1AVOA

Proteasome activator reg(alpha)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
60
structure length
60
Chain Sequence
LRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 11S REGULATOR
publication title Structure of the proteasome activator REGalpha (PA28alpha).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Proteasome activator
total genus 18
structure length 60
sequence length 60
chains with identical sequence C, E, G, I, K, M
ec nomenclature
pdb deposition date 1997-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.120 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Proteasome activator pa28, N-terminal domain 1avoA00
1AVOA
chains in the Genus database with same CATH superfamily
3KXDA 1FDMA 1BCCE 2HR3A 4IL6E 2O01N 3CWBE 4NPDA 3RL0C 3P8CE 1RE3C 3QH9A 1S5LH 2E43A 1BCCG 1OVUA 2WTYA 4I7ZC 2IDBA 1JTHA 1ZV8A 4DT0A 1IFPA 4IL6H 2N9BA 4D6TE 1WRGA 5M1BA 5CHXA 1IFJA 2QSIA 3M9BA 1M1JB 2YMYA 3TK1A 4L76A 3AE4C 1KB9H 3LIDA 3H32B 1EZVI 4RKUJ 2OYHC 4H0LD 2ZAEB 1ZXGA 2AXTH 3N7NA 1AVYA 1KORA 3GG2A 3L36A 4R4MA 2M5AA 3CX5I 2ZT9D 5KJ7C 1J1DC 5APVA 3SFDC 3KZIE 1DX7A 1VQ7P 3GHGA 2O01J 3S1KA 3IAOA 1LTJA 3G9RA 1NU1K 1LT9B 1GL2D 1S3JA 3H1KJ 1Y8AA 2N1TD 1YJ9P 5CCGC 1S9KD 4YXWH 2BCCE 2Q7CA 1KFNA 1H89A 2KK7A 1YIJP 1JY2O 2JP3A 1VQOP 3GF3A 3S4RA 1M7LA 3H1KD 3U59A 2W90A 3TF5A 1AQ5A 2BCCG 3KDPB 5APSA 3CCEP 1G2CB 4QMAA 2ZT9B 4GOEA 1M1JC 1CW5A 3PTZA 4H13D 1T2KD 1N7SA 1DD4A 4BXLA 2FYUJ 3JSVC 5BU5A 1RF0A 2V4HA 2PP6A 3I5CA 1SQQJ 1G1IA 2KOGA 4W7YA 5AW3B 3AE6C 3V2PA 4PD4I 1GL2B 2ZYAA 3FGAD 1GMJA 2FYUD 3BCCE 2KUBA 2WWWA 2N1TB 2HFED 1SQQD 2P2UA 2LR2A 1KN7A 1KQGB 3R4YA 2Y9YA 2Q6QA 1A02F 1VF5B 2Y9ZA 2C0WA 1URQD 1S4XA 5APYA 2PAJA 3L74E 1LT9C 5KLVE 1X8YA 1X22A 5APTA 4BRYB 3VP9A 1MUUA 4H13B 2FXOA 1X0TA 1VQ8P 1BSNA 1SQXE 3L74G 4JYBA 2W83C 5KLVG 1FZAA 1K9MQ 4GDOA 2OTLP 1HJBA 1BE3J 4UB8H 2QA4P 3OA7A 3L75J 1JMMA 1JMBA 1L0NJ 2K9YA 2K37A 1JCCA 1SQXG 1QEXA 3OJAB 2V7QJ 2ZT9C 3M91A 2A45I 1BE3D 2YIUB 3L75D 2QRXA 5H2FE 1L4AA 1SP4A 1K04A 3K5BA 4M3LA 1T6AA 1FDOA 1SQBJ 2M3BA 4LC1A 4ZMDA 3NTNA 1ZP0C 1GL2C 3AE9C 1BGYJ 3TGUE 2KYVA 5H2FH 2KSEA 2R32A 3PP5A 3G6EP 1L2PA 2N1TC 1EZVD 4WY4A 4RO0A 1SQPJ 2LXCB 1SQBD 1KYOI 2E76D 1BGYD 1VF5C 2ZXXA 1GW4A 1YQ3C 1Q81Q 2HG5D 1LT1A 4DOJA 5AVQB 1SQPD 1NTMJ 1FBMA 3R2PA 1R5LA 1ZW0A 3JCUE 4H13C 3EQ2A 4GOFA 3AE1C 2IBZD 1OFCX 4HB1A 3U1CA 5AVXB 1KTMA 5AW6B 1NOHA 1SQVJ 1NTMD 2HYNA 1LTBC 3JCUH 4KT0J 2JDIH 3KHUA 3M9QA 3ITKA 1L0LJ 3Q5PA 1EDLA 3GF7A 2OTJP 2ZXEB 1SQVD 2YIUC 1EXJA 5CBNA 3CCMP 3CCSP 2KSJA 5AW7B 1GU4A 3CCJP 3L73G 1L0LD 3AE8C 2B87A 1EDIA 4Y28J 1IC2A 4EIJA 2IZ0A 2H8PD 2YO3A 2OYHA 3TDKA 3VN0A 3CL3D 3LW5H 1CI6B 1LTTC 3D6YA 1JY2P 2P58A 2HPCA 