;  2FFD A;  2AEM A;  3GHG C;  1K04 A;  3CMA P;  1L4A D;  2YMK A;  1RE3 A;  4PV1 D;  2HPC A;  3MP7 B;  2K3R A;  2E42 A;  2QE7 H;  4I7Z B;  2CPS A;  2W27 A;  3I55 P;  1CZQ A;  1T3U A;  1WRG A;  3CL3 D;  2OYO A;  3GW6 A;  3L75 G;  3S9O A;  2WPS A;  4H0L B;  3CWB J;  4EIJ A;  2KOG A;  3R4Y A;  1RY3 A;  1MUU A;  4WBA A;  3H1K J;  3H32 A;  5KJ7 D;  5CCG D;  1VQ6 P;  2QJP B;  1S72 P;  5CJ4 A;  1G1J A;  1H8A A;  1JY3 N;  1NTZ J;  2KB7 P;  1KQL A;  4DOJ A;  2XZR A;  4PJ0 H;  1PGJ A;  1GL2 C;  5H2F E;  4XA4 A;  1RF1 B;  4N6J A;  1QX8 A;  2WIT A;  3HD7 A;  3JCU E;  3KDP B;  1VF5 B;  3M9H A;  2H7H A;  2Q7C A;  3M0D A;  4YPC A;  4YXW H;  2M8R A;  1SQQ K;  2WSC H;  4HH2 A;  4MN4 C;  1FZC C;  2YXQ B;  3RK3 E;  4H13 B;  3E1I A;  3L37 A;  3IN6 A;  1L4A C;  2H43 A;  2IYP A;  2J59 M;  1DX7 A;  4PV1 C;  2ZXX A;  1AVY A;  1IFI A;  5B5E E;  2OTJ P;  4U3F G;  5KTB A;  1LWU B;  1EC5 A;  3L74 G;  1RHZ B;  2A06 G;  1Y8A A;  3HTK B;  3AE3 C;  4M3L A;  3L73 G;  4C7R A;  3SFE C;  2ZVO B;  1T2K D;  2LXC B;  3TK1 A;  4H44 D;  5KJ7 C;  5CCG C;  3P8M C;  4JBZ A;  1SQX J;  2C0W A;  4AQR D;  1NOH A;  1RE4 A;  2NPS B;  5AW5 B;  3S4R A;  1GK4 A;  3FGA D;  1KYO I;  4UB6 E;  3B5N B;  3U59 A;  1L0L J;  3TGU J;  2LR2 A;  3HE4 A;  1IFM A;  4JYB A;  1BCC E;  4OGQ B;  4IFF A;  2MKV A;  3CCM P;  3GG2 A;  2AEJ A;  1AQ5 A;  4IOI H;  2W6J H;  1NH4 A;  1NO4 A;  5APU A;  2P10 A;  1SFC D;  3B4S A;  1OWA A;  2AEF A;  1L0N J;  2WT7 B;  2IFN A;  1N73 B;  2BCC D;  1PP9 D;  1BCC D;  4Y99 C;  1SQP J;  2GUV A;  3OW2 O;  1P84 H;  1NJI Q;  1BE3 E;  2OTK E;  1J1E B;  1T2K C;  1FDM A;  1OVV A;  3H1L E;  2E74 D;  3CXH D;  3CCU P;  3M9Q A;  2K1A A;  2OYH A;  1S1C X;  1GD2 E;  2YIU B;  1YJ9 P;  1M1K Q;  3W68 A;  5GTH E;  4KT0 J;  2WPV B;  2E76 B;  3MTU E;  3H1I J;  2V7Q H;  1KD1 Q;  1BE3 D;  3CXH H;  5APX A;  2WQY C;  4IL6 H;  4N78 D;  2Z5H A;  3L36 A;  3CCS P;  2KI7 B;  3AE6 C;  1VQM P;  4LGD E;  1SQB E;  1VQ4 P;  3OAK A;  4GOF A;  3K5B A;  4GOD A;  2D2C C;  3H1J D;  2FYN C;  1OW7 A;  4ASW A;  3NFQ A;  2POH A;  2KP8 A;  1JNM A;  4WY4 B;  2G3A A;  2LKM A;  3GHG B;  5CCH C;  1NTM E;  5KLV E;  1S3J