3FGAD

Structural basis of pp2a and sgo interaction
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
47
structure length
47
Chain Sequence
b'PSTLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein phosphatase 2A 65 kDa regulatory su
publication title Structure and function of the PP2A-shugoshin interaction
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/hydrolase inhibitor
total genus 22
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2008-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.730 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3fgaD00
1TU3F 3FGAD 1PL5A 1NYHA 1UIXA 1S1CX
chains in the Genus database with same CATH superfamily
1SQPK 4O9BA 3OW2O 5CHXA 1SQPG 1VF5C 5CCGA 3CC7P 2N9BA 2IBZE 3L72E 5CBOA 1SQQE 3TF5A 4JYBA 1L0NJ 1FZFA 1BCCE 3ITKA 2A45G 3OJAB 1YJWP 3CMAP 2BASA 4EIJA 1PP9E 2ZYGA 1N86A 3T97B 2OYIA 3BRTB 3Q5RA 1NTMD 3V4WA 2FY8A 2XDJA 2R44A 4JPZB 3CCVP 2M3BA 4H44D 3V6IA 2HFED 3AECC 3KZIH 1XTGB 5AVRB 3L35A 1J2JB 1SP4A 3BRVB 2IBZD 5APUA 3L72D 1SQQD 2B88A 2OQQA 5AVQB 2KYVA 1VQ8P 1BCCD 1D7MA 2ZAEB 2ZVNB 1HH0A 3EWKA 3HE5A 1PP9D 1FZCC 1CZQA 1HGZA 1JY3P 2H89C 2QJYC 1EDIA 1KILB 1OXZA 1DD4A 2DW3A 1K73Q 1QEXA 3H1HJ 1LT9B 1BDDA 1NH4A 1Q90D 1PL5A 3CXHH 2NZ2A 1Y9BA 1FJPA 3H1KG 1PGPA 4IL6H 3G6EP 2K88A 5APQA 5GTHE 1KYOH 4W7YA 1AQTA 1LP1A 5K5GB 2WTYA 3CCJP 2H7HA 3MIWA 4UB6H 2D2CC 1Q82Q 5AVYB 3AE2C 5BU8B 4IL6X 3CWBG 4WVZA 2Q5UA 1SFCD 4L73A 1SQVJ 1GL2B 2L91A 1JO5A 3Q3DA 3TK1A 2FYUJ 1GW4A 3D71A 3G9RA 3I56P 3B5NC 4AYCA 1NO4A 4TT3H 3S9OA 4PV1B 4ASVA 3RBXA 3AEFC 1M56D 3HTKA 1OWAA 2E74C 4IOIH 3SWFA 1M1KQ 5CCGD 1AA0A 4ZKUA 1GU4A 3HUSC 3RK3B 5AVSB 2KZJA 2KI7B 5DJUB 5CJ4A 1Q86Q 1HF9A 3RGUA 1FC2C 1G1IA 5TJHA 1VQ7P 1AVOA 2O1JA 4EYYQ 3F89A 1EZVG 3BASA 3H1LJ 3TGUE 1KQGB 1LTSC 3MHVA 1X9VA 1LGHB 2E76C 4I1LA 1FDMA 1FDIA 1PGQA 3RK2C 2JKVA 2QM7A 1SQBK 2Q7CA 5AW0B 1SQBG 1KV4A 1P84I 1AVYA 1NTKJ 1ZLLA 1P84E 2HODA 4Z1MH 1LT1A 1NTZJ 2ZFCA 2K9JA 1ZRTE 1U7MA 1JY2O 2YMYA 1L0LJ 3SSUA 3F5HA 5AW8B 2M5AB 4DT0A 4K3AA 4N3YB 1RE4C 1RF1A 2QJKB 2Y9ZA 2J59M 4OGQD 2OGUA 3M9QA 5AW7B 1P84D 2CK3H 1KN7A 1BE3G 1KC8Q 3H1JE 1ZRTD 2KLVA 4H44C 1YJ9P 4HJGH 3CPWO 3L73J 1FZEA 3IFMA 5GTHH 3Q1MA 1LTJC 2XNDH 3HD7A 2G8YA 1N7SA 1URQA 1L4AB 5C39A 3AE8C 2JP3A 1M1JB 1EZVI 3P32A 1PZQA 4WY4B 2E42A 2OYHA 1FZGA 2P7JA 3A2AA 3BCCG 3M06A 2W6JH 5CCHA 3WMM0 2O3JA 1R5SA 1WMKA 1Y47A 3GG2A 4C7NA 1OMIA 4RESB 3H1JD 5KLIB 3P8CE 4UB8E 1E79H 3CX5I 1K8AQ 4GT1A 2KK7A 3MUDC 3KQGA 3CX5E 1ZR2A 2Y9YA 2KP8A 2RMZA 2E5YA 1WRGA 3PHLA 2XKMA 3L36A 1L0NE 4IFMA 2WMMA 3T97A 1HTLC 1LWUB 2PRRA 2R5DA 2VRSA 1SQVK 1YQ3C 4OWFA 1SQVG 2E75D 1EXJA 1USEA 3M9HA 3P8CD 2FYUK 5APYA 3JSVC 2FYUG 3CX5D 1SFCC 2IYOA 1SLQA 1PGJA 3WUUA 1N2DC 2YKPA 1H8AA 1JY2P 4GOFA 2HYNA 3B71A 4DCKA 2O1KA 3KXDA 2QVAA 4I7ZB 1L0ND 1VF5B 2Y0CA 1PFIA 3L4FA 3Q2YA 3LIDA 3W67A 3A7OA 1RE3A 2HPCA 3GHGA 1IK9A 3H1KJ 3KHUA 3G4SP 3TNUB 1P84H 2IPPA 1KB9I 3AEBC 1LT9A 4ASWA 2KUBA 1WT6A 1EDKA 2WSCJ 3H1HE 1JEKA 2H43A 2OYIC 4JBZA 2GM4A 4H13B 1NKNA 3AE3C 3CWBJ 3H1LG 1JB0J 1A02F 2IX7C 3L70E 