3FGAD

Structural basis of pp2a and sgo interaction
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
47
structure length
47
Chain Sequence
PSTLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine/threonine-protein phosphatase 2A 65 kDa regulatory su
publication title Structure and function of the PP2A-shugoshin interaction
pubmed doi rcsb
source organism Mus musculus
total genus 22
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2008-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.730 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3fgaD00
1TU3F 1S1CX 3FGAD 1UIXA 1NYHA 1PL5A
chains in the Genus database with same CATH superfamily
1KILB 2O3JA 1ZW0A 5KKZB 2FKWB 1J1DB 1URQB 3AEAC 3V4WA 3L70G 5K5GB 3CX5D 2H8PD 2D2CD 3Q5PA 3RK2C 2XU6A 2HPCA 2HG5D 1VF5B 2E76D 3BCCE 3HD7A 1SFCD 1VQMP 1JEKA 4XA4A 1K05A 2YXQB 3CXHH 2KSJA 1PGOA 2AEFA 3L74G 3E7KA 3FGAD 3ABVC 3L71E 1MV8A 2R3SA 3L74D 2DW3A 1L0LE 1NU1D 1N8RQ 4PV1C 5L8RJ 4WY4C 3FXEA 1SLQA 3I5CA 2QM8A 3R4YA 2L91A 4HYTB 4RESB 1USDA 2P7JA 2Z5IA 1HGZA 3GF7A 4DZOA 1T3UA 3PH0A 2B89A 1JTHA 5GTHE 3H1JE 2FYNB 2PAJA 3CWBE 1GMJA 1HF9A 1HJ0A 2IX7C 1ZRTE 3P8MC 3TYYA 3C9IA 1SQQK 4KJMA 3FWNA 1M56D 4YPCA 1N73C 3N7NA 1KILA 4DOJA 4HH2A 2ZVOB 3C8VA 1URQA 1N7SB 4IFDK 1AFOA 4IL6H 2WWWA 2I1KA 2Y0DA 2FYUG 5E79H 2GUSA 2WSEJ 2RN0A 2QJKB 5AVWB 2OARA 1EZVE 2FFDC 3A0BE 1VQOP 2FYUD 3VMAA 2OYHC 1M57D 3RL0g 2YIUB 1L0ND 3L73J 2R3CA 1EXJA 1K9MQ 2QJYC 3RK2D 3JCUH 3CCEP 1BDDA 3VTPC 1LT1A 1PFIA 3GF3A 4BWNA 1G1IA 1IFMA 4PJ0E 1BCCE 1SQXJ 3L75E 1MFZA 3HUSB 1PZQA 1FZAA 1K04A 1LTIC 1RF1B 2M3BA 3AE5C 4DJGA 5CJ4A 1LWUB 2D2CB 3CCSP 3MD0A 3IN6A 3U1CA 2HFED 1EDLA 3W67A 2E76B 2H43A 3U1AA 1OX3A 1SQBK 1QVGO 1SFCB 2AXTE 1FOSE 4PV1D 4WY4D 2FXMA 3KYQA 3AEBC 1JUNA 3USSA 1DD3A 1MZ9A 1RY3A 1NHLA 3Q2YA 2FXPA 2KXPB 3VN0A 3RK3C 1N7SA 5AW4B 1IFPA 1NYHA 1VQ7P 1QLED 1SQQE 1KFNA 5AVYB 4WB4A 5APSA 5CMZA 1YJ9P 1G2CB 5KLIB 1KQFB 4ZMDA 1S9KD 4GIFA 2WT7A 1KQSO 1P84D 3CCQP 5AVQB 2E5YA 3G6EP 2J5UA 5KTBA 4GOFA 1HUCA 2AEJA 4H0LC 1KQLA 3KXDA 5CHXA 3KDPB 3H1KJ 1BSHA 5CBOA 3L73G 1AQ5A 3HUSA 1RF1A 1HJBA 1CI6B 3L73D 1HTLC 1LWUA 1Q82Q 2XNXA 3V6IA 1SQXG 3PP5A 1VQ8P 3B8EB 4BXLA 4TT3H 1SQXD 1SFCA 4N78E 1JMBA 4OH8B 4Y28J 2YKOA 1RE3A 1VQLP 1KB9I 2L5GB 4ZNCA 3RK2B 1SQBE 5M1BA 1Q90D 4D6TG 1KB9E 2IDBA 4JQ0D 5GTIH 3D71A 2IPPA 3AE3C 2POHA 2QIWA 4D6TD 1KB9H 1PP9J 1G1JA 4XFJA 5AVTB 1NTKK 5TJHA 3P7KA 1G2CA 2JR8A 3G71P 2BCCJ 3H1IE 3RK3D 2AEMA 5TISE 1Y9BA 3F5HA 2PRRA 2M5AB 5TISH 4OGQC 2GA1A 2C0XA 1SQPG 1ZR4A 1QL2A 4PV1B 3B5NC 4WY4B 2I1JA 3R2PA 1JCCA 1FZFA 1VQNP 1P84I 1SQPD 3KZIE 4PD4D 3PTZA 1CI6A 4HB1A 2FY8A 1P84H 1RQVA 1OWAA 2M8RA 3TDKA 3A2AA 3H1KG 1BGYE 2JEEA 4H0LD 3H1LJ 3WU2E 4AQRD 3A5TA 1Q7YQ 2A06G 1N73B 2LKMA 4Z1MH 3NXSA 2WSEH 5KLVJ 2A06D 2HPCB 5AW1B 1NU1J 1ZXGA 5C39A 2N1TC 1IFNA 4A7PA 2NPSC 2QM7A 2P10A 3BASA 1IO4A 1PL5A 2FFDB 5APVA 5AW7B 2OYHB 5BVZA 3G3ZA 2JP3A 2O1KA 2JO1A 2K37A 1AV1A 1OVVA 5APTA 2OTLP 2QEXP 2QJYB 1HVVA 3M9QA 1VL2A 1YBKA 5AVSB 3VP9A 1PP9G 2M5AA 1FDOA 1NJIQ 1YI2P 1NTKE 3WMM0 4WY4A 