1VQKP 1MKMA 5C39A 3SWFA 1KMIZ 1OX3A 5KJ7A 2FFDB 1AV1A 3CD6P 2Q1KA 1MZ9A 1PV3A 5AVTB 1EXIA 3G71P 1HUCA 5KLVK 5CJ4A 4Y99B 3CX5E 1M56D 2Q5UA 1LTIC 2GA1A 1OWAA 3HE5A 3USSA 3AE7C 3M9HA 3PRJA 3FX0A 2OYOA 1IFNA 2CPBA 1SQXK 1Q82Q 1HBWA 3CX5H 3P32A 2ZFCA 5E79E 2QM8A 5CCGA 3AEFC 1IFDA 5AW5B 1LWUB 1AFOA 1QGKB 1HH0A 1AJYA 5E79H 3EFFK 1SQVE 2WZ7A 3Q3DA 3H1IE 1M1JA 1GZLA 2PRRA 2XV5A 4ASVA 4HH2A 2M3EA 2HODB 3H32A 3H1HD 4O9BA 2UWJE 2ZVOB 1NAYA 3H1IG 3MGNA 2WT7B 2FYUK 1PP9E 1S5LX 2E74D 2E75B 1JY3P 1JY3N 4WBAA 5KAFH 2Z5IA 4JF7A 2P7JA 5AVUB 5AVWB 2FFDC 4PD4E 1U57A 2PFXA 1PP9G 5CJ0A 4C46A 4U3FE 4Y99C 1BDDA 1EDKA 3WUUA 1OIPA 1ZRTD 2CPSA 4PD4H 1KYOD 1LT9A 3L72G 1AVOA 5CCHD 3PH0A 5DJTB 1LTAC 1CSBA 3FXDA 2YO2A 1YITP 3AEAC 3IR9A 2NPSA 1LWUC 4ZKPA 3CWBG 1N73B 2JR8A 1FU1A 1P84E 4AUWA 3SSUA 2QG4A 2Q3IA 1GU5A 1NTZJ 3HUSA 1NKZB 4Z1MH 4WB4A 1FZBA 1G2CA 4D6TG 4KHXA 2K9JB 2KS1A 3VTPC 1P84H 4N6JA 1USEA 5APQA 3H1HE 1FAVA 4EDFA 1NTZD 2OARA 1VQ9P 2C0XA 2LXBA 1GL2A 1PGOA 3II6A 2E75C 3VMZA 1ZLLA 3FXEA 3QWOC 2N1TA 2IBZI 2A45H 2WPVB 2YNYA 3L71E 3KQGA 3WUTA 3KYQA 1SQPK 1JM0A 1IZNB 3KZIH 1VPCA 1USDA 1ZRTE 1IK7A 2ITAA 3S9OA 4OH8B 3HTKB 4CPGA 3L71G 2H43A 2CK3H 4AYCA 4BRYA 2FYNB 1KILD 3H1JJ 2BEZF 1RQUA 3RGUA 4H0LB 1FZCB 1NTMK 2QM7A 3L37A 2B88A 3I55P 2XZRA 1N73C 1LTGC 4HJGH 2QEXP 1GW3A 1NTKJ 4WVZA 2WSFH 3H1JD 1IO4A 4ZNCA 2GM4A 1PPJD 1SQVK 2BEQD 4C7RA 4N78D 3B71A 1KZUB 4KJMA 1NTKD 1HWTC 4H44D 3RK2D 4K3AA 3A7OA 1NTZE 1H8AA 2IFNA 1ZMEC 3A0HE 2H88C 2R3SA 1J1EB 4JPZB 1QL1A 4PJ0E 2WSEJ 2JEEA 3T97B 1OVRA 1HGVA 2ZYGA 1HVVA 2G3AA 2QIWA 4IFFA 5CCHC 1JNMA 1KILB 1AQTA 1TU3F 4DZOA 1U7JA 3TSIA 3MP7B 2XU6A 3A0HH 4I1LA 1JOCA 3BCCG 3B8EB 3A5TA 1N7SD 1GDTA 3G3ZA 2KLVA 2I1KA 2H7HA 1G1JA 1VQPP 3HE4B 1RE4C 4L73A 2FYNC 2WSCJ 3V6IA 5B66E 3E7KA 3MTUE 2A06D 2DW3A 2IFMA 1S9KE 4H0LC 1FZCC 5AW9B 1U7MA 4RESB 3L70J 1KB9I 1MFTA 4H44B 1NGMB 3RK3D 3H1KE 2O01H 3L73J 2WQYC 1YJWP 3NFQA 2MKVA 5AVRB 1KV4A 2P10A 3BRVB 1HF9A 1LP1B 3L70D 1HJ0A 4DCKA 3BVHA 1PPJE 3L35A 1SLQA 2AEJA 4N78E 3SWYA 3H1KG 1OXZA 1L0ND 2R3CA 2LKMA 3L73D 1NTKE 1T3JA 1URQB 2QJKB 1FJPA 4JBZA 2Q3EA 1Q86Q 3IN6A 5AVSB 4RJTA 1KQSO 1J1EC 5KLIB 3IFMA 2FYUE 3O6QB 3FWNA 3TNUB 3AE5C 3CCRP 2ZVNB 1KILC 4AQRD 1ZN5A 1FOSE 1SQQE 1CI6A 2W6AA 1FOSF 3M0AA 2JO1A 3V2NA 3CXHD 3TGUG 3VYIA 1KFMA 1YYCA 2FYUG 3RK3B 1NO4A 1NU1J 1VQ5P 1CZQA 2YXRB 3CLQA 2FFDA 1SQQG 1L4AD 1NWQA 1QVFO 2ZJSE 2YKPA 1T2KC 1T8ZA 3B5ND 1S1CX 2K88A 3D70A 2IPPA 1NU1D 3H1LJ 2K1AA 4A7PA 2A06E 3V2RA 3H6PA 4UB6E 3F89A 1RF1B 4H44C 4WY4D 1RE3A 2E5TA 3RK3E 3NMDA 1LJ2A 3H1LD 1Y47A 4UB6H 1N86A 1ZR2A 1LWUA 3MD0A 2Y0DA 1BE3E 2YXQB 1FS0E 3L75E 1Q2NA 2E76B 1L0NE 2GUVA 5APXA 1QX8A 2VRSA 1URQC 2QJKC 5DJUB 3H25A 1RF0C 2FBWC 1BE3G 