3FGAD

Structural basis of pp2a and sgo interaction
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
47
structure length
47
Chain Sequence
PSTLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein phosphatase 2A 65 kDa regulatory su
publication title Structure and function of the PP2A-shugoshin interaction
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/hydrolase inhibitor
total genus 22
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2008-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.730 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3fgaD00
1UIXA 3FGAD 1NYHA 1PL5A 1TU3F 1S1CX
chains in the Genus database with same CATH superfamily
5CMZA 4QMAA 4IFFA 2E42A 2FYUG 2QA4P 4YPCA 3CWBG 3IAOA 3AEFC 1T2KD 5KAIH 3RL0C 2Z5HA 3H1IG 3V5BA 2ZT9D 1SFCC 1HBWA 5B66H 1ZRTE 2KZIA 2KYVA 2XNXA 1BCCE 1LTAC 5AVQB 2M3BA 3L73J 2FY8A 4JQ0D 4H44D 3T97A 1PP9D 3H1LJ 1NTME 3Q5RA 2WQYC 2OARA 3TF5A 2OTLP 2QSIA 2W90A 1WT6A 1ZR2A 1ZR4A 1FOSE 4BXLA 2WWWA 5KLVK 1LTJA 1AJYA 1M90Q 1L4AA 2KXPB 1J1EC 4NPFX 3T97B 3L36A 5GTHE 2E76B 1Q90D 2I1KA 3CWBE 4IL6E 2NPSD 5KLVD 1L0NE 2G3AA 5APUA 3MP7B 1SQQG 3E7KA 2ZFCA 1PPJE 3H1IE 2YKPA 2WPVB 1LTJB 2NPSB 4YXWH 3Q5SA 1L4AB 2OYHC 4I7ZC 3L74D 2VRSA 4YXDC 1KYOH 2KIKA 1G1IA 5KKZC 1A02F 2QE7H 1IFDA 3FX0A 1Q7YQ 1E79H 2C0XA 3Q5PA 1MV8A 3V2QA 2WPSA 2HODA 1HTLC 4U3FD 2R5BA 2XU6A 3M91A 1S4XA 1Y8AA 2LR2A 3VMXA 3AE4C 1H89A 2MJZA 1N8RQ 2KUBA 3BCCE 4D6TD 4DZOA 4RESB 3B5ND 1NU1K 3RK2B 3M9QA 3K5BA 2XKMA 2HG5D 4KT0J 1LJ2A 4R4MA 3VOPA 2HODB 1VDFA 2YXRB 1RQVA 1N7SA 1FAVA 3TGUJ 1NU1D 2OTKE 2ZYDA 4HKZH 3GW6A 3SFEC 1FBMA 3ZDMA 3L73G 1N7SD 3B71A 3H1LG 3M0DC 2W8ZA 2HFED 3FXEA 3W68A 5CCGA 1HJ0A 1ZRTD 3U59A 1N7SB 2YNYA 2HLOA 4EYYQ 1BCCD 3D70A 1R5LA 3M9BA 5APVA 2QVAA 5KAFE 3Q2YA 1NTMD 1DEBA 3N4XA 4HH2A 2ZXEB 1FDOA 2A45I 2YMYA 1VF5C 2FYUK 5B5EH 3RL0B 1IK9A 1P84E 2HPCA 1HGVA 1SP4A 4GOFA 1VPCA 1LGHB 2W27A 2FYUD 2CPSA 1GU4A 3CWBD 3FWNA 2XV5A 3V2NA 3L73E 1JCDA 5B66E 1GDTA 3H1LE 2WSCH 3H1ID 1SQVJ 4L73A 2HPCB 2QRXA 2K37A 2H43A 4Y28J 1SQXJ 2FYZA 2WSFH 1OXZA 3WUUA 4GKGA 2WSCJ 2IFNA 3I56P 2OYHA 1YYCA 3CCUP 1USEA 1XTGB 3MGNA 1W2BO 2K3RA 1BE3J 3PJSK 2E74C 1KQGB 1RE4C 1PZQA 4OVNF 2G8YA 3V2PA 2JWAA 3BCCD 4H13C 4PJ0E 5APQA 1SQQK 3TGUG 1S5LX 3G3ZA 2E75D 2OYHB 4I7ZB 1H0TB 2O3JA 3F89A 1FC2C 1AVYA 2L91A 2QJKC 3KDPB 5KJ7D 2IBZG 2WSEH 2E75B 2JKVA 2A06E 2YMKA 2Z4EA 1YITP 3GLMA 1EZVE 5CBNA 2RH0A 1CW5A 3FWLA 1GL2D 2M0BA 3CPWO 2P7JA 3RK3E 4ZMDA 1QVGO 3CX5H 1PGOA 4TLFA 1IFNA 3AE5C 5AW9B 1T2KC 2HYNA 2AXCA 2ZT9C 5AW2B 2WTYA 1FDIA 3GMAA 3D6ZA 2LXCB 3IFMA 2GM4A 1RF0A 3TGUE 4IL6X 2Q1KA 2ITAA 3WU2H 5AVTB 4N6JA 3AE3C 4PD4I 1IFIA 3S1KA 1JNMA 2OGUA 3NMDA 3P8CE 2QJYC 2IBZE 5APXA 1K8AQ 1JY3N 3V4QA 2N9BA 1JTHA 4BWNA 2Y0DA 4M3LA 2E76C 1SQVG 4ZNCA 4W80A 4WWIA 1DX7A 4ASVA 3I55P 1SQXG 2UWJE 2W6BA 2YO2A 4KHXA 5GTIH 4WY4D 3L73D 3ABVC 2JWDA 1LTJC 1EDIA 2KLVA 2NPSC 3H1LD 1VF5B 1X79B 2QEXP 3L4FA 1BE3G 1JTHB 3O8ZA 4N3YB 1AA0A 4C7RA 3E1RA 3AE7C 1IFPA 3MUDA 5AVZB 1FE6A 5KLVE 3L37A 1JY3P 4C46A 2R5DA 2J58A 3CMEP 5APSA 