1AVOA

Proteasome activator reg(alpha)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
60
structure length
60
Chain Sequence
LRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the proteasome activator REGalpha (PA28alpha).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Proteasome activator
molecule keywords 11S REGULATOR
total genus 18
structure length 60
sequence length 60
chains with identical sequence C, E, G, I, K, M
ec nomenclature
pdb deposition date 1997-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.120 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Proteasome activator pa28, N-terminal domain 1avoA00
1AVOA
chains in the Genus database with same CATH superfamily
1G1IA 1OVUA 2H8PD 3CCQP 2E42A 1VQ8P 1GL2B 1KB9I 2M0BA 1FBMA 3KXDA 1NTMJ 3KQGA 1SQVJ 2YO2A 2GM4A 1BE3D 3PTZA 2KK7A 1NTKK 2A45H 4I6MC 2JEEA 1PPJE 2K1AA 4WWIA 3CCVP 1NJIQ 2Q9IA 1MFTA 1SQPD 3ABVC 2R44A 3M06A 4WBAA 2N1TC 3LIDA 1BSNA 2QJYC 1L4AB 3EQ2A 5AW4B 4HH2A 4JYBA 1G1JA 1RE4C 4H44C 5E79E 5AVQB 5KLVD 4CPGA 2HYNA 2KSEA 3BCCE 2NPSB 1FOSF 4HJGH 1RHZB 1NO4A 1OX3A 2H88C 3HD7C 1BGYJ 3M0DA 5BU8B 2RH0A 2HODA 1MV8A 2RKLA 1SQVE 2FYNC 2P7JA 2FY8A 3K5BA 3NMDA 1M1KQ 5GTHH 3RL0g 2K37A 4NPEA 3RK2D 3KZIE 2OTJP 4H13B 5CJ4A 3CCMP 5DJTB 1YI2P 3O6QA 3SFEC 4Z1MH 1LTJC 5L8RJ 3HE4A 1NTZE 3AE6C 2FYNB 3C9IA 1YIJP 1BGYE 1ZXGA 5AW8B 4DCKA 2QJKC 2QSIA 3BASA 3VMYA 1ZV8A 3D71A 3F5HA 4RESB 3L70G 2YNYA 4RO0A 2K9JA 3KZIH 1L0ND 4GIFA 3CCJP 1RF1C 3H32A 4W80A 2D2CB 3OJAB 1GK6A 4DT0A 3H1KE 1T2KD 1HVVA 2PGDA 4U3FG 1SQVD 1UIIA 2QA4P 1VQMP 1NTKE 1U7MA 3RK2C 1GU4A 1XTGB 2YMYA 3H1LD 3RL0C 1JCCA 3OAKA 5TISE 1KC8Q 1SQPG 1IK7A 4UB8E 3AE5C 3H1HD 2BASA 1L0NE 1NAFA 1PZQA 2H7HA 1LT9A 1FDMA 1KILB 1RY3A 2QRXA 1FZFA 4OWFA 1J1DB 1URQD 3A0BH 3MTUE 1LT1A 1FZEA 5M1BA 1VQ5P 2E43A 1FC2C 2R3CA 1NTKJ 1QX8A 1NTME 3B5ND 3VYIA 5CMZA 5AVUB 5AW2B 2NZ2A 2E75C 3BRTB 2KLUA 1URQA 1JNMA 1M90Q 1DIPA 1OZHA 2Y9ZA 3FWLA 1SQQD 2ZYDA 1QL2A 1L0NJ 1RF0A 4LC1A 3Q5RA 3WUTA 3P8CD 4KJMA 1YJ9P 1AFOA 4GOFA 1S9KD 3HD7A 3AEEC 3MZWB 1GTWA 3O8ZA 5KJ7C 3CMEP 3Q1MA 3PRJA 3VP9A 2AXCA 1KB9E 2JDIH 3R2PA 4PD4D 2IZ0A 4H0LC 1H8AA 3AEAC 5KKZC 1JY3P 3TDKA 1JY3N 1IFMA 1L0LE 3P7KA 1AV1A 2WPSA 3MHVA 3PH0A 4IOIH 2OYIC 1EQ7A 1N7SB 3L35A 2W6BA 2Y0CA 1AJYA 1UIXA 2IBZI 2E75D 2FXOA 3HUSB 3RBZA 2P2UA 3EFGA 4IL6H 3CWBJ 1AVOA 3HE5A 4PV1B 3TGUD 5CHXA 2E74D 3AE1C 1X22A 2B87A 2JO1A 2OYOA 1VF5B 3AEGC 2ZT9C 1KB9H 3CWBD 3SFDC 1GL2A 1RQUA 3CC2P 2CPSA 2N9YB 1VQ9P 2QIWA 1NKNA 2W27A 2WZ7A 1NGMB 1GW3A 3H1IJ 5KLVJ 2QJPC 2W6JH 2W8ZA 2ZXXA 4M3LA 1SQQG 1NU1G 2K88A 2WVRA 1AQ5A 3CI9A 3QWOC 2M8RA 1VF5C 5B66H 1JB0J 2OYIA 1HWTC 1S5LE 2KYVA 3CC4P 4KT0J 1KILD 3AEDC 5APXA 4QMAA 