A;  2QJY C;  3L71 E;  1VL2 A;  3F5H A;  3AED C;  2ZVN B;  4BXL A;  3H1H J;  2W6A A;  3MD0 A;  5CBO A;  5GTH H;  1VQ8 P;  2KUB A;  2ZJS E;  2BEQ D;  2E74 C;  3BVH A;  2C9N Y;  3L75 D;  3VMX A;  4EDF A;  1EQ7 A;  3CWB E;  5BVZ A;  5KAF E;  2I1K A;  1M1J A;  1QEX A;  1OZH A;  1JY2 P;  1Q7Y Q;  1IZN B;  2NZ2 A;  2R5B A;  1LT9 C;  1FAV A;  3ZDM A;  1NTM D;  4DJG A;  1BGY J;  3L71 D;  2Y0E A;  1GL2 B;  1NTZ E;  3SWY A;  3F89 A;  1PIX A;  4NPE A;  2OYI A;  4D6T J;  3A5T A;  3U1A A;  3FWN A;  2KSJ A;  1NWQ A;  2L5G B;  3MUD C;  1KMI Z;  4ZKU A;  3RL0 D;  1NU1 J;  1RF0 A;  1SQV E;  3G4S P;  2QM8 A;  5AVQ B;  2ZXE B;  2NRG A;  3PRJ A;  1Z56 A;  3AEA C;  1KB9 E;  1FZC B;  1YIT P;  4UB8 E;  1LJ2 A;  1LP1 B;  1URQ B;  4RES B;  2H8P D;  3SWF A;  1RF1 A;  4W7Y A;  1GW4 A;  3HUS C;  1OMI A;  3BAT A;  1VQP P;  4U3F D;  2Y0D A;  3CX5 D;  1SQV D;  3R2P A;  1QVG O;  3L74 D;  4Y28 J;  3BRT B;  3WU2 H;  2I1J A;  3E7K A;  1DH3 A;  3S1K A;  1KB9 D;  1KIL B;  1AQT A;  2W83 C;  1LGH B;  3IFM A;  1H88 A;  3L70 D;  1K8A Q;  2KZI A;  2N1T B;  1SQX E;  1W2B O;  2R3C A;  4U7J A;  1PP9 G;  1KQG B;  3HRN A;  1BCC G;  3CX5 H;  1P84 I;  4ASV A;  3FX0 A;  1L0L E;  1VQO P;  2Y0C A;  1LWU A;  5APV A;  3HTK A;  3HD7 D;  1NGM B;  3FWL A;  2FYU E;  3Q2Y A;  5AW4 B;  3RL0 C;  1NKN A;  2IX7 C;  4Z1M H;  2Q3E A;  4L76 A;  3KPE A;  1NTK D;  3PH0 A;  3MIW A;  2YO2 A;  2OAR A;  2NPS A;  4PD4 E;  1FOS E;  2RMZ A;  2QG4 A;  3B5N A;  2KXP B;  1NYH A;  1RE3 C;  2H88 C;  1OW6 A;  3VP8 A;  3CXH I;  1BE3 G;  3CCQ P;  2QSI A;  5K5G B;  4R4M A;  5B66 E;  2XNX A;  3L72 J;  1VQK P;  1SQQ J;  5AW1 B;  1VQ7 P;  1AVO A;  2FYU D;  3AE8 C;  2YKQ A;  3BCC E;  3H1L G;  1JEK A;  5BU8 B;  1MKM A;  1DD3 A;  2XV5 A;  1LNQ A;  2V4H A;  2JJL A;  4LC1 A;  1D7M A;  2P7J A;  3B8E B;  1K05 A;  3CCV P;  1RQU A;  2Y9Z A;  3RBX A;  2WT7 A;  1PL5 A;  1JMM A;  1Q2N A;  3BCC D;  3H1I E;  3HD7 C;  3CC7 P;  4ZNC A;  1SQB G;  5AW3 B;  1BDD A;  5KKZ C;  3GLM A;  3JC2 2;  4GIF A;  1KIL E;  3M0D C;  2D2C B;  2G8Y A;  2FYN B;  3P7K A;  1LTA C;  2A45 H;  5APT A;  2QA4 P;  2HFE D;  1JY2 O;  2OQQ A;  3AE7 C;  1QVF O;  