3A3YB

Crystal structure of the sodium-potassium pump with bound potassium and ouabain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
278
structure length
265
Chain Sequence
RTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEQLQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Crystal structure of the sodium-potassium pump (Na+,K+-ATPase) with bound potassium and ouabain.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 54
structure length 265
sequence length 278
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3a3yB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 3a3yB02
5AVUB 3VN0A 3HE4B 1HJBA 2C9NY 3VMXA 5AVRB 2IPPA 1FAVA 5CMZA 4B86A 3IR9A 3HE5A 1DH3A 1YYCA 5AVQB 2WT7B 1FOSF 1NAFA 1H88A 2P2UA 4GT1A 3NTNA 1CZQA 2WPRA 2ZFCA 3M0AA 1FOSE 1OXZA 2P67A 1GU5A 2Z5HA 2H7HA 1GD2E 5AW1B 2E43A 3P7KA 3M91A 5AVXB 4GKGA 5AVSB 3MGNA 3A5TA 3P32A 1HBWA 5AW7B 1JNMA 3B8EB 5AW8B 1S9KE 5AVTB 5AW0B 3L35A 4C7NA 5AVYB 4C7NB 5APTA 4I6MC 2WWWA 1MUUA 5AW5B 3HE4A 2BASA 4RESB 5APWA 3T97A 2WT7A 5APUA 2QM7A 3NFQA 1X8YA 1SP4A 5AVVB 5AW3B 2R5DA 3A3YB 3V4WA 3M9HA 3LIDA 4I2LC 1MV8A 3VMYA 5AW9B 3SWFA 3P8MC 2Z5IA 1HWTC 5AVZB 3TNUB 1H89A 3TK1A 3M06A 2R32A 4AUWA 2XZRA 3NXSA 4JYCA 2XV5A 1GU4A 3VMZA 2XU6A 1A02F 2W27A 1SLQA 1H8AA 3V4QA 3I5CA 3WGUB 4HYTB 5APQA 3VTPC 1G2CB 3V5BA 2YO3A 1J2JB 2KP8A 1CI6B 2P7JA 2Q3IA 2Q5UA 1T2KC 2W6AA 5APXA 4JYBA 5APVA 1GZLA 3A2AA 2JJLA 2R5BA 2VRSA 3MD0A 4KHXA 2QM8A 3A7OA 3L36A 4C46A 1S9KD 1CSBA 1MFZA 4DZOA 1KQLA 4RETB 3TNUA 2WPSA 1GTWA 5APSA 3M0DA 5AW4B 5AW2B 3L37A 3WGVB 2C9LY 1IO4A 4EOTA 3KQGA 5APYA 3HE5B 2WPQA 1GK4A 1A02J 3M9BA 2YO2A 2WTYA 1JUNA 1CI6A 2Q7CA 2E42A 1HUCA 1NWQA 2R3CA 4LC1A 4M3LA 1T2KD 3KDPB 3HTKA 4XE5B 3LIEA 3NMDA 3O8ZA 5AVWB 2N9BA 2YNYA 1OWAA 3VYIA 1GK6A 2ZXEB 4AQRD 5AW6B 3TYYA 4AYCA 3UIAA 3OAKA
chains in the Genus database with same CATH superfamily
2C9AA 2ZSVB 1DX7A 1T66C 2ZG1A 2EYRB 2VDNB 5AVRB 1S9XA 4J4PA 4O02A 4IS6A 4PG9A 4H1LA 4DJGA 2PP8A 3OLDA 4N0FB 1TETL 3MODH 4PLJD 3SDDC 3MV7A 2H9GA 4MXVE 2P67A 4UNUA 2VXVL 3LKNB 5DO2C 4ANWA 3AE4C 3GSQA 1UTDA 3D85A 3KW8A 2WXLA 1DQTA 4TSBH 4DGIH 2X9YA 3T4YA 3JBG7 5IVXB 2VR8A 1P4BL 2X5PA 4KJQC 4D3CL 2G3XA 1EA9C 3V0DA 5I66B 3WUWG 3UIYA 1N6VA 3HG1A 1NL0H 3F84A 4NPJA 3WFHA 1ETJA 1PY9A 1NMBL 4KRNA 4XC1H 1FZMA 3QDJB 1PX4A 1ITBB 2FYVA 4D9LH 2FSEB 2DIBA 3LH2H 2DM2A 3S4SG 3WS3A 1NC4D 2N3JA 3SJVE 5BS0B 1E9OA 1UB5B 1W0WB 1ETB1 3FU9A 2OXGA 4LGRB 3EAKA 4QY8B 2VSCA 2EP6A 4WNQB 5BMFL 1ZLVH 4Y5YB 5GGRB 1R5WA 2G60L 4MMYA 5EZJA 5DJAB 2Q0ZX 4LLDB 1A0QL 4KY1L 2BNQB 2ZCLH 4L3EE 1LP9B 4PJGE 5D8JH 4N1HB 4JVPA 4U6VL 3SPGA 4HK3J 5F1IB 5DURB 5F9WB 1BMZA 4XVSH 4J4PD 2G5BB 3L81A 1AO7E 1BDDA 4GP4B 2G4GA 1KTLA 3LRGA 2J3SA 3T8XA 1N7SC 1G2CB 2N01B 1CYXA 2WXKA 3FO9A 3MV7D 2ARWA 5C7XH 1NIAA 3LS5H 2PP7A 3THMH 4XN9A 1U57A 1FBIH 1HWWA 4KKAD 4EIGB 1B4JL 1WT5C 4NZRH 1FVEA 3D85D 3KEHA 4MJ5B 4QRUA 3TF5A 2J1XA 2OP4L 4P3WA 4K5MA 1BZ9A 4G1MB 4Y1TA 4YHOH 2AEPH 3UZVA 4J3VA 4BH7A 1BPLB 3HG1D 4UV7H 5F70A 3ZQWA 4PJ9A 4IFMA 1U8NA 3JTTA 5APSA 4N20A 2RACA 1LEKB 4YBLC 5DJYA 2O5XL 5C0IB 3MO1A 2WKOA 3L13A 3NCXA 3BWZA 3WO3B 1YDPA 1GK4A 1XGQB 1J87A 3NIFB 4JQIL 1TZHA 4DPRA 2VM3A 5EEUA 3VCLA 3WKQA 1MCKA 4L76A 3MXWH 4OCRH 4Z7WA 4YBQC 5B5EE 1A7QL 2YS4A 3WEXA 2EIJB 3V5DB 3QPQD 3KL3A 1BFVL 4P06A 2N9BA 1DVFA 1KPUA 2CR3A 4JBSA 4OGAD 4YGVA 3ILPB 3MDJA 1X7TA 1IAOA 1MZYA 2AABL 2H88C 2WSSH 1INDH 5D6CA 5JW4M 1I7ZB 1OAKL 2WZAA 1K85A 2AQPA 1A6TB 1O0VA 4I87A 1LTJB 4GKZA 2R4SL 3BO8B 5KAQG 4KITB 2EDNA 1U6AL 5HGGS 3ZMNA 5EN2A 1LO5A 2YIHA 5EC1B 1NIFA 3GHEL 5KOMC 3OKNA 5GQBA 5H94B 4R4BB 5I1IL 1CZQA 2NY4C 3TASA 2VM9A 3UTSB 1USEA 1D5MA 1FNLA 2C7UB 3PGDA 1RK1A 2BSTB 4YPCA 3ARSA 3N1MC 3ZYIA 1MXDA 4PJ9D 3RWEA 1ZSDB 4PRNA 4WO0A 5IIEB 1MCRA 4E41A 4FQPA 2OMXB 3PXJA 1EANA 1OT2A 3NJNA 2EUZA 2XHNA 3EO9H 4OZGA 3MACL 4WV1C 4B27A 3VXRA 3M8OH 2FD6H 3VUAA 5D1ZB 4L1BA 3Q5RA 4PRDA 1G6RL 2AJXH 2YRZA 2BASA 3JYCA 4HDIA 1PCXA 1RLWA 4XBEH 4KO6A 3CFIC 3CXFA 5DEFB 2ZG2A 2JQAA 2GJRA 5DEGA 4P46B 5ICUA 4PH8A 3M1OA 4TNWF 3BRDA 4UUJA 5G5DA 1DVFD 2VDKH 3QYMA 1NUGA 5IGXH 2EXSA 4EI6B 2WLLA 3KDMB 3RK3E 2Y2YA 3QCTL 1A9EA 2AJSH 4BHUI 4XHJD 1MFEL 4G8GA 4K9EL 1BZ7B 4BSWA 1HJBC 1WWCA 3CZNA 2AJZB 3BVUA 4WVRA 1EHKB 4Y9CA 1V3MA 4ERSH 2XPYA 4JMXA 3MROA 2XZQH 5CN1A 4X4XB 1T5KA 3C8VA 1OVVA 2CIIB 3HD7C 2OMVA 3MV8A 3H1JD 3TONA 3WSQL 1E7UA 2R27A 3MYJA 4PCKA 1E50A 4AEHL 3RZCA 3ZVVA 3U9PL 4XP9H 4ZO6A 3CBKB 5F7WC 2GIYA 3RUGB 1IEAA 3UAEA 2YJLA 1CW5A 2DMGA 4DP0X 2ENQA 5EEVA 4E41D 3U4BH 1N73A 4HGMA 5HY9A 1YJDC 1S78D 1KLGA 4HCGA 2QQLL 3QDMB 4JFYA 1FZAA 2H0JA 4WLCA 2VLLA 3JCUH 5DK3A 4IOFC 3PNWB 3VXRD 1NTMK 3S3JA 3EFGA 2F5AH 3ZKXC 2Y9ZA 3O3BB 5KVDE 2R56H 1NKOA 4MAYA 2FGWL 1MCDA 2XLLA 1XF3A 4G6JL 2D3LA 3GJFB 5K9QI 4KO5A 3J07A 3L17A 1U33A 5KSUA 2LT9A 1JY3P 4G71B 4S0SD 4ODSL 3KEDA 3DOSB 4P9HL 3O6KH 1BCCG 3Q3GB 1ECYA 1I7UA 3AREA 2PTTA 3HBGA 5C9JA 2IWFA 2DTML 4XMLH 4AV4A 1M6OB 4NPYA 2PP9A 1LTIC 4WK0B 4U3FJ 2NR6D 3GIVA 3QORA 4UOW0 1BCIA 2WSEH 4IGBB 3RWHB 3WLWC 5JORB 4G8GD 2UUDK 1NH4A 1TF4A 2NY0C 5AOJA 