1YHQP 4BRYA 2PAJA 3Q1MA 1RE4A 3RBXA 3RK2C 1EDLA 2H88C 5AW0B 3KPEA 2DW3A 5AVWB 1SQQJ 4U7JA 1Y9BA 1ZW0A 1NJIQ 1PGJA 3M0AA 1JOCA 1KMIZ 1M1JB 2QG4A 1URQD 3UIAA 4OH8B 1YJNP 1NYHA 4CPGA 2KI7B 3TSIA 4BRYB 2B87A 2E74B 1ZV8A 1EZVD 5DJUB 3VMZA 4GDOA 2M8RA 4RO0A 2IPPA 1BE3E 1KYOD 3HE4A 1AQTA 3HE5A 3RGUA 3RK3D 3AE9C 1BDDA 5AW6B 2D2CD 4KJMA 1N7SC 3RK3B 1Y47A 2XDJA 2B87B 1LTTC 4NPEA 1NU1E 1NGMB 1MUUA 1NVOA 1IK7A 1FDMA 3HE4B 3BRVB 3HE5B 3A7OA 3TDKA 4L76A 2K1AA 1EXIA 3TGUD 1ZLLA 4A7PA 5AVRB 2AXTH 3I5CA 3WMM0 1KQLA 2K9YA 5CCGC 3P8CD 1YQ4C 4Y99B 2IBZD 2N9YB 2SPZA 4OWFA 4GOEA 2KOGA 3F5HA 3L70J 2KS1A 3NXSA 1EQ7A 3M06A 2ZT9B 3B4SA 3HD7D 1T8ZA 1QLED 3LIDA 3CX5I 1RF1A 4H44B 1JCCA 1LTGC 2NPSA 2YKOA 2QJYB 2KS1B 1QX8A 2GA1A 2E43A 2Q3IA 2FYUE 1YTZT 1NAFA 3G6EP 4AQRD 2KSEA 3WU2E 2KK7A 4H0LD 1Q82Q 1RF1B 3IN6A 1GK6A 2RKLA 4ZKUA 1FZAA 3NFQA 1SQVK 2PRRA 1KQFB 2B89A 2O1KA 3W67A 1SQXK 3CXHE 1NWQA 4UB6E 1FOSF 3VN0A 1SQVD 2CPBA 1YJ9P 1S1CX 2E75C 5GTIE 1SQXD 3CLQA 2MKVA 2Q9IA 1OVRA 1SS1A 3A0BE 5AW4B 3GF3A 1L0LG 3B5NA 5KJ7C 1LWUA 4LC1A 4UB8H 2O1JA 1JMMA 3VMYA 3SWKA 1BE3D 1K05A 3P7KA 2A45G 2NRGA 2H8PD 2WVRA 1VQ4P 3G9RA 1RY3A 5KLIB 1KC8Q 4PD4H 1T3UA 1J1DC 1GMJA 1S3JA 3JSVC 1KFMA 2KP8A 1HGZA 2Q6QA 2WPRA 3B5NB 1SQQE 1BSHA 1LWUB 1VQOP 2JR8A 3A2AA 3EQ2A 5EFWB 2QM7A 3SWFA 1U57A 3L70G 1Q2NA 3MTUE 2H89C 2N1TD 2ZVOB 3VYIA 3H1JJ 1M8OB 3L75G 2AEFA 3EFFK 2WPQA 2WT7A 2JJLA 3L35A 1IZNB 1RF0C 1L2PA 5M1BA 3E1IA 1U7JA 5E79E 5CJ0A 1NHLA 3NTNA 2Q7CA 1USDA 1RE3A 1X8YA 3CD6P 1NO4A 1W5CE 4WY4C 1X22A 3H6PA 4NPDA 1YTZI 1K04A 2WT7B 1CZQA 2ZAEB 1CI6A 3IR9A 1QEXA 2HR3A 3BASA 1QGKB 1FZFA 1RH5B 5KAIE 3L70E 3R2PA 1P84I 3VMAA 4PV1D 2C9NY 3SSUA 2E5YA 2POHA 1Q86Q 4Z1MH 1XTCC 5BU8B 3CXHD 4PV1B 5C39A 3R4YA 1G1JA 1PL5A 1CI6B 3MUDC 1GD2E 4ZKPA 1E5WA 1H0TA 1OW8A 2JDIH 2OQQA 1VQNP 1M1JC 3CCVP 4W7YA 1DEEG 2WSFJ 2O01N 1BSNA 1DIPA 2P2UA 3P32A 3PLNA 4MN4C 4HYTB 1U7MA 1Z56A 5KJ7A 3L71J 2BASA 1SQBK 3CCRP 1BDCA 1JY3O 3MIWA 4I2LC 2YIUC 3RK3C 1GL2A 4JPZB 2D2CC 1VQ9P 3HRNA 5AW8B 1SQQD 3A5TA 1S5LH 1FZCC 1KZUB 1NOHA 3AE6C 3H1JG 2Z5IA 1KYOE 2FXPA 2WSEJ 1IC2A 3AE1C 1L0LK 2PP6A 1R8EA 3PP5A 1OVUA 4Y99C 1GL2B 1SQPK 4IOIH 2YKQA 1KB9I 4IFDK 1EZVI 1J1DB 3MD0A 2AEMA 3CC7P 1JUNA 3VP9A 2O01H 4DCKA 1KTMA 2WSSH 3C8VA 3EWKA 3QH9A 2E5TA 4H44C 4PD4E 3HD7C 2RN0A 1PFIA 1LT9A 2KZJA 4GODA 3WUVA 3PHLA 1UIIA 5AVXB 5GTHH 4WY4A 1A02J 1LTIC 4IL6H 3N7NA 3H1JE 3H25A 3MHVA 1R5SA 1VQKP 1RF1C 2LKMA 3L70D 2XZRA 2IBZI 1IFMA 1L0NJ 1LT9B 4OGQD 1OW6A 2J5UA 2FYNC 3D6YA 1OMIA 1PGQA 3GF7A 4WY4B 1WRGA 1M7LA 3AEEC 2FXMA 2IZ0A 4GIFA 3L71G 1KN7A 5B5EE 1AV1A 2C0WA 2NZ2A 1M1JA 2BCCJ 3USSA 3TNUA 2Y0EA 2I8DA 1URQA 5KLIC 4DJGA 1LNQA 1SQVE 1SQBJ 2R3SA 3BCCJ 2I1JA 1SQXE 3B5NC 1LWUC 4JYBA 1LP1A 1GW3A 3TNUB 1AQ5A 2PGDA 1OWAA 3PRJA 3C9IA 4EOTA 1URQB 1N86A 1FZCA 4TT3H 2R3CA 1MFTA 4RKUJ 2K9JA 2AEJA 1H88A 1L0LJ 1MZ9A 3L71E 1PV3A 5AVUB 2N1TC 2YIUB 1LP1B 2ZYGA 1SQPJ 1NTKJ 3RBZA 2D2CB 4RJTA 3H32A 5CCHD 5CBOA 1MKMA 3CL3D 1FZCB 3CCSP 3VP8A 4XFJA 1YI2P 2K9JB 4PD4D 1FS0E 1P84H 4EI2A 5K5GB 3CC4P 3OA7A 1KILE 3KZIH 2KNCA 3HD7A 