4IFMA 1NTZK 3O8ZA 3L75G 3UIAA 5KLIC 3WUVA 2H89C 2HODA 3RL0D 3B5NB 3SFEC 2RH0A 1JY2N 1WT6A 3VP8A 2V7QH 1VQ6P 1EZVE 1Y9BA 2WT7A 3CCUP 5CMZA 2RMZA 1SQBE 5AW1B 3AE3C 1BGYE 3RK3C 3G4SP 1NKNA 5B5EE 1EZVG 3PLNA 2JWAA 1OMIA 1S2EA 1SQPE 1BCCJ 2JKVA 2Y0CA 3GW6A 1BGYG 3M0DC 5B5EH 2IBZE 3CCLP 1GK4A 2JJLA 3V4QA 3OW2O 1SQPG 3HD7D 3SWKA 2GUSA 1PZQA 1RF1C 1LNQA 1NTME 1BCCD 1K05A 3P8MC 3WU2E 1N7LA 2IBZG 1OW6A 2POHA 2M8RA 1FC2C 4PV1D 4C7NB 1N2DC 3BATA 2IZ1A 2XNDH 3ABVC 1N73A 1NTMG 5L8RJ 3U1AA 2AEFA 3C1LA 1KB9D 1FDIA 1IFMA 2E76C 1LGHB 1VQNP 1OZHA 3B4SA 1L0LE 5BU8B 1NTKK 3GLMA 2WVRA 1SQVG 1NVOA 4OWFA 5AW8B 3B5NC 1M90Q 2WPQA 1SFCD 1SQQK 2D2CD 3MUDC 1D7MA 3HD7B 3L4FA 1H0TB 4IL6X 5CCHA 3BASA 3RBZA 3EFGA 3A0BE 2G8YA 4W80A 4PV1B 1X79B 1VL2A 3AEGC 2BASA 2W6BA 2OGUA 4IFDK 3M06A 2WPRA 3A0BH 2W6JH 3D71A 1KQLA 4U3FG 4GIFA 2P1JA 2BCCJ 3HTKA 1RE4A 2FXMA 1YTZI 2B89A 1QVGO 1FZCA 5AW4B 4ASWA 2Z4EA 2BCCD 1JUNA 3C9IA 4B86A 2E74B 2O1JA 1SFCB 3C8VA 1DEBA 2D2CB 1KQFB 2J58A 2KNCB 3E1IA 1KB9E 1L0NK 3VMYA 2KB7P 3CXHI 2AXTE 1OW7A 1XTGB 3W68A 4U7JA 1RY3A 3BCCJ 1PL5A 1JEKA 1GK6A 2NPSD 1KC8Q 2KXPB 2OYIB 1HGZA 2WPSA 1UIIA 1NJIQ 3H1HG 3T97A 3HD7C 3Q2YA 1SQBK 1A02J 3AEEC 1JO5A 3WMM0 2A45G 5K5GB 1KILA 3E1RA 2I1JA 2I8DA 3BCCD 2FXPA 3L74J 2E5YA 5KLVJ 4PV1C 1EDJA 2RN0A 3CC2P 4GODA 2SPZA 2KLUA 1KYOE 1IJDB 4LGDE 1SQXJ 4JYCA 1ZOYC 2W27A 2J59M 3L74D 5KLVD 3HE4A 3GMAA 2KZJA 5AVZB 1XTCC 1M8OB 2C9LY 1KYOH 3VOPA 1SQXD 3BRTB 1NHLA 2NPSB 2E74C 1JTHB 1SFCC 3VMXA 3D6ZA 1R8EA 2D2CC 4XFJA 4W7ZA 1VF5D 2OTKE 2C9NY 1E5WA 4HKZH 1LP1A 4WWIA 3HUSB 2IYPA 1L0LK 3JC22 1DH3A 1DEEG 1J2JB 1SS1A 3TGUJ 2KS1B 5TISE 1N8RQ 1BDCA 2B9BA 1URQA 2R5DA 1K8AQ 1AA0A 2OYIC 3CPWO 2KIKA 4ZKUA 1NAFA 1VDFA 2M0BA 3O6QA 3TNUA 1NTZG 5TISH 1UIXA 1IK9A 3V4WA 3CI9A 1BSHA 2M5AB 3TGUD 1RHZB 4PJ0H 4YXDC 1FJKA 3I56P 3VMAA 2KP8A 3GHGB 3AEDC 1IFIA 5BVZA 1LTJB 4K35A 3CC7P 2FYZA 1KD1Q 1YJNP 3ZDMA 1KILE 1YQ4C 2RKLA 2XNXA 3M0DA 1VQ4P 4EOTA 1ZR4A 1DD3A 2J5UA 4UB8E 4XA4A 5TJHA 3RK2B 3LIEA 5APWA 4I6MC 1P84I 1K73Q 1QL2A 1RF1A 5B66H 1PGQA 1DIPA 2NPSC 3HRNA 2XDJA 3H1JE 4L74A 1JY3O 2QJPB 2IYOA 2N9YB 3LW5J 3P7KA 3HUSC 3AE2C 4OGQD 1N7SB 3H1JG 5GTHE 3V5BA 1PPJG 2Q9IA 2E42A 1PGJA 1W5CE 1PGPA 1NTKG 1FE6A 5GTIE 5EFWB 1YTZT 3MIWA 5GTHH 3Q5RA 1VQLP 3B5NA 4GKGA 2NRGA 3V2QA 3MUDA 1LTSC 5GTIH 1VQMP 3GHGC 1FZGA 4R4LA 2KZIA 3CMEP 1X9VA 2QE7H 1LTJC 4IOIH 2QVAA 2YKOA 4HYTB 2FKWB 2WSEH 2NZ2A 3N4XA 5APUA 2YKQA 1QLED 3MHVA 1Q7YQ 3CX5D 4OGQB 2JWDA 1YHQP 3RK2C 1RH5B 3Q5SA 3PJSK 2A06G 1S72P 1T3UA 4C7NA 3L70E 2QJPC 2FY8A 2WMMA 4YTPC 4MN4C 3H1IJ 2R44A 1YBKA 2WSCH 1GTWA 1N7SC 3L73E 4LLHA 1MV8A 5KKZB 3L70G 1L4AB 4I2LC 2W8ZA 4EI2A 2WSSH 1R5SA 5AVVB 1L0NG 1PP9J 3H1ID 1SVFA 3AEBC 1EQ7A 