3A3YB

Crystal structure of the sodium-potassium pump with bound potassium and ouabain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
278
structure length
265
Chain Sequence
RTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEQLQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the sodium-potassium pump (Na+,K+-ATPase) with bound potassium and ouabain.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 54
structure length 265
sequence length 278
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3a3yB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 3a3yB02
4DZOA 4C7NB 1FOSE 2ZXEB 5AVZB 3MD0A 3A5TA 2IPPA 1CI6B 3VMYA 1KQLA 1SLQA 3OAKA 3HE4B 1T2KC 1A02J 5AW1B 1DH3A 3LIDA 5AVVB 1HJBA 4JYCA 3P32A 3HE5A 5AW9B 1H89A 1IO4A 1CZQA 3A2AA 1FOSF 1GZLA 3VYIA 2Q5UA 5AW4B 1GD2E 2E42A 2Q3IA 3L37A 1GU4A 4AUWA 3V4QA 1FAVA 3TNUB 5AW7B 5AVQB 3M9HA 3P8MC 1A02F 3TK1A 4JYBA 1HBWA 3IR9A 3A7OA 1JNMA 4I2LC 2WPRA 5APWA 5AVSB 3WGUB 1H88A 2WWWA 1J2JB 1YYCA 4AYCA 2W27A 4M3LA 3TNUA 1G2CB 4C46A 5AVUB 3L35A 2P7JA 1OXZA 3VN0A 1S9KE 3M0DA 5APUA 2N9BA 3HE4A 5APVA 3V4WA 1NWQA 5APYA 2JJLA 2YO3A 2P2UA 1MUUA 4I6MC 4KHXA 3NFQA 4GT1A 2Q7CA 2ZFCA 2Z5IA 5AW5B 3HE5B 5AVTB 5AW6B 5APQA 5AW0B 3VTPC 1NAFA 3WGVB 3MGNA 5AW2B 4RETB 3O8ZA 1HUCA 3A3YB 2E43A 1GU5A 3KDPB 2C9NY 4B86A 2WPQA 2XV5A 2R3CA 5AW3B 4C7NA 2WTYA 4GKGA 2QM8A 4HYTB 3HTKA 4RESB 5CMZA 5APSA 3VMXA 2W6AA 5AVRB 2R5BA 5AVWB 5APTA 1CI6A 1GTWA 1X8YA 3M0AA 3SWFA 1SP4A 1CSBA 3V5BA 2P67A 2H7HA 2C9LY 1H8AA 3P7KA 5AVYB 3UIAA 4EOTA 2YNYA 5AW8B 2WT7A 3T97A 1GK6A 1T2KD 2R32A 1GK4A 1MV8A 3NXSA 2R5DA 3NTNA 5AVXB 2WPSA 2Z5HA 2KP8A 2XZRA 2BASA 2XU6A 3M9BA 1HWTC 3I5CA 2VRSA 3B8EB 3NMDA 1S9KD 1MFZA 2YO2A 2WT7B 1JUNA 1OWAA 3M06A 4AQRD 2QM7A 3M91A 3LIEA 4XE5B 3L36A 5APXA 3KQGA 4LC1A 3TYYA 3VMZA
chains in the Genus database with same CATH superfamily
2WPGA 1FL3A 3CC5B 4KDTC 4ORGB 3MZGB 4XMPH 1XF4A 2PYEA 3REWA 3VXMB 5HY9B 5D1QD 3HAEB 3LZNA 3T0EB 4OQTA 3HUSB 4D3CH 3E8UH 4JB9H 1A02N 1JPTH 3B56A 4G8GD 2FBRA 1DJXA 1PZCA 4HEPG 3RIFK 2Y2TA 1YEDA 2DRUA 1AP2A 4G8FB 4ELMA 3CDCA 3NFSH 2IBBA 5IQLA 2HTLD 3GMPA 4Y7OC 1E6JL 4QRRB 4D0DA 2P7TB 4OD2B 1QYGL 3GXPA 5K93A 2WTRA 4YQXL 2CJTA 4JHVA 2VLKB 3QG6A 1N2RA 4PRIB 1INEL 1CI3M 3AWFA 2A45I 4R96A 4FJYA 3F84A 4QRPB 1C5CH 1G1CA 5ICUA 3MC0A 2OI9B 2GSGA 2LU4A 5AW7B 1A02F 1QFUL 4FNSA 4ZS7H 4P04A 4MXQC 5LNGA 4GO9A 4A2GA 2N7BA 4OZGF 3SJVE 4AEFA 3IGKA 4QHKI 1NTMG 2M3BA 1TU3F 2VN4A 3B7SA 3CN2A 4W1TA 2FWSA 4DP2X 1W15A 1J8KA 1HKLH 3H9SE 4FQJL 1HVVA 1RZGA 4JANB 4HCIA 1M53A 3HB3B 3P4MA 4KOBA 5AVUB 4M8QA 2OK0H 1YEFL 1IFGA 1K5NB 1YUHB 1ZPLA 3L7EA 4PJ5B 1G7QB 3HW7A 4C55A 2NRDA 3UTPE 4Z7NE 2D3VA 3H2PA 4JFFE 3FAXA 5IHLB 2DI8A 5IJVA 1MNUL 1RHZB 5IGXL 5JW3L 3K8KA 4FABH 2DAVA 4BWTA 1V05A 1T7WA 1UM5L 1XCQB 2WXLA 1KJMB 1B9ZA 1HNYA 1VJSA 4NOFA 4GY4A 2E43A 4WUKL 4Y4FB 3PAYA 4TNFA 3L75J 4XBGA 1YY9D 2P5EB 3C8HA 3Q9PA 3VXTA 4JLRA 1N5YL 4F57H 1MEXL 1J5OH 1SDDB 1VQMP 1PZ2A 1FLRH 1BX2A 2WZ6A 3GDBA 