1JB0 J;  3P32 A;  1YJW P;  1NTM G;  1KTM A;  5KLV G;  3TF5 A;  1FJP A;  2WSF H;  1IFD A;  1N7S B;  2R32 A;  3L71 G;  2QRX A;  1KOR A;  2QJY B;  1X9V A;  4A7P A;  1YJN P;  2SPZ A;  3WUU A;  1MFZ A;  1FZB A;  2HYN A;  1EDK A;  2WSE J;  3H1H E;  3A3Y B;  1S5L X;  3P8C E;  4EOT A;  3D71 A;  1RE4 C;  4W80 A;  2KNC B;  1FBM A;  1K9M Q;  1LT9 B;  1S5L E;  5KAI E;  1PGO A;  2P1J A;  1NTZ G;  3MZW B;  4QMA A;  1EXJ A;  3IAO A;  3L73 J;  4RKU J;  1EDL A;  3RK2 B;  2E75 D;  1TU3 F;  3Q1M A;  4R4L A;  1YI2 P;  1KV4 A;  2J58 A;  1EXI A;  1SQV G;  4D6T E;  3CPW O;  3IR9 A;  3SSU A;  2E5T A;  1SQB K;  5APQ A;  1NU1 E;  2KIK A;  1IJD B;  3L70 G;  1HJB A;  4DCK A;  5H2F H;  1FZG A;  1AFO A;  1OXZ A;  3RK3 D;  4KJM A;  2W8Z A;  3CX5 I;  1FZA A;  1GL2 A;  2HOD B;  2N9Y B;  3AE9 C;  3JCU H;  3D6Z A;  3HUS B;  4I6M C;  1NTM K;  2FXP A;  2M5A B;  1HBW A;  1QL2 A;  1JY2 N;  1KZU B;  4L74 A;  1ZME C;  1NTK G;  3AEG C;  3AEE C;  1NVO A;  1SVF A;  1SQX G;  4O9B A;  1USE A;  2ZT9 D;  3QH9 A;  1FZC A;  3TNU B;  2QEX P;  1UII A;  2E43 A;  3GF7 A;  5B5E H;  1G1I A;  5AW7 B;  1URQ A;  5DJT B;  1MFT A;  4W7Z A;  1JTH A;  1OFC X;  1LTG C;  2JKV A;  4AUW A;  1USD A;  1YQ4 C;  2FYU G;  1Q86 Q;  2E75 C;  1NTZ K;  1IFP A;  2IBZ E;  4H0L D;  1FZE A;  3CCE P;  4BRY B;  3OA7 A;  5E79 E;  2O01 N;  2O01 H;  1A02 F;  2KK7 A;  3WUV A;  1KIL A;  4H44 C;  2JP3 A;  4UB6 H;  2N1T A;  1SQV K;  4YXD C;  3M9B A;  4BWN A;  3RK3 C;  1JCD A;  4EYY Q;  4HKZ H;  1GTW A;  2A45 G;  2B87 B;  3T97 B;  5AVW B;  1RQV A;  3BCC G;  2IBZ D;  1LTJ B;  5CBN A;  5EFW B;  1VF5 D;  5CHX A;  3H32 B;  3AE5 C;  3H1L D;  2UWJ E;  3AE1 C;  1M1J C;  2A45 I;  4IFD K;  4OH8 B;  3V4Q A;  1SFC C;  4I1L A;  4H13 D;  1NTK K;  2JDI H;  1N7L A;  3H6P A;  1PGP A;  3CCR P;  2WSC J;  2CK3 H;  1VQL P;  1SQX K;  4CPG A;  4I7Z C;  2OYI C;  2ZYG A;  1S9K E;  4DZO A;  1GU4 A;  4HB1 A;  2I8D A;  3PP5 A;  5AVU B;  2P2U A;  1SQB D;  1RF0 C;  1XTC C;  2FYU K;  5M1B A;  3KQG A;  1VQN P;  2NPS D;  2LXB A;  4IFM A;  5AW2 B;  1X0T A;  4HYT B;  3B5N D;  2Q3I A;  1GW3 A;  3H1K E;  1ZRT E;  1S9K D;  1RF1 C;  4HJG H;  5KLV D;  1IC2 A;  