1URQB 3T3PB 4PJFB 3Q2WA 1VFBB 4LEXL 2IOIA 3AWGA 2HKFH 3MA7A 3ABZA 2FY8A 1ZPUA 3SE8L 1OARL 1FAVA 2X4OB 3P3RA 4IS6B 3HE6B 4A6YH 5KEZA 4ZAKD 3RZCD 3CC1A 4H1LB 3OKDB 3WL9A 2VERA 1YJNP 3QIBC 2DS4A 3QI9B 2FJSA 4PFEA 1A6VL 1T3UA 3R4DA 3T9WA 5CM1A 1SHXA 2E43A 5GHWL 4L3AA 4BD4A 2YUVA 4X2UA 3H1LD 3QHZH 5TD4A 4NN5B 1UZ6E 4MAYD 1JHKL 3ZHDA 2WWWA 2F54A 1NBCA 3CQPA 5HHMB 4OLXH 3WFHB 3WY1A 1EGJH 5D2LB 3CXHH 4M5YL 4E36A 3ARED 3WS3B 3N55A 1AE6H 1E9OB 3RTLA 4BBWA 4JHZA 3BZEA 4QHUB 3DXAE 3QORD 1F90H 2K8QA 2MNJB 5FECB 2I69A 4JM2F 4MMYB 4XCYA 5EZJB 4Y16C 1GC1L 2A9DA 5DJXA 5JXAL 5CZVL 1G9NH 2VDQH 4U1NB 2JLLA 1L0LK 3LY6A 2D9CA 3TCLA 2OCJA 1EDLA 1JXKA 1L6XA 5IMLA 4LL9A 4QT5A 1TU2A 2XG4A 4U1GB 4PP2B 2AJUH 2Z65C 1NGXA 3GKWH 1U21A 1J05B 2RMNA 2WQXA 1OGAB 2NY1C 3L3IB 4GIPD 5BZZA 4D2NA 2W0FB 4FN0A 3DVNB 4LPYA 3KXFA 5MENE 1E9QB 2EKJA 2X42A 3FO9B 4PJ6A 4HOXA 1B6UA 1RZQA 1DBML 2BHYA 4NB7A 2NPSC 1LK3H 2W6AA 4J8RA 4LSRL 2O3JA 3VNZA 1SS1A 1KTMA 3LZRA 4PY7B 4WW2C 5F1NB 3S6CA 4AGOA 2X7LA 1S9KC 5JXEA 3IJYB 2VQ4A 4H8WC 4MMXC 1JGUH 3CE1A 5D7LB 4K3HA 4PJGF 1AG6A 1YEHH 3GI8L 1BZ9B 1M42A 5CUSL 43CAA 4J2QA 1OP4A 4BH7B 3UZVB 1NMCB 5CSBA 5GZNA 3MLPA 1HH6A 5KLIC 2F54D 3BLBA 3JTTB 4L8SA 4MX7A 2KYVA 2JK5A 3NK4A 4BFEA 1M56D 1CQKA 1RUAL 4CL7A 1E3XA 4WW1B 3N40P 4ALAL 4JDZA 3V55A 1YDPB 4A6YA 3CXDH 4P5RA 5E8EB 1D5RA 1AHWB 2D0FA 3EWKA 1RIVL 3DUHA 2IG2H 4Z7WB 3DHUA 5ES4B 3CMOH 3UEZA 1F02I 4M1CD 2FX7H 1BZ8A 5GS0C 4NKMA 3FWNA 4FMFA 3HC0B 1KPUB 3L45A 4ODHH 1OLLA 4JCMA 4KXBA 4YGVB 3KJ4B 1ZVYA 3NAAL 1SQQJ 5MI0B 3OAKA 3F83A 4IRZL 4PB9L 1NTMG 3VI4A 1VFAA 4YX2L 5CJXA 3B2UC 4NXKA 3TF4A 3ET9F 1H3UA 3I9AA 4GKZB 1ZRTD 4DN3H 4ZMVA 1P5UC 2Y7QA 2ZCZA 5HGAB 3B9DA 2R23B 4U1LB 3OJ2C 1Q1JH 1G4MA 1JUFB 2I26N 3CK0L 4M3HA 3OC5A 1SQVJ 5JXED 2EUWA 4P2OC 5ALBH 3SBWC 1D5MB 2Z35A 4JFPA 5F9OL 5KANG 4NRXA 3V0HA 4I48A 5GZND 2C4FT 3WAKA 1KGCE 3RWEB 4PRNB 4HVBA 5ADPH 3UTTE 1QZ1A 3R4YA 1NICA 1ODUA 2B4CH 2N56A 5D6DC 4UQ3A 4GRLC 3JVGA 4PUBH 2HODB 3TURA 4DQOH 1W72B 3PRZA 4HJ0D 2DJMA 3F58L 2Q5BA 3G6DL 2Z93A 5FO8A 2XY2A 2R4RL 3LNIA 5KVDL 5HVWA 1M57B 4GAJH 3FN9A 3IJ9A 3CN2A 1R19A 3AWFA 3MJ7A 1D7DA 4I13B 1OF2A 3Q5OA 1FGNL 2BIOA 2NX5A 1A9EB 3VRJA 1HIML 3W9DA 5EZOH 2NXZC 2HH0H 3GJFK 4W7ZA 4OBRA 1CFQA 3VMZA 3BAWA 1UD6A 4ZODA 3TGUD 4W1TA 2WXPA 3CXHD 3ZIYA 2VABB 1U3ZA 1MHHA 3QEHB 1S3RA 4N0CD 5TK2A 3MV8B 4M6NL 3GSUA 2X1PA 5FO2A 3IEAA 3IU4H 2BNRA 5DJ8B 3MLYH 1L9OA 3GSNH 2OYHA 5H8DA 3PIQA 1HHKA 4ONOA 2IGTA 3L5XL 4JFQA 3SO3C 3V9EA 4AE1A 2VLLB 1L0LG 2CH8A 3LQAH 3AG4B 4M7ZB 4UANA 2QV4A 2CGRL 4QF1A 4QHLB 3HZVA 1XF3B 5KSAB 1ZP0C 4LSTH 3G5VA 3GSOB 3V4PH 3T0WA 2ZYRA 3FCBA 1JYWA 1SJXA 3NYKA 2BY0A 5C9JB 3GHGC 3LNFA 1JV5A 3FUFA 1IAIM 2I60L 3X1EA 1GH7A 3A0BH 3ZTNL 3MUY1 3FU5A 5DUJA 3RGVC 4NQXA 3B2VL 1KBGL 4FQHA 2IJ0C 3U6XA 3LB6D 3KYKL 4HWZA 1DUYB 3B8YA 3OMZA 4BH8A 1FIGL 1K72A 1PW3A 4NKDA 5DQ9A 4FL4C 2Q7AA 1LWJA 3E38A 1JZGA 4HWEH 1JZ4A 2E7CA 3K2UL 1OTUD 1KACB 2C3VA 3VXTB 4FLOA 1WK0A 1A7RL 4LPWA 4QOKB 1YEWA 1BAWA 2XWCA 3BRVB 1OKEA 3NA9L 1OD9A 5AYTA 1I8UA 2DICA 4UM8B 4G80B 5BU8B 3EDJA 3GSRA 4ZDHA 5HHVL 2WGNB 4OCYL 1MCWM 2WINA 5ALCH 1OSPH 2B08A 4JFFA 5FCUH 3E0GA 1NU1K 5KBNC 1PP9G 1NCOA 3RX8A 3BOVA 2RB8A 3AT9A 4GT7A 3FO2A 1S9KE 1T20B 2H6PA 1QPPA 1JTHB 2VH5L 2MRYA 2N0KA 5IMMB 1AVAA 4OB5L 2AK4D 4UWQB 5LAPA 5C6TL 3N1GC 4D94A 3SGJA 1BJ1H 5FFGA 3VH8B 1U8MA 1DDTA 2P42B 4FFWD 4QXWA 5JZ7D 2XQBL 3FW6A 4F80A 3EFFA 5BZXA 3TPUA 3KPRB 3WKPA 3NABH 4N9GB 2V5SA 4X7EC 4YSAA 1RKRA 3ARWA 1UFUA 2R1XA 4ZTOL 4Y5XC 2OTLP 4MZIA 3GSNA 1DVZA 3PUCA 1FRGH 4HKJA 5B7FA 5IUSA 1UZ6F 3NN8A 5F6HJ 2QJYC 4NJ9L 3M06A 1EAPA 2YRLA 4N2GA 4TQIA 4YXLL 2PKDA 3CX5H 2X4NA 4U4IA 1Q2NA 4QT5B 1KWGA 3QRGL 2Q10A 4XMXA 3WGUB 1YPZE 3P0YH 4AIXA 4CPGA 1THCA 2C9VA 2V33A 4N2AA 1I3UA 2DYRB 3KXFB 4ZMQA 3HJEA 1IVTA 4Y99C 4L4VE 5D71L 4KK5C 3V4PA 3QJUB 3H7BB 2VRKA 2CBQA 1EDHA 3FK3A 4JFFD 1JBJA 4FNRA 1P84H 2BINA 4FULA 4YO0B 2KLUA 2ZXCA 2AI0H 5TJWK 2B87B 5D7IE 2XN9E 1AYRA 4JQXA 4Y4FD 1G4RA 2TRHA 3B5HA 3MNZA 2L7JA 2XWJB 3QNXA 3BWAA 2CHNA 3L5WA 5LGJB 3VGAC 4WKZA 2YA2A 1WF5A 1HH6B 1IM9B 2A06G 4KFZC 1AGFA 4HBCL 4MX7B 3TO4C 5F72S 3T0EA 3TM6A 2G30A 1Z3GH 4UDUA 3WTUA 4UNVA 4POYA 4LDLB 3VSUA 2J1YA 3M9BA 4K3JH 4U3XA 1TJXA 2GHWB 5CNHA 4A6YB 4LZKA 2WIIA 1KN2H 1FE8L 4G8EA 4S0HA 4Y5VA 4YQXH 1EMTL 2BZCA 3NIGF 1VCAA 5DZOA 4DAGH 3BAYA 2E9IA 2Z3FA 2CRIA 4X5XB 4LIQH 4F8LA 5F3HB 3Q6GL 2E7BA 3Q8AA 5D5MA 3HLKA 2NXYC 3MLVL 5CLYA 3BLPX 1IQWL 1OFCX 3O0RL 3VI4B 1VFAB 3BFOA 1K8IA 1NOFA 5B66H 1ZK5A 1GL4B 1P7KA 3ECQA 4NCDA 5C0AE 1T1XA 3NESA 2OULB 4LAQH 5D2NB 1NWOA 1MFDH 5JPMA 1SEBA 4TVPE 2R9HD 4GO6B 4ZFOL 1AYOA 2Z35B 4OAWA 4UTAL 4MXQD 1DQLH 3GI9L 4KHTL 5AG8A 1T7YA 2FYZA 4DTGH 1T3FA 2ADGB 2F68X 4A67A 3PGFL 3C6LC 2VC2L 3KJ6L 2E27L 3RWIA 1A8ZA 1B2WH 1ZKAA 3D0VA 3PJNA 1T1YA 5BRPA 2XX1A 4GG6E 5EUKB 4ELMA 5B8CA 4YK4B 1DP0A 2K7PA 1X8YA 2IH1B 4IRJC 4PG2A 1GGYA 1SQXJ 4JFDE 5KS9E 1ZPLA 5KBPA 3S8FB 3L7FB 2OR8A 2R39A 1MCIA 1IKNA 3QNZA 3ZZSA 3OPZL 2DMBA 1JCVA 5AOMA 4G7RB 3VA2C 4DIXA 3PCYA 3Q0HA 4N22A 1X5KA 1NU1G 1OF2B 3WFBH 4FKKA 2NX5B 4HV8B 1VB9A 4WHCA 