4Z7WE 3GSVA 2LOEA 1LE9A 4N2HA 4L3AA 3PP4H 5C07D 3BKJL 3QEUB 2B3IA 2UX7A 1MDTA 2VSDA 3CXHK 5GGVY 3BVTA 2Q10A 3UTTA 1T2XA 3LZOA 1GH7A 1UADC 5DGRA 4KI5F 3RWJB 2BEZF 3TV3H 3EYFB 2X2UA 3FYIB 3MRMA 3UO1L 4ZMNA 1KCRL 2Q76B 3NCMA 4L37A 5K69A 4FQLH 1GJUA 4R3SB 4YZWA 4UM9A 4UM8A 4PVBA 3SPVB 4D8PB 1AQDA 1A1NA 4OGQB 5CGYD 2XWXA 2XWBB 1HL8A 4JO8A 1Z9SB 3B5HA 4P9HC 4JQ0D 1GOFA 1WPCA 2APXA 1MW1A 4YZFE 2R83A 1RZFH 3QXDB 4WKZA 5BQDA 3R19A 5I19L 2BIMA 3V10A 1G4MA 2XWTB 1UIXA 4YHNA 1ZS8B 3QNZA 5HDWA 1DUYB 1WCBA 3UTOA 3RWGA 3UTSD 2XTSA 3G6EP 1KYOD 1NUNB 5C0ND 5KYXA 2I9LB 4HU2A 4YDLB 1A64A 5HGDA 3R4DA 3FQRB 5DO8A 2Z4QB 4PJ8A 2CJSA 3BZ4B 5DUPL 3U1SH 1YEEH 3D30A 1NLDL 3ATFA 4N2LA 3BZEA 1A6UH 3L1OH 1ZEAH 1ZIAA 3PG2A 1PIFA 3FAWA 5E2TH 4NPDA 1SYVA 3FCTA 5T1DL 5F8QC 4UQ3B 1QSFD 1YECL 5CSGA 2NX5D 1EZVG 1BE3D 2FH8A 4HCRL 3NIDF 1L5GA 1DQTA 2HH0H 1NM4A 1Y07A 5D2LA 2YFNA 1EAQA 2CPUA 2H0JA 4ODUB 4YDJB 3OMAB 1J5DA 1M7DB 5EUOE 2FXMA 1T2JA 3KYOA 5HVWA 3QZLA 5IROD 4K7PX 3CFJB 1FFPB 2YK1L 1A6VH 3VH8G 4L8SB 2P7JA 2EDLA 3H55A 3QH9A 5BRPA 3B9EA 4XO3A 5HVGB 4EDXA 1JHLH 4PWHA 4FXKA 1A2YA 1K8DB 3CGTA 4ISVB 5K39A 7PCYA 2HYNA 2IGTA 1QWHA 1AG0A 2BWDA 5ECJE 4JG5A 3FQ4A 4DZ8B 2C9VA 2ADFH 1KTDA 1MI5E 1XTGB 1FNFA 4ZTOH 4ZUVB 2GIYA 3C75A 5IF0B 1FSKC 3S8GB 3T3MB 4UCFA 3TEZA 1DQDH 5B66E 1E9PA 2VMDA 3L7EB 4TSBH 3FXDA 4UZUA 5IVXE 2OGUA 3D71A 3TC9A 3DPBA 3TU6A 2CLRB 3VSQA 5HI4C 5EC1A 1QPXA 1BVOA 1D5MB 1WJ3A 2UWEE 4AT6B 4TTGA 4DGWC 2L04A 5L0QC 2NXYD 4PJIB 3MU3A 1GTWA 3K0YA 2A6DA 3BWSA 3H9SA 4LGPB 4E5XG 3Q7JA 4LRIA 3BD4A 1VFBA 2OTLP 4IJ3B 4OZHB 1HYRC 1ND0A 1KTMA 4QRFA 1WMKA 3RK3C 1ES0B 3CCHB 5CGYC 1FDMA 4KKLD 4NP4L 4ORGA 4EN2A 1DZBA 1FWXA 1JDCA 1J7VR 2IO5A 4AM0Q 2NY2D 2VDNH 3QUMA 2QV4A 3ZHFA 5KSUA 1KGXA 1XF3A 2WMPB 2N1TE 2ED8A 3H6JA 4DN3H 4MQSB 2AJUL 1M7UA 1FZKB 4GRLD 4YX2L 2F5AH 2VO5A 3M9QA 2KC0A 3RTQB 1U91A 2R59A 2B16A 2D0HA 1RZJL 3GJFA 1SY6A 1V8HA 3QT2A 1IE4A 5B66H 3QXDA 2QSVA 1CDGA 4IGBC 1FAIL 3RBSA 1LTGC 1UH2A 4UDTA 4RIRA 2X4OA 1JMBA 2MOQA 4EE2A 1IK9A 3WAKA 2G3NA 3VI4A 3GF8A 3MA7B 1N86A 2NY6C 3HNVH 1RJZB 1TPXB 4WWKA 2YZ8A 3QW9A 5HD8D 2X4UA 3EYVB 2HA1A 3E6HB 1J9RA 3Q2WA 4MS8D 4TUJA 1G9NH 3BUPA 5KTEL 2AQSA 4Y2DA 2X4PB 4BELD 1NBYA 1KGYE 4B95C 3HAEG 4HSCX 4YX2H 4X5WA 1WZMA 1MZ9A 3WLWC 4KK9C 5MEQB 3B9DA 5CEXA 4WJG3 4YDMA 1YNKL 5LXVA 5A2LH 3S35H 3QFJE 2J59M 5DUMH 2WUCH 5LUMA 3W1ZA 3T6VA 2APWA 3H8NA 2IBGA 2Z93A 3I85A 1IGIL 4U7SA 2FEEL 1HXMB 4JFOA 1XCQA 2WKLA 3RTLA 4BFOA 5MENB 3CXHI 3LZQA 1YECH 3HI5L 2VDRB 4Y4FA 3E1F1 4BUHA 3V4WA 3MUGB 3L2MA 5DHYA 2IOMA 2QHLA 3WKPA 3UAEA 4WY4B 3V6BR 3CFKA 3DYPA 3WE6B 1V54B 4GBXD 4OIFA 8FABB 1S9XA 2WZAA 2KLSA 5F0LB 5B7MA 4JDZB 1R0AH 3C9IA 2YD5A 1EPFA 2KERA 3ABVC 2VH5H 3COOA 4XP1H 4H8WC 1FIGH 5LAXA 5TDOB 4XN1A 1FFQA 4U3SA 5FDWB 4OV5B 3O9WA 1J8HE 1AGBA 3BAIA 3QUYC 2VRQA 4H1LB 3VDAA 1LT1A 3DBSA 3MLSL 1ZSHA 4ZMLA 5E23A 1E4KA 4WO4D 4PGDA 3DX9A 2JTYA 3O41A 1P84I 4NQDB 5FCUH 1CGTA 4P2AA 5ACMA 1FVEB 1NLBL 3IVKB 3WIHL 2GTQA 1AOHA 4OLUH 3WIFB 5IOKA 