4NPEA 4QMAA 3IFMA 2BCCG 3B4SA 1EDJA 2KNCB 1KILE 4ZKPA 1ZRTD 3PHLA 1X0TA 1VQPP 3EFGA 3FX0A 2WSSH 3HE5B 3G9RA 1S72P 2P67A 5AVXB 3AEFC 4C46A 4ZKUA 1S2EA 4AYCA 4OGQD 5BU5A 1NKZB 5AW2B 1VPCA 3B5ND 4IOIH 3GHGC 3P8CD 4U3FJ 1L0NJ 4H13C 1GTWA 1N73A 3PRJA 1LJ2A 1FZGA 3RK3B 3O6QB 2WSCJ 3CXHI 1GU4A 2OQQA 2OGUA 2Y9YA 1L2PA 1YITP 3H1LG 4GT1A 4PD4H 3CXHE 1ZN5A 2P2UA 3H1LD 3RBZA 1M90Q 2P1JA 2GUVA 3CCRP 2WPVB 5KLVG 2Y0EA 2K3RA 2FFDA 2ZXXA 2G3AA 3QH9A 2OYHA 1NTMJ 3CL3D 1NU1G 5KLVD 4N3YB 1K8AQ 1QEXA 3MP7B 2RH0A 1VQKP 2N1TD 1KYOD 3L4FA 2KI7B 2ZYAA 2NPSD 1A02F 4L73A 1PPJG 1NU1K 4H0LB 2MJZA 3WUUA 2W8ZA 1PPJD 1SQVJ 1USEA 3IAOA 1JY3P 2KNCA 1JY2P 1W2BO 1FZEA 1N7LA 1AA0A 1BE3J 1LTGC 3HE5A 4L76A 3Q1MA 3TGUE 1Y8AA 1FC2C 1X8YA 5DJTB 3U59A 2H88C 2A45G 3AE1C 3H1HE 2Z5HA 5H2FH 3QWOC 2ZYDA 1J2JB 4U7JA 4DT0A 3AE9C 2YXRB 3RBXA 1FZCA 3A3YB 4IL6E 3CLQA 2IYOA 4LGDE 1LTJC 2YKQA 2E43A 5E79E 3O6QA 1LNQA 1AJYA 4U3FG 2E75C 4I2LC 2KUBA 1L0NG 3TK1A 3V2QA 1Y47A 5APYA 2WT7B 4U3FD 4KT0J 3CX5I 1QGKB 4H13D 3D70A 3JCUE 2HYNA 4H44C 2FYUK 1JNMA 3AECC 2H89C 2QSIA 1L0NK 3L70E 3CX5H 4IL6X 3JC22 1GL2A 2K9JA 4WWIA 4EYYQ 3VMYA 4OGQB 3B5NB 2YKPA 1NTMG 1SVFA 1YIJP 2KOGA 2KS1B 1NTMD 3CMEP 3CCUP 5DJUB 3L74E 3WUVA 2PP6A 1NTZJ 1IFDA 1DEBA 4D6TJ 2RKLA 4LLHA 1SQVG 1FZCC 1OW7A 1KYOH 1SQVD 1LTAC 1S3JA 1BE3G 1H0TB 1JY3O 4B86A 1JY2O 3RL0C 1E5WA 2OYOA 1M1JC 3NFQA 1BE3D 2KB7P 3M0AA 2N1TB 1M7LA 2NPSB 5B66H 1U57A 2A45I 3MUDA 2RMZA 4JYBA 1SQPJ 4YXDC 1GW4A 1IFJA 1IC2A 1GK4A 5CCHA 2HODA 1YTZI 1KORA 2A45H 1GL2C 1T3JA 4HJGH 3SWYA 3EWKA 1JOCA 1J1EC 4JYCA 2E75D 3CPWO 3B5NA 2FYUE 1RE4A 1W2EA 4UB8H 1KC8Q 2KLVA 3VMXA 2PGDA 4H44D 5KAFH 1FDIA 1L4AC 2QG4A 3BATA 2KS1A 1WMKA 3V2RA 3VMZA 3W68A 2IBZG 5APXA 3L71J 1U7MA 3CCJP 2E5TA 2B87A 1H88A 2IBZD 2SPZA 1T2KC 2P58A 1L0LJ 2KYVA 4XE5B 2WSCH 3AEEC 1QVFO 3GHGB 1SQXK 2OYIC 4H13B 5AVVB 1R5SA 3TNUB 3L36A 4GOEA 4UB6H 3C1LA 3Q5SA 5APQA 1H0TA 1NTZG 5GTIE 1AVOA 3T97A 1OVUA 2KP8A 2J59M 3D6YA 2Z4EA 1U7JA 2N1TA 3MUDC 1NTZD 1JMMA 3H1JJ 1OIPA 2NPSA 3N4XA 5CCHC 3L72G 1QL1A 2CK3H 1Q81Q 3RL0D 1VQ4P 2WZ7A 2ZFCA 3TSIA 2R32A 1WT6A 5KAIH 1M1KQ 3CMAP 3L72D 2ZJSE 2JDIH 4CPGA 1M8OB 1FAVA 3ZDMA 1EC5A 3I56P 2JKVA 1RE4C 3KHUA 1H89A 1GU5A 4IFFA 3RGUA 1S9KE 1IK9A 5CJ0A 1FBMA 1P84E 2PFXA 3F89A 1SQPK 1GL2D 3MGNA 1FS0E 3VOPA 5APWA 1MKMA 1YTZT 1NAYA 2GM4A 1Z56A 1BDCA 3BCCG 4N6JA 2W6AA 1QX8A 3TF5A 3BCCD 4EDFA 1LT9C 1XTCC 3GHGA 3L75J 2VRSA 1ZLLA 1L4AD 1TU3F 4W7YA 3TNUA 3V2PA 4DCKA 3L73E 4K35A 3L71G 1LTJB 3FWLA 5AVZB 2Q7CA 1WRGA 1JB0J 1L0LG 3L71D 1T2KD 2E75B 3M06A 1FDMA 2LXCB 1A02J 1L0LD 1SQXE 2QJPC 3AE8C 1JM0A 1KQGB 1LGHB 5B5EH 1LP1B 1S5LH 4H44B 1MUUA 2Q3IA 1GK6A 4I7ZC 2M3EA 3H1JG 2B9BA 2Y9ZA 1YHQP 3CWBG 2NRGA 2V4HA 3H1JD 1SQQJ 3CWBD 4D6TE 5CCHD 1N86A 2JJLA 3B71A 4LC1A 4YTPC 3AE4C 3II6A 1D7MA 2Q1KA 3P32A 3RK3E 4K3AA 2QRXA 3GW6A 3OW2O 3GG2A 4EOTA 3A7OA 4GKGA 1DH3A 1PGPA 4KHXA 1RH5B 2E42A 1VQ9P 3MIWA 1R5LA 1PGJA 1FZCB 3BRTB 5AW9B 1EZVG 1EDIA 1SQPE 2FXOA 4PD4I 3MHVA 3HTKA 3KPEA 2Y0CA 2WPSA 1HH0A 1NKNA 3RL0B 1EZVD 2O1JA 4PD4E 1M1JB 1RF0A 3L35A 3A0HH 