1QFWH 1JK9A 1OAJA 3GD1C 2QDVA 4S1DD 1G0DA 1L7IH 2X6UA 1FP5A 3H7LA 5MEPB 3F00A 1CFQB 1ESOA 1UXWB 1YEJL 2VL4A 1EXUA 2BCMA 5D1XA 1ZHBB 5D9SA 1QGKB 3VXSE 1L7TH 3FZUC 1JNLL 1URLA 3ZE0B 1UZ8A 1GYCA 2ZKYA 1MHHB 4RA3A 4YLQT 4EMZA 2GUSA 3EJJX 4XX1E 4U7JA 5C1MB 5M94B 1HHHA 3CFEA 2BNRB 3VXQA 3GW6A 1ACZA 1KGUA 4WK2B 4WY4A 4P2QE 1E79H 2N7AA 3NRFA 3HMWL 1CFNA 2WSPA 3OJDA 3VG9B 5KVFH 4K55A 2ZP0T 3CX5D 3P11L 4JFQB 1PIXA 1DZ0A 5EF0A 5DU7A 3DUUA 2AANA 3IXTA 4Q6YA 5KBMA 4PWFA 3X2QB 2C9LY 5I15H 2MMXA 4DOHE 1YAZA 2J12B 4Y5YC 1X5HA 1NM4A 5DT1L 4KKQA 3G5VB 2EO9A 1XCQB 3KPSB 3RL0g 1P84D 1LMIA 3SPJA 3VX0A 3G04B 4FJYA 3B1TA 3FH8A 1OE2A 3VD3A 3TBVA 1KXQE 3IRPX 5A6IA 1G7HB 5F9WC 4F7CA 4R90H 1RZFH 1MIMH 4XC3L 3RPIA 2X6VA 4PIRF 2DQIL 5F7KC 3V5KB 4BFFA 3DHMA 4F92B 5D1XD 1Y07A 4A7SA 4XTRC 1CDCA 4F9PC 1D2PA 2OTUA 4NKDB 1HSAB 2NUPB 1FORH 5T5FL 2VZSA 2QKSA 3ARPA 3C8KA 4ONHB 1FDLL 5AG9A 1S9WB 3BDYL 3K91A 3KYOA 5B1KA 3STLB 3MU3A 1EBPA 2HG5B 3OR7B 4M4RA 5GS0L 5CEZE 5D7SH 1NLDL 1J9CT 4WY4D 1W2EA 3IYLW 3QXDB 4HHWA 3BCDA 4ZD3H 4ZDHB 5A1AA 2DQHH 2HLAB 4A39A 1IGFH 3OMAB 2WINB 4P23A 5MP6L 3F8UB 1NWPA 1OW0A 1OWWA 2GM4A 5LQBH 2E6JA 2JFCA 5CZXD 3V6FB 1EHNA 1FFOB 1HYSD 4PB0H 2H6PB 2FBJL 2EILB 1GZQB 3GBML 4FA8A 4LLVA 4YDMA 2CJUL 1N70A 3NTCL 1E67A 4WCYL 1F1AA 5HYEA 4XVUC 1YQ2A 2OR7A 4RMQA 3SPHA 2JXMA 2KSJA 2V9QA 2UY7B 3EFFB 1Q9KA 4Z7QF 4HG4K 3CXHI 1FZFA 3BZ5A 3UJTL 3IAOA 3K6NA 3I9GH 4Z7VB 3GSNB 4B7IA 5I0ZA 3VXUB 4P5KB 2Z5IA 2FQEA 2ZX7A 3NN8B 5C08A 3FOLB 1DO6A 4BWNA 4KNTA 3MLUL 1LTJC 1H8NA 3CWBG 3CVHL 3JWNH 4KQ4H 3TA3A 2CBPA 2FYYA 4JN2B 4LKXA 1F42A 1XR8B 2KZWA 2AEWA 1D5XB 3H2WA 2GC7C 1NBQA 4ZXBC 1J18A 4K5PA 3UADA 1A6AB 3N7NA 4FQ1H 1GW3A 4LDOB 1V27A 5EU3B 1G7IA 5IHZB 4J39A 3UCQA 1BQLL 5FM5M 5D7HA 5F71A 3FU7A 4QTFA 3ZHLA 3HE7D 2EAEA 4PJEF 4P23D 3PH0A 1T1ZB 3E3QE 5T1MB 2X1XR 1UQSA 3FO0L 3QJQB 3W0WE 2BJMH 3O8XA 4AUYA 3CCVP 1TTCA 3L6FA 3MNZB 3HHMA 1SQ2N 4LCCA 5D1ZC 4GQQA 1T5XB 2E6PA 1MDTA 1WA0X 5GGVL 3S3PA 4WKZB 2GTWB 4DP5X 2FYUD 2EVHA 3T0EB 1HDMA 1YPZF 5LWYL 4G3YH 3ZDXE 5KJ7A 2LAGB 2IAMA 4P46C 4KROB 4MMZC 5FK9A 1DVSA 5K33A 5I0WA 3QO1A 2YC1A 4UF7C 2E0PA 2RJMA 2XQYA 5AZEH 3T6ZA 5F0JB 2L3BA 1N59B 4E9LA 2WIIB 3ESUF 1FN4B 1PF3A 4G8EB 4S1QL 5CCGA 3D4ZA 3DX1A 5TDNB 4WHYH 4FTVE 5C08D 1X0TA 1Q90A 4H0IA 4HUKB 1MCOH 3TA3D 2X1QA 4HSCX 3IFOB 1R75A 1SZNA 2D7TH 1K3ZA 1OTSD 4AQRD 5ITBL 4TMPA 3AEFC 1FO0B 3OZKA 3QCUL 3QHFL 5CIPB 5GGQH 1T22A 2F6AA 4HP5A 1GSKA 2KPWA 1BGYD 3HE4B 3F7YB 5CGMA 1CZ8L 1PD1A 2VLMD 3ZE1E 3VW3H 1X5MA 3APNA 4JAMB 5IB5A 4F8OA 4K73A 5TPWH 4PV1B 1LO2H 3O8XD 1IB5A 1U2CA 2YD9A 2HFFB 1YUHB 1DQJB 3LQZB 1VJSA 4NUGL 1SVFA 1ZTXE 2X70B 1RY7B 1PYWB 1MW2A 2ICCA 2VR6A 3ARZA 4PVLA 1YEDB 3VH8G 5KJ7D 1FI8C 2IAMD 2AKRA 5TISH 3D0VB 5JW3L 1KYDA 3FH5A 4ODTL 2IGLA 3UDWC 2HTLD 1KCUH 4KKPA 5L9DL 4LGPB 5JPNA 1SHMA 4KJWD 5B8CB 1E2WA 4NO2A 5CCGD 1MKMA 3VRLE 4IGBC 2OQQA 3S2AA 35C8L 3PWUA 3HAEA 3QFDA 2VW6A 4PCSA 1TNNA 5AZ2H 3NJVA 1URQC 1Q90D 3NSYA 1C5CH 4F37K 1G1IA 4GSDL 3H1ZA 2YKPA 3P30L 1QVGO 2BIPA 3MRJA 4HC1A 3O3AB 1L0ND 1EFXD 4XVJL 4AQZA 1HWTC 4OT1H 1MWAH 4DPAX 4UT6H 4CBZA 4CU8A 5KAIH 2O5NA 4UU9B 4JRYE 3HE6C 1IGCL 1XF4B 1EXUB 1RK0A 2YD2A 1ZIBA 4GG6F 4DP1X 3LPPA 2F8OA 2K9FB 4LKCB 5BVJB 4TNGA 3KVPA 3D4CA 1HS6A 4HUWA 3II2A 1JEKA 3P8CD 5FYJE 4EJ1C 5IR1A 5KS9F 1HHHB 4F1ZA 1A5FH 2FR4B 3L71E 3N9GH 4KTEL 5DS1A 3BH9B 2JB6B 2QR0A 4QRPE 2KC0A 3BQUA 2EEXA 3NH7L 4EIBA 5E2TL 1FDIA 1BIIA 1UA7A 3WIIL 1GOGA 5GRJL 3QG7H 3OJDB 4GKNA 3K4DA 1J0JA 2W81C 5LBVA 5JOPD 4F7PA 4U1MB 3QG6A 4MJIB 4HCIA 2WNWA 3DUUB 3IXTB 1ZE3H 3UPAA 3EOBB 2EDMA 3VFRA 2G3ZA 2IH8A 2AJ3A 3NQIA 1DQQB 1L5GB 1E6JH 1H15B 2Z4TA 2K7QA 1OGPA 4BV1A 1S7RB 2O6FA 3MPCA 4X6DE 5E9AA 4OZIE 2BERA 2GFBB 3L95A 1BCCD 5ANMB 5EOCL 4LQFH 8FABB 5LXGH 5E1GA 2XIIA 4U1GC 2XXGA 3P9WB 3RPIB 4X50A 1F41A 4AJWA 3IDYB 3VGEA 2AGJL 2ZOLB 4QRQA 3F7RA 2K0RA 3MTRA 4CBPA 1HVVA 2P52A 2QELA 5K59E 4WUUA 3EFFK 3C8KB 3MP7B 2X6CA 5JIDA 1BX2A 2QQKH 4JGNA 1FOSF 1JHLH 3CFKB 4F8NA 4IHBA 3KW7A 2Z1PA 1M4KA 4K5NA 1MNNA 1H3WM 1ND0B 2FWLB 3BQUD 4U4BA 4APQA 2UV3A 3GBNH 4WO4B 3RTQA 1F4WL 1NMCC 3ZDYE 4HIPA 4P23B 4MBOA 4PRIA 3UC0L 5I6XB 5KZCB 3MNVA 1PGPA 1IIKA 1MWAA 1RXLA 4Y0GA 4UT6A 3PLYA 4BE6A 4NDMA 4JANB 2R7EA 4LSVH 5KYWA 2BVPB 3MLTA 1ZJAA 2OYMA 1TOXA 3WMQA 1AHWC 1QLEH 3IBOA 4UAHA 4ANKA 1J1OH 3JSVC 5E8DH 4ABQA 4QXVA 2A1WL 2E4TA 1REIA 2JCWA 1QUPA 2PWFA 1DQDL 4ODVH 3V10A 2WOBA 3C8HA 4QI3A 1MCJA 5JHLL 2BCKA 1E27A 3EYVA 2XDJA 2ENYA 3QUKB 3I56P 3KJ4C 4K94C 5MI0C 1PZQA 3GMMA 4KZCA 3D30A 1TZGL 4G42B 1EQWA 4M03A 2CJSA 2F1AA 1NGMB 4WUUD 3RVUD 1IK7A 1WBXA 1IX2A 4I0CC 4RSYA 4JY6A 2CCWA 3GEWB 3T0XA 5KWYC 3OGCB 4CC1A 2AQ2A 2GKIA 3UABA 2W65A 4XPTH 1G7IB 4KPHL 1JV2A 4APQD 3HPJA 4XNYL 1PZSA 5D1QA 3DKHA 3V8OA 5L0QC 3HNTL 3NRPA 1PNCA 1SF3A 3RTQD 1SJEA 5MEOB 1X5YA 3F2LA 1CDBA 2KZJA 1EZVG 1S7TA 2VDNL 2YPKB 3E7JA 2FECL 1C5BH 3H1KJ 3GM8A 3QCVH 1RZGA 5C3TA 2OPCA 2ITAA 2DWTA 2FUQA 1W8EA 2V3EA 1HZHH 5E5LA 1DJIA 1P84I 2AEQH 4JNXA 3FTGA 4HPHA 2XUWA 2E75B 1ZHNB 4PW3A 1ID5I 4NQQA 4PRBA 4NZFA 5CO1A 3L37A 3MFFA 1HDMB 5JIPA 1D5ZB 3MRPB 3KWWB 2NSXA 