1PFIA 1DX7A 1NU1J 3A0HE 1KZUB 2IZ1A 3A2AA 3E1RA 1JM0A 4ZMDA 3L70E 3CX5H 3L37A 3AE4C 1T6AA 3ZDMA 3CX5D 5KKZB 1NAYA 4AYCA 2N1TB 2QJYB 3JCUE 1VQ7P 2BCCD 3L74E 1YITP 3FXDA 3JSVC 1NTKD 1KYOE 2VRSA 4C7NA 5TISH 3SWYA 1NTKG 3TSIA 3CD6P 5C39A 1VPCA 1KQSO 2OYHA 4IFFA 2HPCB 1NYHA 5CCHA 1GD2E 2C0XA 1URQC 2CK3H 2KS1A 3VN0A 2ZYGA 4BXLA 1HGZA 1JEKA 2KZJA 3L70J 1Y9BA 3CX5I 1AVYA 1OW7A 4C7RA 2BCCE 1L0NG 2YMKA 3PJSK 2I1JA 3E7KA 3CCSP 2L5GB 3L72G 2ZVOB 3AE8C 1M7LA 1FDOA 3H1LJ 1RE3A 5EFWB 2YKPA 2OGUA 4N6JA 1T2KC 1QL1A 1NHLA 3KDPB 1JTHA 3P8MC 1J2JB 2FYUE 1OWAA 2I1KA 3PLNA 1L0LJ 1RQVA 3I5CA 5AVXB 3B8EB 3P32A 3VMAA 3OW2O 1QLED 2XKMA 3FWNA 1SQXE 2ZAEB 2E74B 2V7QH 4R4LA 3NTNA 2WSCJ 3SWKA 1L0LK 1YYCA 1PGJA 3CWBE 3HTKB 1X79B 2E75B 3EWKA 4LGDE 4PD4H 4UB6E 2JKVA 1LTSC 1HGVA 4EDFA 3V5BA 1D7MA 2FFDA 2JJLA 1JY2P 1IO4A 2GUSA 2B89A 1SLQA 4KHXA 3TNUB 1M8OB 3H1JD 3MIWA 3D6ZA 3TYYA 2WSFH 1R8EA 2WT7A 3H1IE 1IZNB 1S1CX 1URQB 5E79H 3L4FA 5KLVE 4LLHA 5AVYB 1H88A 1GK4A 1SQVK 3CXHI 3BCCD 4GDOA 3Q5PA 3H1KD 2YO3A 2Z5HA 2B88A 3C1LA 1CSBA 2UWJE 1BE3G 4H44B 4PD4I 4YXDC 1WRGA 3AEBC 4JQ0D 1N7SC 3II6A 4BRYB 1PP9J 2KIKA 3G3ZA 2D2CC 2Q3IA 1BCCE 3B71A 4RKUJ 1PGPA 2O01H 1N8RQ 2L91A 2JWDA 1FZCC 1DD3A 4OVNF 2G8YA 2HG5D 1NH4A 1GZLA 1WMKA 4L74A 3G6EP 1JUNA 2NPSA 2KXPB 3I56P 3HE5B 2RMZA 2OYHC 1GMJA 1N2DC 2Q6QA 2YKOA 1YBKA 2B87B 2YKQA 3GW6A 4DZOA 1P84E 1Q7YQ 4H0LD 1USEA 5AVZB 4IFMA 5APVA 3H1HG 4L75A 1RE4A 4IL6E 3TGUE 2E76B 1SQQK 1X0TA 4HB1A 4N78E 3CCEP 1SFCA 2GUVA 2BEQD 3MP7B 3CLQA 3L74G 2FYUK 3H1LE 3HE4B 2RN0A 1IFIA 5CBNA 1LTAC 3L73D 1EZVE 1VDFA 2A45G 1VF5D 4JYCA 2OYIB 1NOHA 4MN4C 1DD4A 1LTIC 5KAFH 1H89A 2E76C 2Q5UA 2AXTH 3UIAA 5KAIE 3N4XA 5CJ0A 1VQOP 5CCHD 1PGOA 1L4AD 2JP3A 5BVZA 3P8CE 2C9LY 1L2PA 3L72E 3GHGA 1LP1B 1YQ4C 2E5YA 4JBZA 1VQKP 1SQXK 4D6TG 4EYYQ 1NU1K 1QGKB 4PJ0H 4HYTB 1ZLLA 1SQBE 2KI7B 3L71D 3VP8A 2HPCA 1MFZA 2KB7P 1U7JA 3RL0D 2R5DA 2QVAA 2A06D 1ZRTE 1FZGA 2H89C 2IX7C 3V4WA 5B5EE 3CWBG 2LXBA 1MUUA 1BDCA 4R4MA 1LTJB 1Q81Q 2FYZA 3JC22 2H43A 1BSHA 2FXMA 1YJNP 1BCCJ 1JTHB 1BDDA 1FZCA 4N78D 5AVTB 3ITKA 3JCUH 1ZRTD 1GW4A 3VMXA 1XTCC 3AEFC 1J1EC 3M0AA 4K35A 2QM7A 1SQBD 1PPJD 2HFED 4NPDA 3H1KJ 4DOJA 1QVFO 1RF1B 4EI2A 3CPWO 5AW9B 1SS1A 3B5NA 3S9OA 1IK9A 3D70A 1G2CA 2WPRA 3L71G 3U1AA 1K73Q 1EXJA 1VQ6P 4IFDK 2J59M 1KQFB 3HD7D 3L75G 3S4RA 1NTZG 1PIXA 1T3JA 2Z4EA 2OTLP 1E5WA 1SFCC 1OW8A 3HRNA 1FS0E 2E5TA 4PV1D 2KP8A 5KJ7A 4Y99C 2WMMA 4EIJA 2IBZD 3FGAD 1IFPA 1OFCX 2WSEH 3V6IA 1W2BO 3N7NA 2YIUB 1PPJG 2XDJA 1KILC 2V4HA 1NTZJ 1Q90D 5APWA 2M5AB 5KAFE 1W2EA 5AVWB 3L71J 4BRYA 1Y8AA 2W90A 3L74D 4D6TJ 3Q3DA 4W7YA 3BCCG 1VQNP 3CCLP 4BWNA 3AECC 2P10A 1QEXA 3MD0A 5APUA 4U3FD 1K9MQ 3WUUA 1OMIA 2QG4A 1FZAA 1SQPE 