2M0BA 1Q86Q 1LTJA 4O9BA 4RO0A 3CC4P 3SSUA 1BCCG 3L75G 3L70D 2B88A 1MFTA 3H1KE 3JSVC 2KK7A 1BCCD 3L75D 1DX7A 4EIJA 1LP1A 2A06E 1GL2B 1JO5A 2IYPA 1NGMB 2K9JB 2C0WA 2WITA 5KLVK 2FBWC 1J1EB 3EFFK 2YMYA 2BEZF 2W90A 1YQ4C 2AXCA 2W6BA 2ZVNB 1SQBJ 1RHZB 2BASA 4JBZA 1FOSF 3MTUE 2Q9IA 3CC7P 2BEQD 3CCVP 2WVRA 2YO3A 4GODA 1L4AB 3FXDA 1OFCX 2O01J 3IR9A 3UIAA 5AW6B 5H2FE 1UIXA 3SWFA 1YJWP 1EDKA 3H1IJ 1SQQG 1DIPA 1ZR2A 2IFMA 1ZOYC 2KLUA 3M0DC 1SQQD 1W5CE 3CC2P 4Y99C 1PP9E 3OA7A 3CCLP 5GTHH 2OYIB 2JWAA 2K88A 3M91A 5BU8B 4BRYB 4I1LA 2C9NY 2KIKA 1RF0C 1Q2NA 1BSNA 3PLNA 2Q6QA 2BCCE 2O01N 4NPDA 2R44A 2V7QH 2JWDA 1OVRA 4C7NB 1M1JA 3D6ZA 1XTGB 2OTKE 1IFIA 3GMAA 1NWQA 4L75A 2CPBA 4RKUJ 1GDTA 2ZAEB 2MKVA 3HD7C 3P8CE 2HODB 1X22A 3E1IA 2W27A 1BGYJ 1EZVI 3CX5E 2K9YA 3O8ZA 4OVNF 3SFDC 2IFNA 2XDJA 1KFMA 3WUTA 3VP8A 1PIXA 3A0BH 3EQ2A 1NAFA 2YO2A 2E74C 3H1LE 2ZT9C 1YQ3C 3LW5J 1LTBC 2J58A 2HR3A 3NTNA 3VYIA 1CSBA 1KTMA 5KLVE 1L4AA 1ZV8A 3BVHA 4PJ0H 1KZUB 1NTMK 4N78D 1KYOI 1LTTC 2B87B 1NU1E 3BRVB 1SQBG 2H7HA 1KYOE 1K73Q 2KZIA 1KMIZ 1JCDA 1SQBD 5CCGA 1FZBA 1KV4A 1LT9B 1KB9D 4R4MA 1PPJE 2G8YA 1NTKJ 2OYIA 5KJ7A 4BRYA 3T97B 2W83C 2XZRA 1SQVK 3L72J 3H1IG 1KILC 2AXTH 5KKZC 1GZLA 4GDOA 1J1DC 1URQC 5B66E 2QA4P 2OTJP 4WBAA 4C7NA 3SFEC 3H1ID 1IJDB 2IZ0A 1VQ6P 2QJPB 1VF5C 2WSFJ 2HLOA 3OJAB 3S4RA 4I6MC 3H32B 1OXZA 1IK7A 1HBWA 3ITKA 3S1KA 3V5BA 5AW0B 1IZNB 3Q3DA 1HWTC 3S9OA 4C7RA 4I7ZB 1CW5A 4HKZH 2CPSA 2R5BA 4ASVA 4W7ZA 3LIEA 1FE6A 3GLMA 5EFWB 4UB8E 1BGYG 3BCCJ 1N2DC 5KAFE 3HD7D 4U3FE 1BGYD 1JY3N 1L0NE 1JY2N 2QVAA 2YNYA 4JF7A 2Q5UA 1OZHA 1VQ5P 4M3LA 2N9YB 2ZYGA 3M9HA 5CCGC 3SWKA 1FJPA 3I55P 3V2NA 3AEGC 2WPQA 2FYNC 2E74D 5AVUB 1AVYA 2ZT9D 4UB6E 3AE7C 1NOHA 2XNDH 3AE2C 5KJ7C 3CCMP 2WMMA 1LT9A 2QE7H 1FJKA 2KSEA 3Q5RA 2WPRA 1UIIA 1NTME 1AQTA 1R8EA 1YJNP 1HGVA 2C9LY 1N7SC 1T6AA 1YYCA 1ZP0C 2R5DA 1RQUA 2I8DA 3K5BA 3CWBJ 3H25A 3TGUJ 3LIDA 1NTZK 4OWFA 1NTKG 2V7QJ 3G4SP 3H1HJ 1X9VA 5KAIE 3H32A 1SQVE 3AEDC 1NTKD 1KN7A 2QJKC 1ZMEC 1NVOA 1KILD 1BE3E 1FU1A 1URQD 5AVRB 2YIUC 2N9BA 2O01H 1GW3A 1VF5D 1SP4A 3CD6P 3NMDA 3CI9A 4NPFX 2WQYC 3L37A 3HUSC 1RF1C 3OAKA 1PV3A 1EXIA 1LWUC 2D2CC 3KZIH 3L70J 1GD2E 5AW8B 2E76C 2XV5A 1BCCJ 3HTKB 4Y99B 3CXHD 1SFCC 2XKMA 2NZ2A 1CZQA 3HRNA 3HE4B 2Q3EA 2YMKA 4TLFA 1VDFA 3H1KD 2IBZI 4MN4C 3WU2H 1RE3C 2ZXEB 3MZWB 5CCGD 3AE6C 3KQGA 3L74J 2IBZE 3E1RA 5B5EE 1S5LE 4R4LA 3HD7B 4YXWH 4RJTA 3H6PA 5KJ7D 4AUWA 1L0LK 3V4QA 3PJSK 1E79H 3LW5H 2FYZA 1DEEG 5KLIC 4IFMA 2IZ1A 2ITAA 1NH4A 1N7SD 1SS1A 3TGUG 4JPZB 2WTYA 1LTSC 1NTZE 1EQ7A 5AW5B 3H1HG 3TGUD 2W6JH 2E74B 4L74A 2ZT9B 1H8AA 5AW3B 3H1HD 4W80A 1KD1Q 1X79B 1S5LX 5APUA 1NO4A 1PP9D 3L72E 1OW6A 1S4XA 2LR2A 1JTHB 1PGQA 1OMIA 2BCCD 2KZJA 2LXBA 1S1CX 1T8ZA 1DD4A 3IF4A 3M0DA 4EI2A 1OW8A 4WVZA 4ASWA 3A0HE 5CBNA 2UWJE 2K1AA 2WSFH 2FYUJ 3M9BA 3HE4A
chains in the Genus database with same CATH topology