2AXJA 1H6EA 1WFIA 2P7TA 3QGVA 5GGUA 4TNEA 4GG8B 1J9SA 3A24A 4LBAA 5ESQB 4LF3B 2YRPA 5DD1H 4R6UA 4DZBA 1EWHA 2R29L 1DJSA 3AEDC 3I6LD 1KB3A 3AGWA 5EUOA 3D71A 1J9TA 4AY0A 3GIZL 2KB7P 5GPRA 1RUPH 1ZVSA 1P2CA 1CXFA 4YDJA 4V1DA 1LWRA 4ZX3A 5DR5L 1IJ9A 3IDIA 1T22B 1CL7L 3CSBA 4HUCA 3VDCA 3VRIB 4OJFH 1CU4L 2VXUH 3B6SB 5D1QD 1ZDQA 5FKPA 3QE5A 2NW2B 1E0OB 4UNTA 1XD0A 2KNCB 1TU3F 1RIUH 2YKLH 4NQTA 3RX7A 1HINL 1AOHA 2OMNA 2EH8L 2OMYA 2EIEA 3MV7E 4BDVA 4NQEA 1NMAL 2RFXB 1NYHA 4M7ZC 5FYJL 4GFXA 4KQ3H 3VYPA 5DHEA 3VFNB 5AW7B 2GUOB 3G08A 1BLIA 5C6WH 5KSAC 2FZ3B 4NUPA 3HUSB 1GL2D 5FR3A 3TYFB 3HG1E 2AKRB 2K3HA 2LFEA 1JPFA 5CILH 1IBGH 3S4RA 2EZ0C 4NI3A 1CFVH 4WTQA 4ZO8A 3W57A 1OAYH 2O26U 4I2XA 5ERWA 3ERXA 3IAQA 1AHMA 4HS6B 3BVWA 1KIRB 2IMNA 3WYRA 4TUKH 3HAEB 1AZVA 4KK9C 4PLNC 2ADFH 3EYUL 1KNOB 5SWQB 2E9WA 3QJTB 3LEVH 3RI5K 3ZUCA 4FRWA 5JO5A 4GKLA 4V1DD 5IVXF 3QWRD 4GMTH 2XWTA 2F58L 5TQ2L 3MQIA 4AUWA 1YEEL 2E9GA 4FA6A 1BD2A 2X12A 4ECNA 5HHQA 1BAFL 5L88L 4BXVA 4E0RA 1N9PA 1WZKA 1QLED 4NQVA 4H25B 1SEQH 2DLHA 2GSIA 1QFWI 1Q81Q 4L0ZA 3VRLF 4YHLH 1Z5YD 4QLWA 2WANA 4XXDA 3FU6A 4A7GA 4P4KB 2VW4A 2A38A 2FB4L 3GS4A 4HUWB 3CDZA 4NQED 5J5EA 2IDUA 4RDBA 6CGTA 2JJSA 3ME0A 2PR4H 2JQZA 4BRYB 3MCKB 3P4OB 2QR0B 5E6IA 1SFCA 3TV3H 4Z8FL 1RH8A 1Y18B 1QWHA 4NQCB 4XBMA 5GSRA 3FWLA 4JFZL 1BIIB 2NMSA 1JTPA 4LAJH 3D06A 4C54A 3SYPA 4I4WA 3AXLB 3B2MA 3QG6B 3QZPA 1YYLL 2EKSA 1DVYA 4G1EB 2Y2TA 3V6ZA 5E7FA 3TZVA 2Q6QA 3VFRB 4OM0L 5J1AA 4YHYB 2GJ6A 2RBLA 1H6FA 3U36A 1SRDA 3WN6A 3HN5A 1BOYA 2A6KB 3V2PA 1BGXH 3EJQA 2E59A 4JG1L 1XV8A 3D50A 3NOIA 3EZ8A 3MRLB 4M7LT 4NKIH 3S9DB 4HH2A 4QAMB 4KHXH 4U6YA 1KN4H 3HI1A 2HA1A 4NFCA 2WB1A 3ILDA 3BEWB 1V3KA 2KH2B 2GW5A 3ROOB 1KGXA 1AC0A 3S5LG 5SWSD 5CCKL 3CFMA 5D72L 3M6DA 1KCKA 4U05A 1KCBA 3CDGB 4OM1L 4QRQB 1PFIA 4QRRA 2PYFB 3DX9A 2NY5H 5BVPH 3DA0A 2PO6D 2AXWA 3WD5L 3PHSA 3V52L 1KMIZ 1AXTH 3OAWA 1OB1A 4EOWL 3TNMB 2J43A 2DQDH 2AJYL 3G5ZA 4Y9EA 1J5CA 1YBKA 5E6ID 1KYOK 4P2RA 4X6DF 1SFCD 4YNYA 1NCDL 1P6FA 4OZIF 5DI8B 3RU8H 3H1JE 3NCYS 1FYTA 5KG9B 1AGBB 3AE7C 2V17H 3I2CH 4OGYH 5IB4A 1EVTC 2LLNA 4LNRA 2WBJB 1W2BO 5D55A 4PRIB 4HAGA 4EVNA 1E6OL 4Z0XB 2OBGA 3W11C 1MHEB 1PP9D 1DJXA 1RU9H 3TZVD 3V6OC 4E41E 2GCYB 4NDMB 2GJ6D 1T7VA 4X6CB 3BATA 1K4DA 4OZGE 2QV2A 1Z56A 2B59B 2CUAA 3VXRE 2QEJA 2D7PA 3MRIA 4NO0A 4PJCA 3T8MA 1XGUA 2E7LC 3CQQA 2MCG1 4OD2B 5T1LD 5CJQH 1JPST 1XX9C 3RP1A 4LPTA 3ZDYF 3GLAA 4FQIH 3DTUB 3MBEA 3RDTA 1E27B 3FTSA 3O6LH 4F7EB 3C12A 1O6SB 4YVUA 4K23H 4QRRD 1UASA 2FEDC 2HPCB 2PABA 5I9QB 3ZL4H 4TNFA 1CI5A 4G8GE 1LNUA 4G11A 4XMKL 3JWDC 2B8OT 3CD4A 4MHHI 4N0CC 4EAEA 1YNTA 4NI6A 5JA8B 4UQCA 1AJ7H 5D2NC 5FGBA 4BZYA 4OJAA 4P2RD 2M5AA 3QXUA 3A6BH 4N3UA 1OHQA 1FYTD 2EXTA 2NZIA 3TYGH 1NIEA 5EIQA 1C1EH 2FSDA 4RQQA 5KTEL 4X7TA 3NFSH 4X80H 1CBVH 3HW7A 2N1TA 1QLRB 2VSMB 3L3DA 1SJVA 4KHXA 1G9NC 1GIGH 4O02L 2QM8A 3AE9C 4HS8L 1RZGB 4RMWA 1QEXA 1UEYA 2FNWA 3FT0A 4E9TA 5B39B 4XXCA 2P26A 4MA7L 3ZK0A 2BVEA 2BP3A 2CPSA 3FTGB 3H1LE 2JJUA 2VDMH 2J7LA 2WLHA 4NO0D 2WB7A 4PVNA 4YK4C 2A06D 5EO0B 4Q9QL 2EUVA 1UWEL 2R1WB 2HJKA 4KUZH 4XO8A 3BP7B 5APYA 4H13B 3HE5B 1F11A 2SODB 1HNYA 5DGRA 4WHDA 4M62H 5BJTB 5ECGA 2NZ2A 2OFQA 5D7EA 1R3JA 3MBED 3DPDA 3RDTD 2Z8SA 4G5ZH 1E4HA 4O58L 3RUGF 2K70A 3B9EA 3HS0A 1IILE 1YNLH 1X9RA 4X6EA 4CJ1A 4NKOB 1W16A 2PPFA 3L3KA 2BY2A 5BV7H 3SPIA 3QH3B 2CO7B 3VYIA 4ZS7H 1DCEA 1ZVSB 2D9QB 4WTZA 4YDJB 2FJGB 3DSNB 1H9DA 2RR3A 3VD4A 2KUTA 4WAFA 4JZJA 4GXUN 1AA0A 2C9PA 5F96L 2WXQA 1MAML 5I1KH 4TM9A 4I9WD 3UYPA 3TO2B 1U8PB 5F7DA 3DX3A 3KCWA 4RDQG 4POZD 2WT7B 1R24A 3P9MA 4NZUL 4P57B 4S1SH 4YPGB 1XIWA 1BW8A 4B50A 3KR3H 2N1TD 4NRZB 4XPHL 1ZOYC 2H2PC 2WWMC 5IW1A 3LHAA 4FKEA 3VG9C 4CMHB 1ACYH 2V3DA 5I82A 1BM3L 1QWNA 1JWMB 2LAAA 3BDBA 3QFJB 4U1IA 2KZIA 3IGLA 5IHBA 5FFOA 2ENJA 1GXEA 3T3PF 5M7QA 1F4YH 3CFBA 2KT6A 3QYNA 1G7MA 3FSVA 4OIIL 2QSQA 3IDUA 4LCWB 3STBA 3VFWB 2WCSA 3AADB 5DC4B 2F54E 4FQXD 2J8UB 4MN4C 4BIKA 1QRNA 5ERWB 2IO5A 1ZOXA 4QR7A 1AQKH 3MJ8B 2WQRA 1QI4A 4RAVA 5GS3A 1KFNA 1UKQA 3L3GA 3BSZA 3D39B 3U9UA 2KUBA 1WUNT 4DFHA 1HSBB 1XGPB 3WMSA 2UXTA 3ARBA 5JO5B 3X1BA 5C8JA 1N5YL 2WZ5A 1HOCB 5A2CA 4PR5A 2VXTH 1BD2B 1EPFA 1I31A 2CGYA 1AY1L 3KM2A 2AK1H 1TQVA 5CSZA 3JCUE 5FYLL 5CEYA 4NQVB 3TCXA 3C60A 3KYNA 5D2LF 3T2QA 1XIWD 5J9PB 3U2SA 4DGIL 2QQQA 4XXDB 2O01J 1PFOA 2L7QA 1NAKL 1B0GB 3NCJH 1SLVA 1NKZB 2EXYD 4J6IA 3ZL1A 4FZ8H 2HFEA 3EHBD 3CUPA 3ME0B 1XF5B 4XC1L 2IPKB 4NM8L 3RHWK 4MA8H 4HZ1A 4D9LL 3LH2L 3BWSA 2D2CB 1V55B 2QVKA 3H6JA 1NJIQ 3QS3A 1JG9A 5BW7A 3LVEA 1TVHB 5A2BA 3SGJC 4JO3H 4TRPL 2NCEA 3IJSB 4LMQE 5AAPA 3RY4A 3CSYA 3V6ZB 1AI1H 1ZN5A 1QRND 3WGVB 3DTXA 4O51B 2ESVA 4DKFL 5I1LA 2ZCLL 3BAEL 4WU7B 3U36B 4HKZH 4C58B 3M17B 2HT4C 2VUYA 1MAJA 2E86A 3UAJC 3ARBD 4U6YB 2VLKA 1XGYH 3HI1B 4UZUA 1UIIA 4L1DA 3ZX1A 2MSPA 3ESMA 3ZKQD 3W2DL 4YDKH 3OKLA 4U1SA 2VLRA 3OQ3B 4YDVB 2V7QJ 5AW6B 5EU6A 1H3GA 3KPTA 1CGSH 1X4ZA 3S35X 1O9WA 3ARGB 3QUYD 2AAVA 2WKOF 4RGOH 3GHBH 3P73B 3AWEA 4KAQL 1K04A 1KGJA 3TGUE 4UV7L 2HFED 4OJCA 3CXHE 4ZS6D 3D2TA 1JYNA 4ZQKA 4Z7WF 3BRGC 4PWGA 2IBZG 1Y47A 