3FWLA 1YI2P 4OVNF 1Q90D 3CXHE 2O1KA 1RQVA 1NH4A 3KPEA 4GT1A 4WY4B 2IX7C 3TYYA 1HTLC 1M57D 1PP9D 3HD7A 3L72J 1H0TA 4U3FJ 3AECC 2QJYB 1W2BO 3CMAP 1SQBG 1OW8A 5KTBA 2KI7B 3CXHH 5AVYB 1W2EA 4PD4D 3W67A 3CWBJ 3NXSA 3CC4P 4TLFA 1E79H 1PIXA 2AXCA 2PGDA 3A3YB 3L72D 4U3FD 1NU1E 3MZWB 4OGQC 5AW0B 3Q1MA 5KAIE 1JCDA 2HLOA 2Y0EA 4D6TJ 2E75D 3CWBD 1NU1G 3P8CD 5KJ7D 3RL0B 2WITA 1GD2E 2OQQA 3H1LE 2ZYDA 3A2AA 1NYHA 5KAIH 2P67A 2Z5HA 4I7ZB 2YMKA 3WU2H 4NPFX 1SFCA 2K3RA 3RBXA 4D6TD 1EC5A 1P84D 3H1LG 4JQ0D 2KNCA 3H1HJ 4XE5B 2K9JA 5KKZC 4YPCA 1L4AC 4BWNA 3EWKA 2B87B 3CCVP 2L91A 4N3YB 1H88A 3RL0g 4NPEA 1OVVA 1L0LG 5CCGD 2L5GB 2OYHB 1WMKA 5KAFE 1JB0J 2OYIA 1M1KQ 4WY4C 2HPCB 2R5BA 1FZEA 3L71J 1FZFA 5AW2B 1MFZA 2MJZA 5CBOA 3CCQP 2QJYC 3IF4A 4TT3H 1Z56A 1J1DB 4L75A 3OAKA 4EYYQ 3PHLA 2AEMA 3L71D 3F5HA 3HE5B 2WSFJ 3L72E 1S5LE 4DJGA 2O3JA 2XKMA 1PFIA
chains in the Genus database with same CATH topology
1AVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AVO A; 
#chains in the Genus database with same CATH topology
 3KXD A;  1FDM A;  1BCC E;  2HR3 A;  4IL6 E;  2O01 N;  3CWB E;  4NPD A;  3RL0 C;  3P8C E;  1RE3 C;  3QH9 A;  1S5L H;  2E43 A;  1BCC G;  1OVU A;  2WTY A;  4I7Z C;  2IDB A;  1JTH A;  1ZV8 A;  4DT0 A;  1IFP A;  4IL6 H;  2N9B A;  4D6T E;  1WRG A;  5M1B A;  5CHX A;  1IFJ A;  2QSI A;  3M9B A;  1M1J B;  2YMY A;  3TK1 A;  4L76 A;  3AE4 C;  1KB9 H;  3LID A;  3H32 B;  1EZV I;  4RKU J;  2OYH C;  4H0L D;  2ZAE B;  1ZXG A;  2AXT H;  3N7N A;  1AVY A;  1KOR A;  3GG2 A;  3L36 A;  4R4M A;  2M5A A;  3CX5 I;  2ZT9 D;  5KJ7 C;  1J1D C;  5APV A;  3SFD C;  3KZI E;  1DX7 A;  1VQ7 P;  3GHG A;  2O01 J;  3S1K A;  3IAO A;  1LTJ A;  3G9R A;  1NU1 K;  1LT9 B;  1GL2 D;  1S3J A;  3H1K J;  1Y8A A;  2N1T D;  1YJ9 P;  5CCG C;  1S9K D;  4YXW H;  2BCC E;  2Q7C A;  1KFN A;  1H89 A;  2KK7 A;  1YIJ P;  1JY2 O;  2JP3 A;  1VQO P;  3GF3 A;  3S4R A;  1M7L A;  3H1K D;  3U59 A;  2W90 A;  3TF5 A;  1AQ5 A;  2BCC G;  3KDP B;  5APS A;  3CCE P;  1G2C B;  4QMA A;  2ZT9 B;  4GOE A;  1M1J C;  1CW5 A;  3PTZ A;  4H13 D;  1T2K D;  1N7S A;  1DD4 A;  4BXL A;  2FYU J;  3JSV C;  5BU5 A;  1RF0 A;  2V4H A;  2PP6 A;  3I5C A;  1SQQ J;  1G1I A;  2KOG A;  4W7Y A;  5AW3 B;  3AE6 C;  3V2P A;  4PD4 I;  1GL2 B;  2ZYA A;  3FGA D;  1GMJ A;  2FYU D;  3BCC E;  2KUB A;  2WWW A;  2N1T B;  2HFE D;  1SQQ D;  2P2U A;  2LR2 A;  1KN7 A;  1KQG B;  3R4Y A;  2Y9Y A;  2Q6Q A;  1A02 F;  1VF5 B;  2Y9Z A;  2C0W A;  1URQ D;  1S4X A;  5APY A;  2PAJ A;  3L74 E;  1LT9 C;  5KLV E;  1X8Y A;  1X22 A;  5APT A;  4BRY B;  3VP9 A;  1MUU A;  4H13 B;  2FXO A;  1X0T A;  1VQ8 P;  1BSN A;  1SQX E;  3L74 G;  4JYB A;  2W83 C;  5KLV G;  1FZA A;  1K9M Q;  4GDO