2Q3IA 2AEFA 2I1JA 3Q5PA 4W80A 1AV1A 3HD7D 4JF7A 3A0BH 2LR2A 4Y28J 1MZ9A 1N7SD 1URQD 3OA7A 5AVZB 1IJDB 1GL2A 2J58A 2C9NY 4PJ0E 2QJYB 1DX7A 1NTZK 2YKQA 5CCHD 3H1HD 1NTZG 1USDA 2WSEJ 3L74G 5KJ7A 1IZNB 1MFZA 1XTCC 3H25A 4H0LD 4NPDA 1BCCG 5CBNA 2YO3A 3L70D 2XU6A 2L5GB 2OTJP 5KLVK 2NPSA 1J1DB 5KLVG 1OW8A 1N7LA 5BU5A 2D2CB 3W68A 4WB4A 4UB8H 1DD3A 1KZUB 2C9LY 3FXEA 1FZAA 3CX5H 1JCDA 1IO4A 3IN6A 1RF0A 4OGQC 2V7QJ 3L73G 1MFTA 4PD4I 4RO0A 1ZV8A 3PLNA 1IFJA 2R3SA 1FOSF 3SWKA 5B5EH 4GOEA 3CCLP 1SQBJ 1OIPA 2K9YA 1NU1J 4JQ0D 4U3FE 5AW9B 3IAOA 3H1IJ 1BDCA 3CC2P 4R4MA 3HUSB 1FDOA 3O8ZA 1DH3A 1PPJE 5B66E 1X0TA 1CW5A 3V2RA 2P67A 1AJYA 1NTKE 3A3YB 3AE4C 1QL1A 4D6TG 3PP5A 2E5TA 1KQFB 2FFDC 5GTIE 2KB7P 2QIWA 3A0HE 4GODA 4IFFA 4U3FD 2JR8A 2OTLP 4N78E 5AVUB 1K04A 1BE3J 2M5AA 1L0LE 3U1CA 1HJBA 1PGOA 2IYPA 1LTGC 2E76B 3VMYA 1PPJD 2YIUC 3RK2B 2N1TA 4NPFX 3TYYA 1ZN5A 1RH5B 5KAFE 2E75C 1NTKD 1FZBA 1X8YA 3MZWB 1GTWA 1GL2D 2N9YB 3FWLA 3BCCJ 4GIFA 1CSBA 3MTUE 4HYTB 1GMJA 1M1JA 4N78D 5KJ7D 3NXSA 3QWOC 3L75E 1L0LD 1VQ4P 1GK4A 4PJ0H 1JTHB 3V5BA 2WITA 4HH2A 3LW5J 2NPSD 1SQPE 2IZ1A 1VL2A 2RN0A 3WUTA 3I55P 1KMIZ 2K37A 2WPVB 2A45I 1MUUA 4ZKPA 1CI6B 5KKZB 1G1JA 2CPBA 2O01H 5DJTB 1RF1C 1Z56A 2H8PD 5EFWB 3L71G 3AEAC 3L75D 3Q5SA 2KLUA 2WSFJ 1HJ0A 1SVFA 1LWUA 2OTKE 3RL0B 1N73C 1BSNA 3HD7C 1SQPD 1T3JA 1J1EC 1N7SC 1URQC 2YNYA 2JJLA 3IF4A 3O6QB 2OYHC 3C9IA 1U7JA 2POHA 5CCHC 3JC22 3UIAA 1FBMA 3QH9A 4WBAA 4BWNA 4H0LC 3VP9A 1VQOP 4A7PA 2RKLA 4ZMDA 3B4SA 1GU5A 3TNUA 2XNXA 5B66H 3C8VA 2KZIA 3VP8A 3M91A 3CD6P 1IK7A 3H1KE 1OVVA 1RQVA 1VPCA 1SFCB 5GTIH 4BRYB 3CCUP 2N1TD 3A0HH 1JMBA 1MKMA 4L76A 3CWBE 1NU1K 2B87B 3CL3D 2KNCB 1QVFO 2WSSH 1NU1G 2ZT9D 4AUWA 4BXLA 2Y0EA 3MP7B 3H1IG 3L74J 2BCCG 3AE7C 1UIXA 3G3ZA 3H1KD 5KAFH 2W90A 1Q2NA 4YXDC 3TGUD 2WPRA 4ZNCA 1BCCJ 4CPGA 1ZR4A 1G2CB 2QM8A 1RHZB 2H88C 5KLVJ 3KDPB 1RE3C 4AQRD 2WVRA 3GHGC 2J5UA 3CWBD 5AW1B 3A0BE 2OARA 1NJIQ 1BGYE 1W2EA 1LT9C 3RL0g 2M8RA 5E79E 1ZP0C 2B89A 4YTPC 3HE4B 3NFQA 2O01N 2Q1KA 2QA4P 2A45H 2G3AA 1EZVE 5KAIE 3AEDC 3VYIA 1NWQA 1YI2P 2HR3A 1GL2C 2LKMA 1BGYD 4RJTA 1JNMA 1S9KE 3M9BA 3VMZA 4U7JA 1SQBE 1DIPA 1KORA 3U59A 3D70A 1S2EA 4D6TJ 2A06G 3VOPA 3EFFK 1HGVA 2NPSC 1EZVD 1LP1B 5B5EE 4WWIA 1T2KD 2ZYDA 3L70G 1S9KD 2I1KA 1QGKB 3NTNA 1EC5A 1OX3A 1SQBD 3M0DA 4H13D 2AXTE 1RF0C 2WQYC 4N6JA 2W27A 1BE3E 3CCRP 1JY3N 1NGMB 1NYHA 2W8ZA 4DJGA 1QL2A 2FYNC 3S1KA 1EDJA 5APWA 3PTZA 5TISE 1M7LA 5H2FE 1FS0E 1LTAC 1IFNA 2WPSA 3BCCE 1KILA 5CCGC 2Y0DA 1T3UA 2WWWA 1SQXK 3FWNA 2FFDB 1SQXG 2Z5IA 1KB9E 1GDTA 1T8ZA 1BE3D 1M57D 1JUNA 1JTHA 1FAVA 2P58A 5AW4B 1RE4A 2FXMA 1H0TB 1Q7YQ 1YHQP 1PIXA 3VMXA 3L71J 3MGNA 2WSEH 3AE1C 4B86A 5AVXB 1S4XA 2ZXXA 2E75B 1L2PA 4KHXA 5AVTB 2WZ7A 1NTMK 2QJKC 3BCCD 1FZCB 1NTMG 4XFJA 4HB1A 1IFIA 4R4LA 4U3FG 2N1TC 3TDKA 2XZRA 5M1BA 1KB9D 3A5TA 3S4RA 5E79H 1SQVE 3II6A 3N7NA 3GLMA 3E1RA 2FYUE 1SQQK 1SS1A 2ZT9C 2IBZG 3L72G 1SQQG 2YKOA 3CXHI 1BSHA 2Q6QA 1M1JC 5CJ0A 3O6QA 3EQ2A 3BATA 5KAIH 1PP9G 1KYOI 2V7QH 5AVVB 3PJSK 2AXCA 1NKZB 3VN0A 1S5LE 3H32B 1HWTC 5AW2B 1JY3O 1FJKA 