2F74B 4M93B 2JP3A 5IB4B 2QPSA 3OSVA 2DQFA 4PLKC 3F85A 2APXA 3MGOB 1HC1A 3T0EC 1NTKK 2BNUB 3X1NA 4R96B 3RFZB 1O7SA 4KROC 2APWA 3JV6A 4OCRL 4YHPA 2ESVD 2VN6A 4B96A 3MYZA 2EDLA 4EUPB 1K4DB 1N4XL 2R2HA 4OSUL 4YSUA 4DGUA 4PPTA 4KX7A 1AACA 2Y7NA 3CMGA 3EO0A 1NAMH 2EIDA 3ITKA 5IFJA 5HDOA 3A21A 25C8L 3BHBA 2VLRD 3K3QA 5EU6D 1ZGLB 5I8KL 5I24A 3W9EB 1U8KA 1AIFB 3NZ8B 4G6AD 2OSWA 2NX5E 4JYCA 5FDWB 2JV6A 12E8L 2I25N 4OZGF 3TJHD 4OKVB 5IMKA 3L2LA 1UM5L 4TTDC 4HGWB 2EDBA 1BAGA 1L3NA 1HCVA 2ARJQ 1YNTB 3VFMA 4IMLA 4PV1C 3VMOA 5LGKA 1IE4A 5SX5K 5PCYA 4BWUA 2KZKA 1KT2A 4HKZA 4X7TB 4W9HC 1FH2A 2BNRE 3L9BA 1CGXA 4S2SB 5CR1A 1E4XL 1L2PA 1RJZA 5ABDE 3D0LA 2AJXL 1ORQB 1OD7A 1OCRB 2Z31A 2XKNA 3ARRA 3JV0A 3LN4A 3M45A 3OB0K 4XBEL 2WPVB 2YPVL 5DC9B 1RSYA 4NN6B 2AEMA 3BYTA 2Q76B 4WWKA 4XAWL 4BFIA 4Z77A 5B8CC 3AC0A 4K71B 1BF2A 2ODIA 1BV8A 1JOIA 1LYQA 4NNPH 2O61A 1SMAA 5C0CB 4X9GA 2AK4E 1BMGA 2YA0A 2YMYA 3ILQD 4OZFB 5E2VL 1CI6A 3LKPA 1DLFH 3IJEB 4ONFL 3T1FA 3EYQC 5CJBA 3HS0B 4R7VA 3FBKA 1ZLWK 1KIQA 4NOFA 2XZQL 4X6EB 4CKVX 2IWEA 1I85A 3L3KB 4HUMB 4NGHH 1KEMH 3GFUA 1TKWB 4HIQA 2W9DH 1U3NA 1EZLA 3GWJA 1YEFH 1JY2O 4J3OG 5CD5C 4XP9L 3VO0A 4AUJA 2EXWD 4Q9BA 3PP5A 3L1OL 1WD9A 3G5XA 3M7FB 4YFDB 1GZPA 4DERA 3DX2A 3S3BB 4XNMA 2CNZA 5I6NA 1S7UB 4WY4C 4LLUA 1GW6A 2VAAA 4LEEA 4WRLA 2F5AL 2PN5A 3MRFB 1IZJA 1RZIA 2R0WH 2R56L 4CVXA 1UVQA 3CFUA 2XVLA 4MB3A 3ZTJH 1H5BA 4JFFE 5AVXB 2GK0B 4XZ4A 5E70A 1GSMA 3QAZB 1HILB 4WWKD 2VERN 3TTSA 4YHZH 2AVFA 3BD3A 5C7ZA 1CURA 1G7MB 1PPJG 4YLBA 3GXFA 2EDOA 5EEXA 2CK3H 4KMQA 4CW1B 5HD8C 4AXWA 3F7PC 1AR1B 3S48A 1LEGB 2XPGA 1QO3B 2G3MA 4DVBB 2ZUWA 4PJ7B 4RX4A 2A9NH 1JWUA 1HEHC 2DQEL 1T0MB 4XN2A 1DEEB 4YWGH 3UTQA 2FT7A 3L3GB 4KWUA 3AG2B 3IDYC 3QUZB 3U9UB 3MJWA 2B1HL 5EOQH 4GSRA 3S3DB 4G8AC 1VAHA 4HK0A 4L3CA 4A6YL 1DN0B 3ZHKA 1ZEAL 5DVLA 1CFMA 4F33A 1SBBA 3MLSH 5KSBA 1P0SE 3MSPA 4JFXB 2ZKHL 3ZKND 4Z7NE 5CSZB 2IVFC 4IRSB 1N19A 3C60B 2KI7B 1OAXH 3POCA 4EN3B 1MPAH 4KU1A 4QD2E 5DDHA 4WO4C 1ZAGA 1G7LA 2MPVA 1VACA 1MIEH 4GIOA 4PS8A 3U2SB 2AXGB 1UCBH 1I9EA 4P23C 2I1KA 5ID1B 1TCMA 4KKCD 5DC2A 3U1SL 5D7JA 3O2WH 3ABGA 4ZSOA 4HWNA 5I6XC 4GNKB 2HFEB 3LKRA 2XOTA 4H0LB 3M7OA 4MD0B 2WSDA 3INUH 4OLXL 5F1SA 5B39G 1BYNA 3BE1L 5T5NF 2PWGA 2GABA 1Q72L 2KZBA 5E2JA 4M1DL 3JWDL 3A0BE 6FABL 4ZT1A 2CKBH 4K3AA 4G43B 4LLMA 4YR6B 1AE6L 1HQRB 3D12B 2Q2LA 5E8PA 1AS7A 3UAFA 4PYGA 5E1AB 2DWDB 2G2RB 2HT3C 1F90L 1P69B 2PCYA 4JO5A 1ZS8A 3CSYB 1K4CA 5GSVA 3T0EE 3ZE2E 3ZT7A 3DTXB 4RX4D 5J9PA 3GGWA 1G9NL 2WSCJ 1KJMA 2FATL 4PWEA 5C09A 2KL6A 3WTYA 3C08H 2LR2A 3MUGA 1NWQA 1PZBA 4MB4A 5IB3A 2AJUL 3UTPD 3U7YH 3BESR 3L71J 4LL4A 3HTKA 2VLKB 3FKUS 4N5EC 3IKCA 4PJDB 2R69L 5CSGA 3F05A 3UGUA 2R59A 1WBZA 1FZOB 4K3EH 1IFIA 2ICEB 4JO1H 3V9FA 5D5ME 3X1GA 4IJTA 1CDHA 3O3EB 4LHUA 1J5OH 5CEXB 4Y19A 3E7KA 1YEHL 1E8YA 1U95A 3C5JB 3PJSA 3OC8A 5D7JD 3UBXG 3T6VA 3REWA 2B89A 1FVDB 3NTNA 1P4UA 4IMKA 2CRYA 2YKQA 3KBHE 5JMOC 2WVRA 3JWOH 3Q5SA 4LCCC 1ZLEA 1MWOA 1SM3H 2AQ3A 4YE4H 4K07A 1JK8B 3CFCL 2XA8L 4ZMOA 2E75C 3TBSA 1BJ8A 2XWBA 3K2KA 4WEBL 3N44B 2XTJD 3V0AC 2XKMA 3CXDL 1WQVT 2DLFH 1RK7A 2WSFH 4JGMA 4JM0A 4I6MC 3VI4F 1BVLA 3Q8BA 4KZ0A 3CX5E 4WBAA 2HTLC 1YQ4C 3BQVA 4ORZC 3NEXA 1JOCA 2ED7A 5C09D 2E76D 4UT9H 1RSFA 4K7FB 4ODHL 4ELME 2J4WH 1QBML 2YD3A 1RV6X 4RFEB 5DS8A 4FNUA 2SPZA 3EOAB 4F91B 1K05A 1OZHA 1P84E 3II6A 5DK2A 4DN3L 3SCMB 5J06A 4LLQB 1NFKA 4R5TA 1ZHLB 4ZMAT 4UZGA 2ZT9B 2QGBA 4J3UA 4LHUD 4ABWA 5JOFA 1A65A 1FG2B 4Y19D 5IMKB 5D1XE 4XBGB 3GMAA 3KS0H 1L6ZA 2J57A 4PJ8A 3BH8A 4ORGA 3T6QC 2X3BA 4IMLB 3HHSB 4ENZA 4JCLA 5AB2A 2JO1A 3QIUD 4PRAA 4J28A 4PUBL 4F2FA 1VQ6P 1S8DA 3SEPA 3EO1A 2XACC 3P0GB 4YIQA 3D0LB 1XMWA 3HUSC 4E42A 4PYHA 3WKMH 3ZZLA 2Z31B 1J8HD 2NUTA 3MOBH 4UQ9A 4GRWH 4LIQE 5FWRA 3B5NA 1E4KC 2DIJA 4LCIL 3PABA 4GAJL 4PV9A 6TAAA 1X5JA 1QZNA 3ULSA 3ZE0F 3QWOB 2DI7A 4KRMB 1KJ2H 1QNIA 2DAVA 4A7QA 1KYAA 3MX0B 4LSQH 4IDJH 3H53A 5ENWB 4GAYA 2DL9A 2Z4QB 5B66E 5E99H 5E5RB 1CCZA 1QA9B 3LKPB 1IE5A 4F9LC 5IUCA 4OFVA 4UCFA 3SYOA 1SQQD 3L5IA 1KIQB 5I6KA 4GXUM 5AENA 1M1XA 3EBGA 2VXQH 1E5WA 4F2MB 3DECA 4F37F 4BQ9A 1VSCA 3IDGB 4IBQA 2ZF9A 4HD9A 4HX1A 4PJ8D 3WXWL 4HUXA 3GSNL 1TYEB 1YECH 1SQVD 2MQ0A 3VXPA 1A1MA 4P5TA 3NP3A 4OLWH 4XNMB 4MS8C 5K93A 4UT9A 3BQUC 3FB6B 4AGPA 4AMKL 4LLUB 3E1RA 3N41F 5BNXD 1KTBA 1VESA 1GGBH 3R19A 4XOEA 2C5DC 1ADQL 2F18A 3LRMA 1OOWA 5AVSB 1N3NB 2WBKA 3TFKD 3NFPB 4EUPG 5DEJA 3VQ1C 2OJZL 3ARXA 3VI3A 1W6WA 4YHYC 5L4FA 1J8SA 2BIQA 5I18L 1T03L 4IIQB 4NHUA 2NNAA 2OW6A 7TAAA 3BFWA 1KC5H 1AJYA 5IEHA 4JKLA 2FYUE 2JTDA 4HQQH 3OR6A 4TXVB 2VDRH 2C7FA 4DT0A 1I1AB 4XP6H 5H4ZA 1JWUB 1QSFB 3BJLA 4OLZH 3CFNA 1VEOA 1ZR4A 3WEBA 1DL7H 4KGLA 2YSSA 1B4RA 2FBRA 2VJ8A 3UO1H 4BRJA 1AGDB 4WY7L 2V7HA 5AVZB 2FUTA 5I2IA 1ZLUK 4C83A 4XO9A 5C08E 4J3OC 1NBVH 5C0FA 1B90A 2BP8A 2J2ZB 5E00B 5KVFE 1ICTA 1Y6NR 2BIMA 4P5TD 1H3VA 2IQAA 1CD0A 2YAHA 5DWPA 1BBJA 4U3HA 5FCUL 4LASH 5A6MA 3TVMA 1MG3C 5EIIA 5DDHB 2HX7A 3ECUA 1KJ2A 4U3SA 3S9OA 1BGYE 3DARA 1FCCA 4KKZA 1FHGA 4Q97A 5L2KB 5FUZH 4C47A 4X6BB 2P80A 4ZNCA 2VLME 1P6WA 3IFPB 4OUUB 4PJIA 2EIKB 