A;  2OTL P;  1HJB A;  1BE3 J;  4UB8 H;  2QA4 P;  3OA7 A;  3L75 J;  1JMM A;  1JMB A;  1L0N J;  2K9Y A;  2K37 A;  1JCC A;  1SQX G;  1QEX A;  3OJA B;  2V7Q J;  2ZT9 C;  3M91 A;  2A45 I;  1BE3 D;  2YIU B;  3L75 D;  2QRX A;  5H2F E;  1L4A A;  1SP4 A;  1K04 A;  3K5B A;  4M3L A;  1T6A A;  1FDO A;  1SQB J;  2M3B A;  4LC1 A;  4ZMD A;  3NTN A;  1ZP0 C;  1GL2 C;  3AE9 C;  1BGY J;  3TGU E;  2KYV A;  5H2F H;  2KSE A;  2R32 A;  3PP5 A;  3G6E P;  1L2P A;  2N1T C;  1EZV D;  4WY4 A;  4RO0 A;  1SQP J;  2LXC B;  1SQB D;  1KYO I;  2E76 D;  1BGY D;  1VF5 C;  2ZXX A;  1GW4 A;  1YQ3 C;  1Q81 Q;  2HG5 D;  1LT1 A;  4DOJ A;  5AVQ B;  1SQP D;  1NTM J;  1FBM A;  3R2P A;  1R5L A;  1ZW0 A;  3JCU E;  4H13 C;  3EQ2 A;  4GOF A;  3AE1 C;  2IBZ D;  1OFC X;  4HB1 A;  3U1C A;  5AVX B;  1KTM A;  5AW6 B;  1NOH A;  1SQV J;  1NTM D;  2HYN A;  1LTB C;  3JCU H;  4KT0 J;  2JDI H;  3KHU A;  3M9Q A;  3ITK A;  1L0L J;  3Q5P A;  1EDL A;  3GF7 A;  2OTJ P;  2ZXE B;  1SQV D;  2YIU C;  1EXJ A;  5CBN A;  3CCM P;  3CCS P;  2KSJ A;  5AW7 B;  1GU4 A;  3CCJ P;  3L73 G;  1L0L D;  3AE8 C;  2B87 A;  1EDI A;  4Y28 J;  1IC2 A;  4EIJ A;  2IZ0 A;  2H8P D;  2YO3 A;  2OYH A;  3TDK A;  3VN0 A;  3CL3 D;  3LW5 H;  1CI6 B;  1LTT C;  3D6Y A;  1JY2 P;  2P58 A;  2HPC A;  1VQK P;  1MKM A;  5C39 A;  3SWF A;  1KMI Z;  1OX3 A;  5KJ7 A;  2FFD B;  1AV1 A;  3CD6 P;  2Q1K A;  1MZ9 A;  1PV3 A;  5AVT B;  1EXI A;  3G71 P;  1HUC A;  5KLV K;  5CJ4 A;  4Y99 B;  3CX5 E;  1M56 D;  2Q5U A;  1LTI C;  2GA1 A;  1OWA A;  3HE5 A;  3USS A;  3AE7 C;  3M9H A;  3PRJ A;  3FX0 A;  2OYO A;  1IFN A;  2CPB A;  1SQX K;  1Q82 Q;  1HBW A;  3CX5 H;  3P32 A;  2ZFC A;  5E79 E;  2QM8 A;  5CCG A;  3AEF C;  1IFD A;  5AW5 B;  1LWU B;  1AFO A;  1QGK B;  1HH0 A;  1AJY A;  5E79 H;  3EFF K;  1SQV E;  2WZ7 A;  3Q3D A;  3H1I E;  1M1J A;  1GZL A;  2PRR A;  2XV5 A;  4ASV A;  4HH2 A;  2M3E A;  2HOD B;  3H32 A;  3H1H D;  4O9B A;  2UWJ E;  2ZVO B;  1NAY A;  3H1I G;  3MGN A;  2WT7 B;  2FYU K;  1PP9 E;  1S5L X;  2E74 D;  2E75 B;  1JY3 P;  1JY3 N;  4WBA A;  5KAF H;  2Z5I A;  4JF7 A;  2P7J A;  5AVU B;  5AVW B;  2FFD C;  4PD4 E;  1U57 A;  2PFX A;  1PP9 G;  5CJ0 A;  4C46 A;  4U3F E;  4Y99 C;  1BDD A;  1EDK A;  3WUU A;  1OIP A;  1ZRT D;  2CPS A;  4PD4 H;  1KYO D;  1LT9 A;  3L72 G;  1AVO A;  5CCH D;  3PH0 A;  5DJT B;  1LTA C;  1CSB A;  3FXD A;  2YO2 A;  1YIT P;  3AEA C;  3IR9 A;  2NPS A;  1LWU C;  4ZKP A;  3CWB G;  1N73 B;  2JR8 A;  1FU1 A;  1P84 E;  4AUW A;  3SSU A;  2QG4 A;  2Q3I A;  1GU5 A;  1NTZ J;  3HUS A;  1NKZ B;  4Z1M H;  4WB4 A;  1FZB A;  1G2C A;  4D6T G;  4KHX A;  2K9J B;  2KS1 A;  3VTP C;  1P84 H;  4N6J A;  1USE A;  5APQ A;  3H1H E;  1FAV A;  4EDF A;  1NTZ D;  