5CCGA 4I7ZC 1ZW0A 2KUBA 2IPPA 3U1CA 1EDLA 1M1JA 3A0HH 2OQQA 3GMAA 4YPCA 3RK3D 1P84H 1VL2A 1WT6A 2E74C 1LWUC 1P84D 2Z5IA 3AE7C 3RGUA 5AVRB 1PP9D 1K8AQ 1SQXD 2A45I 2POHA 4WY4A 3W68A 1MZ9A 2P1JA 2HLOA 1N86A 1KILE 2KZIA 2QJKB 3BRVB 4H0LB 5AW1B 3M91A 3G4SP 1H0TA 3LIEA 3AE3C 3V2PA 3T97A 1SFCB 3V2QA 5AW0B 1JOCA 2M3BA 4C7NB 3BCCJ 3CXHD 3LW5H 4AQRD 3MGNA 4H44D 1LTBC 2Q3EA 3HUSC 1LTGC 2KS1B 2KNCB 5KJ7D 2YIUC 3TF5A 2WTYA 1SFCD 3V4QA 2JWAA 1PP9G 1YTZI 2G3AA 2AEFA 3EFFK 4U3FE 1NVOA 2P58A 2PRRA 4Y28J 1USDA 1ZOYC 2O01J 3GHGB 5KLIB 1PL5A 3A7OA 1OVVA 1R5SA 3D6YA 3H1JG 4I2LC 3VTPC 4OGQB 1L0LD 5H2FH 2IFMA 1KORA 1NKZB 2R5BA 1JY2O 1N7SD 1U57A 2XNXA 3V2RA 3AE9C 3F89A 3NFQA 3KHUA 1S9KE 1SQPK 2WITA 3M0DC 5B5EH 4U3FJ 1HJ0A 2OARA 1JMBA 3HTKA 3CCUP 3CC7P 2FYUD 1NTMG 1YJWP 1TU3F 2FFDB 2O1JA 2N9BA 4WY4D 5AW6B 1E79H 2WSFJ 2J58A 2MKVA 2WPVB 3FXEA 1SQQE 2AEMA 3C8VA 3H1JJ 2ZYAA 3TK1A 3L71E 2FBWC 1J1EB 2QJPB 1LTJA 2WT7B 3WMM0 4WB4A 2FKWB 4K3AA 4W7ZA 1HJBA 5CCGD 2PAJA 2C0WA 2M3EA 2WPQA 2WSEJ 2KSJA 1HUCA 5K5GB 1KQGB 3GLMA 2FFDC 1N73C 1FZBA 1KQLA 5CCGC 3I55P 4AUWA 3U59A 2QEXP 1HTLC 1M1JC 1IC2A 1W5CE 2AXTE 4UB8H 3A5TA 3IFMA 1L0LG 4GKGA 3W67A 2W83C 2W6AA 2AEJA 1SQQJ 2QE7H 5H2FE 1IFNA 3G71P 1RF1A 1FJPA 3V2NA 1X9VA 2NRGA 4WY4C 3LW5J 1GU5A 2IFNA 1LTTC 2O01N 4TT3H 3RK3C 1IFDA 3CMAP 1KYOD 1LJ2A 1S4XA 3PHLA 4IL6X 2LR2A 3GF7A 5AVSB 3S1KA 2A06E 3H32B 1PV3A 3L70D 1JMMA 2O3JA 1CI6B 1LNQA 1DH3A 2J5UA 1FE6A 1YHQP 1NU1E 1VQLP 1KFMA 1EZVI 2IYPA 3RK3B 1SQBK 1QVGO 2N1TD 2KOGA 2NPSC 1HH0A 2C9NY 3CXHH 4O9BA 1A02J 1Q82Q 1LWUB 3L74J 2FYUG 4D6TD 1HBWA 2ZT9B 5GTHE 1LT9B 2Y0DA 2WSSH 3RBXA 1Y47A 3GF3A 4TLFA 3H6PA 1RF0C 1SQXG 2XNDH 1M1JB 1P84I 2PP6A 1EDIA 3RK3E 1FOSE 1PP9E 3L73E 1LGHB 2D2CD 4GOEA 5TJHA 5AW7B 1NTZK 4XA4A 1FZCB 4WY4B 2WSCH 1T3UA 2V7QJ 1LP1A 4XE5B 1Q2NA 3L72D 1EC5A 1YQ3C 4GODA 2P67A 4DJGA 2Y9YA 4HKZH 5APQA 4I7ZB 2PFXA 1K04A 5AW3B 5KLVG 2Q1KA 1X8YA 3H1ID 2NPSD 1EXIA 4U7JA 3H1JE 1IFJA 1ZN5A 2BCCG 3HD7B 3M9QA 2FXPA 4Y99B 2FYUJ 2XV5A 2DW3A 1BE3E 5APSA 4RJTA 5KLIC 3L73J 3GHGC 3OA7A 4UB6H 3R4YA 1KB9D 3KYQA 3IF4A 4PD4E 1S3JA 2ZVNB 1R5LA 3RK2B 2IBZG 1GL2C 1L4AA 1OXZA 2K9YA 3CXHE 3MUDA 4H13C 5AVVB 5CBOA 1HF9A 3IAOA 1BCCG 1AQTA 1RH5B 1NTZD 4YTPC 3H25A 2ZFCA 2JR8A 2BEZF 2K3RA 1L0NK 2XZRA 1OIPA 2HODB 3CCRP 1VQPP 1KTMA 1DEBA 3VMZA 1ZR4A 2IYOA 3VOPA 2ITAA 1BE3J 2LKMA 2Y0EA 1J1DC 3A0BE 4OH8B 1NTMD 2YXQB 3KPEA 3M9BA 4OGQD 4ASWA 5APTA 2BCCJ 4XFJA 2LXCB 3M9HA 1JY2N 1K05A 1Q86Q 4ZKUA 2WQYC 3O6QB 1OW6A 5KLVK 2MJZA 4ASVA 2SPZA 2OTKE 3H1HE 3BVHA 4PV1C 3B5NB 3H1IG 2O1KA 1CW5A 1GL2D 1G2CB 1S2EA 3WU2H 3WU2E 3RL0B 3H1LG 1JY3O 5AW5B 3SSUA 4A7PA 4C46A 1KYOH 1MKMA 1SQVG 2ZXEB 3PP5A 2K9JB 1JO5A 5CCHC 5DJUB 1SQXJ 2R32A 