9CGTA 2E7HA 3L73G 3BEWA 4UZGA 4PLNC 5I8CB 2BOLA 2Y0DA 3QJQB 4XN9A 5INCB 1KN7A 5DRWA 1DVUA 4S10A 1SQQK 3V9FA 1NU1J 2YO2A 5FUOH 5T3ZE 3HC0A 2CIIA 5IW3A 4FA8A 4UTAH 1TSRA 4G6FB 4WTZA 3EHBD 4YHKL 4FQCH 2VR3A 4WUUD 5DCCA 2F5BH 1HAUA 3B3IB 4WFEE 1OPGH 1IGML 4EN3C 3MGTA 3ZY7A 4G9FB 3ETBF 2F7RA 2XRAH 3NN8B 2FX8L 1CXLA 3EH4B 4ZQTA 4BQ8A 1IBGL 3U36B 4Z0BH 5E2VH 1HCFX 1NJ9A 3LIDA 4O02L 3DTUB 4GS7C 4NO3B 4FRWA 5AZ2L 1BE3E 1L9SA 5T5NG 3VD3A 4BKLB 3CC2P 4YSEA 3PYCA 4ZD3H 1CFSB 3K8LA 4LSVH 2BFGA 2CK2A 2HRHA 4D0CA 5IQNA 3OB0H 4KRMB 1YNLL 4AMXA 2X4OB 2OLDA 4XPAH 4LLYA 1TIUA 1FNHA 3KPRD 3QUMH 4KKLC 4OSUH 4PB0L 1IAMA 1MLBB 4BE6A 1L3WA 1X22A 1P4IL 4FXKB 2R4RH 5BQ7A 4Z0XA 3FF8A 1BVNT 4PJAF 3E2HC 2HG5D 2J5UA 1WFTA 2VDRH 4Q56A 1DSYA 3QB7C 4XX5A 1JZEA 1VQ5P 3MBXL 2AQ2A 1NOLA 4A67A 1V55B 2Y9RT 4WFED 4FZ8H 4QXGH 3SE4C 3CG8A 3VFMA 4OZFB 3EJQA 1NGZB 1KCRH 3EOAB 5D2NB 5DC4B 1H15B 3M0DA 1QLEL 3Q1MA 5EHFA 4ZUSA 4V1DD 4ZX3A 4ZD3L 3V7AE 5FO7B 2P42B 25C8L 3KD4A 1OAUL 3TJPA 1EJFA 3G6AA 3T6WA 4IGBA 3ZE0B 3CMAP 3CSFA 3O8XB 4UB6H 1DEEG 1OZTG 2W5PA 4JKLA 1EGJL 5DEGA 5F7EH 2VXVH 4Z7UB 1N6VA 1G9MH 4JFYA 1OVRA 4YGVB 5K9OA 4W9IC 5IOPB 2H32A 1HWHB 1NGYA 1S7VB 3TGUG 4Z78A 3VTMA 3VA6A 2YXRB 3MV8D 4DP9X 3BFWA 5E2JA 5FA3A 5GSVA 1Q1JH 1KB9K 1SFHA 2BP8A 3IXAB 4L2YA 1JI1A 1U8HA 2BINA 2Z92B 3VQMA 3ZZSA 1TVHA 3S88L 1DDHB 3I55P 4PRNB 3UZVB 2ZYGA 2OCFD 5KSAD 5B8CC 4F7MA 4GI6A 3BHBA 3K71B 5HI3D 5ID1B 4PRHB 4NQEA 2XZQH 4W6XB 2A06D 3BLPX 2CMRH 4ERSL 4NPEA 3IDXH 4J6RH 4HIXH 4QT5B 5C71A 1ZGLP 2VZUA 4ICWA 4Z7QF 2LVEA 5F3BA 5FLVA 4LB8A 2D7NA 4PJ8C 1G43A 2NUTB 3V4PA 2IV9A 4YS4A 4AH2A 1CL7H 3HS0C 4XNAA 3MZTA 3NRPA 3VGAB 2IZ1A 2VLJE 3BEWB 1EIBA 2XV3A 5HYSB 3QIUB 3V5HA 5HGBA 5I8CA 4J7RA 4PBXA 3QP3A 2GABA 4L3FA 5JPNA 4RMBA 5AYTA 1MW0A 2DKUA 3V4PH 3BQUC 3BPCA 2LU5A 3OAKA 4FKKA 1P7BA 3LHPL 2PRRA 3GSWB 1JK8B 2R0KL 2QVIA 2DJ4A 2Y24A 3GWJA 3PAVA 2RJMA 1E6JH 3PWVA 4RCAA 1HIMH 5DDHB 1XIWD 2A9BA 2VQ1A 3FC8A 4NENB 5EU6D 5TF1L 4CVUA 4FQPA 4UTBA 3HAEA 4G9FA 3HRZA 3MCLL 1P1ZA 3GLAA 2R29L 3HFMH 2DH3A 3NJIA 5IW1B 2Z8VC 4PCTA 4NN5B 4HUCA 1SVBA 3T3PE 5KKZB 4HWZB 3KXDA 5I1GH 1K5WA 1GY2A 3BN3B 4Y5YA 3WSQH 1E6OL 1N9PA 2W6BA 3NEEA 4XH2B 1D6VL 1UA6H 3IEAA 3MUGA 1JWSB 2CKBB 4PV8B 2CO2A 2O6DA 2WYHA 3NFPA 2PYEE 4FCAA 1MCNA 4JY6A 4K8RD 1NO4A 2ORBL 3FOMB 4WJ5B 4CL7A 3ZYIA 1EZVI 2G5RA 2WKGA 3VWKA 1CK0H 1FGNL 1FDLH 2J3SA 2X28A 2YD9A 3MTRA 1NWQA 4UYQA 3SD2A 5LVEA 4ELME 3GMNB 3OKNB 2VC2L 3AXIA 1QABA 2YUZA 3QULB 2VR7A 5EOQL 4CC1A 5D4IA 4FXTA 2BIHA 1Z6JT 1K73Q 4G9DA 4JFXA 4OZIB 2NZ2A 3VFMB 3RUGB 3IETA 5KANG 1N7SD 3V2QA 5CGTA 2PWDA 4H8HA 2R0ZH 1ACYH 3EJYD 1NMBL 1JXFA 2NY3D 4MLIA 1UWGH 5I76A 1H3XA 5ID0A 4GAJH 3V4UL 4Z7QB 4GT7A 1SMAA 5C0CE 5DC2A 5L2KE 4DN3L 5C07A 5IOPA 1BECA 2CBMA 4Z7VF 5E4EC 1R3IL 2NXYC 2Y1ZA 3ABGA 2EO9A 4MNQA 2MNWA 2QQLH 4XBGB 4Q8BA 3GBNH 2YNYA 2DJMA 2CIIB 4KAQH 3USSA 4AYMC 2VTFA 3GMQA 2HVBA 1KNOA 1UENA 3HG1B 1IGCL 1JOIA 4X4YA 4W93A 4TN9A 2CK3H 3US9A 2BNQD 4WTZG 2F74B 2G3AA 4FX5A 4E9QA 2J1KA 