1SQPJ 5IESH 1VKXA 2AMGA 4HEMA 4Z7VF 3KL5A 3IRZA 3FQWB 2BRRH 1JRHH 3Q1MA 2BLFA 2RTTA 5E4EB 1LO0H 2VXQA 4FLSA 2PUQT 1Q0XH 4PSPA 3CFQA 4Z7NF 1RQUA 1P4IL 5I6PA 1NBZB 1CWVA 2Q86B 4OZFG 4R83A 4CKQA 2I8DA 5GSVB 1X9QA 3GMQB 3B8SA 3BN9C 3N04A 5J3HC 3RVWD 4XMTA 4TLUA 3D3VD 4UT7H 1A02J 2PLTA 5I8EB 3SGKA 4DP7X 4OCWH 4PJ5B 1YMMB 2V2XA 4QRTA 1G84A 1JCKA 2OMWB 4E9WA 4UTBH 2VLJB 3HS9A 5CCGE 5I9QC 4XE5B 2WVVB 3FT9A 4HJ1A 2H3KA 1Y8AA 5IEKA 2JE8A 2DMCA 4JPZB 1AKJB 1M1JB 3BIAX 3ZTEA 3CCLP 2B15A 3KBEA 3QVAA 4FXKA 4OLVH 3T8VA 4M56A 2APVA 5DMIL 5JDSB 2BMKA 1B6DA 1L0NE 3L7EB 3TVMD 3ZE2F 5GGTH 5D1QC 2AI0L 2PTUA 1Y9BA 3EG9A 4Y19B 4PRPA 1U95B 3QJZA 2XNXA 4E5XG 4ZNCD 3L9RB 2WXNA 4YFLI 1UG9A 1XL4A 3GNMH 4LU5L 3P8CE 4HKXA 1GD2E 3OAYK 5DZVA 3HUJA 4FI6A 4HJJH 3TBSB 4F20A 2FIKA 4UTCA 1I9IH 3NDZE 5TH2B 4TPRH 2JDIH 2DW5A 1A14H 5D5MF 5KYYA 1U8JB 1R5LA 4H13C 4ETQB 5AVYB 3E6HA 4YQXL 1IC7L 3JWNE 5ESAA 5C0DA 2DYPA 4Y2LA 3O4LA 3VG0H 5JOPE 5I73B 1DEEG 1MJJA 2FJHA 2JF1A 3C5ZB 4N3TA 3PFQA 1I3GH 3W3BA 3ZZQA 2O30A 2FLMA 4CN6A 3VM5A 2WPGA 1VF5B 4Z23A 3EZJB 1I8AA 1TJIL 2CRMA 5TF1L 3SPVB 1ZLDA 1N8ZB 4L05A 1UM6H 1DJGA 1BCCE 2JJTA 5JQIB 2GYSA 2D4DA 3R1GL 1TTBA 1P5VA 3DTDA 4AZ8B 1MFDL 3DMMA 1SXCA 2OMUA 3O11A 3DWTA 4JPWL 5HGDA 4PRPD 4WEMB 5HVGB 2NY6D 4OFYA 1FF5A 1G7JA 1DQLL 3DETD 4ORGB 4ELMF 4CMHC 3EGDB 4OFIA 4BWTA 4DTGL 5EO1A 4O5LL 2YUWA 3FB8B 2Y0SA 4PJHB 5AOZA 5KUMA 1Q94A 1IAKA 1S2EA 1B2WL 2UWEA 1LTSC 3NMEA 4UTBA 3EGSA 1GTFA 3BVTA 1WFUA 4HH8A 1U8HA 3FFCD 4Y28J 5IKCB 3EO1B 4E42B 4YIQB 4OR1A 4M8RA 3N5AA 1VGKA 3R06A 2GJZB 2DYPD 2KBGA 3O4LD 3MLXH 5C0BB 3TU6A 2R83A 3B5NB 2H32H 4LVNC 1I9RH 4XP1H 1AGCB 4OWFA 3MRRB 4FEMA 2JIXA 1INQA 1FNEA 1JF1A 2EECA 2NY2D 4XBPA 5GGTA 4HEPA 5DJ0B 4DJMA 1NGZA 3RG1C 3O81A 2IQ9H 4PV8A 4OLEA 3WFBL 3FTYA 4FFZH 1JNJA 4AGMA 1M71A 3RK2B 2I7SA 4IL6X 3GTVA 4XMVA 5F44A 3VFPB 3ARDA 4XE0A 2GUVA 4CA4A 3MRQB 3AEBC 4NHCL 3VU2A 5I30H 1CLVA 1HAUA 2XTSA 3KLAA 4HZAA 5F0LB 4I0KA 4NNXA 3SKMA 4HXBH 4JR9L 4AQ1A 5D7KD 1IGTA 2W1NA 2XTLA 3DMMD 3NCEB 3RI5F 3ZR5A 2FLRT 1OCWH 1QL1A 4HX1B 1DFBH 4OFYD 3LNDA 1LXMA 3H1LJ 1PZ3A 1QI5A 1ONQA 1EHAA 4WUUE 4IKIA 1LL1A 2JJSC 5TISE 4NPFX 1YMHB 3F6IA 5F7HA 5KVFL 4M48H 3PNRB 2DH2A 4M3KB 2PPAA 3FQRB 4PJBB 1VQPP 3FTVA 4N2LA 1RE4C 1QYGH 2D2CC 3LCYA 4L9LA 4QLRA 3OXRB 1NGYA 1WISA 2PCXA 1OCZB 4LVHB 4PRIE 5EZLA 4HUNB 2DKUA 1INEH 1TMQA 1VDGA 2B2XL 1ORSA 1P6AB 2XBTA 3VI3B 2ZOKA 1ZT4A 2ADJB 3MJ9H 5KAIE 5CBEA 1SQXD 5E94A 4OGXL 3GMOB 3S5YA 4RIRB 2ITDA 1MIML 3SDAA 2F5BL 4N8PA 1MJUH 5E0QA 4F27A 3OR6B 5CINH 1GGIL 3ARDD 1NKNA 2JVUA 4B5EA 5E08L 3KLHD 1FORL 2H0FA 3O2DH 5GRVK 4AQOA 1NCCH 3V4WA 2CUHA 1UD2A 3I6LE 2YSSB 1FZCA 1TCRB 5K9OA 3TNUB 4P2AA 3O2VH 3LXCA 2CO6A 4MNGA 5E4OA 4R4MA 1R3LA 5EF2A 5D7SL 4Z95H 5C0FB 4GBXA 5FLVA 2NSQA 5L2JA 2PNDA 1YQVL 2H32A 5BO1H 1IGFL 2IBZY 2JKWA 2QMJA 4CMMB 2AITA 4K7PH 2VR3A 4NUJA 5EIIB 3WY4A 3ESOA 5LQBL 4M93C 3IDXL 1PAMA 5AB9A 2AEOA 2B77A 2J21A 3HIZA 2N0MA 3UZEC 1T2KC 2P5EB 5DFWH 4AGQA 5D1QE 1JGEA 1MELA 4AOFA 5T33L 4X7FC 4XH2A 5KVEH 3H1HD 4PJIB 3SFEC 1MFBH 1SQBK 1VEPA 4HKBB 3CZKA 2IWKA 3RFZC 4I0PA 4Y89A 4X4ZA 3B9AA 4NYLB 4MD4A 2BFVH 1I7RB 2YHGA 2XCMC 4YAQA 1HEJC 3ELAT 4G59C 3V4VH 1OZUA 3CDFA 1U92B 5IHWA 1JI1A 2JKNA 3MRBB 2E6QA 4U7KA 4Z18A 4EI5B 1OW7A 1UH2A 3OG6B 3L8QA 3SDAD 3I9GL 1AQ8A 3V4UL 2NW3A 2XXCB 2OMBA 3V79C 3MBEC 1B0RB 2BVOA 1AGEB 3CCJP 2YXRB 2X88A 5DD6A 4D0CA 3WHXA 1HYRC 1R17A 1W0VA 2HP4A 2IFFL 3TWCH 1QG3A 4RZKA 1NFAA 1WIPA 1O7VA 5EUOE 2ROXA 5EFIA 3F5WA 5I0DA 4GBXD 3ZR6A 3ZW3A 4AWJC 1MFAH 5I8CB 4V1DE 3RNQA 5FGBC 3N06B 1GGTA 2A9MH 4IBWA 1R6VA 3SE3A 1GPOH 4HHAB 4HC1L 3SJVA 3DPBA 5HI5D 4E9XA 3CDCA 1USZA 3FO1B 5CJOL 3VFGH 3ZDZE 3WU2H 1Q9WB 3BZDA 1H9VA 1KUMA 3B3BA 3EFOB 4GEJA 4I0PD 3PPSA 3C2AH 2H7HA 3O2DA 1G87A 4BKSC 4NN6C 4NQEE 4MB5A 2IBZD 4G3YL 4LBEA 4PHXA 5C0EA 1Q9OA 4JLRB 4ISVA 4K71C 3A5TA 4GDOA 1VQ7P 1HU8A 4K3DH 4DN4H 4ZPTB 3S8GB 3VJ6A 5K9JL 2VT0A 3QRBA 3HOGA 2OK0L 3BKYH 3E6HB 2BDNH 2OV0A 4FYSA 15C8L 3PDDA 4YZWA 4KRLB 4U3FG 1TJMA 3HEIB 4P3DA 4X7SH 2FJHB 3FHQA 3HS0C 4PTUB 4I2XE 3C9NA 2D7TL 3CLFL 3EW3B 4PRHD 3KHQA 3TGUJ 2CXGA 2H1XA 3CXHJ 1VCBC 2ZX5A 2L8AA 1D6VH 4DESA 4AG4H 2YQBA 2IALA 4PGCA 4AV0A 3EJYD 2Z6FA 1BVZA 1PD0A 4G70B 3VW3L 4ZMLA 3KHUA 1PDKA 3QXTA 3IMBA 5C0DB 4WJG3 3OTTA 3WXVH 2EDKA 3RBSA 1BD2E 5AKVA 5SWSE 3V4VA 3H9SA 1H8OA 4HOZA 1T4KB 5HGDB 3TJEH 2WO4A 3VFUB 4Y4KA 4AENB 1FNGB 2F61A 1KY7A 4M7KH 4N0YH 3FCSA 5HYJA 1OW8A 2EXYC 2L4OA 1KJVB 4RGMB 4KDWA 1TXKA 4MQXC 3A2AA 2CDEA 3QAZC 3U7WH 5DWUH 2KLRA 4KI5D 2B5IB 4RISH 3ULVC 4E9SA 1BVNP 3EGSB 4OQTA 1LWUB 3F7VB 3MKGA 4ESKA 1MW0A 3I3DA 1N67A 1OK0A 5JNYB 1V7MH 5JQHC 3EQ2A 3IDMB 4IBLT 2YGVA 3RL0D 1EZVX 1AR1C 2MHAB 4AVKA 4B9FA 4QRSB 4KZDH 4P5MA 1G5GA 1A7PL 4WVZA 3LZFH 2JIXB 3CU1A 4JY5H 1PP9E 1G9MH 1DVXA 1XZ0B 2HRGA 4M4PA 1M2VB 2GJ6E 4XNXL 3QUZC 2WTYA 4PV8B 5AOIA 4OT1L 1VQLP 1MWAL 2H1PH 4IQHA 4UT6L 4BKLA 3TESA 1EJ6A 1M71B 3H42L 4KJPC 4W9LC 3OKOA 4G6FB 4ZK8A 2X89A 3I02B 4ATTA 3O8ZA 1SQBG 5I19H 2DJ4A 1CTMA 4L5FL 2P24B 1WPCA 2K1MA 4H26A 4IRSC 4AQ1B 3C60C 3UG3A 3H9SD 5BZWA 2HJLA 3H55A 5HHOA 