2OAR A;  1VQ9 P;  2C0X A;  2LXB A;  1GL2 A;  1PGO A;  3II6 A;  2E75 C;  3VMZ A;  1ZLL A;  3FXE A;  3QWO C;  2N1T A;  2IBZ I;  2A45 H;  2WPV B;  2YNY A;  3L71 E;  3KQG A;  3WUT A;  3KYQ A;  1SQP K;  1JM0 A;  1IZN B;  3KZI H;  1VPC A;  1USD A;  1ZRT E;  1IK7 A;  2ITA A;  3S9O A;  4OH8 B;  3HTK B;  4CPG A;  3L71 G;  2H43 A;  2CK3 H;  4AYC A;  4BRY A;  2FYN B;  1KIL D;  3H1J J;  2BEZ F;  1RQU A;  3RGU A;  4H0L B;  1FZC B;  1NTM K;  2QM7 A;  3L37 A;  2B88 A;  3I55 P;  2XZR A;  1N73 C;  1LTG C;  4HJG H;  2QEX P;  1GW3 A;  1NTK J;  4WVZ A;  2WSF H;  3H1J D;  1IO4 A;  4ZNC A;  2GM4 A;  1PPJ D;  1SQV K;  2BEQ D;  4C7R A;  4N78 D;  3B71 A;  1KZU B;  4KJM A;  1NTK D;  1HWT C;  4H44 D;  3RK2 D;  4K3A A;  3A7O A;  1NTZ E;  1H8A A;  2IFN A;  1ZME C;  3A0H E;  2H88 C;  2R3S A;  1J1E B;  4JPZ B;  1QL1 A;  4PJ0 E;  2WSE J;  2JEE A;  3T97 B;  1OVR A;  1HGV A;  2ZYG A;  1HVV A;  2G3A A;  2QIW A;  4IFF A;  5CCH C;  1JNM A;  1KIL B;  1AQT A;  1TU3 F;  4DZO A;  1U7J A;  3TSI A;  3MP7 B;  2XU6 A;  3A0H H;  4I1L A;  1JOC A;  3BCC G;  3B8E B;  3A5T A;  1N7S D;  1GDT A;  3G3Z A;  2KLV A;  2I1K A;  2H7H A;  1G1J A;  1VQP P;  3HE4 B;  1RE4 C;  4L73 A;  2FYN C;  2WSC J;  3V6I A;  5B66 E;  3E7K A;  3MTU E;  2A06 D;  2DW3 A;  2IFM A;  1S9K E;  4H0L C;  1FZC C;  5AW9 B;  1U7M A;  4RES B;  3L70 J;  1KB9 I;  1MFT A;  4H44 B;  1NGM B;  3RK3 D;  3H1K E;  2O01 H;  3L73 J;  2WQY C;  1YJW P;  3NFQ A;  2MKV A;  5AVR B;  1KV4 A;  2P10 A;  3BRV B;  1HF9 A;  1LP1 B;  3L70 D;  1HJ0 A;  4DCK A;  3BVH A;  1PPJ E;  3L35 A;  1SLQ A;  2AEJ A;  4N78 E;  3SWY A;  3H1K G;  1OXZ A;  1L0N D;  2R3C A;  2LKM A;  3L73 D;  1NTK E;  1T3J A;  1URQ B;  2QJK B;  1FJP A;  4JBZ A;  2Q3E A;  1Q86 Q;  3IN6 A;  5AVS B;  4RJT A;  1KQS O;  1J1E C;  5KLI B;  3IFM A;  2FYU E;  3O6Q B;  3FWN A;  3TNU B;  3AE5 C;  3CCR P;  2ZVN B;  1KIL C;  4AQR D;  1ZN5 A;  1FOS E;  1SQQ E;  1CI6 A;  2W6A A;  1FOS F;  3M0A A;  2JO1 A;  3V2N A;  3CXH D;  3TGU G;  3VYI A;  1KFM A;  1YYC A;  2FYU G;  3RK3 B;  1NO4 A;  1NU1 J;  1VQ5 P;  1CZQ A;  2YXR B;  3CLQ A;  2FFD A;  1SQQ G;  1L4A D;  1NWQ A;  1QVF O;  2ZJS E;  2YKP A;  1T2K C;  1T8Z A;  3B5N D;  1S1C X;  2K88 A;  3D70 A;  2IPP A;  1NU1 D;  3H1L J;  2K1A A;  4A7P A;  2A06 E;  3V2R A;  3H6P A;  4UB6 E;  3F89 A;  1RF1 B;  4H44 C;  4WY4 D;  1RE3 A;  2E5T A;  3RK3 E;  3NMD A;  1LJ2 A;  3H1L D;  1Y47 A;  4UB6 H;  1N86 A;  1ZR2 A;  1LWU A;  3MD0 A;  2Y0D A;  1BE3 E;  2YXQ B;  1FS0 E;  3L75 E;  1Q2N A;  2E76 B;  1L0N E;  2GUV A;  5APX A;  1QX8 A;  2VRS A;  1URQ C;  2QJK C;  5DJU B;  3H25 A;  1RF0 C;  2FBW C;  1BE3 G;  4IFM A;  1NTZ K;  3O8Z A;  3L75 G;  3UIA A;  5KLI C;  3WUV A;  2H89 