2ZXXA 1EDKA 5H2FH 1S5LE 3GHGA 4WVZA 3H32B 3HTKA 1L0NG 2IX7C 1PPJG 3H1JD 4WB4A 2W6JH 4JF7A 1RE3C 3CX5E 1HVVA 1BGYJ 1VQMP 3HUSA 3L75J 1KD1Q 1HWTC 3G71P 2KNCB 2LXBA 3HD7B 4PV1C 2IYPA 3GHGB 3HTKB 1RQUA 2BCCG 4YTPC 4AUWA 1JEKA 1DH3A 2GUSA 1PGPA 3SWYA 3H1KJ 3TYYA 1G2CA 3HUSB 4WBAA 3L72J 2E76D 3AE8C 1SQBG 1HJBA 1X0TA 3BCCG 1YJWP 4PJ0H 2H7HA 3A0HH 1FU1A 4H0LB 1K73Q 3II6A 1QVFO 3KHUA 2FYNB 1JY2N 1L4AD 1G2CB 2WZ7A 1ZMEC 1H8AA 1KB9H 5AVYB 3CXHI 5BVZA 2QJPB 1CSBA 1DD3A 3AEBC 2W83C 1EDJA 1SQPG 1NTKG 2ZVNB 1J2JB 1NTZJ 2BCCE 1GK4A 1ZN5A 2P10A 1IO4A 5APWA 1GL2C 3H1HJ 1TU3F 3L71D 3RK2D 1LTBC 4HJGH 1Q81Q 1SQBE 1N73A 2OYIA 1JY2P 1VQ6P 3U1CA 4C7NA 1HF9A 1JMBA 2N1TA 1KILA 2BEZF 2IYOA 2IDBA 5AW3B 2IZ1A 3AE2C 4O9BA 4XA4A 1NKNA 1FJPA 1KILD 1VQLP 1BGYG 2ZYAA 2OYIB 1N73B 1JM0A 1FZEA 1L0LE 2B9BA 4C7NB 2N1TB 2QIWA 1KILB 3V6IA 2WITA 4K35A 5TJHA 2JO1A 1SQPE 1NTKE 3S9OA 1NTMK 3CX5D 1FJKA 1YIJP 1PP9J 1LT9C 1M1KQ 4XE5B 2B88A 2FFDC 1SFCA 1S72P 3H1KG 2V7QH 2Q3EA 3KQGA 3L72G 2FXOA 3RL0D 4OGQC 5CCGD 4N78E 3CCQP 2V7QJ 1SFCD 1ZOYC 5APYA 1N2DC 5CJ4A 1YBKA 4HB1A 2QM8A 2AXTE 1OZHA 1OFCX 5AVSB 1FZBA 2R32A 1L0NK 4DOJA 1SFCB 3KZIE 2IFMA 5KLVJ 2XNDH 3TK1A 5H2FE 5DJTB 4GT1A 3CCMP 3QWOC 1BGYE 3AEAC 3L75E 1S9KE 1VQ8P 2J59M 2C9LY 2KB7P 5AW1B 1L0ND 3JCUH 2A06G 3L74J 4R4LA 1PPJD 1LT1A 4L74A 1D7MA 1EZVG 1NTZG 1VL2A 2R44A 3V4WA 1GU5A 3V2RA 1DD4A 1N7LA 3H1KE 3H1HG 5TISH 1W2EA 2CK3H 1ZP0C 1URQC 3L72E 3C1LA 4U3FJ 1J1EB 3G4SP 1JO5A 5KTBA 2V4HA 1VQPP 1EXJA 2BCCD 1UIXA 2W6AA 4B86A 1NAYA 2ZJSE 3AEDC 4D6TJ 3IF4A 3KXDA 1T3JA 1AFOA 2P58A 5APTA 3ITKA 4ASWA 1X9VA 1SQBD 4DT0A 3A0HE 1MFZA 2KSJA 2FBWC 1FZGA 5BU5A 5KKZB 3FXDA 1NU1J 5CCHC 1PIXA 2WMMA 1IFJA 1KB9E 4I6MC 1YQ3C 1NTZE 3CCEP 3OAKA 1OX3A 1NTKK 1IJDB 1PP9G 4UB8E 1L0LD 1KYOI 3H1HE 5AVVB 3CCLP 4EDFA 1BCCJ 1SLQA 1SQPD 1NTKD 1VQ7P 3PH0A 2M5AA 3M0DA 4JYCA 4W7ZA 1NTMJ 2O01J 3GHGC 2JEEA 1ZXGA 3D71A 2FFDA 1GW4A 2FKWB 2RMZA 3WUTA 3LW5H 3OW2O 2L5GB 3BVHA 5KLVG 1M57D 4N78D 3A3YB 2Q5UA 1SVFA 1T6AA 3HUSC 1RHZB 1GZLA 2M5AB 2BEQD 3CCJP 5AW7B 5CHXA 2PFXA 3LW5J 4I1LA 1P84D 2FYUJ 1OVVA 3L74G 2OTJP 3CXHH 3BRTB 3CWBJ 3PTZA 2YO3A 3EFGA 3AEGC 1KORA 2K88A 4H0LC 2FFDB 4UB6H 1BGYD 1PP9E 3GG2A 2YXQB 3L75D 1M56D 1S9KD 1VF5D 3H1IJ 2OYOA 3U1AA 4OGQB 4AYCA 4U3FG 4IFMA 3A0BH 4EIJA 1L4AC 3AECC 2QJPC 5AW5B 3H1KD 3O6QA 4D6TG 2Y9YA 2GUVA 1HUCA 3L72D 4LGDE 3CC2P 1K9MQ 2Y9ZA 2P1JA 1OIPA 1WMKA 3VTPC 3MZWB 3FGAD 1AVOA 4LLHA 1KQSO 3BATA 1NU1G 1JB0J 3CMAP 1HH0A 1LTSC 4L75A 3CI9A 3L74E 2KLUA 3O6QB 1EC5A 1NKZB 1QL1A 2JP3A 1NTZK 1OW7A 1VQ5P 2E74D 3JCUE 1KV4A 4K3AA 3OJAB 3M9HA 2P67A 5CCHA 2A06D 4U3FE 1BCCG 2OYIC 1N73C 1KB9D 4H13D 1NTZD 3S4RA 1KILC 3KYQA 1NTMG 5TISE 3SFDC 3RL0g 4JBZA 4D6TE 3H1HD 1S2EA 5KAFH 2A45H 3Q3DA 5E79H 4H13B 1KFNA 3P8MC 2M3EA 1GTWA 3LIEA 3JC22 2Y0CA 1QL2A 5L8RJ 1JY2O 2QJKB 1NH4A 3B8EB
chains in the Genus database with same CATH topology