5GTIE 1AA0A 2I8DA 3B5NC 2CPBA 1SVFA 2A06G 2N1TA 3CX5E 1DEEG 2M5AA 2B9BA 4ZKPA 3Q5SA 4L73A 1M57D 2GA1A 2QM8A 3L36A 2OYHB 1BGYG 1RE3C 1S72P 4PJ0E 5B66E 1KYOI 1BGYD 2HR3A 3TGUJ 1KD1Q 1OVRA 4ZNCA 1T8ZA 2ZJSE 3IN6A 1SQBG 3E1IA 1N73A 1VQ4P 1KILA 1ZMEC 3WUVA 4OGQC 2XU6A 1FU1A 1FDIA 3USSA 5GTIH 4GT1A 1FJKA 3Q2YA 1ZR2A 1EDJA 1KMIZ 1N7LA 1Z56A 3QH9A 5KAIH 1A02F 3H1KG 4H13D 2YXRB 3TGUG 4EOTA 1CI6A 1EDKA 1S5LX 1SP4A 3L73G 4L76A 1GDTA 4YXWH 1FAVA 4WVZA 1H0TB 1EZVG 1L4AC 1JCDA 3CL3D 3MUDC 3NXSA 3T97B 3SWFA 1EZVD 3L72J 2ZT9D 3IR9A 5BU5A 1KN7A 3L75J 2Q7CA 1LWUA 3A3YB 4B86A 1M56D 2WWWA 3BATA 2KNCA 3GG2A 4N3YB 1SQBJ 4I1LA 4JF7A 1PGQA 1YTZT 3G9RA 5APYA 2E76D 3AE2C 1KFNA 1CZQA 1S5LH 4JPZB 3TNUA 2R3SA 2KLVA 4D6TE 1N7SA 1KV4A 2IBZE 1BCCD 4NPFX 2IDBA 3HUSA 5KTBA 1IJDB 1ZP0C 3H1HJ 3L75D 3L75E 1LT9C 1SQPJ 1NWQA 1NTMK 1N73B 3FX0A 3B4SA 1NU1D
chains in the Genus database with same CATH topology
1AVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AVO A; 
#chains in the Genus database with same CATH topology
 1G1I A;  1OVU A;  2H8P D;  3CCQ P;  2E42 A;  1VQ8 P;  1GL2 B;  1KB9 I;  2M0B A;  1FBM A;  3KXD A;  1NTM J;  3KQG A;  1SQV J;  2YO2 A;  2GM4 A;  1BE3 D;  3PTZ A;  2KK7 A;  1NTK K;  2A45 H;  4I6M C;  2JEE A;  1PPJ E;  2K1A A;  4WWI A;  3CCV P;  1NJI Q;  2Q9I A;  1MFT A;  1SQP D;  3ABV C;  2R44 A;  3M06 A;  4WBA A;  2N1T C;  3LID A;  1BSN A;  2QJY C;  1L4A B;  3EQ2 A;  5AW4 B;  4HH2 A;  4JYB A;  1G1J A;  1RE4 C;  4H44 C;  5E79 E;  5AVQ B;  5KLV D;  4CPG A;  2HYN A;  2KSE A;  3BCC E;  2NPS B;  1FOS F;  4HJG H;  1RHZ B;  1NO4 A;  1OX3 A;  2H88 C;  3HD7 C;  1BGY J;  3M0D A;  5BU8 B;  2RH0 A;  2HOD A;  1MV8 A;  2RKL A;  1SQV E;  2FYN C;  2P7J A;  2FY8 A;  3K5B A;  3NMD A;  1M1K Q;  5GTH H;  3RL0 g;  2K37 A;  4NPE A;  3RK2 D;  3KZI E;  2OTJ P;  4H13 B;  5CJ4 A;  3CCM P;  5DJT B;  1YI2 P;  3O6Q A;  3SFE C;  4Z1M H;  1LTJ C;  5L8R J;  3HE4 A;  1NTZ E;  3AE6 C;  2FYN B;  3C9I A;  1YIJ P;  1BGY E;  1ZXG A;  5AW8 B;  4DCK A;  2QJK C;  2QSI A;  3BAS A;  3VMY A;  1ZV8 A;  3D71 A;  3F5H A;  4RES B;  3L70 G;  2YNY A;  4RO0 A;  2K9J A;  3KZI H;  1L0N D;  4GIF A;  3CCJ P;  1RF1 C;  3H32 A;  4W80 A;  2D2C B;  3OJA B;  1GK6 A;  4DT0 A;  3H1K E;  1T2K D;  1HVV A;  2PGD A;  4U3F G;  1SQV D;  1UII A;  2QA4 P;  1VQM P;  1NTK E;  1U7M A;  3RK2 C;  1GU4 A;  1XTG B;  2YMY A;  3H1L D;  3RL0 C;  1JCC A;  3OAK A;  5TIS E;  1KC8 Q;  1SQP G;  1IK7 A;  4UB8 E;  3AE5 C;  3H1H D;  2BAS A;  1L0N E;  1NAF A;  1PZQ A;  2H7H A;  1LT9 A;  1FDM A;  1KIL B;  1RY3 A;  2QRX A;  1FZF A;  4OWF A;  1J1D B;  1URQ D;  3A0B H;  3MTU E;  1LT1 A;  1FZE A;  5M1B A;  1VQ5 P;  2E43 A;  1FC2 C;  2R3C A;  1NTK J;  1QX8 