1VF5C 2WSFJ 1RQUA 2E75D 3H25A 4I7ZC 3AEAC 3IAOA 4PV1D 3G9RA 4TT3H 1RQVA 3AE6C 3AEBC 1NGMB 3AEFC 1IK7A 2V7QJ 2K9YA 1DD3A 3SFDC 2D2CD 2FBWC 3C8VA 4R4LA 3Q5PA 2BEZF 4H0LD 3AEDC 1PIXA 4H44D 1YQ4C 1FDIA 3Q1MA 3Q3DA 4OGQD 1VF5B 2QJKC 3S9OA 1ZMEC 2E76D 4I7ZB 3Q2YA 2FXPA 1WMKA 2H88C 3B71A 3AE1C 4YTPC 2YIUC 5KLIC 4Z1MH 4Y28J 2E74C 1NYHA 2BEQD 3AE4C 2ZT9C 1YQ3C 3LW5J 4H13C 3GLMA 4U7JA 3AE9C 1K05A 1MKMA 2WSEJ 3RK3E 1OW7A 5M1BA 1Q90D 2O01J 3AEEC 3FGAD 1VF5D 3RL0g 2IDBA 3ABVC 3D71A 1KTMA 2WSCJ 3AE3C 1KQFB 2QIWA 2OQQA 2E74B 1UIXA 4H13B 2ZT9B 2P10A 1DIPA 3O6QA 4XFJA 1EXJA 1ZOYC 2WQYC 1PL5A 2QJYC 3Q5SA 1AJYA 1TU3F 1S5LX 2E75C 2JP3A 3GF3A 1KMIZ 4PV1C 2J5UA 2JO1A 5L8RJ 2WPVB 1PV3A 1EXIA 3R4YA 3D6YA 1Y9BA 1OW6A 1U57A 2G3AA 3AEGC 2FYNC 4KT0J 2D2CC 2E74D 4R4MA 4H13D 1JB0J 2ZT9D 3GF7A 2G8YA 3D70A 3AE7C 4H0LC 3AE2C 1OMIA 4H44C 4YXDC 1K04A 4OGQC 1S1CX 2E75B 3T97B 1VL2A 1DD4A 2E76C 3D6ZA 3Q5RA 3AECC 2H89C 3AE5C 2QJPC 3AE8C 4PV1B 2QSIA 1KORA 1FDOA 5KKZC 4GDOA 2NZ2A 3GMAA 1OW8A 4IL6X 1KQGB 2D2CB 3IN6A 1GMJA 3SFEC 4RKUJ 1R8EA 3EWKA 1HF9A 1HJ0A 4H0LB 4H44B 1ZRTE 2YMKA 4OGQB 2MKVA 1KILE 2E76B 1ZP0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TU3 F;  1S1C X;  3FGA D;  1UIX A;  1NYH A;  1PL5 A; 
#chains in the Genus database with same CATH topology
 1KIL B;  2O3J A;  1ZW0 A;  5KKZ B;  2FKW B;  1J1D B;  1URQ B;  3AEA C;  3V4W A;  3L70 G;  5K5G B;  3CX5 D;  2H8P D;  2D2C D;  3Q5P A;  3RK2 C;  2XU6 A;  2HPC A;  2HG5 D;  1VF5 B;  2E76 D;  3BCC E;  3HD7 A;  1SFC D;  1VQM P;  1JEK A;  4XA4 A;  1K05 A;  2YXQ B;  3CXH H;  2KSJ A;  1PGO A;  2AEF A;  3L74 G;  3E7K A;  3FGA D;  3ABV C;  3L71 E;  1MV8 A;  2R3S A;  3L74 D;  2DW3 A;  1L0L E;  1NU1 D;  1N8R Q;  4PV1 C;  5L8R J;  4WY4 C;  3FXE A;  1SLQ A;  3I5C A;  2QM8 A;  3R4Y A;  2L91 A;  4HYT B;  4RES B;  1USD A;  2P7J A;  2Z5I A;  1HGZ A;  3GF7 A;  4DZO A;  1T3U A;  3PH0 A;  2B89 A;  1JTH A;  5GTH E;  3H1J E;  2FYN B;  2PAJ A;  3CWB E;  1GMJ A;  1HF9 A;  1HJ0 A;  2IX7 C;  1ZRT E;  3P8M C;  3TYY A;  3C9I A;  1SQQ K;  4KJM A;  3FWN A;  1M56 D;  4YPC A;  1N73 C;  3N7N A;  1KIL A;  4DOJ A;  4HH2 A;  2ZVO B;  3C8V A;  1URQ A;  1N7S B;  4IFD K;  1AFO A;  4IL6 H;  2WWW A;  2I1K A;  2Y0D A;  2FYU G;  5E79 H;  2GUS A;  2WSE J;  2RN0 A;  2QJK B;  5AVW B;  2OAR A;  1EZV E;  2FFD C;  3A0B E;  1VQO P;  2FYU D;  3VMA A;  2OYH C;  1M57 D;  3RL0 g;  2YIU B;  1L0N D;  3L73 J;  2R3C A;  1EXJ A;  1K9M Q;  2QJY C;  3RK2 D;  3JCU H;  3CCE P;  1BDD A;  3VTP C;  1LT1 A;  1PFI A;  3GF3 A;  4BWN A;  1G1I A;  1IFM A;  4PJ0 E;  1BCC E;  1SQX J;  3L75 E;  1MFZ A;  3HUS B;  1PZQ A;  1FZA A;  1K04 A;  1LTI C;  1RF1 B;  2M3B A;  3AE5 C;  4DJG A;  5CJ4 A;  1LWU B;  2D2C B;  3CCS P;  3MD0 A;  3IN6 A;  3U1C A;  2HFE D;  1EDL A;  3W67 A;  2E76 B;  2H43 A;  3U1A A;  1OX3 A;  1SQB K;  1QVG O;  1SFC B;  2AXT E;  1FOS E;  4PV1 D;  4WY4 D;  2FXM A;  3KYQ A;  3AEB C;  1JUN A;  3USS A;  1DD3 A;  1MZ9 A;  1RY3 A;  1NHL A;  3Q2Y A;  2FXP A;  2KXP B;  3VN0 A;  3RK3 C;  1N7S A;  5AW4 B;  1IFP A;  1NYH A;  1VQ7 P;  1QLE D;  1SQQ E;  1KFN A;  5AVY B;  4WB4 A;  5APS A;  5CMZ A;  1YJ9 P;  1G2C B;  5KLI B;  1KQF B;  4ZMD A;  1S9K D;  4GIF A;  2WT7 A;  1KQS O;  1P84 D;  3CCQ P;  