1U57A 3Q5SA 3AECC 3D70A 1YQ3C 1OW8A 1TU3F 2OQQA 4H13C 4H44C 4I7ZC 2QJPC 4YXDC 1S5LX 2E75D 3O6QA 3AE9C 3Q2YA 4I7ZB 2H89C 5KKZC 4H0LD 2D2CD 2E76C 2WSFJ 1FDOA 3IN6A 4PV1C 3IAOA 1DIPA 3AEFC 1KQFB 3ABVC 3AEAC 2QJKC 1HF9A 1VF5C 3Q5PA 2BEZF 1RQUA 2E75B 4YTPC 1VF5B 2IDBA 1WMKA 2ZT9D 3AE2C 2YMKA 3FGAD 4R4LA 1ZRTE 1NGMB 3GLMA 4TT3H 3H25A 1JB0J 4RKUJ 5M1BA 1IK7A 3AE4C 2O01J 1VL2A 3AE7C 2E76D 1DD4A 3AE8C 1EXIA 2YIUC 3RK3E 4H44D 1S1CX 2E75C 3D71A 1PV3A 3Q5RA 2MKVA 2K9YA 2WQYC 2JP3A 2D2CC 1ZP0C 4OGQD 4KT0J 1OW6A 1OW7A 2J5UA 3AE5C 2FYNC 2QSIA 3GF3A 2QIWA 4H0LB 4R4MA 2D2CB 3D6YA 2E74D 1OMIA 1YQ4C 1K04A 1EXJA 3GF7A 1UIXA 3AE6C 2JO1A 3AEEC 2BEQD 1RQVA 2ZT9C 2FXPA 1MKMA 1K05A 2WSEJ 3LW5J 3S9OA 3Q1MA 1FDIA 3AEDC 3AE1C 1AJYA 2ZT9B 4XFJA 4Y28J 3GMAA 4H13D 2H88C 3D6ZA 1ZMEC 3G9RA 3AEGC 1KORA 1R8EA 3SFEC 4H0LC 1KILE 2WSCJ 4U7JA 3SFDC 1Y9BA 3T97B 3RL0g 2NZ2A 4PV1D 2E76B 4IL6X 1GMJA 1KMIZ 1Q90D 3Q3DA 1VF5D 4H44B 4H13B 3AE3C 4OGQC 2FBWC 3B71A 2G3AA 4Z1MH 1DD3A 3AEBC 2E74C 2V7QJ 1KQGB 1ZOYC 1NYHA 4OGQB 2QJYC 1PIXA 1HJ0A 4PV1B 1KTMA 2E74B 5L8RJ 3R4YA 5KLIC 2P10A 1PL5A 4GDOA 2WPVB 3C8VA 3EWKA 2G8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UIX A;  3FGA D;  1NYH A;  1PL5 A;  1TU3 F;  1S1C X; 
#chains in the Genus database with same CATH topology
 5CMZ A;  4QMA A;  4IFF A;  2E42 A;  2FYU G;  2QA4 P;  4YPC A;  3CWB G;  3IAO A;  3AEF C;  1T2K D;  5KAI H;  3RL0 C;  2Z5H A;  3H1I G;  3V5B A;  2ZT9 D;  1SFC C;  1HBW A;  5B66 H;  1ZRT E;  2KZI A;  2KYV A;  2XNX A;  1BCC E;  1LTA C;  5AVQ B;  2M3B A;  3L73 J;  2FY8 A;  4JQ0 D;  4H44 D;  3T97 A;  1PP9 D;  3H1L J;  1NTM E;  3Q5R A;  2WQY C;  2OAR A;  3TF5 A;  2OTL P;  2QSI A;  2W90 A;  1WT6 A;  1ZR2 A;  1ZR4 A;  1FOS E;  4BXL A;  2WWW A;  5KLV K;  1LTJ A;  1AJY A;  1M90 Q;  1L4A A;  2KXP B;  1J1E C;  4NPF X;  3T97 B;  3L36 A;  5GTH E;  2E76 B;  1Q90 D;  2I1K A;  3CWB E;  4IL6 E;  2NPS D;  5KLV D;  1L0N E;  2G3A A;  5APU A;  3MP7 B;  1SQQ G;  3E7K A;  2ZFC A;  1PPJ E;  3H1I E;  2YKP A;  2WPV B;  1LTJ B;  2NPS B;  4YXW H;  3Q5S A;  1L4A B;  2OYH C;  4I7Z C;  3L74 D;  2VRS A;  4YXD C;  1KYO H;  2KIK A;  1G1I A;  5KKZ C;  1A02 F;  2QE7 H;  1IFD A;  3FX0 A;  1Q7Y Q;  1E79 H;  2C0X A;  3Q5P A;  1MV8 A;  3V2Q A;  2WPS A;  2HOD A;  1HTL C;  4U3F D;  2R5B A;  2XU6 A;  3M91 A;  1S4X A;  1Y8A A;  2LR2 A;  3VMX A;  3AE4 C;  1H89 A;  2MJZ A;  1N8R Q;  2KUB A;  3BCC E;  4D6T D;  4DZO A;  4RES B;  3B5N D;  1NU1 K;  3RK2 B;  3M9Q A;  3K5B A;  2XKM A;  2HG5 D;  4KT0 J;  1LJ2 A;  4R4M A;  3VOP A;  2HOD B;  1VDF A;  2YXR B;  1RQV A;  1N7S A;  1FAV A;  3TGU J;  1NU1 D;  2OTK E;  2ZYD A;  4HKZ H;  3GW6 A;  3SFE C;  1FBM A;  3ZDM A;  3L73 G;  1N7S D;  3B71 A;  3H1L G;  3M0D C;  2W8Z A;  2HFE D;  3FXE A;  3W68 A;  5CCG A;  1HJ0 A;  1ZRT D;  3U59 A;  1N7S B;  2YNY A;  2HLO A;  4EYY Q;  1BCC D;  3D70 A;  1R5L A;  3M9B A;  5APV A;  2QVA A;  5KAF E;  3Q2Y A;  1NTM D;  1DEB A;  3N4X A;  4HH2 A;  2ZXE B;  1FDO A;  2A45 I;  2YMY A;  1VF5 C;  2FYU K;  5B5E H;  3RL0 B;  1IK9 A;  1P84 E;  2HPC A;  1HGV A;  1SP4 A;  4GOF A;  1VPC A;  1LGH B;  2W27 A;  2FYU D;  2CPS A;  1GU4 A;  3CWB D;  3FWN A;  2XV5 A;  3V2N A;  3L73 E;  1JCD A;  5B66 E;  1GDT A;  3H1L