1LTS C;  1HH0 A;  5AVS B;  2YKP A;  1VF5 C;  2YKO A;  5AVY B;  4OVN F;  1IO4 A;  3IF4 A;  1VQ9 P;  2PFX A;  3MGN A;  1U7J A;  1N2D C;  3CWB D;  3B71 A;  2R5D A;  2YNY A;  3D6Y A;  1Y9B A;  5APW A;  3H1K D;  1QL1 A;  5CCH A;  1N7S A;  3CLQ A;  2Q9I A;  4EI2 A;  1ZR2 A;  3NTN A;  2FXO A;  1LWU C;  1NTZ D;  1L4A B;  3RBZ A;  3G9R A;  4PV1 B;  3O6Q B;  1IK9 A;  1YQ3 C;  5L8R J;  3A0H E;  5KAF H;  1KYO E;  2C0X A;  2AXT E;  4K3A A;  4WVZ A;  2PAJ A;  1RH5 B;  1SS1 A;  3LIE A;  2JWD A;  2Z5I A;  2NPS C;  2E5Y A;  2KNC A;  1LT9 A;  2BCC J;  1PP9 J;  4L75 A;  3KZI E;  3B5N C;  1BCC J;  1Q82 Q;  2E76 D;  1NAF A;  3PJS K;  5GTI E;  2VRS A;  2KS1 B;  2QM7 A;  2V7Q J;  2FXM A;  4YTP C;  1Y47 A;  1KYO D;  3C9I A;  1ZW0 A;  3VN0 A;  1J1D C;  1MV8 A;  3HE5 B;  1VPC A;  3TGU E;  3V2P A;  3V2Q A;  1KB9 H;  2O1K A;  4UB8 H;  5AW8 B;  1PGQ A;  5KLI C;  1EZV E;  3M91 A;  1SQX D;  1BE3 J;  3ITK A;  2FFD C;  2HOD A;  1YIJ P;  1JM0 A;  3CI9 A;  2IBZ G;  3TSI A;  1LTI C;  4K35 A;  1OVU A;  2M5A A;  1YBK A;  1L0N E;  1L0L D;  3TGU D;  3KXD A;  1CI6 B;  4Y99 B;  4ZKP A;  1ZXG A;  2JWA A;  3A7O A;  3H1J J;  2WWW A;  3V6I A;  2KSE A;  1JMB A;  1SQP E;  1HJ0 A;  2IDB A;  1YTZ T;  4H44 B;  4NPF X;  1ZV8 A;  1HF9 A;  1S4X A;  4XE5 B;  1A02 J;  1EZV D;  2IBZ I;  1OIP A;  1GU5 A;  3TNU A;  3RGU A;  4XFJ A;  2E76 C;  4PD4 D;  3TYY A;  2QVA A;  1DEE G;  1S2E A;  3I5C A;  1GL2 D;  5CJ0 A;  2M0B A;  2W6B A;  1FDI A;  1J2J B;  1L0N D;  1N73 A;  2JO1 A;  2IZ0 A;  3Q3D A;  4C7N B;  1ZN5 A;  3L75 J;  4BRY A;  1M90 Q;  4PJ0 E;  2Q5U A;  1SQP D;  4PD4 H;  2WVR A;  1X22 A;  3EFF K;  1NTM J;  1ZP0 C;  4OWF A;  1SFC B;  3L71 J;  3KYQ A;  5CMZ A;  1FZF A;  5B66 H;  4ZMD A;  1URQ D;  2ZFC A;  4N3Y B;  1R5S A;  3G3Z A;  2B87 A;  2FYZ A;  3T97 A;  3O8Z A;  2WTY A;  3H25 A;  2OYI B;  1JOC A;  1HGZ A;  4L73 A;  2JR8 A;  2RH0 A;  1E5W A;  1LTJ A;  2HG5 D;  3H1I D;  1T3J A;  2Q1K A;  1GDT A;  4JPZ B;  1KIL D;  2E74 B;  3FXD A;  3CWB G;  1GK6 A;  2N1T D;  3VMY A;  3H1K G;  2GUS A;  1Q90 D;  1WT6 A;  3FXE A;  4WY4 A;  1OX3 A;  1X79 B;  1FJK A;  4TT3 H;  2FY8 A;  3GHG A;  1OVR A;  4U3F J;  