1QLRB 4FZEL 1KEGH 2BS8A 4IRSB 1TZIA 4JZJA 1BZ9B 4PBWD 1QLFA 1DD3A 1H9VA 3E38A 4U3CA 3TVMD 3VSVA 3EO1A 1NIAA 1VKXA 1OOAA 4HWEL 1IT9L 2PP8A 2KXPB 3WMM0 4HJGH 4HALA 1ORSB 5CLTA 1VSCA 2ZKYA 3R0NA 3DX8A 4NB7A 5EB9A 1RQVA 4DGIH 4GXUM 4WB4A 5DEZA 4OCSL 1FO0L 3B4NA 3IDMA 4WKZB 3OJDA 1B88A 3P69A 3D25B 1KYFA 2BVEA 4H88H 4XRCB 4GG8B 1HS6A 4LRNH 3GZKA 4P8QA 1LWJA 2XUWA 1EDQA 3CSTA 1EXUA 3ULAB 3O4OB 1HINH 4WWPA 3CCSP 1E90A 2RH0A 4LVNC 3MR9A 2FYUG 1C9SA 1R3JB 2YUWA 1Y18B 4FQHA 5E5UB 3VWKD 1P69B 1LO3H 3E9TA 4WO0A 4F27A 2I7OA 1BSHA 1JK8A 2CR0A 4M5ZL 1JL8A 2NY3B 4TNVK 5C09A 2RTTA 3JTTB 3RYMA 2GUOB 3UC2A 3SHSA 4M4RA 1X44A 3MRCA 3V6ZB 2CHZA 1PGQA 2O01J 2ZF9A 5TISE 1AQMA 2AJUH 4QXUH 3AJ7A 2ZOKA 3ULSA 4A68A 3L3OA 2BY3A 2GTZA 3EYUH 3UEZA 3E8UL 1NC4D 5DJDA 2PNDA 2OMWA 1J5OL 4NKMB 1LGVA 2OQJB 1X5IA 4FHKA 4Z1MH 5CJOL 2R2CA 1USDA 1PX8A 4QHMB 8CGTA 3C60A 4MWFB 3NCJH 4WUKH 1YN7B 1NCHA 4G7SB 4JZNB 2D0FA 2O6PA 3NFQA 2Q7CA 4RZKA 4BZ2H 1BCCE 5AVTB 1U8CA 3QNYA 2Z92A 3PDDA 2ITEA 1FNSH 4FD0A 4KTYA 5J1AA 3UMTA 5ABDE 3GT6A 1VGKB 3ZKQD 4KITB 1ONQA 5HHPB 4LF3A 2K3HA 6TAAA 4ZUVA 2V2WA 4L74A 2NY1B 2WKOF 3FQNA 5MERB 4PREB 3Q5RA 4FA6A 3ETSA 2WLLA 1XV8A 1IVTA 2GVYA 3F58H 1JY3P 4MMYA 2DYPA 2NW2A 1G7HA 3MO1B 5AUMB 1VF5C 4I1NB 1UWXK 3BSHA 4I18B 1FNEB 1LQSR 4IIQB 1IM9A 2XC8A 3O9WC 1PLCA 4ALAH 4FNTA 5HSFA 1EBPA 1MI5A 3RL1B 3WS6C 1GXEA 3X3FL 1WRGA 3MBEA 3O8XD 4XX1E 1YJDC 5IFAH 3B5TA 2M3EA 4S1RL 3IDGA 2ZF8A 4OD3L 4G1EB 4QXWA 1TYRA 2UXGA 4R4BB 5KLVK 1HH9A 1C7SA 1G7JB 4YR6A 4Q58C 5JORA 4PR5A 1L7TH 3HG1D 2Y2YA 4JE4B 4HCRH 1MEXH 4ZMPA 2QDWA 3IMUA 3L3OC 5MHSE 3L5WA 2A9DA 3DHMA 3HB3D 4YLCA 1GL2A 4X6EA 5ICZB 2IDSA 2KKQA 4UTBL 1RJLA 4PD4H 3L3JB 3T8MA 1SN5A 3RDJA 4TPRH 3ULUE 2XV6B 3CE1A 4WWIA 3U6XA 3OR6A 5AW1B 2OL3L 5J13B 5GZOD 4XMLH 4X5XA 1UD5A 3VI3E 2PR4L 1Q94B 3QJUB 3LN4A 4AK1A 3NZSA 3GHGC 2QZ5A 1IO4A 2X6AA 3SOBH 1GC1H 4P99A 1V27A 3IFNL 5F89A 3TURA 4PJBA 1ZMEC 2H26A 1XBDA 3BISA 4LCCB 2IF7A 3I9IA 4TUKH 3SDCB 1BQLH 1XCWA 2IOOA 1EX0A 5F7DB 3T1WA 5I1DA 5D70L 3NAAH 3ZTDC 4BXLA 1Q9LB 4S1DD 4DKAA 5FA4B 4LE8A 5E79H 2OYHA 4K3EL 3SJVB 2V9TA 3VWJC 3WXVH 3NCEB 1RUKH 1FHNA 1MN4A 4BFKA 4ZX6A 3PWPE 2OMVB 3CVHL 1UIIA 1NUFA 3MKGA 1DN0B 5C09B 3VFUB 2A4EA 3VGGA 5A16A 3SZ6A 1BD2A 3HE4A 2WSCH 4IU2B 4RMRA 4IOIB 4GKOA 1FH5H 3GBLA 4XMUA 3BKCL 3VXRB 1A66A 3ITKA 4S1SL 5GJTL 2JVUA 1TTAA 3W2DH 2VM9A 3EO9L 1MHCB 2HJKA 1TFPA 1SHXA 3L74D 2D73A 3HBQA 3LJ3A 5GRJH 2IGFH 3CFBA 3O4OC 4H40A 5CP3A 5FOBA 4HAFA 3A3YB 1INQB 4IMKC 3VXUD 2NLJB 4CC0A 1IC4L 3PJSK 1YPZB 3AFLA 5ADPL 1L4AB 4OF3A 3AY4A 3OC5A 1DDTA 4WY4A 1NH6A 1IJDB 2P5EE 1SQPE 1KJ3H 2K9UA 3K46A 3OLDA 4XCYA 1K05A 4U4IA 2PYED 2NMSA 4X4YB 4K3AA 4K7PL 3TONA 1AE6L 4C4KT 1A21A 1UT9A 4JRYD 2DV6A 4I4WA 4KU1A 2IDFA 4MDRA 3WENA 2BVQB 3Q3GA 4R7NB 1IKNC 2J72A 2R2BA 1S5LE 4EO5A 3TYFB 2EABA 3HE7B 1G1JA 2HKFL 3OGCA 3MTXA 1BVZA 2XWDA 4KHTH 2FJGB 4PJEE 4XP9H 2EXTA 3ESUF 5DRZB 4L29A 3FUNA 3FQNB 3QEQD 2K9JA 1K6QH 1URQD 4WU7A 4NQCB 1T1WA 1M1KQ 1EXGA 4PWEA 1CR9H 1EANA 