E;  2WSC H;  3H1I D;  1SQV J;  4L73 A;  2HPC B;  2QRX A;  2K37 A;  2H43 A;  4Y28 J;  1SQX J;  2FYZ A;  2WSF H;  1OXZ A;  3WUU A;  4GKG A;  2WSC J;  2IFN A;  3I56 P;  2OYH A;  1YYC A;  3CCU P;  1USE A;  1XTG B;  3MGN A;  1W2B O;  2K3R A;  1BE3 J;  3PJS K;  2E74 C;  1KQG B;  1RE4 C;  1PZQ A;  4OVN F;  2G8Y A;  3V2P A;  2JWA A;  3BCC D;  4H13 C;  4PJ0 E;  5APQ A;  1SQQ K;  3TGU G;  1S5L X;  3G3Z A;  2E75 D;  2OYH B;  4I7Z B;  1H0T B;  2O3J A;  3F89 A;  1FC2 C;  1AVY A;  2L91 A;  2QJK C;  3KDP B;  5KJ7 D;  2IBZ G;  2WSE H;  2E75 B;  2JKV A;  2A06 E;  2YMK A;  2Z4E A;  1YIT P;  3GLM A;  1EZV E;  5CBN A;  2RH0 A;  1CW5 A;  3FWL A;  1GL2 D;  2M0B A;  3CPW O;  2P7J A;  3RK3 E;  4ZMD A;  1QVG O;  3CX5 H;  1PGO A;  4TLF A;  1IFN A;  3AE5 C;  5AW9 B;  1T2K C;  2HYN A;  2AXC A;  2ZT9 C;  5AW2 B;  2WTY A;  1FDI A;  3GMA A;  3D6Z A;  2LXC B;  3IFM A;  2GM4 A;  1RF0 A;  3TGU E;  4IL6 X;  2Q1K A;  2ITA A;  3WU2 H;  5AVT B;  4N6J A;  3AE3 C;  4PD4 I;  1IFI A;  3S1K A;  1JNM A;  2OGU A;  3NMD A;  3P8C E;  2QJY C;  2IBZ E;  5APX A;  1K8A Q;  1JY3 N;  3V4Q A;  2N9B A;  1JTH A;  4BWN A;  2Y0D A;  4M3L A;  2E76 C;  1SQV G;  4ZNC A;  4W80 A;  4WWI A;  1DX7 A;  4ASV A;  3I55 P;  1SQX G;  2UWJ E;  2W6B A;  2YO2 A;  4KHX A;  5GTI H;  4WY4 D;  3L73 D;  3ABV C;  2JWD A;  1LTJ C;  1EDI A;  2KLV A;  2NPS C;  3H1L D;  1VF5 B;  1X79 B;  2QEX P;  3L4F A;  1BE3 G;  1JTH B;  3O8Z A;  4N3Y B;  1AA0 A;  4C7R A;  3E1R A;  3AE7 C;  1IFP A;  3MUD A;  5AVZ B;  1FE6 A;  5KLV E;  3L37 A;  1JY3 P;  4C46 A;  2R5D A;  2J58 A;  3CME P;  5APS A;  1YHQ P;  4BRY A;  2PAJ A;  3Q1M A;  1RE4 A;  3RBX A;  3RK2 C;  1EDL A;  2H88 C;  5AW0 B;  3KPE A;  2DW3 A;  5AVW B;  1SQQ J;  4U7J A;  1Y9B A;  1ZW0 A;  1NJI Q;  1PGJ A;  3M0A A;  1JOC A;  1KMI Z;  1M1J B;  2QG4 A;  1URQ D;  3UIA A;  4OH8 B;  1YJN P;  1NYH A;  4CPG A;  2KI7 B;  3TSI A;  4BRY B;  2B87 A;  2E74 B;  1ZV8 A;  1EZV D;  5DJU B;  3VMZ A;  4GDO A;  2M8R A;  4RO0 A;  2IPP A;  1BE3 E;  1KYO D;  3HE4 A;  1AQT A;  3HE5 A;  3RGU A;  3RK3 D;  3AE9 C;  1BDD A;  5AW6 B;  2D2C D;  4KJM A;  1N7S C;  3RK3 B;  1Y47 A;  2XDJ A;  2B87 B;  1LTT C;  4NPE A;  1NU1 E;  1NGM B;  1MUU A;  1NVO A;  1IK7 A;  1FDM A;  3HE4 B;  3BRV B;  3HE5 B;  3A7O A;  3TDK A;  4L76 A;  2K1A A;  1EXI A;  3TGU D;  1ZLL A;  4A7P A;  5AVR B;  2AXT H;  3I5C A;  3WMM 0;  1KQL A;  2K9Y A;  5CCG C;  3P8C D;  1YQ4 C;  4Y99 B;  2IBZ D;  2N9Y B;  2SPZ A;  4OWF A;  4GOE A;  2KOG A;  3F5H A;  3L70 J;  2KS1 A;  3NXS A;  1EQ7 A;  3M06 A;  2ZT9 B;  3B4S A;  3HD7 D;  1T8Z A;  1QLE D;  3LID A;  3CX5 I;  1RF1 A;  4H44 B;  1JCC A;  1LTG C;  2NPS A;  2YKO A;  2QJY B;  2KS1 B;  1QX8 A;  2GA1 A;  2E43 A;  2Q3I A;  2FYU E;  1YTZ T;  1NAF A;  3G6E P;  4AQR D;  2KSE A;  3WU2 E;  2KK7 A;  4H0L D;  1Q82 Q;  1RF1 B;  3IN6 A;  1GK6 A;  2RKL A;  4ZKU A;  1FZA A;  3NFQ A;  1SQV K;  2PRR A;  1KQF B;  2B89 A;  2O1K A;  3W67 A;  1SQX K;  3CXH E;  1NWQ A;  4UB6 E;  1FOS F;  3VN0 A;  1SQV D;  2CPB A;  1YJ9 P;  1S1C X;  2E75 C;  5GTI E;  1SQX