C;  2HOD A;  3RL0 D;  3B5N B;  3SFE C;  2RH0 A;  1JY2 N;  1WT6 A;  3VP8 A;  2V7Q H;  1VQ6 P;  1EZV E;  1Y9B A;  2WT7 A;  3CCU P;  5CMZ A;  2RMZ A;  1SQB E;  5AW1 B;  3AE3 C;  1BGY E;  3RK3 C;  3G4S P;  1NKN A;  5B5E E;  1EZV G;  3PLN A;  2JWA A;  1OMI A;  1S2E A;  1SQP E;  1BCC J;  2JKV A;  2Y0C A;  3GW6 A;  1BGY G;  3M0D C;  5B5E H;  2IBZ E;  3CCL P;  1GK4 A;  2JJL A;  3V4Q A;  3OW2 O;  1SQP G;  3HD7 D;  3SWK A;  2GUS A;  1PZQ A;  1RF1 C;  1LNQ A;  1NTM E;  1BCC D;  1K05 A;  3P8M C;  3WU2 E;  1N7L A;  2IBZ G;  1OW6 A;  2POH A;  2M8R A;  1FC2 C;  4PV1 D;  4C7N B;  1N2D C;  3BAT A;  2IZ1 A;  2XND H;  3ABV C;  1N73 A;  1NTM G;  5L8R J;  3U1A A;  2AEF A;  3C1L A;  1KB9 D;  1FDI A;  1IFM A;  2E76 C;  1LGH B;  1VQN P;  1OZH A;  3B4S A;  1L0L E;  5BU8 B;  1NTK K;  3GLM A;  2WVR A;  1SQV G;  1NVO A;  4OWF A;  5AW8 B;  3B5N C;  1M90 Q;  2WPQ A;  1SFC D;  1SQQ K;  2D2C D;  3MUD C;  1D7M A;  3HD7 B;  3L4F A;  1H0T B;  4IL6 X;  5CCH A;  3BAS A;  3RBZ A;  3EFG A;  3A0B E;  2G8Y A;  4W80 A;  4PV1 B;  1X79 B;  1VL2 A;  3AEG C;  2BAS A;  2W6B A;  2OGU A;  4IFD K;  3M06 A;  2WPR A;  3A0B H;  2W6J H;  3D71 A;  1KQL A;  4U3F G;  4GIF A;  2P1J A;  2BCC J;  3HTK A;  1RE4 A;  2FXM A;  1YTZ I;  2B89 A;  1QVG O;  1FZC A;  5AW4 B;  4ASW A;  2Z4E A;  2BCC D;  1JUN A;  3C9I A;  4B86 A;  2E74 B;  2O1J A;  1SFC B;  3C8V A;  1DEB A;  2D2C B;  1KQF B;  2J58 A;  2KNC B;  3E1I A;  1KB9 E;  1L0N K;  3VMY A;  2KB7 P;  3CXH I;  2AXT E;  1OW7 A;  1XTG B;  3W68 A;  4U7J A;  1RY3 A;  3BCC J;  1PL5 A;  1JEK A;  1GK6 A;  2NPS D;  1KC8 Q;  2KXP B;  2OYI B;  1HGZ A;  2WPS A;  1UII A;  1NJI Q;  3H1H G;  3T97 A;  3HD7 C;  3Q2Y A;  1SQB K;  1A02 J;  3AEE C;  1JO5 A;  3WMM 0;  2A45 G;  5K5G B;  1KIL A;  3E1R A;  2I1J A;  2I8D A;  3BCC D;  2FXP A;  3L74 J;  2E5Y A;  5KLV J;  4PV1 C;  1EDJ A;  2RN0 A;  3CC2 P;  4GOD A;  2SPZ A;  2KLU A;  1KYO E;  1IJD B;  4LGD E;  1SQX J;  4JYC A;  1ZOY C;  2W27 A;  2J59 M;  3L74 D;  5KLV D;  3HE4 A;  3GMA A;  2KZJ A;  5AVZ B;  1XTC C;  1M8O B;  2C9L Y;  1KYO H;  3VOP A;  1SQX D;  3BRT B;  1NHL A;  2NPS B;  2E74 C;  1JTH B;  1SFC C;  3VMX A;  3D6Z A;  1R8E A;  2D2C C;  4XFJ A;  4W7Z A;  1VF5 D;  2OTK E;  2C9N Y;  1E5W A;  4HKZ H;  1LP1 A;  4WWI A;  3HUS B;  2IYP A;  1L0L K;  3JC2 2;  1DH3 A;  1DEE G;  1J2J B;  1SS1 A;  3TGU J;  2KS1 B;  5TIS E;  1N8R Q;  1BDC A;  2B9B A;  1URQ A;  2R5D A;  1K8A Q;  1AA0 A;  2OYI C;  3CPW O;  2KIK A;  4ZKU A;  1NAF A;  1VDF A;  2M0B A;  3O6Q A;  3TNU A;  1NTZ G;  5TIS H;  1UIX A;  1IK9 A;  3V4W A;  3CI9 A;  1BSH A;  2M5A B;  3TGU D;  1RHZ B;  4PJ0 H;  4YXD C;  1FJK A;  3I56 P;  3VMA A;  2KP8 A;  3GHG B;  3AED C;  1IFI A;  