3PH0A 3SFEC 1RF1B 2HG5D 4EDFA 1SQVD 2KSJA 3RBZA 1VQPP 2FYUD 1DEBA 3USSA 2K3RA 3GW6A 1KILE 3B5NB 4PD4E 1JOCA 2QSIA 1N73B 1EDLA 1HBWA 1J1EB 1K05A 1VQKP 3H1LE 1LWUC 1FE6A 4KT0J 4Y99C 3RK2D 2PAJA 3CC4P 2E74B 3P7KA 2BCCJ 1KQLA 1S3JA 2B87A 2KNCA 2AXTH 2R5BA 2W83C 1PV3A 1YBKA 2GUSA 1QVGO 1KILD 4HKZH 2IBZI 4PD4D 1NTZE 1ZW0A 3L74E 4I7ZC 3G71P 2P10A 3TSIA 4GKGA 1A02J 1G2CA 5TISH 1H89A 5H2FH 1KD1Q 2GA1A 3H1LD 3BVHA 2YXQB 4EOTA 3WUVA 3PRJA 5KLVE 2R32A 1T2KC 2YXRB 1OVUA 2B9BA 2FXOA 3OAKA 4I2LC 3HRNA 1KB9H 4IFDK 5AW5B 3N4XA 2I8DA 3AEEC 3RK3E 1NTZD 2JWAA 3L74D 4H13C 3LW5H 1OW7A 3HE4A 1L4AA 3L73E 2KXPB 4WY4A 3RL0D 4MN4C 3R4YA 2AEMA 4PV1D 5KLVD 2QG4A 1W2BO 4LC1A 1LJ2A 1HVVA 2HPCB 3GHGB 3FXDA 2WSFH 1AFOA 3RK3D 1OFCX 2WPQA 4I6MC 1OW6A 1OVRA 2KSEA 3L73D 4H44B 3TGUG 2W6BA 3L70J 1J1DC 4D6TE 1LTJB 3E1IA 1YJNP 2KIKA 2QJPC 3CCQP 4RKUJ 2C0XA 1S5LH 2FYZA 1LTTC 2Q3EA 3D6ZA 1JY2N 1UIIA 4OVNF 1S5LX 1YYCA 3CCMP 4PD4H 4LLHA 1GK6A 2QE7H 5APTA 1VQ6P 4W7ZA 2O01J 4D6TD 1W5CE 2AEJA 4K35A 1N8RQ 3AEGC 3KPEA 2NPSB 1SQXJ 4M3LA 1MV8A 2UWJE 3CCSP 3R2PA 1K9MQ 1BGYG 1DEEG 2FFDA 3H1JG 3L37A 3CMEP 1NHLA 1ZMEC 2V4HA 1JMMA 3FGAD 2BEZF 3V2PA 3LIEA 2WT7B 2IFNA 1H0TA 1NVOA 1NTMJ 2R3CA 1IC2A 1R5LA 3P8MC 4U3FJ 1YITP 4DOJA 3M0DC 3L71E 2JDIH 2FYNB 1FZCA 2KS1B 1L4AD 3V4QA 1NOHA 4WY4D 3VMAA 3L72J 1SQQJ 2JEEA 1M90Q 3CCEP 4OH8B 1NAYA 1PP9J 2RH0A 2ZVOB 1VQ9P 1L0NK 1IFDA 1KILC 1L0NG 2M0BA 2OYIB 1KFNA 3SFDC 3D6YA 4L74A 3K5BA 4XA4A 3L71D 5CMZA 1HUCA 3GF7A 2GUVA 4L75A 1KTMA 1FU1A 2Q9IA 3H32A 3V2NA 2Z4EA 1IFMA 2W6AA 2P2UA 2N1TB 2ZJSE 3JCUE 5KKZC 5APXA 1GZLA 4C7RA 2FBWC 2PFXA 3HE5B 5AW6B 3B5NA 2ZT9B 1N73A 1GD2E 5AVWB 2QRXA 1OZHA 3L75J 1ZOYC 3V2QA 2HLOA 2CPSA 1GW3A 2FXPA 4YPCA 1NAFA 2ZXEB 5KJ7C 1NU1E 3RL0C 3C1LA 3MD0A 1VF5D 3ZDMA 3AE5C 3GF3A 4PV1C 3HUSA 1E5WA 2ITAA 1LTBC 3H1IE 1SQPJ 1LTIC 2BCCE 5BVZA 3AE6C 2PP6A 3H1HG 1JCCA 1T6AA 4OGQB 2YO2A 3RK3C 1ZXGA 2IFMA 3VTPC 3ABVC 3FX0A 5APVA 1VQ5P 4TLFA 3E7KA 3U1AA 1NU1D 5AW3B 2FKWB 2M3EA 4Y99B 3H1ID 4LGDE 3WU2E 2BCCD 1YTZI 3SWYA 1TU3F 1VDFA 1LNQA 2WSCH 3CI9A 3HTKB 2JO1A 1AQ5A 1QLED 5APSA 4EI2A 1Y8AA 4JYCA 5L8RJ 2QEXP 3KZIE 4GDOA 3B8EB 3TGUJ 2YIUB 2LXCB 2D2CD 2A06E 4KJMA 1CI6A 1R8EA 3M0AA 2ZYAA 2KOGA 3H6PA 1LTJA 2P1JA 4NPEA 2K1AA 1FOSE 2XV5A 4DZOA 3IR9A 3B5ND 1JM0A 1KQSO 1VQMP 2OYOA 1S72P 3EFGA 1EXIA 2HODB 1PPJG 2K9JB 2Z5HA 1L4AC 3CXHE 1NTKK 3JCUH 4WY4C 1NTKG 2A06D 4IL6E 2E74D 4QMAA 4XE5B 3MUDA 2IZ0A 1KYOE 1YIJP 2E43A 1Q81Q 2C0WA 2BEQD 1S1CX 2JWDA 4UB6E 1BGYJ 4C46A 5KLIC 1L0LK 1EQ7A 1VQNP 2MKVA 1L0LG 1QX8A 3H1JJ 1X79B 1VQLP 3I5CA 1YTZT 2MJZA 1SQXE 2QJPB 3CXHD 2LXBA 1YQ4C 4YXWH 3CLQA 2SPZA 3HD7B 1U57A 2YMKA 3AE9C 1N7SB 1URQB 3KYQA 1SFCA 1X22A 1KYOD 2E76D 1H88A 3NMDA 2WT7A 4BRYA 2NRGA 2OYHB 1KFMA 2PGDA 1RQUA 2IDBA 3GMAA 3L75G 5KTBA 1NTME 1RY3A 1IFPA 4C7NB 1M8OB 4H0LB 2KS1A 1SQXD 3WU2H
chains in the Genus database with same CATH topology