D;  3CLQ A;  2MKV A;  2Q9I A;  1OVR A;  1SS1 A;  3A0B E;  5AW4 B;  3GF3 A;  1L0L G;  3B5N A;  5KJ7 C;  1LWU A;  4LC1 A;  4UB8 H;  2O1J A;  1JMM A;  3VMY A;  3SWK A;  1BE3 D;  1K05 A;  3P7K A;  2A45 G;  2NRG A;  2H8P D;  2WVR A;  1VQ4 P;  3G9R A;  1RY3 A;  5KLI B;  1KC8 Q;  4PD4 H;  1T3U A;  1J1D C;  1GMJ A;  1S3J A;  3JSV C;  1KFM A;  2KP8 A;  1HGZ A;  2Q6Q A;  2WPR A;  3B5N B;  1SQQ E;  1BSH A;  1LWU B;  1VQO P;  2JR8 A;  3A2A A;  3EQ2 A;  5EFW B;  2QM7 A;  3SWF A;  1U57 A;  3L70 G;  1Q2N A;  3MTU E;  2H89 C;  2N1T D;  2ZVO B;  3VYI A;  3H1J J;  1M8O B;  3L75 G;  2AEF A;  3EFF K;  2WPQ A;  2WT7 A;  2JJL A;  3L35 A;  1IZN B;  1RF0 C;  1L2P A;  5M1B A;  3E1I A;  1U7J A;  5E79 E;  5CJ0 A;  1NHL A;  3NTN A;  2Q7C A;  1USD A;  1RE3 A;  1X8Y A;  3CD6 P;  1NO4 A;  1W5C E;  4WY4 C;  1X22 A;  3H6P A;  4NPD A;  1YTZ I;  1K04 A;  2WT7 B;  1CZQ A;  2ZAE B;  1CI6 A;  3IR9 A;  1QEX A;  2HR3 A;  3BAS A;  1QGK B;  1FZF A;  1RH5 B;  5KAI E;  3L70 E;  3R2P A;  1P84 I;  3VMA A;  4PV1 D;  2C9N Y;  3SSU A;  2E5Y A;  2POH A;  1Q86 Q;  4Z1M H;  1XTC C;  5BU8 B;  3CXH D;  4PV1 B;  5C39 A;  3R4Y A;  1G1J A;  1PL5 A;  1CI6 B;  3MUD C;  1GD2 E;  4ZKP A;  1E5W A;  1H0T A;  1OW8 A;  2JDI H;  2OQQ A;  1VQN P;  1M1J C;  3CCV P;  4W7Y A;  1DEE G;  2WSF J;  2O01 N;  1BSN A;  1DIP A;  2P2U A;  3P32 A;  3PLN A;  4MN4 C;  4HYT B;  1U7M A;  1Z56 A;  5KJ7 A;  3L71 J;  2BAS A;  1SQB K;  3CCR P;  1BDC A;  1JY3 O;  3MIW A;  4I2L C;  2YIU C;  3RK3 C;  1GL2 A;  4JPZ B;  2D2C C;  1VQ9 P;  3HRN A;  5AW8 B;  1SQQ D;  3A5T A;  1S5L H;  1FZC C;  1KZU B;  1NOH A;  3AE6 C;  3H1J G;  2Z5I A;  1KYO E;  2FXP A;  2WSE J;  1IC2 A;  3AE1 C;  1L0L K;  2PP6 A;  1R8E A;  3PP5 A;  1OVU A;  4Y99 C;  1GL2 B;  1SQP K;  4IOI H;  2YKQ A;  1KB9 I;  4IFD K;  1EZV I;  1J1D B;  3MD0 A;  2AEM A;  3CC7 P;  1JUN A;  3VP9 A;  2O01 H;  4DCK A;  1KTM A;  2WSS H;  3C8V A;  3EWK A;  3QH9 A;  2E5T A;  4H44 C;  4PD4 E;  3HD7 C;  2RN0 A;  1PFI A;  1LT9 A;  2KZJ A;  4GOD A;  3WUV A;  3PHL A;  1UII A;  5AVX B;  5GTH H;  4WY4 A;  1A02 J;  1LTI C;  4IL6 H;  3N7N A;  3H1J E;  3H25 A;  3MHV A;  1R5S A;  1VQK P;  1RF1 C;  2LKM A;  3L70 D;  2XZR A;  2IBZ I;  1IFM A;  1L0N J;  1LT9 B;  4OGQ D;  1OW6 A;  2J5U A;  2FYN C;  3D6Y A;  1OMI A;  1PGQ A;  3GF7 A;  4WY4 B;  1WRG A;  1M7L A;  3AEE C;  2FXM A;  2IZ0 A;  4GIF A;  3L71 G;  1KN7 A;  5B5E E;  1AV1 A;  2C0W A;  2NZ2 A;  1M1J A;  2BCC J;  3USS A;  3TNU A;  2Y0E A;  2I8D A;  1URQ A;  5KLI C;  4DJG A;  1LNQ A;  1SQV E;  1SQB J;  2R3S A;  3BCC J;  2I1J A;  1SQX E;  3B5N C;  1LWU C;  4JYB A;  1LP1 A;  1GW3 A;  3TNU B;  1AQ5 A;  2PGD A;  1OWA A;  3PRJ A;  3C9I A;  4EOT A;  1URQ B;  1N86 A;  1FZC A;  4TT3 H;  2R3C A;  1MFT A;  4RKU J;  2K9J A;  2AEJ A;  1H88 A;  1L0L J;  1MZ9 A;  3L71 E;  1PV3 A;  5AVU B;  2N1T C;  2YIU B;  1LP1 B;  2ZYG A;  1SQP J;  1NTK J;  3RBZ A;  2D2C B;  4RJT A;  3H32 A;  5CCH D;  5CBO A;  1MKM A;  3CL3 D;  1FZC B;  3CCS P;  3VP8 A;  4XFJ A;  1YI2 P;  2K9J B;  4PD4 D;  1FS0 E;  1P84 H;  4EI2 