A;  1NTM E;  3B5N D;  3VYI A;  5CMZ A;  5AVU B;  5AW2 B;  2NZ2 A;  2E75 C;  3BRT B;  2KLU A;  1URQ A;  1JNM A;  1M90 Q;  1DIP A;  1OZH A;  2Y9Z A;  3FWL A;  1SQQ D;  2ZYD A;  1QL2 A;  1L0N J;  1RF0 A;  4LC1 A;  3Q5R A;  3WUT A;  3P8C D;  4KJM A;  1YJ9 P;  1AFO A;  4GOF A;  1S9K D;  3HD7 A;  3AEE C;  3MZW B;  1GTW A;  3O8Z A;  5KJ7 C;  3CME P;  3Q1M A;  3PRJ A;  3VP9 A;  2AXC A;  1KB9 E;  2JDI H;  3R2P A;  4PD4 D;  2IZ0 A;  4H0L C;  1H8A A;  3AEA C;  5KKZ C;  1JY3 P;  3TDK A;  1JY3 N;  1IFM A;  1L0L E;  3P7K A;  1AV1 A;  2WPS A;  3MHV A;  3PH0 A;  4IOI H;  2OYI C;  1EQ7 A;  1N7S B;  3L35 A;  2W6B A;  2Y0C A;  1AJY A;  1UIX A;  2IBZ I;  2E75 D;  2FXO A;  3HUS B;  3RBZ A;  2P2U A;  3EFG A;  4IL6 H;  3CWB J;  1AVO A;  3HE5 A;  4PV1 B;  3TGU D;  5CHX A;  2E74 D;  3AE1 C;  1X22 A;  2B87 A;  2JO1 A;  2OYO A;  1VF5 B;  3AEG C;  2ZT9 C;  1KB9 H;  3CWB D;  3SFD C;  1GL2 A;  1RQU A;  3CC2 P;  2CPS A;  2N9Y B;  1VQ9 P;  2QIW A;  1NKN A;  2W27 A;  2WZ7 A;  1NGM B;  1GW3 A;  3H1I J;  5KLV J;  2QJP C;  2W6J H;  2W8Z A;  2ZXX A;  4M3L A;  1SQQ G;  1NU1 G;  2K88 A;  2WVR A;  1AQ5 A;  3CI9 A;  3QWO C;  2M8R A;  1VF5 C;  5B66 H;  1JB0 J;  2OYI A;  1HWT C;  1S5L E;  2KYV A;  3CC4 P;  4KT0 J;  1KIL D;  3AED C;  5APX A;  4QMA A;  1PFI A;  1DX7 A;  1NU1 J;  3A0H E;  1KZU B;  2IZ1 A;  3A2A A;  3E1R A;  1JM0 A;  4ZMD A;  3L70 E;  3CX5 H;  3L37 A;  3AE4 C;  1T6A A;  3ZDM A;  3CX5 D;  5KKZ B;  1NAY A;  4AYC A;  2N1T B;  2QJY B;  3JCU E;  1VQ7 P;  2BCC D;  3L74 E;  1YIT P;  3FXD A;  3JSV C;  1NTK D;  1KYO E;  2VRS A;  4C7N A;  5TIS H;  3SWY A;  1NTK G;  3TSI A;  3CD6 P;  5C39 A;  1VPC A;  1KQS O;  2OYH A;  4IFF A;  2HPC B;  1NYH A;  5CCH A;  1GD2 E;  2C0X A;  1URQ C;  2CK3 H;  2KS1 A;  3VN0 A;  2ZYG A;  4BXL A;  1HGZ A;  1JEK A;  2KZJ A;  3L70 J;  1Y9B A;  3CX5 I;  1AVY A;  1OW7 A;  4C7R A;  2BCC E;  1L0N G;  2YMK A;  3PJS K;  2I1J A;  3E7K A;  3CCS P;  2L5G B;  3L72 G;  2ZVO B;  3AE8 C;  1M7L A;  1FDO A;  3H1L J;  1RE3 A;  5EFW B;  2YKP A;  2OGU A;  4N6J A;  1T2K C;  1QL1 A;  1NHL A;  3KDP B;  1JTH A;  3P8M C;  1J2J B;  2FYU E;  1OWA A;  2I1K A;  3PLN A;  1L0L J;  1RQV A;  3I5C A;  5AVX B;  3B8E B;  3P32 A;  3VMA A;  3OW2 O;  1QLE D;  2XKM A;  3FWN A;  1SQX E;  2ZAE B;  2E74 B;  2V7Q H;  4R4L A;  3NTN A;  2WSC J;  3SWK A;  1L0L K;  1YYC A;  1PGJ A;  3CWB E;  3HTK B;  1X79 B;  2E75 B;  3EWK A;  4LGD E;  4PD4 H;  4UB6 E;  2JKV A;  1LTS C;  1HGV A;  4EDF A;  3V5B A;  1D7M A;  2FFD A;  2JJL A;  1JY2 P;  1IO4 A;  2GUS A;  2B89 A;  1SLQ A;  4KHX A;  3TNU B;  1M8O B;  3H1J D;  3MIW A;  3D6Z A;  3TYY A;  2WSF H;  1R8E A;  2WT7 A;  3H1I E;  1IZN B;  1S1C X;  1URQ B;  5E79 