5AVQ B;  2E5Y A;  3G6E P;  2J5U A;  5KTB A;  4GOF A;  1HUC A;  2AEJ A;  4H0L C;  1KQL A;  3KXD A;  5CHX A;  3KDP B;  3H1K J;  1BSH A;  5CBO A;  3L73 G;  1AQ5 A;  3HUS A;  1RF1 A;  1HJB A;  1CI6 B;  3L73 D;  1HTL C;  1LWU A;  1Q82 Q;  2XNX A;  3V6I A;  1SQX G;  3PP5 A;  1VQ8 P;  3B8E B;  4BXL A;  4TT3 H;  1SQX D;  1SFC A;  4N78 E;  1JMB A;  4OH8 B;  4Y28 J;  2YKO A;  1RE3 A;  1VQL P;  1KB9 I;  2L5G B;  4ZNC A;  3RK2 B;  1SQB E;  5M1B A;  1Q90 D;  4D6T G;  1KB9 E;  2IDB A;  4JQ0 D;  5GTI H;  3D71 A;  2IPP A;  3AE3 C;  2POH A;  2QIW A;  4D6T D;  1KB9 H;  1PP9 J;  1G1J A;  4XFJ A;  5AVT B;  1NTK K;  5TJH A;  3P7K A;  1G2C A;  2JR8 A;  3G71 P;  2BCC J;  3H1I E;  3RK3 D;  2AEM A;  5TIS E;  1Y9B A;  3F5H A;  2PRR A;  2M5A B;  5TIS H;  4OGQ C;  2GA1 A;  2C0X A;  1SQP G;  1ZR4 A;  1QL2 A;  4PV1 B;  3B5N C;  4WY4 B;  2I1J A;  3R2P A;  1JCC A;  1FZF A;  1VQN P;  1P84 I;  1SQP D;  3KZI E;  4PD4 D;  3PTZ A;  1CI6 A;  4HB1 A;  2FY8 A;  1P84 H;  1RQV A;  1OWA A;  2M8R A;  3TDK A;  3A2A A;  3H1K G;  1BGY E;  2JEE A;  4H0L D;  3H1L J;  3WU2 E;  4AQR D;  3A5T A;  1Q7Y Q;  2A06 G;  1N73 B;  2LKM A;  4Z1M H;  3NXS A;  2WSE H;  5KLV J;  2A06 D;  2HPC B;  5AW1 B;  1NU1 J;  1ZXG A;  5C39 A;  2N1T C;  1IFN A;  4A7P A;  2NPS C;  2QM7 A;  2P10 A;  3BAS A;  1IO4 A;  1PL5 A;  2FFD B;  5APV A;  5AW7 B;  2OYH B;  5BVZ A;  3G3Z A;  2JP3 A;  2O1K A;  2JO1 A;  2K37 A;  1AV1 A;  1OVV A;  5APT A;  2OTL P;  2QEX P;  2QJY B;  1HVV A;  3M9Q A;  1VL2 A;  1YBK A;  5AVS B;  3VP9 A;  1PP9 G;  2M5A A;  1FDO A;  1NJI Q;  1YI2 P;  1NTK E;  3WMM 0;  4WY4 A;  4NPE A;  4QMA A;  3IFM A;  2BCC G;  3B4S A;  1EDJ A;  2KNC B;  1KIL E;  4ZKP A;  1ZRT D;  3PHL A;  1X0T A;  1VQP P;  3EFG A;  3FX0 A;  2WSS H;  3HE5 B;  3G9R A;  1S72 P;  2P67 A;  5AVX B;  3AEF C;  4C46 A;  4ZKU A;  1S2E A;  4AYC A;  4OGQ D;  5BU5 A;  1NKZ B;  5AW2 B;  1VPC A;  3B5N D;  4IOI H;  3GHG C;  3P8C D;  4U3F J;  1L0N J;  4H13 C;  1GTW A;  1N73 A;  3PRJ A;  1LJ2 A;  1FZG A;  3RK3 B;  3O6Q B;  2WSC J;  3CXH I;  1GU4 A;  2OQQ A;  2OGU A;  2Y9Y A;  1L2P A;  1YIT P;  3H1L G;  4GT1 A;  4PD4 H;  3CXH E;  1ZN5 A;  2P2U A;  3H1L D;  3RBZ A;  1M90 Q;  2P1J A;  2GUV A;  3CCR P;  2WPV B;  5KLV G;  2Y0E A;  2K3R A;  2FFD A;  2ZXX A;  2G3A A;  3QH9 A;  2OYH A;  1NTM J;  3CL3 D;  1NU1 G;  5KLV D;  4N3Y B;  1K8A Q;  1QEX A;  3MP7 B;  2RH0 A;  1VQK P;  2N1T D;  1KYO D;  3L4F A;  2KI7 B;  2ZYA A;  2NPS D;  1A02 F;  4L73 A;  1PPJ G;  1NU1 K;  4H0L B;  2MJZ A;  3WUU A;  2W8Z A;  1PPJ D;  1SQV J;  1USE A;  3IAO A;  1JY3 P;  2KNC A;  1JY2 P;  1W2B O;  1FZE A;  1N7L A;  1AA0 A;  1BE3 J;  1LTG C;  3HE5 A;  4L76 A;  3Q1M A;  3TGU E;  1Y8A A;  1FC2 C;  1X8Y A;  5DJT B;  3U59 A;  2H88 C;  2A45 G;  3AE1 C;  3H1H E;  2Z5H A;  5H2F H;  3QWO C;  2ZYD A;  1J2J B;  4U7J A;  4DT0 A;  3AE9 C;  2YXR B;  3RBX A;  1FZC A;  3A3Y B;  4IL6 E;  3CLQ A;  2IYO A;  4LGD E;  1LTJ C;  2YKQ A;  2E43 A;  5E79 E;  3O6Q A;  1LNQ A;  1AJY A;  4U3F G;  2E75 C;  4I2L C;  2KUB A;  1L0N G;  3TK1 A;  3V2Q A;  