3AEBC 1GMJA 2V7QJ 3ABVC 1NGMB 1NYHA 1ZP0C 1WMKA 2E76C 1VF5C 2FYNC 1S5LX 1OMIA 1FDIA 1EXIA 4YTPC 2WSCJ 2D2CC 3SFDC 3C8VA 3D6YA 3SFEC 3AE2C 4IL6X 1IK7A 4H13B 3AE3C 3AEEC 3RK3E 2O01J 2G3AA 3GF7A 2K9YA 1RQVA 1JB0J 4H13C 1KTMA 2E74D 3AEDC 3T97B 3LW5J 1OW7A 4Z1MH 3AEGC 3Q5RA 3IAOA 3Q5PA 3Q3DA 1ZRTE 1TU3F 4R4MA 1VL2A 1KILE 2BEQD 1KMIZ 3D71A 1FDOA 1S1CX 3G9RA 2WPVB 2QSIA 4Y28J 1MKMA 4H44D 3AECC 3R4YA 2JO1A 4PV1D 5KLIC 4U7JA 1DIPA 1K05A 4TT3H 2MKVA 5KKZC 1AJYA 3S9OA 4PV1B 1KORA 2ZT9D 2FBWC 3AEFC 1YQ3C 4KT0J 3D70A 3AE4C 1PIXA 2E75D 2OQQA 3AEAC 1EXJA 1ZMEC 2ZT9B 3AE1C 3Q5SA 2WSEJ 2E74B 2WSFJ 2E75B 1KQFB 1HJ0A 1YQ4C 2BEZF 2E74C 3AE7C 3FGAD 1UIXA 3H25A 2QIWA 4H0LD 2QJKC 3EWKA 1ZOYC 5L8RJ 4OGQD 4YXDC 1OW6A 2FXPA 4GDOA 1PV3A 1U57A 1K04A 2YMKA 4XFJA 3AE9C 4H44B 4R4LA 3B71A 2E76D 1VF5D 5M1BA 4H44C 2H88C 3AE5C 3GF3A 2H89C 4PV1C 4I7ZB 2E76B 1VF5B 2QJYC 2D2CD 1HF9A 1OW8A 4I7ZC 2YIUC 2J5UA 3GLMA 1DD4A 2P10A 3Q1MA 3Q2YA 2ZT9C 2D2CB 1RQUA 3AE6C 1R8EA 2G8YA 2IDBA 2QJPC 3AE8C 2E75C 1DD3A 3GMAA 2JP3A 4H13D 4RKUJ 2WQYC 1Q90D 1PL5A 2NZ2A 1Y9BA 4H0LB 3O6QA 3RL0g 4OGQB 3D6ZA 3IN6A 4H0LC 1KQGB 4OGQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TU3 F;  3FGA D;  1PL5 A;  1NYH A;  1UIX A;  1S1C X; 
#chains in the Genus database with same CATH topology
 1SQP K;  4O9B A;  3OW2 O;  5CHX A;  1SQP G;  1VF5 C;  5CCG A;  3CC7 P;  2N9B A;  2IBZ E;  3L72 E;  5CBO A;  1SQQ E;  3TF5 A;  4JYB A;  1L0N J;  1FZF A;  1BCC E;  3ITK A;  2A45 G;  3OJA B;  1YJW P;  3CMA P;  2BAS A;  4EIJ A;  1PP9 E;  2ZYG A;  1N86 A;  3T97 B;  2OYI A;  3BRT B;  3Q5R A;  1NTM D;  3V4W A;  2FY8 A;  2XDJ A;  2R44 A;  4JPZ B;  3CCV P;  2M3B A;  4H44 D;  3V6I A;  2HFE D;  3AEC C;  3KZI H;  1XTG B;  5AVR B;  3L35 A;  1J2J B;  1SP4 A;  3BRV B;  2IBZ D;  5APU A;  3L72 D;  1SQQ D;  2B88 A;  2OQQ A;  5AVQ B;  2KYV A;  1VQ8 P;  1BCC D;  1D7M A;  2ZAE B;  2ZVN B;  1HH0 A;  3EWK A;  3HE5 A;  1PP9 D;  1FZC C;  1CZQ A;  1HGZ A;  1JY3 P;  2H89 C;  2QJY C;  1EDI A;  1KIL B;  1OXZ A;  1DD4 A;  2DW3 A;  1K73 Q;  1QEX A;  3H1H J;  1LT9 B;  1BDD A;  1NH4 A;  1Q90 D;  1PL5 A;  3CXH H;  2NZ2 A;  1Y9B A;  1FJP A;  3H1K G;  1PGP A;  4IL6 H;  3G6E P;  2K88 A;  5APQ A;  5GTH E;  1KYO H;  4W7Y A;  1AQT A;  1LP1 A;  5K5G B;  2WTY A;  3CCJ P;  2H7H A;  3MIW A;  4UB6 H;  2D2C C;  1Q82 Q;  5AVY B;  3AE2 C;  5BU8 B;  4IL6 X;  3CWB G;  4WVZ A;  2Q5U A;  1SFC D;  4L73 A;  1SQV J;  1GL2 B;  2L91 A;  1JO5 A;  3Q3D A;  3TK1 A;  2FYU J;  1GW4 A;  3D71 A;  3G9R A;  3I56 P;  3B5N C;  4AYC A;  1NO4 A;  4TT3 H;  3S9O A;  4PV1 B;  4ASV A;  3RBX A;  3AEF C;  1M56 D;  3HTK A;  1OWA A;  2E74 C;  4IOI H;  3SWF A;  1M1K Q;  5CCG D;  1AA0 A;  4ZKU A;  1GU4 A;  3HUS C;  3RK3 B;  5AVS B;  2KZJ A;  2KI7 B;  5DJU B;  5CJ4 A;  1Q86 Q;  1HF9 A;  3RGU A;  1FC2 C;  1G1I A;  5TJH A;  1VQ7 P;  1AVO A;  2O1J A;  4EYY Q;  3F89 A;  1EZV G;  3BAS A;  3H1L J;  3TGU E;  1KQG B;  1LTS C;  3MHV A;  1X9V A;  1LGH B;  2E76 C;  4I1L A;  1FDM A;  1FDI A;  1PGQ A;  3RK2 C;  2JKV A;  2QM7 A;  1SQB K;  2Q7C A;  5AW0 B;  1SQB G;  1KV4 A;  1P84 I;  1AVY A;  1NTK J;  1ZLL A;  1P84 E;  2HOD A;  4Z1M H;  1LT1 A;  1NTZ J;  2ZFC A;  2K9J A;  1ZRT E;  1U7M A;  1JY2 O;  2YMY A;  1L0L