5JR1L 3N9GL 4QRRE 1R3IH 3GS0A 4Y4KD 4JKPL 2ZAEB 2BSRB 2QHRH 3TP4A 5GRXG 5HYJD 2F08A 5E2WH 2J72A 3QG7L 4TUJA 4PD4H 2BOBA 4H0LC 2E9BA 4FI8A 1WFNA 1WCBA 1BBDH 4P0DA 3G6JA 5GRUL 1RZ8B 4H20H 3L16A 4L8DA 2DQCH 5FHBL 5FYKH 4P2RE 5A2FA 4CSTA 2MKVA 3QJFB 1FYTE 5BW7C 3AB0B 3UACA 5DQDL 2NT0A 5ETUA 5K1JA 4O4YL 5CGBA 1S3JA 2VE6B 3H1ID 3MC0A 3ECBA 3EUDA 1MRDH 5E8NB 4LEOB 1M9WA 1X9UA 4GIFA 3G5WA 3HFFA 2ZOKB 3K1DA 5INDA 2HZHA 3L4UA 1JY3N 3CZFB 1SXZA 2VKWA 2K37A 1ACCA 1A4KA 2UZXA 5D70L 1PPJD 4LQFL 1GJIA 1AD9B 2VSDA 3L1FA 4MNQB 3NCMA 4YE0A 2QJKB 4PJCE 3QS2A 2A06E 4NJAH 1KJ3L 1MNUH 1S9YB 2EEBA 3T2LA 1PSKH 2YD4A 1GVIA 3HFML 5DUBB 2E5EA 1T2QH 4GSQA 5AUMB 3DGGB 2MIZA 1ETZA 3H85A 4FFTA 1S9VA 3RWDA 3KPQA 2PW1B 2CPCA 3VSTA 1KB5H 5EU4A 1N10A 1X7SA 2EIZA 4OIFA 1AZZC 3RWCB 5FIEA 4RLDA 4ACTA 5BO0D 5I23A 2RGSA 3M46A 1I3VA 1U36A 3BW9B 3N1PC 4TSCH 5HHOD 2WLJA 4MNGB 2WZPA 4JRWA 2OYIA 2OXHA 3RJDA 1U8OA 3GBNL 4FZEH 5L2JB 3ATFA 4L37A 4BE5A 1B2YA 2ILLA 4DEUA 1KIPB 1EQ7A 3CCEP 2QADD 2GSGA 3OQRA 4ZOEA 3HI5L 3VWJB 2UZIH 5HDLA 5J6HB 3BP6B 1JY3O 4I9WE 3IVKA 4UV4L 3Q2LA 2BP0B 2FE0A 4LSVL 2E74D 2E8YA 3UBXA 4Q9RH 2N1TE 4P59H 4B9IA 4TTGA 5EZIL 1AD0B 2Y6SC 3RY6A 1IJNA 1J1OL 3PL6A 2LW3A 1DQML 4MD4B 5BQDA 4IOIB 5JIKA 4ONGH 1CLOH 3IXAB 2ZWZA 3LKSA 5AW2B 3P3UA 2FJUB 1JRHI 4JDEA 3K74B 4UIMB 4WI0A 1EJFA 2XZAH 3BWUF 2X0UA 5LG1A 2G0KA 3ILQC 4KTDL 5ESVA 2JELH 3QXAA 2Y2WA 4WUKH 2BVOB 1NTDA 4PGEA 3DRQB 3WHXB 1YN6A 3L3OB 4GRMA 3SCMC 4NBYB 3RBGA 4O2EB 1Q1PA 4KKBC 3OA7A 5IG7B 1UWGL 2EDFA 2R51A 4J23A 2ZT9C 4A7TA 4B60A 4Y2DA 2WZPD 1CC3A 2IPUG 3T08A 4F15B 1T7ZA 2DLTA 2ZWKA 3FQNB 3RNQB 1WA1X 2HYMA 1JMZA 3O3DA 4XNQA 4YXKH 4BCZA 5KVGL 3QCVL 3SJVB 2B1AH 2ZE0A 4PS4H 2YAOA 3IR9A 4CGTA 1OW6A 4APXB 3MBWA 1HZHL 3DXAA 3B5GA 2AEQL 2ITFA 3FT4B 2NY7H 2ADIA 5EU5B 4G72B 4W6YB 1B3IA 2Z31C 3CHPA 4LARL 2XKSA 2QSTA 3FRUA 2P58A 3K8LA 3PL6D 4L3EB 1HHIA 3HZMA 4LBEB 4PJGB 1KB5A 4MJ6A 3S3CB 2Q8BL 1Q9OB 4ZTPH 3CAFA 4ISVB 3QWOC 5C0ND 3X14B 1JZHA 4HW6A 5DD1L 4BFBD 4C4UA 3VJ6B 1CICA 4NLHA 1G0XA 4L8BA 4JFWA 2QQNH 1AO7B 1BEXA 2ZUTA 2CBMA 4LOVA 4ANXA 1T2XA 2VITA 2I85A 2BC4B 2RQ8A 3WHE1 2F7RA 3I50L 3O6FA 1W80A 4KRPD 3ZDZF 4PD4D 4Z3FA 1RUPL 1WVZA 4TQPA 1KCVL 1QRNE 1Y0LA 4IOSA 5FYKD 3LV3A 2C9SA 1UA6L 1BJ1J 3SDCB 5DRNA 2AXHA 3N40F 4UILH 3BC9A 1PKQA 5T3ZL 4Y2DD 2X4RA 3OGOE 3TN0B 5IW6B 4XN8A 3BVXA 4PGCB 2VXUL 1X6NA 2DH3A 3AG3B 3ZO0A 3RB5A 3QWQB 1SXBA 4GS7B 4HS3B 1AQ5A 3J7HA 1PDKB 2UX7A 3SQBA 3ZKNC 1OCOB 2YKLL 4HJSA 4JN1L 3ZN6A 2PPCA 5FKAA 4LP8A 4N2OA 4WDIA 1UM4L 3CX5J 4EQ3A 1NPUA 2PTVA 1CF8H 2VXSH 1I1FB 1L3WA 4TNWK 2ITCA 3LMJH 1WEJL 3Q6FB 3FCSB 1ZWIB 2GTZB 1UB6B 2EVGA 5ILTH 5EBLB 4JZNB 1EIBA 5E2UL 4MXWH 3C1LA 4LLAA 5KLVJ 5EU7C 2G75A 1MCBA 3KYMA 2JH2A 1NCAH 1IBGL 4YHNB 3NIDE 4IIQC 2FJFA 1OAYL 4RBPH 2V9UA 1CICD 3U46A 5IQ7H 3KYQA 1P84J 3MRGA 3MCLL 3QULA 1JZJA 4WU5A 4XCNB 4TUKL 2VO8A 5ICXA 3FTWA 3NA4A 3O6FD 3QUMH 5EBMB 4MKTA 2GEQA 3V0VA 1I1AC 1OQOA 1HKLL 3LEVL 5DXWA 1CFSB 4MQ7B 4IOSD 2MQ3A 3SKUD 2ESVE 5JLZA 1TSRA 4A7GF 1GYAA 1CIUA 2VWEE 3PHLA 3CDYA 5JA9A 2GY5A 3L73G 3SKNA 4MQTB 2MKWA 3H56A 1KBPA 3OKOB 3KZIH 3F7LA 3GTNA 5B3SB 1NTZD 3NJIA 3QDGA 1HXMA 4PCYA 2Q9IA 1F3JB 4XGZB 4AYCA 2NDGA 3AW5A 3IGAB 4H26B 2VLRE 3WDIA 5EU6E 3T3ME 4BZ2L 1RI8A 5BZWB 5EBWA 3MIWA 2PR4L 5C86A 1S3KL 1DSWA 1JGVL 2X9XA 1YY9C 1BOGA 4H88H 1ULVA 3HBQA 3QHTC 2R2BB 3MLWH 5ID0A 4P2YA 4UNIA 5LCVL 1HK6A 3W67A 2ZFCA 3BRTB 2ID5A 1UD8A 4RH4A 3BD4A 4NC2B 5E4EC 3KL0A 2KHAA 5E6YA 3AQZA 4GXVL 2FLBT 3RK3B 4TVSa 3TC9A 2IX7C 1HNGA 1B3JA 2Y1VA 4ODWA 2W0PA 2RHEA 3BLKA 1DBAH 5F88A 2P3YA 4CRPA 3ECBB 4L0YA 3P4NB 2OL3H 4HXAH 4NEHB 1P9MA 4U0RB 4WJ5A 5AFAA 1FFPA 4QTHA 3EYOA 3ZKMC 5GGSA 1UATA 1OSEA 1WG3A 3FB5B 3HTLX 2K1AA 2ZUUA 3TCTA 2W80C 4F58H 4OKDA 1P7HL 2ATPA 2EYSB 3GXDA 2M0BA 2H8PA 4FP8L 4NO5A 3Q5TA 1QSEA 4ZFGH 1M1JC 1FFQA 3HR5B 5BVPL 1QUNA 1D3CA 3QDGD 1ANUA 1S9VB 3CH1A 1RJLA 1S7WB 1J7VR 1VPOH 3KPQB 4AQEA 5L8JB 2EIZB 3R2PA 1SDYA 8CGTA 5DHYB 1PQZB 4XCFH 3IETB 1W91A 1H89A 5CCHD 2DQDL 3NQKA 4ZW7A 1CBJA 5C70A 1GGCH 1IAMA 3CPUA 3QEQA 1MZZA 4TVUA 4R8WH 3VWKD 3O9WA 3A4EA 4OGYL 3QUMA 3CFJB 1GZHC 4I5BA 4PJCF 1H0DB 5DJCA 1MEXL 4TQEH 3HLAB 2X09A 2FYUJ 1Z9MA 3IN0A 4LPXA 4N28A 4YXHL 4HIXH 2CDGA 3VGBA 1KORA 2K88A 3PHOB 3UP6A 3KPNB 2EDJA 3STZA 3VXNA 3ESPA 3VE0A 1QR1B 4LOUC 4KV5E 2AJVH 4M43L 5I73C 1LTBC 4YHMH 3VFVA 4E9VA 3C5ZC 3DVIA 5CJQL 2NLJA 1GA2A 2FIRT 1KCSL 3GO1L 4JDEB 4WI0B 2DQUH 3GUTA 1RZKC 2X4SA 1IO4A 1YNTF 4IFFA 3ULVL 3EJZD 1WRGA 1QLFA 5ESVB 1WBYB 4K23L 5DLMH 2H8PD 1VF5C 2BOCB 1KLUB 1QSED 3QXAB 2ZXBA 4JJHA 1QKZH 5DMKA 5ICZB 3ZL4L 1BGYJ 3LEXB 1OP9A 4MAZA 4I18B 5KN5B 3B71A 1SOQA 2BCCG 2W07A 4K8RH 3T4AB 3WEOA 1FJKA 4PWHA 4UM9B 4GOFA 2I07B 1N6UA 2A6JB 2OCCB 3QEQD 3GDBA 1CD1B 4R5VA 4S11A 1GMJA 3VP9A 3O9WD 2GITA 3BSZL 1PVHA 3NFSL 1TZ8A 5C0JB 5CHNB 1F58H 4TQHA 4JJ5B 3FQTB 1GIGL 1SVBA 4XNQB 4JRXD 1A3LH 3APFA 4YBLB 1S5LH 5B38B 3FGAD 3QIWA 2X05A 7CGTA 1DEBA 3MBWB 1H88A 3DXAB 3DUSB 3OLIA 2A3TA 3B37A 4LFHG 3SWYA 1I7TA 1WZMA 1H3TA 1S7VA 5E5UB 2FFDA 1VFUA 2OTPA 3PREA 4M6MH 1I8MB 2CIKA 4GI8A 4H0GA 3B5NC 1VPCA 