1VRSA 3SQOH 3ZQXA 4PVLA 4Q97A 2GBUA 2V7HB 1KDJA 4H13B 4AOFA 1ASPA 3FU5A 3UTQA 3ZE2B 3QDGA 5D7LE 1MKFA 1RUML 4ZW3A 2P8LA 4PPTA 4CC4A 4K5LA 2DYRB 3HTLX 1M3IA 1X7TA 3N1FC 3FO1B 2OMUA 2F9BT 3MLYL 1QBMH 5D6CB 4JJ5A 3VWJA 4H1LG 1JDDA 1CO1A 5SWSB 4JX0A 1CFTA 2DBLH 3D69A 4NAMA 1NU1E 3T2OA 4MCYB 1CUOA 5MEOA 4EI5C 2F7IA 3M8OL 4KJPC 5JXAH 1XGQA 2ENYA 1TT6A 4PUBH 1XAKA 5KN5B 1HL5A 4GLRI 4KMLB 4ZNCA 4M7LT 2P47B 4GMSH 1A7BA 2VXSH 4HZLA 2FJUB 1YC8A 3EWKA 4MZIA 2MH4A 2Z35B 2Z91B 1AKPA 2DQJL 2APTA 4N68A 5GTIE 2R69H 3ULSB 1V3MA 1MJ8L 4JQIA 4J8QA 1LP9F 3UJTL 2NY6D 5EMYA 4EPSA 1BPVA 4OVUA 1F13A 1DFXA 1MWAL 3FTZA 4IKIA 5FUCC 2XYBA 1LNQA 5JPMC 4M9OA 4MNHB 4R2GB 1LMIA 3AEBC 2Z7WA 5AVSB 4U1HB 3RGBA 4ANUA 2W80C 2DMCA 4JZNA 2J4WH 1J2JB 1AKJD 1XGTA 1NIFA 2OMXA 2L5GB 4HFWA 5FB8B 1E5YA 3VD4A 2AEFA 1ZVYA 5CJBA 3RK2D 3QS2A 4HUUB 4WY4D 1AJ7H 2YEZB 4JQIH 4XXCC 4WI5A 4CJ1A 4KI1A 5FFOA 4R7LA 2EO7A 1WFIA 5BRQA 2BHUA 4PY7B 3U1QA 1EHLL 2QJPC 3CX5H 3I2CH 3MRFB 1BHGA 1Z5HA 5IQOA 2F1AA 3UTTD 2OMVA 2XZAH 3EOTH 3WGVB 5EF1A 4L3EE 2Q3XA 2F61A 1GU5A 1FBIL 1UH4A 4UOW0 1B0RB 2M8RA 1BQUA 5GJTH 1OCCB 1VLXA 5I0XA 3PJLA 5KBDA 4I18A 3ZE1E 3MV8A 2AK4E 1RF0C 2VR6A 3B2XA 4OTXL 4X6CE 3VU1A 2BX5A 2YD4A 1KMIZ 5DMIH 3RAJL 2R5BA 4GDOA 3GSXA 4PJIE 3NEOA 4POUB 1IFMA 1Q82Q 3EJRA 1NGYB 4A2MA 4D8OA 1J9SA 2XETA 2BSSA 3UG5A 4LPUA 4L4TA 2MTPA 3QEGL 4KXAA 5F9WB 3D8MA 5KANI 3T6QC 5E1IA 4LCWE 5CLWA 5EDXA 3K91A 1O5DT 3ZL1A 1MKMA 4MYPA 3ZZQA 5JYLA 5KBKA 3OKOA 1DDHA 2FYNB 4MJ6B 4B9ZA 1H8OA 2PP6A 1S9VA 1A6TB 1U8PA 3LQAL 4LDOB 2CDGA 4AC2A 1MCFA 4WWNA 1E5BA 3K6NA 5KS9E 3HE7A 1Z9PA 1UM5H 3ZTCC 1QVFO 1TCRA 4YIQB 2O26U 3L81A 2CR6A 4AUUA 1VQKP 1RIHL 4XNYH 2Y5QA 4PGBB 1C1EL 3EBHA 3FT3B 4NUJB 1X5ZA 32C2A 3HBPA 4BH7B 1WC7A 1K4CB 1H3GA 1J12A 2ZUQB 2DS4A 3BP5B 4JO3H 2QEJA 2QFRA 5CXPA 4K8RC 2ZJSH 3KXFE 4AQOA 3DETD 4RMWA 3WJLC 2IBZG 1XR9A 1I7UA 3ZGIA 4AV5A 1OE3A 1RHFA 4I3SH 1U8MB 2XWRA 4LP5A 3QC5X 1T04B 2OARA 2CDEB 3LQMA 3LKRB 3TWCH 4I3RH 3BSZA 1NUGA 5FKAA 4HKXB 5E5RB 5KYXB 4NLHA 2O72A 2I1KA 4G7VH 3GLZA 3S4SG 4M5YH 3M8OH 1ICTA 4Y88A 1HHHA 1GZLA 1NTKG 3MLXH 2E42A 2KZWA 5FW7A 2VDRL 2GUYA 1FYTE 1L0ND 5LCVA 3T6XA 1DN0A 4GQ9H 4O4YL 2CSPA 4PJDF 1CWVA 2W65B 2XBZA 1HU8A 1MPAL 3EQ2A 4NCC2 3HRZB 3QDAA 5MHSD 1NKOA 4FJZA 5G4MA 2FLRT 4YBLB 3B6SA 5HYJB 4DETA 2UXFA 2AK1L 4NQXB 2HVKA 4DPCX 4LU5L 2YJLA 3UTSB 1UB6A 1ZSDA 3L35A 3K7UA 1FGNH 3KE0A 4RWYH 4IFDK 1JF5A 1JVOA 2CD0A 3FNKA 4FXKC 4PJ9B 3RJQB 4RRPG 1VQNP 3F6LA 1T4KA 5GHWH 2FGWL 2BVPA 4YBLC 5A6LA 4DNLA 3MV7A 2W0FA 3CC1A 3QYNA 4RO0A 5DS2A 3OZKA 3SYQA 5I24A 1NDGB 2H32H 1TZGL 1NTMJ 1S78C 4WSJA 5B1JC 2DN7A 2UXTA 1JDAA 5MP6H 3W82A 1CVRA 3TN0C 4W9DC 4XNMA 3G6DH 3OKEB 2EICA 4LU5H 3T65B 4S2SA 2NNAB 4PRIE 3KGTA 1AMXA 2ZUXA 2K4WA 2RCSH 1BJ8A 2WBJD 3TDKA 3ASWA 3MRHB 4UNUA 1H3TA 3MRKB 3QJTB 4YXLH 5CCHA 3S8WA 3DIVA 2UY6A 3P4OA 1MY7A 4Y8AA 5CKGA 1TLMA 3VNYA 3FRUB 2XN9D 1SQPJ 2BY1A 3JYBA 5EFIA 4NJ9H 5B1AB 3NXSA 3CFEA 4DKFL 3DMMD 3QZWA 5DJZA 5F0MB 4YPCA 2ZUQC 1QA9A 1UEMA 2AJ3A 