J;  3SSU A;  3F5H A;  5AW8 B;  2M5A B;  4DT0 A;  4K3A A;  4N3Y B;  1RE4 C;  1RF1 A;  2QJK B;  2Y9Z A;  2J59 M;  4OGQ D;  2OGU A;  3M9Q A;  5AW7 B;  1P84 D;  2CK3 H;  1KN7 A;  1BE3 G;  1KC8 Q;  3H1J E;  1ZRT D;  2KLV A;  4H44 C;  1YJ9 P;  4HJG H;  3CPW O;  3L73 J;  1FZE A;  3IFM A;  5GTH H;  3Q1M A;  1LTJ C;  2XND H;  3HD7 A;  2G8Y A;  1N7S A;  1URQ A;  1L4A B;  5C39 A;  3AE8 C;  2JP3 A;  1M1J B;  1EZV I;  3P32 A;  1PZQ A;  4WY4 B;  2E42 A;  2OYH A;  1FZG A;  2P7J A;  3A2A A;  3BCC G;  3M06 A;  2W6J H;  5CCH A;  3WMM 0;  2O3J A;  1R5S A;  1WMK A;  1Y47 A;  3GG2 A;  4C7N A;  1OMI A;  4RES B;  3H1J D;  5KLI B;  3P8C E;  4UB8 E;  1E79 H;  3CX5 I;  1K8A Q;  4GT1 A;  2KK7 A;  3MUD C;  3KQG A;  3CX5 E;  1ZR2 A;  2Y9Y A;  2KP8 A;  2RMZ A;  2E5Y A;  1WRG A;  3PHL A;  2XKM A;  3L36 A;  1L0N E;  4IFM A;  2WMM A;  3T97 A;  1HTL C;  1LWU B;  2PRR A;  2R5D A;  2VRS A;  1SQV K;  1YQ3 C;  4OWF A;  1SQV G;  2E75 D;  1EXJ A;  1USE A;  3M9H A;  3P8C D;  2FYU K;  5APY A;  3JSV C;  2FYU G;  3CX5 D;  1SFC C;  2IYO A;  1SLQ A;  1PGJ A;  3WUU A;  1N2D C;  2YKP A;  1H8A A;  1JY2 P;  4GOF A;  2HYN A;  3B71 A;  4DCK A;  2O1K A;  3KXD A;  2QVA A;  4I7Z B;  1L0N D;  1VF5 B;  2Y0C A;  1PFI A;  3L4F A;  3Q2Y A;  3LID A;  3W67 A;  3A7O A;  1RE3 A;  2HPC A;  3GHG A;  1IK9 A;  3H1K J;  3KHU A;  3G4S P;  3TNU B;  1P84 H;  2IPP A;  1KB9 I;  3AEB C;  1LT9 A;  4ASW A;  2KUB A;  1WT6 A;  1EDK A;  2WSC J;  3H1H E;  1JEK A;  2H43 A;  2OYI C;  4JBZ A;  2GM4 A;  4H13 B;  1NKN A;  3AE3 C;  3CWB J;  3H1L G;  1JB0 J;  1A02 F;  2IX7 C;  3L70 E;  2Q3I A;  2AEF A;  2I1J A;  3Q5P A;  4W80 A;  1AV1 A;  3HD7 D;  4JF7 A;  3A0B H;  2LR2 A;  4Y28 J;  1MZ9 A;  1N7S D;  1URQ D;  3OA7 A;  5AVZ B;  1IJD B;  1GL2 A;  2J58 A;  2C9N Y;  4PJ0 E;  2QJY B;  1DX7 A;  1NTZ K;  2YKQ A;  5CCH D;  3H1H D;  1NTZ G;  1USD A;  2WSE J;  3L74 G;  5KJ7 A;  1IZN B;  1MFZ A;  1XTC C;  3H25 A;  4H0L D;  4NPD A;  1BCC G;  5CBN A;  2YO3 A;  3L70 D;  2XU6 A;  2L5G B;  2OTJ P;  5KLV K;  2NPS A;  1J1D B;  5KLV G;  1OW8 A;  1N7L A;  5BU5 A;  2D2C B;  3W68 A;  4WB4 A;  4UB8 H;  1DD3 A;  1KZU B;  2C9L Y;  3FXE A;  1FZA A;  3CX5 H;  1JCD A;  1IO4 A;  3IN6 A;  1RF0 A;  4OGQ C;  2V7Q J;  3L73 G;  1MFT A;  4PD4 I;  4RO0 A;  1ZV8 A;  3PLN A;  1IFJ A;  2R3S A;  1FOS F;  3SWK A;  5B5E H;  4GOE A;  3CCL P;  1SQB J;  1OIP A;  2K9Y A;  1NU1 J;  4JQ0 D;  4U3F E;  5AW9 B;  3IAO A;  3H1I J;  1BDC A;  3CC2 P;  4R4M A;  3HUS B;  1FDO A;  3O8Z A;  1DH3 A;  1PPJ E;  5B66 E;  1X0T A;  1CW5 A;  3V2R A;  2P67 A;  1AJY A;  1NTK E;  3A3Y B;  3AE4 C;  1QL1 A;  4D6T G;  3PP5 A;  2E5T A;  1KQF B;  2FFD C;  5GTI E;  2KB7 P;  2QIW A;  3A0H E;  4GOD A;  4IFF A;  4U3F D;  2JR8 A;  2OTL P;  4N78 E;  5AVU B;  1K04 A;  1BE3 J;  2M5A A;  1L0L E;  3U1C A;  1HJB A;  1PGO A;  2IYP A;  1LTG C;  2E76 B;  3VMY A;  1PPJ D;  2YIU C;  3RK2 B;  2N1T A;  4NPF X;  3TYY A;  1ZN5 A;  1RH5 B;  5KAF E;  2E75 C;  1NTK D;  1FZB A;  1X8Y A;  3MZW B;  1GTW A;  1GL2 D;  2N9Y B;  3FWL A;  3BCC J;  4GIF A;  1CSB