1Y47 A;  5APY A;  2WT7 B;  4U3F D;  4KT0 J;  3CX5 I;  1QGK B;  4H13 D;  3D70 A;  3JCU E;  2HYN A;  4H44 C;  2FYU K;  1JNM A;  3AEC C;  2H89 C;  2QSI A;  1L0N K;  3L70 E;  3CX5 H;  4IL6 X;  3JC2 2;  1GL2 A;  2K9J A;  4WWI A;  4EYY Q;  3VMY A;  4OGQ B;  3B5N B;  2YKP A;  1NTM G;  1SVF A;  1YIJ P;  2KOG A;  2KS1 B;  1NTM D;  3CME P;  3CCU P;  5DJU B;  3L74 E;  3WUV A;  2PP6 A;  1NTZ J;  1IFD A;  1DEB A;  4D6T J;  2RKL A;  4LLH A;  1SQV G;  1FZC C;  1OW7 A;  1KYO H;  1SQV D;  1LTA C;  1S3J A;  1BE3 G;  1H0T B;  1JY3 O;  4B86 A;  1JY2 O;  3RL0 C;  1E5W A;  2OYO A;  1M1J C;  3NFQ A;  1BE3 D;  2KB7 P;  3M0A A;  2N1T B;  1M7L A;  2NPS B;  5B66 H;  1U57 A;  2A45 I;  3MUD A;  2RMZ A;  4JYB A;  1SQP J;  4YXD C;  1GW4 A;  1IFJ A;  1IC2 A;  1GK4 A;  5CCH A;  2HOD A;  1YTZ I;  1KOR A;  2A45 H;  1GL2 C;  1T3J A;  4HJG H;  3SWY A;  3EWK A;  1JOC A;  1J1E C;  4JYC A;  2E75 D;  3CPW O;  3B5N A;  2FYU E;  1RE4 A;  1W2E A;  4UB8 H;  1KC8 Q;  2KLV A;  3VMX A;  2PGD A;  4H44 D;  5KAF H;  1FDI A;  1L4A C;  2QG4 A;  3BAT A;  2KS1 A;  1WMK A;  3V2R A;  3VMZ A;  3W68 A;  2IBZ G;  5APX A;  3L71 J;  1U7M A;  3CCJ P;  2E5T A;  2B87 A;  1H88 A;  2IBZ D;  2SPZ A;  1T2K C;  2P58 A;  1L0L J;  2KYV A;  4XE5 B;  2WSC H;  3AEE C;  1QVF O;  3GHG B;  1SQX K;  2OYI C;  4H13 B;  5AVV B;  1R5S A;  3TNU B;  3L36 A;  4GOE A;  4UB6 H;  3C1L A;  3Q5S A;  5APQ A;  1H0T A;  1NTZ G;  5GTI E;  1AVO A;  3T97 A;  1OVU A;  2KP8 A;  2J59 M;  3D6Y A;  2Z4E A;  1U7J A;  2N1T A;  3MUD C;  1NTZ D;  1JMM A;  3H1J J;  1OIP A;  2NPS A;  3N4X A;  5CCH C;  3L72 G;  1QL1 A;  2CK3 H;  1Q81 Q;  3RL0 D;  1VQ4 P;  2WZ7 A;  2ZFC A;  3TSI A;  2R32 A;  1WT6 A;  5KAI H;  1M1K Q;  3CMA P;  3L72 D;  2ZJS E;  2JDI H;  4CPG A;  1M8O B;  1FAV A;  3ZDM A;  1EC5 A;  3I56 P;  2JKV A;  1RE4 C;  3KHU A;  1H89 A;  1GU5 A;  4IFF A;  3RGU A;  1S9K E;  1IK9 A;  5CJ0 A;  1FBM A;  1P84 E;  2PFX A;  3F89 A;  1SQP K;  1GL2 D;  3MGN A;  1FS0 E;  3VOP A;  5APW A;  1MKM A;  1YTZ T;  1NAY A;  2GM4 A;  1Z56 A;  1BDC A;  3BCC G;  4N6J A;  2W6A A;  1QX8 A;  3TF5 A;  3BCC D;  4EDF A;  1LT9 C;  1XTC C;  3GHG A;  3L75 J;  2VRS A;  1ZLL A;  1L4A D;  1TU3 F;  4W7Y A;  3TNU A;  3V2P A;  4DCK A;  3L73 E;  4K35 A;  3L71 G;  1LTJ B;  3FWL A;  5AVZ B;  2Q7C A;  1WRG A;  1JB0 J;  1L0L G;  3L71 D;  1T2K D;  2E75 B;  3M06 A;  1FDM A;  2LXC B;  1A02 J;  1L0L D;  1SQX E;  2QJP C;  3AE8 C;  1JM0 A;  1KQG B;  1LGH B;  5B5E H;  1LP1 B;  1S5L H;  4H44 B;  1MUU A;  2Q3I A;  1GK6 A;  4I7Z C;  2M3E A;  3H1J G;  2B9B A;  2Y9Z A;  1YHQ P;  3CWB G;  2NRG A;  2V4H A;  3H1J D;  1SQQ J;  3CWB D;  4D6T E;  5CCH D;  1N86 A;  2JJL A;  3B71 A;  4LC1 A;  4YTP C;  3AE4 C;  3II6 A;  1D7M A;  2Q1K A;  3P32 A;  3RK3 E;  4K3A A;  2QRX A;  3GW6 A;  3OW2 O;  3GG2 A;  4EOT A;  3A7O A;  4GKG A;  1DH3 A;  1PGP A;  4KHX A;  1RH5 B;  2E42 A;  1VQ9 P;  3MIW A;  1R5L A;  1PGJ A;  1FZC B;  3BRT B;  5AW9 B;  1EZV G;  1EDI A;  1SQP E;  2FXO A;  4PD4 I;  3MHV A;  3HTK A;  3KPE A;  2Y0C A;  2WPS A;  1HH0 A;  1NKN A;  