4U1MA 4AI7A 4XXWC 2KPNA 3H9SB 5SWZA 3GHBL 1L6XA 3EDFA 2DL2A 2DQCH 4ABVA 1ND0B 2ZAIA 1K85A 1SFCA 3MNWB 5I0VA 5IK3B 3RAJH 2XZQL 4LVOC 2JELL 3UH8A 4JFFB 1QW9A 4RNRB 4LC1A 1P53A 4APQA 4NRXA 3CX5J 1ZXKA 3F7YA 5SWQB 4PB0H 1SBBA 2IWGA 4H20L 1OP3H 5CCGA 2BIQA 2Z65C 3MPCA 5SX4I 4BGLA 2C9RA 2X42A 5IVZA 4PWFA 4HT1L 4G83A 1TCRB 4YIQA 4MA3A 3NYKA 4Q0XL 3EFOA 3CD4A 3FBQA 4RRPA 2PGDA 4MXQD 5CBAA 3KR3H 1S1CX 3IFMA 2MHAB 4PB9H 5LBGA 5BMFH 4R26H 3OJAB 3DXAE 3MRJA 3HE5A 4J3XA 1KFMA 1TTFA 4EUPG 3L13A 3IXTB 4ONFL 5H94B 2VDKB 1UXSA 3R1GH 3DSFL 5GZNA 2CBQA 4ZMZA 4PV9B 3K5SA 4IU3A 1D7DA 2CK0L 3L9RB 4PJXB 3TO4A 3UIZA 3AROA 4DEUA 3RDTC 5KVEH 1A5FH 1SJMA 3D07A 4D6TJ 2FBJL 4QRRD 2H3NA 3QIBC 2BO0A 4BK5C 1OPGL 4I9XA 3MLPA 4C8XA 2X9WA 2EO1A 1R8EA 2NNRA 3GMMB 2Q9OA 5H2BB 1KCSL 2IGFL 3SE6A 2HJLA 2OXGB 4NKIL 4C4KO 5D2LF 1BGXL 4D2NA 1M56B 3G5YB 3H1IJ 4H0LB 4FG2A 3AE4C 3MRGA 3JTTA 2K6ZA 1GCYA 4H8UA 4G72B 4XBEL 5FYJU 4HHGA 4L0ZA 1UWGL 2VDKH 1SMOA 2WXFA 5TISH 2YAOA 2YRBA 1JXDA 1QL2A 1NFDB 3BRDA 4UDTB 1AZZC 3DMMB 5EEWA 1UATA 3ARGC 2XN9B 1LNUA 1EAOA 3P54A 1NAML 2QJYC 4FNLH 4K3JL 4KOCA 3F5WB 4M3JA 1THAA 5DMGC 3V95A 7TAAA 2IJ0C 5CSZB 1SLUA 1DVFC 3TCLB 3UIYA 4PJ0E 2C26A 3H9SD 3WKQA 3TBSB 5C3TA 2ZCKH 4JRXD 3JV4A 2VISA 3TN0A 4PJBF 3R7QA 1F6FB 1K6QL 1SLXA 1OB0A 2FYYB 5C0CD 3AABA 3RWFA 5LKNA 1AYRA 3CIAA 4WNQA 5BO1H 5C0DB 1U8CB 3TH3T 3ZRSA 4A55A 3M17A 2X44D 5AKTA 3ARDC 1TZGH 3RKDC 1MFMA 2EECA 1X8YA 3CPUA 5E00B 3O3AB 2C0WA 1WAPA 1O6TA 3GKWH 3E0GA 1OY3B 2ERJC 3M1BA 4TLKA 5LAXB 1H8AA 3IPEA 4JFPB 4U3SB 5HHOD 4R8WH 1MJ7H 5J3HC 3VFSA 1IQDB 4FZEH 3TA3B 3Q44A 3ZDYF 1PKOA 2UZIH 2C3HA 4FJ6A 1E42A 4OQTL 2EYTB 3L3DB 1GKEA 2WJ7A 3KLDA 2XXMB 4ZPTA 2F19H 3CQFA 2Y6SD 3UJTH 2EDTA 1BVLA 4G42A 3CFKB 1JGDB 3EOYG 1I8IB 3WE6A 1FPTH 2ATPA 4GBXB 4B9PA 3Q2VA 3PJSB 5I6LA 1RZJC 2R56L 1WHOA 2PPAA 1PP9J 3WIFA 2EIDA 4FG4A 2DLFH 1BM3L 1E8WA 1OVZA 1TETL 3AG1B 3DLQR 4LSPL 4BSVA 4PP1D 1KBGH 1MI5B 3FCSA 3DRTA 3RL1A 1WFOA 1FGVH 1OALA 4P0DA 3KWWB 4G7RB 4PGEB 2FWUA 2CO4A 2EYRB 4PQXA 4E41E 1SFCB 2V4LA 2EVGA 2IX7C 5CJ4A 3Q05A 3H6AA 1HHHB 3WHXB 4NZTH 1RIVL 2F68X 1ZLVH 3MXWL 3UTPD 4ZMOA 4XMKH 2VQUA 5EH1A 1IILE 2CCVA 4RJTA 3S36X 4FQ1L 5TQ2L 4BINA 3QUGA 2IAMD 4NO2A 4HP5A 4NM8H 1HJ0A 4X6EB 4HJEA 4KJQC 4IFFA 3QJOA 3VYIA 2YPLE 3IFOB 4QNPF 3D6GA 4NN5C 2L0DA 3CHXA 4PGZA 5CILH 3T1FB 3WE1A 5ENWB 2L7UA 1URIA 2AQRA 1SHWA 1NWPA 4MKTA 4J3VA 3STLB 1J8HD 2D3NA 3NAAL 3AT0A 4IK6A 1NFIB 2VDOL 3D85D 1FNSL 1G1OA 3PCYA 1ZLEA 5E8OA 5E9DB 4PGJA 5HI5D 4L8CB 1PP9G 5F9JB 5C08D 4KK8D 2PYEB 2CKBH 4U6TA 1XMWA 4FNQA 4I5BB 2B2XL 5DLMH 1E9OB 5EBWA 5TDNB 4QJ4B 2YFOA 5CEZE 1DQVA 3EXLA 3F3HA 1KENL 3MNMA 4X83A 5GGRY 2KDYA 5EZIH 3QS3A 4WBAA 2AQQA 4YHPB 2FEJA 2QTEA 4YO0B 4KAQL 3PABB 4WHYH 3H1JD 1QSEE 4GMSL 4NGHH 1L9NA 3MLWL 2CALA 2CGRL 3PAZA 3L8QA 5D2NA 1U4FA 5CP7B 3RUGE 1N64L 2Q7YA 2K1MA 4P3DA 2XN2A 1T0MB 2CZNA 5FV2A 4NHCL 4KVNL 4AW4A 3TIEB 4FZ8L 4MXWH 4PTTA 1X7QA 4QXGL 3GD1C 2O1JA 3Q5PA 1S78D 4KRPD 4N2OA 3N41F 3IAPA 3AB0B 3NSXA 1BYOA 