H;  3L4F A;  5KLV E;  4LLH A;  5AVY B;  1H88 A;  1GK4 A;  1SQV K;  3CXH I;  3BCC D;  4GDO A;  3Q5P A;  3H1K D;  2YO3 A;  2Z5H A;  2B88 A;  3C1L A;  1CSB A;  2UWJ E;  1BE3 G;  4H44 B;  4PD4 I;  4YXD C;  1WRG A;  3AEB C;  4JQ0 D;  1N7S C;  3II6 A;  4BRY B;  1PP9 J;  2KIK A;  3G3Z A;  2D2C C;  2Q3I A;  1BCC E;  3B71 A;  4RKU J;  1PGP A;  2O01 H;  1N8R Q;  2L91 A;  2JWD A;  1FZC C;  1DD3 A;  4OVN F;  2G8Y A;  2HG5 D;  1NH4 A;  1GZL A;  1WMK A;  4L74 A;  3G6E P;  1JUN A;  2NPS A;  2KXP B;  3I56 P;  3HE5 B;  2RMZ A;  2OYH C;  1GMJ A;  1N2D C;  2Q6Q A;  2YKO A;  1YBK A;  2B87 B;  2YKQ A;  3GW6 A;  4DZO A;  1P84 E;  1Q7Y Q;  4H0L D;  1USE A;  5AVZ B;  4IFM A;  5APV A;  3H1H G;  4L75 A;  1RE4 A;  4IL6 E;  3TGU E;  2E76 B;  1SQQ K;  1X0T A;  4HB1 A;  4N78 E;  3CCE P;  1SFC A;  2GUV A;  2BEQ D;  3MP7 B;  3CLQ A;  3L74 G;  2FYU K;  3H1L E;  3HE4 B;  2RN0 A;  1IFI A;  5CBN A;  1LTA C;  3L73 D;  1EZV E;  1VDF A;  2A45 G;  1VF5 D;  4JYC A;  2OYI B;  1NOH A;  4MN4 C;  1DD4 A;  1LTI C;  5KAF H;  1H89 A;  2E76 C;  2Q5U A;  2AXT H;  3UIA A;  5KAI E;  3N4X A;  5CJ0 A;  1VQO P;  5CCH D;  1PGO A;  1L4A D;  2JP3 A;  5BVZ A;  3P8C E;  2C9L Y;  1L2P A;  3L72 E;  3GHG A;  1LP1 B;  1YQ4 C;  2E5Y A;  4JBZ A;  1VQK P;  1SQX K;  4D6T G;  4EYY Q;  1NU1 K;  1QGK B;  4PJ0 H;  4HYT B;  1ZLL A;  1SQB E;  2KI7 B;  3L71 D;  3VP8 A;  2HPC A;  1MFZ A;  2KB7 P;  1U7J A;  3RL0 D;  2R5D A;  2QVA A;  2A06 D;  1ZRT E;  1FZG A;  2H89 C;  2IX7 C;  3V4W A;  5B5E E;  3CWB G;  2LXB A;  1MUU A;  1BDC A;  4R4M A;  1LTJ B;  1Q81 Q;  2FYZ A;  3JC2 2;  2H43 A;  1BSH A;  2FXM A;  1YJN P;  1BCC J;  1JTH B;  1BDD A;  1FZC A;  4N78 D;  5AVT B;  3ITK A;  3JCU H;  1ZRT D;  1GW4 A;  3VMX A;  1XTC C;  3AEF C;  1J1E C;  3M0A A;  4K35 A;  2QM7 A;  1SQB D;  1PPJ D;  2HFE D;  4NPD A;  3H1K J;  4DOJ A;  1QVF O;  1RF1 B;  4EI2 A;  3CPW O;  5AW9 B;  1SS1 A;  3B5N A;  3S9O A;  1IK9 A;  3D70 A;  1G2C A;  2WPR A;  3L71 G;  3U1A A;  1K73 Q;  1EXJ A;  1VQ6 P;  4IFD K;  2J59 M;  1KQF B;  3HD7 D;  3L75 G;  3S4R A;  1NTZ G;  1PIX A;  1T3J A;  2Z4E A;  2OTL P;  1E5W A;  1SFC C;  1OW8 A;  3HRN A;  1FS0 E;  2E5T A;  4PV1 D;  2KP8 A;  5KJ7 A;  4Y99 C;  2WMM A;  4EIJ A;  2IBZ D;  3FGA D;  1IFP A;  1OFC X;  2WSE H;  3V6I A;  1W2B O;  3N7N A;  2YIU B;  1PPJ G;  2XDJ A;  1KIL C;  2V4H A;  1NTZ J;  1Q90 D;  5APW A;  2M5A B;  5KAF E;  1W2E A;  5AVW B;  3L71 J;  4BRY A;  1Y8A A;  2W90 A;  3L74 D;  4D6T J;  3Q3D A;  4W7Y A;  3BCC G;  1VQN P;  3CCL P;  4BWN A;  3AEC C;  2P10 A;  1QEX A;  3MD0 A;  5APU A;  4U3F D;  1K9M Q;  3WUU A;  1OMI A;  2QG4 A;  1FZA A;  1SQP E;  5CCG A;  4I7Z C;  1ZW0 A;  2KUB A;  2IPP A;  3U1C A;  1EDL A;  