3RL0 B;  1EZV D;  2O1J A;  4PD4 E;  1M1J B;  1RF0 A;  3L35 A;  3A0H H;  2M0B A;  1Q86 Q;  1LTJ A;  4O9B A;  4RO0 A;  3CC4 P;  3SSU A;  1BCC G;  3L75 G;  3L70 D;  2B88 A;  1MFT A;  3H1K E;  3JSV C;  2KK7 A;  1BCC D;  3L75 D;  1DX7 A;  4EIJ A;  1LP1 A;  2A06 E;  1GL2 B;  1JO5 A;  2IYP A;  1NGM B;  2K9J B;  2C0W A;  2WIT A;  5KLV K;  2FBW C;  1J1E B;  3EFF K;  2YMY A;  2BEZ F;  2W90 A;  1YQ4 C;  2AXC A;  2W6B A;  2ZVN B;  1SQB J;  1RHZ B;  2BAS A;  4JBZ A;  1FOS F;  3MTU E;  2Q9I A;  3CC7 P;  2BEQ D;  3CCV P;  2WVR A;  2YO3 A;  4GOD A;  1L4A B;  3FXD A;  1OFC X;  2O01 J;  3IR9 A;  3UIA A;  5AW6 B;  5H2F E;  1UIX A;  3SWF A;  1YJW P;  1EDK A;  3H1I J;  1SQQ G;  1DIP A;  1ZR2 A;  2IFM A;  1ZOY C;  2KLU A;  3M0D C;  1SQQ D;  1W5C E;  3CC2 P;  4Y99 C;  1PP9 E;  3OA7 A;  3CCL P;  5GTH H;  2OYI B;  2JWA A;  2K88 A;  3M91 A;  5BU8 B;  4BRY B;  4I1L A;  2C9N Y;  2KIK A;  1RF0 C;  1Q2N A;  1BSN A;  3PLN A;  2Q6Q A;  2BCC E;  2O01 N;  4NPD A;  2R44 A;  2V7Q H;  2JWD A;  1OVR A;  4C7N B;  1M1J A;  3D6Z A;  1XTG B;  2OTK E;  1IFI A;  3GMA A;  1NWQ A;  4L75 A;  2CPB A;  4RKU J;  1GDT A;  2ZAE B;  2MKV A;  3HD7 C;  3P8C E;  2HOD B;  1X22 A;  3E1I A;  2W27 A;  1BGY J;  1EZV I;  3CX5 E;  2K9Y A;  3O8Z A;  4OVN F;  3SFD C;  2IFN A;  2XDJ A;  1KFM A;  3WUT A;  3VP8 A;  1PIX A;  3A0B H;  3EQ2 A;  1NAF A;  2YO2 A;  2E74 C;  3H1L E;  2ZT9 C;  1YQ3 C;  3LW5 J;  1LTB C;  2J58 A;  2HR3 A;  3NTN A;  3VYI A;  1CSB A;  1KTM A;  5KLV E;  1L4A A;  1ZV8 A;  3BVH A;  4PJ0 H;  1KZU B;  1NTM K;  4N78 D;  1KYO I;  1LTT C;  2B87 B;  1NU1 E;  3BRV B;  1SQB G;  2H7H A;  1KYO E;  1K73 Q;  2KZI A;  1KMI Z;  1JCD A;  1SQB D;  5CCG A;  1FZB A;  1KV4 A;  1LT9 B;  1KB9 D;  4R4M A;  1PPJ E;  2G8Y A;  1NTK J;  2OYI A;  5KJ7 A;  4BRY A;  3T97 B;  2W83 C;  2XZR A;  1SQV K;  3L72 J;  3H1I G;  1KIL C;  2AXT H;  5KKZ C;  1GZL A;  4GDO A;  1J1D C;  1URQ C;  5B66 E;  2QA4 P;  2OTJ P;  4WBA A;  4C7N A;  3SFE C;  3H1I D;  1IJD B;  2IZ0 A;  1VQ6 P;  2QJP B;  1VF5 C;  2WSF J;  2HLO A;  3OJA B;  3S4R A;  4I6M C;  3H32 B;  1OXZ A;  1IK7 A;  1HBW A;  3ITK A;  3S1K A;  3V5B A;  5AW0 B;  1IZN B;  3Q3D A;  1HWT C;  3S9O A;  4C7R A;  4I7Z B;  1CW5 A;  4HKZ H;  2CPS A;  2R5B A;  4ASV A;  4W7Z A;  3LIE A;  1FE6 A;  3GLM A;  5EFW B;  4UB8 E;  1BGY G;  3BCC J;  1N2D C;  5KAF E;  3HD7 D;  4U3F E;  1BGY D;  1JY3 N;  1L0N E;  1JY2 N;  2QVA A;  2YNY A;  4JF7 A;  2Q5U A;  1OZH A;  1VQ5 P;  4M3L A;  2N9Y B;  2ZYG A;  3M9H A;  5CCG C;  3SWK A;  1FJP A;  3I55 P;  3V2N A;  3AEG C;  2WPQ A;  2FYN C;  2E74 D;  5AVU B;  1AVY A;  2ZT9 D;  4UB6 E;  3AE7 C;  1NOH A;  2XND H;  3AE2 C;  5KJ7 C;  3CCM P;  2WMM A;  1LT9 A;  2QE7 H;  1FJK A;  2KSE A;  3Q5R A;  2WPR A;  1UII A;  1NTM E;  1AQT A;  1R8E A;  1YJN P;  1HGV A;  2C9L Y;  1N7S C;  1T6A A;  1YYC A;  1ZP0 C;  2R5D A;  1RQU A;  2I8D A;  3K5B A;  3CWB J;  3H25 A;  3TGU J;  3LID A;  1NTZ K;  4OWF A;  1NTK G;  2V7Q J;  3G4S P;  3H1H J;  1X9V A;  5KAI E;  3H32 A;  1SQV E;  3AED C;  1NTK D;  1KN7 A;  2QJK C;  