1UACH 3AAZB 2EYSB 2VE6B 1XMEB 4MAYC 2B3RA 1SQVD 5BVZA 4A37A 4ANWA 3OHXB 1DEEB 4XMKL 3Q2LA 3K6IA 3QORC 4FI8A 2N0MA 2H2SD 1HEJC 4HOWA 4UV4H 3WTWA 4P23C 1CFNB 1K5NA 1FO0H 1T83C 1NBVH 3ARDB 4CDGC 2VLJD 3ASNB 5IM7B 4DCQB 1KQSO 4JRLA 4AQEB 2QPSA 3BW9B 1JV5B 3JTBA 1YNTA 3QFDA 4WTXA 5IESL 1B4TA 1HXYB 2CUMA 5GS0L 1DVYA 4OFVA 3RB5A 3SGKA 5HYQA 2WLZA 5EUKA 4N2IA 4UMGA 1CLOL 4Y5YC 2VDML 1ITBB 1D7CA 1KCVH 3LKNB 2YPKB 4Z78B 1JY2N 1EEZA 3B37A 3V0VB 3T0ED 1UKQA 2ATKA 3RK2B 4MJ4A 2B2XH 5F3BB 2FSDA 5IJKC 2WVTA 4FI7A 1JUFA 4JDEA 2X3BA 4N8CH 4GB9A 5E4IA 1CT8A 1QI3A 2D9CA 3MCYA 4GW1B 3IFLH 2WANA 1Q0EA 1IZJA 3R4RA 1LK2A 4RGMB 1W6LA 3HR5A 2G60H 4V1DE 2QLVB 1A4BA 3MRIB 3DRTB 5E2TL 4JYCA 2HKHH 1M9WA 2E7LA 3GMRA 3V6IA 2ZXCA 1M57B 3CX5D 3QJHA 4APXB 1OGAE 2PAJA 1WT5A 3CFQA 1R5VA 1IAKB 4WTQA 4YE4H 3QIBB 1CFVH 2B87B 1TYEB 4FLHA 5C0FB 1HQ4A 1CDIA 3BCCD 1JV2A 5H2FE 1EGJA 1GGBL 2B1HH 3HNTH 1HX0A 3OHMB 3CVHH 4HQQH 4KTGA 2XKUA 1DQDL 3K8MA 4NO2B 3DSNA 5BS0D 4HUNB 3N5AA 3PPSA 1T66D 4IOIH 3P3SA 2PO6D 4YHNB 1IFHH 3AG3B 4QRTB 2GT9A 1K8AQ 4X8CA 3RWGB 1IBBA 1F3JB 1SLWA 1XGZA 5EPMA 2G75B 1HILB 4HLZH 4LHJB 4N5ED 2Q8AL 1Q9KB 2NCEA 3AEAC 1NL0H 3FQRA 3SE3A 4CVWA 5HDQL 3MLSH 4WFGD 5E6YA 4F2MA 4QAMB 3RLSA 1EHKB 3S35X 3KLHC 2RKLA 3APDA 3GSWA 3H2WA 4Y5VB 4HX1A 3AACA 4I6MC 3HBZA 4EJ1C 4XNQA 2ORBH 3DV6A 1IM3D 4LQFH 4NPKA 5JR1H 2W60B 1NEUA 4MASA 1UGNA 3T3ME 5AW0B 1W8OA 4CU6A 1JYVA 4OUUB 1J1DB 3QIWC 4NQUA 2EE9A 4D3CL 1NFKA 2NY3C 3EF7A 3RBXA 4KKAC 2UUDH 3OKNA 1EQWA 3LW5J 1CJYA 5AKRA 4ODVH 1ECYA 2NY4B 4MB3A 4NO5B 5T3ZH 3ILDA 1IL1A 1GZHA 4HPYH 1MJJA 4P4KD 4RDBA 4OZIA 1P84E 1RUPH 2GG1A 2JIXD 1CE6B 1O6SB 2DQ6A 2H2SC 2EXYC 4MJ5A 1SP4A 2E75D 1CICC 4Y2LA 3QORA 3HC4H 1SXNA 4DVBA 3U25A 5I8KL 3PHLA 2OX5A 4ICXA 4TRPH 5B22A 3BUDA 2N01B 4OJDH 1U92B 4FYSA 1F58H 5AB2A 2BCKA 3RK2C 3H7BB 1G5AA 3BT0A 4NN7B 3EJJX 4DJGA 4UU9A 3QULA 1JZ5A 3Q8AA 5E1QA 3KPPB 4E2OA 1AXTH 2C9XA 1QHPA 2G2RA 4WK2B 4NI3A 5BRZD 4M93B 1NU1K 5J6SA 3BI9X 3TBTB 1VL2A 1LEIA 2XDJA 3MJ7A 1DEBA 3T2QA 5I6KA 2QM7A 1E9PB 3ZIYA 4XO8A 2XIBA 1E7UA 1XWVA 1CF8H 2V5MA 1XF5B 4KT0J 2VGLM 4GAGL 5CINL 2UZXB 3OM3B 3OD3A 2E8ZA 5JTWA 5KJRL 4N8VG 2FX9L 1KBPA 2FO8A 3OC8A 3HCVB 1YNLH 1A1OB 2O5YL 2XVLA 4YHMH 5E0FA 1JZ7A 1PPJG 1QRNE 4Y1AE 2E6JA 1X9QA 3VGDA 1QLFB 2YXFA 4B5EA 5CLZA 1KN4L 1NANI 3J8F7 4OZHA 4YDZA 1RPQA 5ENWA 1B2WH 2VUYA 2WYZA 4F7CA 2XN1A 4IKNA 3QO1A 4PJ7F 2IFFH 4HDIA 4HCGA 3V4VH 4F33A 1I3GH 1DR9A 3ARED 1NGQL 5F9JA 5CBEA 3IPBA 3E6FB 3PLYA 3QWOC 4UB8E 4ASWA 1RMFL 5TDNA 1TU2A 5JOFA 3MRIA 4PRHE 3VB9A 3HPLB 1XBRA 2VYRE 3KNBA 3HOGA 3LRHA 3IBOA 3B9VA 1NCJA 3VAEA 3C2AH 1QFWH 4JFHE 1YIJP 4JFEE 2ZP0T 1P5VB 1N6QH 3KDMA 1CLVA 1IAKA 2VDPL 3I02A 4CILA 3PDOA 1KXTA 2DQDH 3OW2O 1O0VA 2B0SH 2GJ6D 3DGGB 4M62L 5F7LB 4KRPB 4OZFH 4S1QL 2OW6A 3P1VA 1G2CB 4RWYL 5DJ6B 1ZHNA 3NIGB 1ILSA 2FB4H 4LEOA 4PJFE 1AGDA 1MRFL 4R7DB 5I1HL 1B9KA 1ZAGA 3CX2A 3W11D 4F2EA 1NTKE 1BFOA 4XWOD 1NVOA 3EJTA 3NJXA 4XC3L 3E1IA 3LEYH 3GB7A 3GMOA 3VI4B 4OT1L 5A43C 1O6VA 3TZVA 