A;  5K5G B;  3CC4 P;  3OA7 A;  1KIL E;  3KZI H;  2KNC A;  3HD7 A;  2ZXX A;  1EDK A;  5H2F H;  1S5L E;  3GHG A;  4WVZ A;  3H32 B;  3HTK A;  1L0N G;  2IX7 C;  1PPJ G;  3H1J D;  4WB4 A;  2W6J H;  4JF7 A;  1RE3 C;  3CX5 E;  1HVV A;  1BGY J;  1VQM P;  3HUS A;  3L75 J;  1KD1 Q;  1HWT C;  3G71 P;  2KNC B;  2LXB A;  3HD7 B;  4PV1 C;  2IYP A;  3GHG B;  3HTK B;  1RQU A;  2BCC G;  4YTP C;  4AUW A;  1JEK A;  1DH3 A;  2GUS A;  1PGP A;  3SWY A;  3H1K J;  3TYY A;  1G2C A;  3HUS B;  4WBA A;  3L72 J;  2E76 D;  3AE8 C;  1SQB G;  1HJB A;  1X0T A;  3BCC G;  1YJW P;  4PJ0 H;  2H7H A;  3A0H H;  1FU1 A;  4H0L B;  1K73 Q;  3II6 A;  1QVF O;  3KHU A;  2FYN B;  1JY2 N;  1L4A D;  1G2C B;  2WZ7 A;  1ZME C;  1H8A A;  1KB9 H;  5AVY B;  3CXH I;  5BVZ A;  2QJP B;  1CSB A;  1DD3 A;  3AEB C;  2W83 C;  1EDJ A;  1SQP G;  1NTK G;  2ZVN B;  1J2J B;  1NTZ J;  2BCC E;  1GK4 A;  1ZN5 A;  2P10 A;  1IO4 A;  5APW A;  1GL2 C;  3H1H J;  1TU3 F;  3L71 D;  3RK2 D;  1LTB C;  4HJG H;  1Q81 Q;  1SQB E;  1N73 A;  2OYI A;  1JY2 P;  1VQ6 P;  3U1C A;  4C7N A;  1HF9 A;  1JMB A;  2N1T A;  1KIL A;  2BEZ F;  2IYO A;  2IDB A;  5AW3 B;  2IZ1 A;  3AE2 C;  4O9B A;  4XA4 A;  1NKN A;  1FJP A;  1KIL D;  1VQL P;  1BGY G;  2ZYA A;  2OYI B;  1N73 B;  1JM0 A;  1FZE A;  1L0L E;  2B9B A;  4C7N B;  2N1T B;  2QIW A;  1KIL B;  3V6I A;  2WIT A;  4K35 A;  5TJH A;  2JO1 A;  1SQP E;  1NTK E;  3S9O A;  1NTM K;  3CX5 D;  1FJK A;  1YIJ P;  1PP9 J;  1LT9 C;  1M1K Q;  4XE5 B;  2B88 A;  2FFD C;  1SFC A;  1S72 P;  3H1K G;  2V7Q H;  2Q3E A;  3KQG A;  3L72 G;  2FXO A;  3RL0 D;  4OGQ C;  5CCG D;  4N78 E;  3CCQ P;  2V7Q J;  1SFC D;  1ZOY C;  5APY A;  1N2D C;  5CJ4 A;  1YBK A;  4HB1 A;  2QM8 A;  2AXT E;  1OZH A;  1OFC X;  5AVS B;  1FZB A;  2R32 A;  1L0N K;  4DOJ A;  1SFC B;  3KZI E;  2IFM A;  5KLV J;  2XND H;  3TK1 A;  5H2F E;  5DJT B;  4GT1 A;  3CCM P;  3QWO C;  1BGY E;  3AEA C;  3L75 E;  1S9K E;  1VQ8 P;  2J59 M;  2C9L Y;  2KB7 P;  5AW1 B;  1L0N D;  3JCU H;  2A06 G;  3L74 J;  4R4L A;  1PPJ D;  1LT1 A;  4L74 A;  1D7M A;  1EZV G;  1NTZ G;  1VL2 A;  2R44 A;  3V4W A;  1GU5 A;  3V2R A;  1DD4 A;  1N7L A;  3H1K E;  3H1H G;  5TIS H;  1W2E A;  2CK3 H;  1ZP0 C;  1URQ C;  3L72 E;  3C1L A;  4U3F J;  1J1E B;  3G4S P;  1JO5 A;  5KTB A;  2V4H A;  1VQP P;  1EXJ A;  2BCC D;  1UIX A;  2W6A A;  4B86 A;  1NAY A;  2ZJS E;  3AED C;  4D6T J;  3IF4 A;  3KXD A;  1T3J A;  1AFO A;  2P58 A;  5APT A;  3ITK A;  4ASW A;  1X9V A;  1SQB D;  4DT0 A;  3A0H E;  1MFZ A;  2KSJ A;  2FBW C;  1FZG A;  5BU5 A;  5KKZ B;  3FXD A;  1NU1 J;  5CCH C;  1PIX A;  2WMM A;  1IFJ A;  1KB9 E;  4I6M C;  1YQ3 C;  1NTZ E;  3CCE P;  3OAK A;  1OX3 A;  1NTK K;  1IJD B;  1PP9 G;  4UB8 E;  1L0L D;  1KYO I;  3H1H E;  5AVV B;  3CCL P;  4EDF A;  1BCC J;  1SLQ A;  1SQP D;  1NTK D;  1VQ7 P;  3PH0 A;  2M5A A;  3M0D A;  4JYC A;  4W7Z A;  1NTM J;  2O01 J;  3GHG C;  2JEE A;  1ZXG A;  3D71 A;  2FFD A;  1GW4 A;  2FKW B;  2RMZ A;  3WUT A;  3LW5 H;  3OW2 O;  2L5G B;  3BVH A;  5KLV G;  1M57 D;  4N78 D;  3A3Y B;  2Q5U A;  1SVF A;  1T6A