1M1J A;  3A0H H;  2OQQ A;  3GMA A;  4YPC A;  3RK3 D;  1P84 H;  1VL2 A;  1WT6 A;  2E74 C;  1LWU C;  1P84 D;  2Z5I A;  3AE7 C;  3RGU A;  5AVR B;  1PP9 D;  1K8A Q;  1SQX D;  2A45 I;  2POH A;  4WY4 A;  3W68 A;  1MZ9 A;  2P1J A;  2HLO A;  1N86 A;  1KIL E;  2KZI A;  2QJK B;  3BRV B;  4H0L B;  5AW1 B;  3M91 A;  3G4S P;  1H0T A;  3LIE A;  3AE3 C;  3V2P A;  3T97 A;  1SFC B;  3V2Q A;  5AW0 B;  1JOC A;  2M3B A;  4C7N B;  3BCC J;  3CXH D;  3LW5 H;  4AQR D;  3MGN A;  4H44 D;  1LTB C;  2Q3E A;  3HUS C;  1LTG C;  2KS1 B;  2KNC B;  5KJ7 D;  2YIU C;  3TF5 A;  2WTY A;  1SFC D;  3V4Q A;  2JWA A;  1PP9 G;  1YTZ I;  2G3A A;  2AEF A;  3EFF K;  4U3F E;  1NVO A;  2P58 A;  2PRR A;  4Y28 J;  1USD A;  1ZOY C;  2O01 J;  3GHG B;  5KLI B;  1PL5 A;  3A7O A;  1OVV A;  1R5S A;  3D6Y A;  3H1J G;  4I2L C;  3VTP C;  4OGQ B;  1L0L D;  5H2F H;  2IFM A;  1KOR A;  1NKZ B;  2R5B A;  1JY2 O;  1N7S D;  1U57 A;  2XNX A;  3V2R A;  3AE9 C;  3F89 A;  3NFQ A;  3KHU A;  1S9K E;  1SQP K;  2WIT A;  3M0D C;  5B5E H;  4U3F J;  1HJ0 A;  2OAR A;  1JMB A;  3HTK A;  3CCU P;  3CC7 P;  2FYU D;  1NTM G;  1YJW P;  1TU3 F;  2FFD B;  2O1J A;  2N9B A;  4WY4 D;  5AW6 B;  1E79 H;  2WSF J;  2J58 A;  2MKV A;  2WPV B;  3FXE A;  1SQQ E;  2AEM A;  3C8V A;  3H1J J;  2ZYA A;  3TK1 A;  3L71 E;  2FBW C;  1J1E B;  2QJP B;  1LTJ A;  2WT7 B;  3WMM 0;  4WB4 A;  2FKW B;  4K3A A;  4W7Z A;  1HJB A;  5CCG D;  2PAJ A;  2C0W A;  2M3E A;  2WPQ A;  2WSE J;  2KSJ A;  1HUC A;  5K5G B;  1KQG B;  3GLM A;  2FFD C;  1N73 C;  1FZB A;  1KQL A;  5CCG C;  3I55 P;  4AUW A;  3U59 A;  2QEX P;  1HTL C;  1M1J C;  1IC2 A;  1W5C E;  2AXT E;  4UB8 H;  3A5T A;  3IFM A;  1L0L G;  4GKG A;  3W67 A;  2W83 C;  2W6A A;  2AEJ A;  1SQQ J;  2QE7 H;  5H2F E;  1IFN A;  3G71 P;  1RF1 A;  1FJP A;  3V2N A;  1X9V A;  2NRG A;  4WY4 C;  3LW5 J;  1GU5 A;  2IFN A;  1LTT C;  2O01 N;  4TT3 H;  3RK3 C;  1IFD A;  3CMA P;  1KYO D;  1LJ2 A;  1S4X A;  3PHL A;  4IL6 X;  2LR2 A;  3GF7 A;  5AVS B;  3S1K A;  2A06 E;  3H32 B;  1PV3 A;  3L70 D;  1JMM A;  2O3J A;  1CI6 B;  1LNQ A;  1DH3 A;  2J5U A;  1FE6 A;  1YHQ P;  1NU1 E;  1VQL P;  1KFM A;  1EZV I;  2IYP A;  3RK3 B;  1SQB K;  1QVG O;  2N1T D;  2KOG A;  2NPS C;  1HH0 A;  2C9N Y;  3CXH H;  4O9B A;  1A02 J;  1Q82 Q;  1LWU B;  3L74 J;  2FYU G;  4D6T D;  1HBW A;  2ZT9 B;  5GTH E;  1LT9 B;  2Y0D A;  2WSS H;  3RBX A;  1Y47 A;  3GF3 A;  4TLF A;  3H6P A;  1RF0 C;  1SQX G;  2XND H;  1M1J B;  1P84 I;  2PP6 A;  1EDI A;  3RK3 E;  1FOS E;  1PP9 E;  3L73 E;  1LGH B;  2D2C D;  4GOE A;  5TJH A;  5AW7 B;  1NTZ K;  4XA4 A;  1FZC B;  4WY4 B;  2WSC H;  1T3U A;  2V7Q J;  1LP1 A;  4XE5 B;  1Q2N A;  3L72 D;  1EC5 A;  1YQ3 C;  4GOD A;  2P67 A;  4DJG