1SQV J;  1SP4 A;  3BAS A;  1E79 H;  3L74 J;  1BGY E;  2KZJ A;  2QIW A;  3TDK A;  1U7M A;  3V2R A;  2AXC A;  1W2E A;  3EQ2 A;  1ZLL A;  3H1H D;  3L70 J;  4WWI A;  1N8R Q;  3P8C D;  1UIX A;  1KFN A;  2RN0 A;  1HVV A;  3D70 A;  1URQ C;  2IPP A;  3EFG A;  5TJH A;  3GMA A;  1IFJ A;  3PTZ A;  4NPD A;  1VDF A;  2XU6 A;  3A0B E;  3AEF C;  3VMA A;  4I2L C;  2BAS A;  1AA0 A;  2YMY A;  3G71 P;  3KHU A;  1BGY D;  3LW5 H;  1NTK J;  1H0T B;  2WPR A;  5KLV K;  1KB9 I;  4GT1 A;  1NKZ B;  4B86 A;  1P84 E;  4D6T D;  2XND H;  1S5L H;  5KAI H;  1KIL C;  5AVV B;  3PLN A;  2KLU A;  1BDC A;  2N1T C;  3VOP A;  2OYH C;  1NU1 D;  1X8Y A;  3AEC C;  2IFM A;  1QGK B;  5BU5 A;  1SLQ A;  4TLF A;  2BCC E;  1PP9 E;  2FYU J;  2K9J B;  1GMJ A;  5APS A;  1L4A A;  4IL6 X;  1LP1 A;  3O6Q A;  1ZOY C;  1L0L G;  3TGU G;  2C9L Y;  1BSN A;  1J1D B;  1P84 D;  1N86 A;  1Q81 Q;  2D2C D;  3CXH E;  3A0B H;  4IL6 E;  1G2C B;  3L4F A;  3RL0 B;  1YYC A;  3QWO C;  5AW0 B;  1EZV G;  5KJ7 A;  5CCG A;  4GDO A;  1KC8 Q;  2ZAE B;  5KLI B;  3LID A;  2KYV A;  5CCH D;  1N7S D;  1HTL C;  1W5C E;  3BCC J;  2FFD B;  2O1J A;  1R5L A;  2KS1 A;  2Z4E A;  2WSF J;  2ITA A;  1L0N G;  4N78 E;  2PRR A;  3NMD A;  2HPC B;  1PPJ E;  1KFM A;  1EZV I;  1T8Z A;  1JY3 P;  1QLE D;  3HE5 A;  2QJK C;  2R44 A;  1GZL A;  1CW5 A;  1SQP G;  4PD4 I;  1AV1 A;  1FU1 A;  3L72 E;  1SQQ E;  3H1J E;  5AVX B;  1BSH A;  3PHL A;  4C46 A;  3M0A A;  1HGV A;  2ZT9 C;  3N4X A;  1WMK A;  2M3B A;  1R8E A;  2ZYA A;  3OJA B;  2FBW C;  3G6E P;  2N9B A;  1PPJ D;  3RK2 D;  5E79 H;  1CI6 A;  1ZR4 A;  3H1I G;  3I56 P;  3UIA A;  2P67 A;  1NAY A;  3HD7 B;  4GOE A;  3V2N A;  3L72 D;  1SQQ D;  4H0L C;  2O3J A;  3L75 E;  5KKZ B;  1L0L K;  2QJP C;  3CC4 P;  2CPB A;  1JO5 A;  1M56 D;  1KN7 A;  1N7S C;  1KQF B;  2RKL A;  3CD6 P;  1MZ9 A;  1U57 A;  1KQS O;  1M8O B;  1DD4 A;  5DJU B;  2H89 C;  2PP6 A;  3LW5 J;  2WZ7 A;  4C7N A;  2R3S A;  2YXR B;  1NHL A;  1OW8 A;  3N7N A;  4OGQ D;  1K73 Q;  2DW3 A;  2Y9Y A;  2B89 A;  2ZYD A;  2WSS H; 
#chains in the Genus database with same CATH homology
 1AVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...