A;  3HUS C;  1RHZ B;  1GZL A;  2M5A B;  2BEQ D;  3CCJ P;  5AW7 B;  5CHX A;  2PFX A;  3LW5 J;  4I1L A;  1P84 D;  2FYU J;  1OVV A;  3L74 G;  2OTJ P;  3CXH H;  3BRT B;  3CWB J;  3PTZ A;  2YO3 A;  3EFG A;  3AEG C;  1KOR A;  2K88 A;  4H0L C;  2FFD B;  4UB6 H;  1BGY D;  1PP9 E;  3GG2 A;  2YXQ B;  3L75 D;  1M56 D;  1S9K D;  1VF5 D;  3H1I J;  2OYO A;  3U1A A;  4OGQ B;  4AYC A;  4U3F G;  4IFM A;  3A0B H;  4EIJ A;  1L4A C;  3AEC C;  2QJP C;  5AW5 B;  3H1K D;  3O6Q A;  4D6T G;  2Y9Y A;  2GUV A;  1HUC A;  3L72 D;  4LGD E;  3CC2 P;  1K9M Q;  2Y9Z A;  2P1J A;  1OIP A;  1WMK A;  3VTP C;  3MZW B;  3FGA D;  1AVO A;  4LLH A;  1KQS O;  3BAT A;  1NU1 G;  1JB0 J;  3CMA P;  1HH0 A;  1LTS C;  4L75 A;  3CI9 A;  3L74 E;  2KLU A;  3O6Q B;  1EC5 A;  1NKZ B;  1QL1 A;  2JP3 A;  1NTZ K;  1OW7 A;  1VQ5 P;  2E74 D;  3JCU E;  1KV4 A;  4K3A A;  3OJA B;  3M9H A;  2P67 A;  5CCH A;  2A06 D;  4U3F E;  1BCC G;  2OYI C;  1N73 C;  1KB9 D;  4H13 D;  1NTZ D;  3S4R A;  1KIL C;  3KYQ A;  1NTM G;  5TIS E;  3SFD C;  3RL0 g;  4JBZ A;  4D6T E;  3H1H D;  1S2E A;  5KAF H;  2A45 H;  3Q3D A;  5E79 H;  4H13 B;  1KFN A;  3P8M C;  2M3E A;  1GTW A;  3LIE A;  3JC2 2;  2Y0C A;  1QL2 A;  5L8R J;  1JY2 O;  2QJK B;  1NH4 A;  3B8E B; 
#chains in the Genus database with same CATH homology
 1U57 A;  3Q5S A;  3AEC C;  3D70 A;  1YQ3 C;  1OW8 A;  1TU3 F;  2OQQ A;  4H13 C;  4H44 C;  4I7Z C;  2QJP C;  4YXD C;  1S5L X;  2E75 D;  3O6Q A;  3AE9 C;  3Q2Y A;  4I7Z B;  2H89 C;  5KKZ C;  4H0L D;  2D2C D;  2E76 C;  2WSF J;  1FDO A;  3IN6 A;  4PV1 C;  3IAO A;  1DIP A;  3AEF C;  1KQF B;  3ABV C;  3AEA C;  2QJK C;  1HF9 A;  1VF5 C;  3Q5P A;  2BEZ F;  1RQU A;  2E75 B;  4YTP C;  1VF5 B;  2IDB A;  1WMK A;  2ZT9 D;  3AE2 C;  2YMK A;  3FGA D;  4R4L A;  1ZRT E;  1NGM B;  3GLM A;  4TT3 H;  3H25 A;  1JB0 J;  4RKU J;  5M1B A;  1IK7 A;  3AE4 C;  2O01 J;  1VL2 A;  3AE7 C;  2E76 D;  1DD4 A;  3AE8 C;  1EXI A;  2YIU C;  3RK3 E;  4H44 D;  1S1C X;  2E75 C;  3D71 A;  1PV3 A;  3Q5R A;  2MKV A;  2K9Y A;  2WQY C;  2JP3 A;  2D2C C;  1ZP0 C;  4OGQ D;  4KT0 J;  1OW6 A;  1OW7 A;  2J5U A;  3AE5 C;  2FYN C;  2QSI A;  3GF3 A;  2QIW A;  4H0L B;  4R4M A;  2D2C B;  3D6Y A;  2E74 D;  1OMI A;  1YQ4 C;  1K04 A;  1EXJ A;  3GF7 A;  1UIX A;  3AE6 C;  2JO1 A;  3AEE C;  2BEQ D;  1RQV A;  2ZT9 C;  2FXP A;  1MKM A;  1K05 A;  2WSE J;  3LW5 J;  3S9O A;  3Q1M A;  1FDI A;  3AED C;  3AE1 C;  1AJY A;  2ZT9 B;  4XFJ A;  4Y28 J;  3GMA A;  4H13 D;  2H88 C;  3D6Z A;  1ZME C;  3G9R A;  3AEG C;  1KOR A;  1R8E A;  3SFE C;  4H0L C;  1KIL E;  2WSC J;  4U7J A;  3SFD C;  1Y9B A;  3T97 B;  3RL0 g;  2NZ2 A;  4PV1 D;  2E76 B;  4IL6 X;  1GMJ A;  1KMI Z;  1Q90 D;  3Q3D A;  1VF5 D;  4H44 B;  4H13 B;  3AE3 C;  4OGQ C;  2FBW C;  3B71 A;  2G3A A;  4Z1M H;  1DD3 A;  3AEB C;  2E74 C;  2V7Q J;  1KQG B;  1ZOY C;  1NYH A;  4OGQ B;  2QJY C;  1PIX A;  1HJ0 A;  4PV1 B;  1KTM A;  2E74 B;  5L8R J;  3R4Y A;  5KLI C;  2P10 A;  1PL5 A;  4GDO A;  2WPV B;  3C8V A;  3EWK A;  2G8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...