5BVZ A;  1LTJ B;  4K35 A;  3CC7 P;  2FYZ A;  1KD1 Q;  1YJN P;  3ZDM A;  1KIL E;  1YQ4 C;  2RKL A;  2XNX A;  3M0D A;  1VQ4 P;  4EOT A;  1ZR4 A;  1DD3 A;  2J5U A;  4UB8 E;  4XA4 A;  5TJH A;  3RK2 B;  3LIE A;  5APW A;  4I6M C;  1P84 I;  1K73 Q;  1QL2 A;  1RF1 A;  5B66 H;  1PGQ A;  1DIP A;  2NPS C;  3HRN A;  2XDJ A;  3H1J E;  4L74 A;  1JY3 O;  2QJP B;  2IYO A;  2N9Y B;  3LW5 J;  3P7K A;  3HUS C;  3AE2 C;  4OGQ D;  1N7S B;  3H1J G;  5GTH E;  3V5B A;  1PPJ G;  2Q9I A;  2E42 A;  1PGJ A;  1W5C E;  1PGP A;  1NTK G;  1FE6 A;  5GTI E;  5EFW B;  1YTZ T;  3MIW A;  5GTH H;  3Q5R A;  1VQL P;  3B5N A;  4GKG A;  2NRG A;  3V2Q A;  3MUD A;  1LTS C;  5GTI H;  1VQM P;  3GHG C;  1FZG A;  4R4L A;  2KZI A;  3CME P;  1X9V A;  2QE7 H;  1LTJ C;  4IOI H;  2QVA A;  2YKO A;  4HYT B;  2FKW B;  2WSE H;  2NZ2 A;  3N4X A;  5APU A;  2YKQ A;  1QLE D;  3MHV A;  1Q7Y Q;  3CX5 D;  4OGQ B;  2JWD A;  1YHQ P;  3RK2 C;  1RH5 B;  3Q5S A;  3PJS K;  2A06 G;  1S72 P;  1T3U A;  4C7N A;  3L70 E;  2QJP C;  2FY8 A;  2WMM A;  4YTP C;  4MN4 C;  3H1I J;  2R44 A;  1YBK A;  2WSC H;  1GTW A;  1N7S C;  3L73 E;  4LLH A;  1MV8 A;  5KKZ B;  3L70 G;  1L4A B;  4I2L C;  2W8Z A;  4EI2 A;  2WSS H;  1R5S A;  5AVV B;  1L0N G;  1PP9 J;  3H1I D;  1SVF A;  3AEB C;  1EQ7 A;  3FWL A;  1YI2 P;  4OVN F;  1Q90 D;  3CXH E;  2O1K A;  1RQV A;  1NH4 A;  3KPE A;  4GT1 A;  4WY4 B;  2IX7 C;  3TYY A;  1HTL C;  1M57 D;  1PP9 D;  3HD7 A;  3L72 J;  1H0T A;  4U3F J;  3AEC C;  2QJY B;  1W2B O;  3CMA P;  1SQB G;  1OW8 A;  5KTB A;  2KI7 B;  3CXH H;  5AVY B;  1W2E A;  4PD4 D;  3W67 A;  3CWB J;  3NXS A;  3CC4 P;  4TLF A;  1E79 H;  1PIX A;  2AXC A;  2PGD A;  3A3Y B;  3L72 D;  4U3F D;  1NU1 E;  3MZW B;  4OGQ C;  5AW0 B;  3Q1M A;  5KAI E;  1JCD A;  2HLO A;  2Y0E A;  4D6T J;  2E75 D;  3CWB D;  1NU1 G;  3P8C D;  5KJ7 D;  3RL0 B;  2WIT A;  1GD2 E;  2OQQ A;  3H1L E;  2ZYD A;  3A2A A;  1NYH A;  5KAI H;  2P67 A;  2Z5H A;  4I7Z B;  2YMK A;  3WU2 H;  4NPF X;  1SFC A;  2K3R A;  3RBX A;  4D6T D;  1EC5 A;  1P84 D;  3H1L G;  4JQ0 D;  2KNC A;  3H1H J;  4XE5 B;  2K9J A;  5KKZ C;  4YPC A;  1L4A C;  4BWN A;  3EWK A;  2B87 B;  3CCV P;  2L91 A;  4N3Y B;  1H88 A;  3RL0 g;  4NPE A;  1OVV A;  1L0L G;  5CCG D;  2L5G B;  2OYH B;  1WMK A;  5KAF E;  1JB0 J;  2OYI A;  1M1K Q;  4WY4 C;  2HPC B;  2R5B A;  1FZE A;  3L71 J;  1FZF A;  5AW2 B;  1MFZ A;  2MJZ A;  5CBO A;  3CCQ P;  2QJY C;  3IF4 A;  4TT3 H;  1Z56 A;  1J1D B;  4L75 A;  3OAK A;  4EYY Q;  3PHL A;  2AEM A;  3L71 D;  3F5H A;  3HE5 B;  2WSF J;  3L72 E;  1S5L E;  4DJG A;  2O3J A;  2XKM A;  1PFI A; 
#chains in the Genus database with same CATH homology
 1AVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...