A;  3MTU E;  4HYT B;  1GMJ A;  1M1J A;  4N78 D;  5KJ7 D;  3NXS A;  3QWO C;  3L75 E;  1L0L D;  1VQ4 P;  1GK4 A;  4PJ0 H;  1JTH B;  3V5B A;  2WIT A;  4HH2 A;  3LW5 J;  2NPS D;  1SQP E;  2IZ1 A;  1VL2 A;  2RN0 A;  3WUT A;  3I55 P;  1KMI Z;  2K37 A;  2WPV B;  2A45 I;  1MUU A;  4ZKP A;  1CI6 B;  5KKZ B;  1G1J A;  2CPB A;  2O01 H;  5DJT B;  1RF1 C;  1Z56 A;  2H8P D;  5EFW B;  3L71 G;  3AEA C;  3L75 D;  3Q5S A;  2KLU A;  2WSF J;  1HJ0 A;  1SVF A;  1LWU A;  2OTK E;  3RL0 B;  1N73 C;  1BSN A;  3HD7 C;  1SQP D;  1T3J A;  1J1E C;  1N7S C;  1URQ C;  2YNY A;  2JJL A;  3IF4 A;  3O6Q B;  2OYH C;  3C9I A;  1U7J A;  2POH A;  5CCH C;  3JC2 2;  3UIA A;  1FBM A;  3QH9 A;  4WBA A;  4BWN A;  4H0L C;  3VP9 A;  1VQO P;  4A7P A;  2RKL A;  4ZMD A;  3B4S A;  1GU5 A;  3TNU A;  2XNX A;  5B66 H;  3C8V A;  2KZI A;  3VP8 A;  3M91 A;  3CD6 P;  1IK7 A;  3H1K E;  1OVV A;  1RQV A;  1VPC A;  1SFC B;  5GTI H;  4BRY B;  3CCU P;  2N1T D;  3A0H H;  1JMB A;  1MKM A;  4L76 A;  3CWB E;  1NU1 K;  2B87 B;  3CL3 D;  2KNC B;  1QVF O;  2WSS H;  1NU1 G;  2ZT9 D;  4AUW A;  4BXL A;  2Y0E A;  3MP7 B;  3H1I G;  3L74 J;  2BCC G;  3AE7 C;  1UIX A;  3G3Z A;  3H1K D;  5KAF H;  2W90 A;  1Q2N A;  4YXD C;  3TGU D;  2WPR A;  4ZNC A;  1BCC J;  4CPG A;  1ZR4 A;  1G2C B;  2QM8 A;  1RHZ B;  2H88 C;  5KLV J;  3KDP B;  1RE3 C;  4AQR D;  2WVR A;  3GHG C;  2J5U A;  3CWB D;  5AW1 B;  3A0B E;  2OAR A;  1NJI Q;  1BGY E;  1W2E A;  1LT9 C;  3RL0 g;  2M8R A;  5E79 E;  1ZP0 C;  2B89 A;  4YTP C;  3HE4 B;  3NFQ A;  2O01 N;  2Q1K A;  2QA4 P;  2A45 H;  2G3A A;  1EZV E;  5KAI E;  3AED C;  3VYI A;  1NWQ A;  1YI2 P;  2HR3 A;  1GL2 C;  2LKM A;  1BGY D;  4RJT A;  1JNM A;  1S9K E;  3M9B A;  3VMZ A;  4U7J A;  1SQB E;  1DIP A;  1KOR A;  3U59 A;  3D70 A;  1S2E A;  4D6T J;  2A06 G;  3VOP A;  3EFF K;  1HGV A;  2NPS C;  1EZV D;  1LP1 B;  5B5E E;  4WWI A;  1T2K D;  2ZYD A;  3L70 G;  1S9K D;  2I1K A;  1QGK B;  3NTN A;  1EC5 A;  1OX3 A;  1SQB D;  3M0D A;  4H13 D;  2AXT E;  1RF0 C;  2WQY C;  4N6J A;  2W27 A;  1BE3 E;  3CCR P;  1JY3 N;  1NGM B;  1NYH A;  2W8Z A;  4DJG A;  1QL2 A;  2FYN C;  3S1K A;  1EDJ A;  5APW A;  3PTZ A;  5TIS E;  1M7L A;  5H2F E;  1FS0 E;  1LTA C;  1IFN A;  2WPS A;  3BCC E;  1KIL A;  5CCG C;  2Y0D A;  1T3U A;  2WWW A;  1SQX K;  3FWN A;  2FFD B;  1SQX G;  2Z5I A;  1KB9 E;  1GDT A;  1T8Z A;  1BE3 D;  1M57 D;  1JUN A;  1JTH A;  1FAV A;  2P58 A;  5AW4 B;  1RE4 A;  2FXM A;  1H0T B;  1Q7Y Q;  1YHQ P;  1PIX A;  3VMX A;  3L71 J;  3MGN A;  2WSE H;  3AE1 C;  4B86 A;  5AVX B;  1S4X A;  2ZXX A;  2E75 B;  1L2P A;  4KHX A;  5AVT B;  2WZ7 A;  1NTM K;  2QJK C;  3BCC D;  1FZC B;  1NTM G;  4XFJ A;  4HB1 A;  1IFI A;  4R4L A;  4U3F G;  2N1T C;  3TDK A;  2XZR A;  5M1B A;  1KB9 D;  3A5T A;  3S4R A;  5E79 H;  1SQV E;  3II6 A;  3N7N A;  3GLM A;  3E1R A;  2FYU E;  1SQQ K;  1SS1 A;  2ZT9 C;  2IBZ G;  3L72 G;  1SQQ G;  2YKO A;  3CXH I;  1BSH A;  2Q6Q A;  1M1J C;  5CJ0 A;  3O6Q A;  3EQ2 A;  3BAT A;  5KAI H;  1PP9 G;  1KYO I;  2V7Q H;  5AVV B;  3PJS K;  2AXC A;  1NKZ B;  3VN0 