1ZME C;  1NVO A;  1KIL D;  1BE3 E;  1FU1 A;  1URQ D;  5AVR B;  2YIU C;  2N9B A;  2O01 H;  1GW3 A;  1VF5 D;  1SP4 A;  3CD6 P;  3NMD A;  3CI9 A;  4NPF X;  2WQY C;  3L37 A;  3HUS C;  1RF1 C;  3OAK A;  1PV3 A;  1EXI A;  1LWU C;  2D2C C;  3KZI H;  3L70 J;  1GD2 E;  5AW8 B;  2E76 C;  2XV5 A;  1BCC J;  3HTK B;  4Y99 B;  3CXH D;  1SFC C;  2XKM A;  2NZ2 A;  1CZQ A;  3HRN A;  3HE4 B;  2Q3E A;  2YMK A;  4TLF A;  1VDF A;  3H1K D;  2IBZ I;  4MN4 C;  3WU2 H;  1RE3 C;  2ZXE B;  3MZW B;  5CCG D;  3AE6 C;  3KQG A;  3L74 J;  2IBZ E;  3E1R A;  5B5E E;  1S5L E;  4R4L A;  3HD7 B;  4YXW H;  4RJT A;  3H6P A;  5KJ7 D;  4AUW A;  1L0L K;  3V4Q A;  3PJS K;  1E79 H;  3LW5 H;  2FYZ A;  1DEE G;  5KLI C;  4IFM A;  2IZ1 A;  2ITA A;  1NH4 A;  1N7S D;  1SS1 A;  3TGU G;  4JPZ B;  2WTY A;  1LTS C;  1NTZ E;  1EQ7 A;  5AW5 B;  3H1H G;  3TGU D;  2W6J H;  2E74 B;  4L74 A;  2ZT9 B;  1H8A A;  5AW3 B;  3H1H D;  4W80 A;  1KD1 Q;  1X79 B;  1S5L X;  5APU A;  1NO4 A;  1PP9 D;  3L72 E;  1OW6 A;  1S4X A;  2LR2 A;  1JTH B;  1PGQ A;  1OMI A;  2BCC D;  2KZJ A;  2LXB A;  1S1C X;  1T8Z A;  1DD4 A;  3IF4 A;  3M0D A;  4EI2 A;  1OW8 A;  4WVZ A;  4ASW A;  3A0H E;  5CBN A;  2UWJ E;  2K1A A;  2WSF H;  2FYU J;  3M9B A;  3HE4 A; 
#chains in the Genus database with same CATH homology
 1VF5 C;  2WSF J;  1RQU A;  2E75 D;  3H25 A;  4I7Z C;  3AEA C;  3IAO A;  4PV1 D;  3G9R A;  4TT3 H;  1RQV A;  3AE6 C;  3AEB C;  1NGM B;  3AEF C;  1IK7 A;  2V7Q J;  2K9Y A;  1DD3 A;  3SFD C;  2D2C D;  2FBW C;  3C8V A;  4R4L A;  3Q5P A;  2BEZ F;  4H0L D;  3AED C;  1PIX A;  4H44 D;  1YQ4 C;  1FDI A;  3Q1M A;  3Q3D A;  4OGQ D;  1VF5 B;  2QJK C;  3S9O A;  1ZME C;  2E76 D;  4I7Z B;  3Q2Y A;  2FXP A;  1WMK A;  2H88 C;  3B71 A;  3AE1 C;  4YTP C;  2YIU C;  5KLI C;  4Z1M H;  4Y28 J;  2E74 C;  1NYH A;  2BEQ D;  3AE4 C;  2ZT9 C;  1YQ3 C;  3LW5 J;  4H13 C;  3GLM A;  4U7J A;  3AE9 C;  1K05 A;  1MKM A;  2WSE J;  3RK3 E;  1OW7 A;  5M1B A;  1Q90 D;  2O01 J;  3AEE C;  3FGA D;  1VF5 D;  3RL0 g;  2IDB A;  3ABV C;  3D71 A;  1KTM A;  2WSC J;  3AE3 C;  1KQF B;  2QIW A;  2OQQ A;  2E74 B;  1UIX A;  4H13 B;  2ZT9 B;  2P10 A;  1DIP A;  3O6Q A;  4XFJ A;  1EXJ A;  1ZOY C;  2WQY C;  1PL5 A;  2QJY C;  3Q5S A;  1AJY A;  1TU3 F;  1S5L X;  2E75 C;  2JP3 A;  3GF3 A;  1KMI Z;  4PV1 C;  2J5U A;  2JO1 A;  5L8R J;  2WPV B;  1PV3 A;  1EXI A;  3R4Y A;  3D6Y A;  1Y9B A;  1OW6 A;  1U57 A;  2G3A A;  3AEG C;  2FYN C;  4KT0 J;  2D2C C;  2E74 D;  4R4M A;  4H13 D;  1JB0 J;  2ZT9 D;  3GF7 A;  2G8Y A;  3D70 A;  3AE7 C;  4H0L C;  3AE2 C;  1OMI A;  4H44 C;  4YXD C;  1K04 A;  4OGQ C;  1S1C X;  2E75 B;  3T97 B;  1VL2 A;  1DD4 A;  2E76 C;  3D6Z A;  3Q5R A;  3AEC C;  2H89 C;  3AE5 C;  2QJP C;  3AE8 C;  4PV1 B;  2QSI A;  1KOR A;  1FDO A;  5KKZ C;  4GDO A;  2NZ2 A;  3GMA A;  1OW8 A;  4IL6 X;  1KQG B;  2D2C B;  3IN6 A;  1GMJ A;  3SFE C;  4RKU J;  1R8E A;  3EWK A;  1HF9 A;  1HJ0 A;  4H0L B;  4H44 B;  1ZRT E;  2YMK A;  4OGQ B;  2MKV A;  1KIL E;  2E76 B;  1ZP0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...