3D0AA 1SXSA 2DJSA 3BSGA 2IBZX 1CDUA 5AD0B 4ZW8A 4G5ZL 3CBJB 1NEZA 3B9KA 3PWJA 1EHXA 4GFTB 1YNLL 1L0NJ 2DLEA 3DBSA 3DRTA 5MENB 1M8OB 3RK2C 2ZVNB 2CQVA 3NZUA 4XWOD 4L4VA 1MCSA 5C71A 3ZUNC 1MQ8A 1QEWB 5FA4A 2QM7A 2W60A 3FT2B 1S7SA 3L5JA 2RAMA 4OCNC 3NZSA 2EDYA 4UIKH 4W4NA 4YHIA 1F0LA 2XV2A 3S0PA 5EEZA 5J11B 3D6YA 3DV6B 3M9HA 2PR9A 5I1KL 1HJ0A 3PQYD 3FFOA 5DQJA 5F3BA 3ULVF 3CVBA 1AP2B 3FRPA 3UTPE 5CCJA 4S1SL 4JY4A 2IBBA 1O5DT 3APMA 1RURL 5IREA 3KR3L 3SQBB 5KSBE 3TL5A 3N43F 4FXGA 1ACYL 1DCLA 5FKAB 1M1KQ 5TGBA 2WUBH 3U7AA 4WDIB 1FQ9C 1FL3A 1DQKA 4I1RA 1XSIA 1QFUH 1V8HA 2ZWNA 1A9BA 3H32A 3W5MA 2FX8H 5FV1L 3BGMA 4LVHC 4G9DA 4ZSOE 3A6CH 2BZ7A 2VCOA 3OZLA 5B7MA 1A6ZA 3WFCL 4UOJA 2DD8H 3B9KD 3MRGB 4CSSA 1BCCJ 1K8DA 1YI2P 5HHNA 4M7LH 3PPEA 4FERA 5HI4D 1YTZT 3HVNA 1X3DA 5F7MC 5EOTA 4V33A 1EC5A 2N59A 2XTJE 1MRFL 4I7ZB 3TT3H 3W39A 5DFTA 2WXFA 3UJJH 4Z76B 1RP9A 4Z7UA 5HVFB 4M61B 5C09E 3P2BA 1NH6A 3TEZA 4UQ2A 5LAXA 2ENSA 2Z64C 3NIDF 3PWNA 3S1KA 1TQTA 1YEKH 2H45A 2PETA 3US0A 3SB3A 3UTTB 5E6RB 4URKA 1K6QL 3LRSB 4W81A 2BP5M 9CGTA 1HXMB 5I0VA 3T6XA 3UBXI 3MRCA 4S1RH 2EDDA 5HXMA 1D7BA 3TVMC 3EFDL 4RETB 4HK3N 4XMZA 1F1DA 4NRYB 1A21A 1DJWA 4KJYA 4NWTL 1OF0A 1QFOA 2NY3D 2ZAGA 3EJSA 5KJRH 3MZTA 4MA8L 1BOGB 4QNPE 4DW2H 4H2CA 4Y19E 1DJHA 4HCFA 4JFDA 1AXIB 1LO4L 2YBRB 4JO3L 4G8FA 4K8RD 4NQDA 3G9RA 1S7QB 1RMFH 2XV6B 1KFAH 3JTSB 2VL5B 1AI1L 4PD4I 4MA1B 2ARJA 4IHOA 1EDQA 4L23A 4W70A 5DVKA 4EBQL 5BPPA 5IQ9B 4EI5C 5FM8A 4ODWB 2O5ZL 3T3MF 1DSFL 1L9SA 5F88B 4FNLH 3VOPA 4PJXA 1JPSH 5EORH 3SOBL 5JHAA 4WJ5B 2YIUB 4RSVA 1I3RB 1NIBA 3CIAA 1ZLSH 4ZFOB 4IU2A 2F1BA 1M05A 2OZ4H 1VQ4P 4XOBA 3UTZA 2YEZA 2UYLA 2LTQB 2XU9A 3CHRA 1MY5A 4K0OA 3VQ2C 1B0WA 3B4SA 4MWFB 2VC2B 4LEBA 1Z9LA 1KPRA 2WVSA 5I16A 1N86A 4XNUH 1OTTC 4XB8A 1QUNB 4D8PA 2J58A 3J27A 1BFSA 5TFSH 1NCWH 3BUYA 5IBUB 3TXAA 2KDGA 4WFGD 4ZFQA 1EERB 3SY6A 2XVKA 1SQQE 3N44F 2OSLA 4JFTA 4JPIB 3WE6A 2HLFD 4QO1B 2QFRA 1UWXK 3KWTA 1LT9A 2P47B 2PCFA 3BN3B 3LNHA 5CMAB 3BEVA 4X9FA 2FO4B 5LNEA 2I5YH 3CMEP 2VDPB 3CN3A 2DW3A 3FB7A 3KWVA 1E2ZA 1I8IA 4AE0A 5DJCB 2Q6WA 5HHXH 5IWLA 1SQVE 4G6KL 1WFTA 2Q5UA 3KGTA 4N8CH 4NNYB 2NQCA 4HUUA 2PAJA 4KZEH 1CO1A 3SYCA 2CDGB 3FUKA 4OTXH 4PGBB 1MQKH 2X6AA 3DIFB 4J1UA 3ETTA 1CN4A 1M90Q 5ITFB 3ESVF 2XN1A 2Y72A 3LPOA 5J6SA 2DQTH 5TE6H 1J0ZA 2PXYA 3STZB 1JN6B 3FN0H 4XOCA 1N6QH 4XB7A 1A6PA 5L8KB 2WD0A 1HXKA 1AQTA 3A6OA 2HKHH 1PV3A 4FNTA 5F7UA 3PXHA 3U48A 4U1HA 4NCC2 5IV2B 5GS1B 4D8OA 4HAFA 5I28A 3I84A 5T1KB 1EXGA 1N2DC 1TDQA 4RZCB 3JC22 4Y1AA 4H44D 3E6FA 5HDQH 4MJ4A 2BSDA 3DK0A 5MERA 3BCFA 4OFQA 2CBOA 3NJMA 1U8CB 2WTRA 2JI3A 2JJTC 4N8VA 1D9KA 3BD5A 1OAZH 3IDNA 2IYOA 2NPSB 1XH1A 2CLVB 3QISA 5CJ8A 4KK6D 4KV5F 4Y9FA 4AMWA 2XNDH 3X17A 1EJ8A 1ROWA 3QPXL 3OAUH 3EH2A 4HALA 4TKWA 3L74G 1IBBA 3GT6A 1LEIA 2EACA 5KLIB 4JFEA 1T5WA 4RGMC 4YFLF 3FUJA 2Y25A 1A4CA 4YSTA 5CGYD 4OZ4B 5ACLA 2K9YA 2B5IC 2EYTA 1FLRH 1IGJA 1EZSA 3V2RA 3QIWB 1LWUC 1CR9L 4QGYA 2OZ4A 4LLYA 4D0BA 3P77B 1TEYA 5CD3A 3O4OB 4IKJA 4RNRA 4R7DA 4I89A 2PXYD 5DJTB 5F9JA 1XD1A 1HI6B 1QOKA 4WGKA 2Q8AH 2KSEA 2M8XA 2RMZA 3FMGH 5E24E 2CIKB 1WTLA 4JKNA 2NZ9D 3QDHA 3PV7A 2OSYA 5AVTB 3I9PA 3VI3E 2G0LA 3E80A 3PWJB 1YPZB 1DBBH 2YAEA 3TBWA 3L3JA 4I3SH 2VIRA 1HL8A 4KH9A 2RCSL 4JDVA 4Y1AD 3U1CA 5JQ6L 2OMZA 3FONB 4L4VB 4NGHL 4Q2ZB 5GRVL 1KEML 4KFMA 1DBJH 2W9DL 2AXCA 3BXNA 3GQFA 5FA4B 3KLHC 3QQ9C 1S7SB 4ZMZA 1D9KD 1YEFL 3BPCA 3VB9A 5KYXB 3D3VE 4LCUA 5D7IB 3W0WA 2XN9B 5T1DH 3GMPB 3HZKB 4AQ1C 3BJ91 3RVVD 2BWQA 5FYJU 2AP2A 5KBDA 4HU8A 5DQJB 3FRPB 2VR9A 1EDIA 1OPGL 4GKSA 4HCRH 1TJGH 4JFED 3LH9A 1AKPA 2QTEA 1OSZB 2CDFA 1NPJA 4RAHA 5SWZA 1KBWA 4AEIL 3LX9A 5TGBB 1JZ5A 4JPVH 4WI6A 5H35A 2FX9H 3U25A 2I9TA 3SFDC 3AB0C 4KUCD 1TTAA 3BGMB 1PJWA 3NJLA 4G9DB 2K78A 1OO2A 4HEME 2H26B 2JKIS 1A6ZB 1LP1B 4Y4HB 1YY8B 4G6MH 1XF2A 4QTIL 1QPKA 1GHFL 5KSBF 1DFXA 2Y1AA 2QJKC 2IPTH 3SDAC 2BS8A 4M7JL 3U6RA 2OX5A 1T80A 1ML0A 3GSWA 4LSUH 3C5XA 3W39B 2DM3A 2E5TA 5FO9A 4F7KA 4ZKPA 5C0AB 1T3JA 2VZOA 2Y24A 1CDIA 3MLSL 4W9EC 4ENEC 2D3JA 4UQ2B 2NTFA 4WSJA 2WMPA 4L0PB 1E8WA 4MDIB 4FD0A 3OMIB 5IT2H 1MPAL 4WWIA 4N2CA 3MV9A 1RZKL 1YZZA 4OBSA 2KLVA 1UCBL 1RPUA 3PAYA 3I9IA 1J0IA 3HG4A 5I74B 5SWZD 1FSKB 4QYOA 4WGWB 4PJ0H 5B38G 5I6MA 2J6EH 4MVBD 1RHHA 3FDWA 2A0LC 4YHKL 4R7XA 5IM7B 1UKSA 4JPKH 5FCSH 5KUKA 2XJKA 1PP9J 4FFVC 2WUCH 1MUJA 2W8CA 4PRPE 4PGDB 3FT1A 1JZ3A 5LBSA 4JFDB 4O2FA 4Y9GA 1T0NB 3KMDA 4NQDB 1XGRA 3C8DA 1SDDB 2DBLH 3T0BA 2ZYAA 3UGXA 2OKMA 4G2AA 4A7UA 2F19H 4GW1B 3HUJE 5DHVH 3FFCE 3C08L 3LTVA 4UDTA 1OANA 1SGKA 4YSRA 1TT6A 4HCRA 2L04A 3VXSB 5IHUL 3UIZA 4L29A 1OP3K 3U7YL 2C1PB 4QNPF 5SV4A 3O4LE 1B9ZA 4N2KA 3VXOB 1N26A 1M05B 2H2SD 5FB8B 3UTZB 4URTB 5KTBA 3EGXB 4K3EL 4AQ8A 5IHHA 2HUHA 4FQLL 4JO1L 4HU2A 3IMSA 3JUYA 1YCSA 3KWUA 2R5DA 4F15C 2GG1A 3FT3B 4XMWA 5HYSB 1RFDH 3BUYB 1NEPA 4U6XA 1EDKA 3SE3C 4HPYL 4M5ZH 1U8LA 4N2HA 7FABL 5ISZD 4JO4H 4XZUA 4TL4A 5JHMA 4FG2A 5D7KE 1U58B 4A2GA 4YE4L 2ZJSH 4DOHB 5J57B 4EI2A 3ISYA 1CG9A 3D5OF 1NBYA 4GW5B 1IBDA 1O9ZA 5DD5H 3CVIH 5E5MB 4DUWA 1IGMH 1G7PA 1OX3A 4AEFA 2FHCA 1KTRL 2QLYA