A;  1S5L E;  3H32 B;  1HWT C;  5AW2 B;  1JY3 O;  1FJK A;  3PH0 A;  3SFE C;  1RF1 B;  2HG5 D;  4EDF A;  1SQV D;  2KSJ A;  3RBZ A;  1VQP P;  2FYU D;  1DEB A;  3USS A;  2K3R A;  3GW6 A;  1KIL E;  3B5N B;  4PD4 E;  1JOC A;  2QSI A;  1N73 B;  1EDL A;  1HBW A;  1J1E B;  1K05 A;  1VQK P;  3H1L E;  1LWU C;  1FE6 A;  4KT0 J;  4Y99 C;  3RK2 D;  2PAJ A;  3CC4 P;  2E74 B;  3P7K A;  2BCC J;  1KQL A;  1S3J A;  2B87 A;  2KNC A;  2AXT H;  2R5B A;  2W83 C;  1PV3 A;  1YBK A;  2GUS A;  1QVG O;  1KIL D;  4HKZ H;  2IBZ I;  4PD4 D;  1NTZ E;  1ZW0 A;  3L74 E;  4I7Z C;  3G71 P;  2P10 A;  3TSI A;  4GKG A;  1A02 J;  1G2C A;  5TIS H;  1H89 A;  5H2F H;  1KD1 Q;  2GA1 A;  3H1L D;  3BVH A;  2YXQ B;  4EOT A;  3WUV A;  3PRJ A;  5KLV E;  2R32 A;  1T2K C;  2YXR B;  1OVU A;  2B9B A;  2FXO A;  3OAK A;  4I2L C;  3HRN A;  1KB9 H;  4IFD K;  5AW5 B;  3N4X A;  2I8D A;  3AEE C;  3RK3 E;  1NTZ D;  2JWA A;  3L74 D;  4H13 C;  3LW5 H;  1OW7 A;  3HE4 A;  1L4A A;  3L73 E;  2KXP B;  4WY4 A;  3RL0 D;  4MN4 C;  3R4Y A;  2AEM A;  4PV1 D;  5KLV D;  2QG4 A;  1W2B O;  4LC1 A;  1LJ2 A;  1HVV A;  2HPC B;  3GHG B;  3FXD A;  2WSF H;  1AFO A;  3RK3 D;  1OFC X;  2WPQ A;  4I6M C;  1OW6 A;  1OVR A;  2KSE A;  3L73 D;  4H44 B;  3TGU G;  2W6B A;  3L70 J;  1J1D C;  4D6T E;  1LTJ B;  3E1I A;  1YJN P;  2KIK A;  2QJP C;  3CCQ P;  4RKU J;  2C0X A;  1S5L H;  2FYZ A;  1LTT C;  2Q3E A;  3D6Z A;  1JY2 N;  1UII A;  4OVN F;  1S5L X;  1YYC A;  3CCM P;  4PD4 H;  4LLH A;  1GK6 A;  2QE7 H;  5APT A;  1VQ6 P;  4W7Z A;  2O01 J;  4D6T D;  1W5C E;  2AEJ A;  4K35 A;  1N8R Q;  3AEG C;  3KPE A;  2NPS B;  1SQX J;  4M3L A;  1MV8 A;  2UWJ E;  3CCS P;  3R2P A;  1K9M Q;  1BGY G;  1DEE G;  2FFD A;  3H1J G;  3L37 A;  3CME P;  1NHL A;  1ZME C;  2V4H A;  1JMM A;  3FGA D;  2BEZ F;  3V2P A;  3LIE A;  2WT7 B;  2IFN A;  1H0T A;  1NVO A;  1NTM J;  2R3C A;  1IC2 A;  1R5L A;  3P8M C;  4U3F J;  1YIT P;  4DOJ A;  3M0D C;  3L71 E;  2JDI H;  2FYN B;  1FZC A;  2KS1 B;  1L4A D;  3V4Q A;  1NOH A;  4WY4 D;  3VMA A;  3L72 J;  1SQQ J;  2JEE A;  1M90 Q;  3CCE P;  4OH8 B;  1NAY A;  1PP9 J;  2RH0 A;  2ZVO B;  1VQ9 P;  1L0N K;  1IFD A;  1KIL C;  1L0N G;  2M0B A;  2OYI B;  1KFN A;  3SFD C;  3D6Y A;  4L74 A;  3K5B A;  4XA4 A;  3L71 D;  5CMZ A;  1HUC A;  3GF7 A;  2GUV A;  4L75 A;  1KTM A;  1FU1 A;  2Q9I A;  3H32 A;  3V2N A;  2Z4E A;  1IFM A;  2W6A A;  2P2U A;  2N1T B;  2ZJS E;  3JCU E;  5KKZ C;  5APX A;  1GZL A;  4C7R A;  2FBW C;  2PFX A;  3HE5 B;  5AW6 B;  3B5N A;  2ZT9 B;  1N73 A;  1GD2 E;  5AVW B;  2QRX A;  1OZH A;  3L75 J;  1ZOY C;  3V2Q A;  2HLO A;  2CPS A;  1GW3 A;  2FXP A;  4YPC A;  1NAF A;  2ZXE B;  5KJ7 C;  1NU1 E;  3RL0 C;  3C1L A;  3MD0 A;  1VF5 D;  3ZDM A;  3AE5 C;  3GF3 A;  4PV1 C;  3HUS A;  1E5W A;  2ITA A;  1LTB C;  3H1I E;  1SQP J;  1LTI C;  2BCC E;  5BVZ A;  3AE6 C;  2PP6 A;  3H1H G;  1JCC A;  1T6A A;  4OGQ B;  2YO2 A;  3RK3 C;  1ZXG A;  2IFM A;  3VTP C;  3ABV C;  3FX0 A;  5APV A;  1VQ5 P;  4TLF A;  3E7K A;  3U1A A;  1NU1 D;  5AW3 B;  2FKW B;  2M3E A;  4Y99 B;  3H1I D;  4LGD