A;  2Y9Y A;  4HKZ H;  5APQ A;  4I7Z B;  2PFX A;  1K04 A;  5AW3 B;  5KLV G;  2Q1K A;  1X8Y A;  3H1I D;  2NPS D;  1EXI A;  4U7J A;  3H1J E;  1IFJ A;  1ZN5 A;  2BCC G;  3HD7 B;  3M9Q A;  2FXP A;  4Y99 B;  2FYU J;  2XV5 A;  2DW3 A;  1BE3 E;  5APS A;  4RJT A;  5KLI C;  3L73 J;  3GHG C;  3OA7 A;  4UB6 H;  3R4Y A;  1KB9 D;  3KYQ A;  3IF4 A;  4PD4 E;  1S3J A;  2ZVN B;  1R5L A;  3RK2 B;  2IBZ G;  1GL2 C;  1L4A A;  1OXZ A;  2K9Y A;  3CXH E;  3MUD A;  4H13 C;  5AVV B;  5CBO A;  1HF9 A;  3IAO A;  1BCC G;  1AQT A;  1RH5 B;  1NTZ D;  4YTP C;  3H25 A;  2ZFC A;  2JR8 A;  2BEZ F;  2K3R A;  1L0N K;  2XZR A;  1OIP A;  2HOD B;  3CCR P;  1VQP P;  1KTM A;  1DEB A;  3VMZ A;  1ZR4 A;  2IYO A;  3VOP A;  2ITA A;  1BE3 J;  2LKM A;  2Y0E A;  1J1D C;  3A0B E;  4OH8 B;  1NTM D;  2YXQ B;  3KPE A;  3M9B A;  4OGQ D;  4ASW A;  5APT A;  2BCC J;  4XFJ A;  2LXC B;  3M9H A;  1JY2 N;  1K05 A;  1Q86 Q;  4ZKU A;  2WQY C;  3O6Q B;  1OW6 A;  5KLV K;  2MJZ A;  4ASV A;  2SPZ A;  2OTK E;  3H1H E;  3BVH A;  4PV1 C;  3B5N B;  3H1I G;  2O1K A;  1CW5 A;  1GL2 D;  1G2C B;  1S2E A;  3WU2 H;  3WU2 E;  3RL0 B;  3H1L G;  1JY3 O;  5AW5 B;  3SSU A;  4A7P A;  4C46 A;  1KYO H;  1MKM A;  1SQV G;  2ZXE B;  3PP5 A;  2K9J B;  1JO5 A;  5CCH C;  5DJU B;  1SQX J;  2R32 A;  5GTI E;  1AA0 A;  2I8D A;  3B5N C;  2CPB A;  1SVF A;  2A06 G;  2N1T A;  3CX5 E;  1DEE G;  2M5A A;  2B9B A;  4ZKP A;  3Q5S A;  4L73 A;  1M57 D;  2GA1 A;  2QM8 A;  3L36 A;  2OYH B;  1BGY G;  1RE3 C;  1S72 P;  4PJ0 E;  5B66 E;  1KYO I;  1BGY D;  2HR3 A;  3TGU J;  1KD1 Q;  1OVR A;  4ZNC A;  1T8Z A;  2ZJS E;  3IN6 A;  1SQB G;  3E1I A;  1N73 A;  1VQ4 P;  1KIL A;  1ZME C;  3WUV A;  4OGQ C;  2XU6 A;  1FU1 A;  1FDI A;  3USS A;  5GTI H;  4GT1 A;  1FJK A;  3Q2Y A;  1ZR2 A;  1EDJ A;  1KMI Z;  1N7L A;  1Z56 A;  3QH9 A;  5KAI H;  1A02 F;  3H1K G;  4H13 D;  2YXR B;  3TGU G;  4EOT A;  1CI6 A;  1EDK A;  1S5L X;  1SP4 A;  3L73 G;  4L76 A;  1GDT A;  4YXW H;  1FAV A;  4WVZ A;  1H0T B;  1EZV G;  1L4A C;  1JCD A;  3CL3 D;  3MUD C;  3NXS A;  3T97 B;  3SWF A;  1EZV D;  3L72 J;  2ZT9 D;  3IR9 A;  5BU5 A;  1KN7 A;  3L75 J;  2Q7C A;  1LWU A;  3A3Y B;  4B86 A;  1M56 D;  2WWW A;  3BAT A;  2KNC A;  3GG2 A;  4N3Y B;  1SQB J;  4I1L A;  4JF7 A;  1PGQ A;  1YTZ T;  3G9R A;  5APY A;  2E76 D;  3AE2 C;  1KFN A;  1CZQ A;  1S5L H;  4JPZ B;  3TNU A;  2R3S A;  2KLV A;  4D6T E;  1N7S A;  1KV4 A;  2IBZ E;  1BCC D;  4NPF X;  2IDB A;  3HUS A;  5KTB A;  1IJD B;  1ZP0 C;  3H1H J;  3L75 D;  3L75 E;  1LT9 C;  1SQP J;  1NWQ A;  1NTM K;  1N73 B;  3FX0 A;  3B4S A;  1NU1 D; 
#chains in the Genus database with same CATH homology
 1AVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...