E;  3WU2 E;  2BCC D;  1YTZ I;  3SWY A;  1TU3 F;  1VDF A;  1LNQ A;  2WSC H;  3CI9 A;  3HTK B;  2JO1 A;  1AQ5 A;  1QLE D;  5APS A;  4EI2 A;  1Y8A A;  4JYC A;  5L8R J;  2QEX P;  3KZI E;  4GDO A;  3B8E B;  3TGU J;  2YIU B;  2LXC B;  2D2C D;  2A06 E;  4KJM A;  1CI6 A;  1R8E A;  3M0A A;  2ZYA A;  2KOG A;  3H6P A;  1LTJ A;  2P1J A;  4NPE A;  2K1A A;  1FOS E;  2XV5 A;  4DZO A;  3IR9 A;  3B5N D;  1JM0 A;  1KQS O;  1VQM P;  2OYO A;  1S72 P;  3EFG A;  1EXI A;  2HOD B;  1PPJ G;  2K9J B;  2Z5H A;  1L4A C;  3CXH E;  1NTK K;  3JCU H;  4WY4 C;  1NTK G;  2A06 D;  4IL6 E;  2E74 D;  4QMA A;  4XE5 B;  3MUD A;  2IZ0 A;  1KYO E;  1YIJ P;  2E43 A;  1Q81 Q;  2C0W A;  2BEQ D;  1S1C X;  2JWD A;  4UB6 E;  1BGY J;  4C46 A;  5KLI C;  1L0L K;  1EQ7 A;  1VQN P;  2MKV A;  1L0L G;  1QX8 A;  3H1J J;  1X79 B;  1VQL P;  3I5C A;  1YTZ T;  2MJZ A;  1SQX E;  2QJP B;  3CXH D;  2LXB A;  1YQ4 C;  4YXW H;  3CLQ A;  2SPZ A;  3HD7 B;  1U57 A;  2YMK A;  3AE9 C;  1N7S B;  1URQ B;  3KYQ A;  1SFC A;  1X22 A;  1KYO D;  2E76 D;  1H88 A;  3NMD A;  2WT7 A;  4BRY A;  2NRG A;  2OYH B;  1KFM A;  2PGD A;  1RQU A;  2IDB A;  3GMA A;  3L75 G;  5KTB A;  1NTM E;  1RY3 A;  1IFP A;  4C7N B;  1M8O B;  4H0L B;  2KS1 A;  1SQX D;  3WU2 H; 
#chains in the Genus database with same CATH homology
 3AEB C;  1GMJ A;  2V7Q J;  3ABV C;  1NGM B;  1NYH A;  1ZP0 C;  1WMK A;  2E76 C;  1VF5 C;  2FYN C;  1S5L X;  1OMI A;  1FDI A;  1EXI A;  4YTP C;  2WSC J;  2D2C C;  3SFD C;  3C8V A;  3D6Y A;  3SFE C;  3AE2 C;  4IL6 X;  1IK7 A;  4H13 B;  3AE3 C;  3AEE C;  3RK3 E;  2O01 J;  2G3A A;  3GF7 A;  2K9Y A;  1RQV A;  1JB0 J;  4H13 C;  1KTM A;  2E74 D;  3AED C;  3T97 B;  3LW5 J;  1OW7 A;  4Z1M H;  3AEG C;  3Q5R A;  3IAO A;  3Q5P A;  3Q3D A;  1ZRT E;  1TU3 F;  4R4M A;  1VL2 A;  1KIL E;  2BEQ D;  1KMI Z;  3D71 A;  1FDO A;  1S1C X;  3G9R A;  2WPV B;  2QSI A;  4Y28 J;  1MKM A;  4H44 D;  3AEC C;  3R4Y A;  2JO1 A;  4PV1 D;  5KLI C;  4U7J A;  1DIP A;  1K05 A;  4TT3 H;  2MKV A;  5KKZ C;  1AJY A;  3S9O A;  4PV1 B;  1KOR A;  2ZT9 D;  2FBW C;  3AEF C;  1YQ3 C;  4KT0 J;  3D70 A;  3AE4 C;  1PIX A;  2E75 D;  2OQQ A;  3AEA C;  1EXJ A;  1ZME C;  2ZT9 B;  3AE1 C;  3Q5S A;  2WSE J;  2E74 B;  2WSF J;  2E75 B;  1KQF B;  1HJ0 A;  1YQ4 C;  2BEZ F;  2E74 C;  3AE7 C;  3FGA D;  1UIX A;  3H25 A;  2QIW A;  4H0L D;  2QJK C;  3EWK A;  1ZOY C;  5L8R J;  4OGQ D;  4YXD C;  1OW6 A;  2FXP A;  4GDO A;  1PV3 A;  1U57 A;  1K04 A;  2YMK A;  4XFJ A;  3AE9 C;  4H44 B;  4R4L A;  3B71 A;  2E76 D;  1VF5 D;  5M1B A;  4H44 C;  2H88 C;  3AE5 C;  3GF3 A;  2H89 C;  4PV1 C;  4I7Z B;  2E76 B;  1VF5 B;  2QJY C;  2D2C D;  1HF9 A;  1OW8 A;  4I7Z C;  2YIU C;  2J5U A;  3GLM A;  1DD4 A;  2P10 A;  3Q1M A;  3Q2Y A;  2ZT9 C;  2D2C B;  1RQU A;  3AE6 C;  1R8E A;  2G8Y A;  2IDB A;  2QJP C;  3AE8 C;  2E75 C;  1DD3 A;  3GMA A;  2JP3 A;  4H13 D;  4RKU J;  2WQY C;  1Q90 D;  1PL5 A;  2NZ2 A;  1Y9B A;  4H0L B;  3O6Q A;  3RL0 g;  4OGQ B;  3D6Z A;  3IN6 A;  4H0L C;  1KQG B;  4OGQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...