2EEDA 2N9YB 1UWEH 2BDNL 1HGVA 1U7MA 3LNDA 5DQ9A 1D5XB 1SGKA 4PJ9A 4DVRL 1HOEA 4RX4A 1SQVG 2KNCA 2COVD 1XGPA 3HPJA 3ZW3A 1J8HB 4KC3B 5DA0B 4ERSH 4DK5A 3MJGX 2HMID 2XNDH 1C7TA 3TL5A 2E59A 1JSYA 1DQQB 2WXRA 1RY3A 3EFDH 3CUPB 3B83A 1OAZL 1UG9A 4P3WA 4DUXA 3GHPA 2YAFA 1S7UB 3ES6B 4HXBL 1GSKA 3FUDA 5FW6A 3WNPA 3QUKB 3ARFB 4UB8H 1A6WL 3FU6A 3K6FA 3MBWB 5JHDE 4Q2ZB 3BP7B 2KI6A 1RUAH 5EORH 3WTXA 1LO5A 2E27H 4H8WH 1IU1A 2VKXA 5E51A 3AS1A 5CJOH 1U8LA 5IKCA 2WLLB 1EEZB 4IBVA 4IRJD 4FQXB 3D2UB 1A1MA 5CWSB 1P7QA 1QSZA 3INOA 1FNEA 2Q2EB 4UMSA 3B8YA 4PJAB 3JWOL 1BAGA 1IQWH 4YHKH 5D2LE 4K71C 3CQQA 3RBGA 1AR1D 4NNPH 1I1RA 2CM6A 1U3JA 4JZOA 2IWFA 1N59A 2ODHA 4N6QA 5CILL 1E2WA 1MREL 3X1GA 4BSJA 4HD9A 5KLVD 3HUJA 4HT1H 4PN6A 3QJHB 5KUMA 4APXA 1ZA3A 4U7KA 1RF1C 4IOFC 3ILPA 5FM5M 3OG4B 3CC4P 1T7ZA 5AALA 3QXWA 4ZQKA 1ID2A 1MZZA 1HH9B 4E9LA 4Y28J 2E9WA 1FORH 1JCKA 3HRNA 4NRXB 2P8PA 4GSUA 4URTB 2RQ8A 1Q7YQ 3HC2A 3LH2H 4D0BB 2YGQA 1QL1A 3APNA 2EXYD 4Y2NA 5J9PA 3MLZH 2C4FT 5SWZD 5ICZA 5EO1B 4QCIB 5LAPA 4NNYB 4WSGA 5H35A 3TEUA 1MJUL 2VM3A 3DURA 5AD0A 2J6EL 3T9WA 2ZUWA 5F7BA 2FX7L 2MHAA 2WIMA 4JFDB 1XTCC 4R5VA 4Z95L 4APQD 2OSLB 2LAGB 2VM4A 4HWBH 2YN3A 1X9RA 2QJYB 1H8LA 2L7JA 4OIBA 4P2OD 2JCWA 4QTIL 5D4HA 4E0RA 3IKKA 5EZOH 4PD4D 4W7YA 4XA4A 1ADQA 3EDJA 5LQBL 3MFFA 1MF2H 1IKNA 3ISYA 1P7QD 4OF0A 2H3NB 1BQRA 1TU2B 5D2NC 5JOFB 2GSIA 1ED3B 3U46A 3PREA 4IKLA 2NNCA 5A2KH 2HRGA 5IG7B 2W90A 1T21B 3GSQB 4RAVA 2QQQA 3WEBA 3OAZK 3KWTA 2XXGA 3A4EA 2E76D 1PG7H 5FEBA 1GHFL 4GAYA 3V6OC 3OMZA 4FKEA 4M61B 4ZFFB 3BAWA 3VTPC 2VLKA 2VDMH 2VL5A 4NQTA 1A0QL 4H13C 1ZXQA 3VXQA 4W81A 3QQ3A 4NUMA 3HD7B 4Y1TA 4AL8L 3O45B 5I74B 3PRJA 5CU9A 3UXFA 5HJBA 4GUOA 1DQJB 5BZWB 1VIWA 2GBVA 1GW3A 5I1DB 3JXAA 2NNFA 3L4CA 5D7KE 3WIHH 4Z0XB 3U7YH 1SNRA 2JNZA 5EU7E 2ITFA 1WH0A 3IDNB 3KGSA 2NLJA 1KB5L 3HE7C 3QEQB 4TM9A 4JPVL 3IMTA 3CZGA 1R33A 2AKRA 3HKFA 5T1KA 2DL9A 5GGQH 5CD3A 3W39A 4EN3B 3JV6A 3O3AA 1MFCL 2KP8A 3P4LA 2BASA 1JPFA 4IL6E 1ZRTD 3G6AB 4NSKA 5L9DL 1KMGA 2WTOA 1EJOH 5F3HB 3B8EB 5I1KH 4OZGE 1S9KD 3ATEA 3DX1A 4ABUA 1UOKA 2GJ6A 5EZJA 1NBQA 2JXMA 1WFNA 1JTHA 2DLFL 3MLWH 1LO5B 4RZCA 1REIA 4Y9FA 4U6XA 2BLFA 2B20A 2FBJH 4Y19D 5D1QA 4NC0B 3V0EA 2V7HA 2ITAA 4HKZH 3D09A 5FYLD 1OT4A 3AXHA 4BFNA 3JTSA 4E42B 3KWVA 4ZMVA 3AE5C 3R1GL 1LM8V 1JPSH 2CHDA 3FONA 2P49B 2R2BB 5K9JL 4QXVA 5TF1H 5FHBL 4XB8A 3FO1A 4IGBD 1J1OH 1GHFH 4J4PC 5D6CA 3VWJB 1E30A 4DPAX 3DETC 1WIPA 2FJGA 4QEGA 4HMCA 1N73B 2IAND 1E67A 4EOWL 3OAZH 4UM9B 5CFHA 5GHWL 2WBJB 3KJ4C 3I02B 3G5XA 2QJKC 4WEUD 5KVDL 3UPRB 5GGUA 3LCYA 1F11A 1XH3B 5DJ6A 1HQRB 3CZFB 3ZGHA 4DKDC 3NUKA 3U79A 1DL7L 5IEKA 2VLLA 3ZTJH 2MRYA 2VLKD 3FUKA 3AEFC 3ABMB 4OCWL 2ODIA 1T1YA 3DURB 2EDXA 4Y8DC 1IEBA 5DLLA 3OSKA 1PKQB 3Q2YA 1KBVA 2FWOA 3ARXA 3OXRB 4JFDA 4G8AC 4G82A 2FIRT 4BQCA 1LTSC 5B1CA 3ULVE 1YN6B 5IQ7H 2KZJA 3LD8B 4WHDA 2HG0A 2K1AA 1U8JB 5E9NA 3VI4F 1WHPA 2HWZL 1AVOA 4HKJB 1E2VA 1TJXA 4K5NA 1QO3A 2BW5A 3FCTB 2FY8A 2ZD0A 4WNSA 2Y07L 5IHUL 2DM4A 3CJJA 2R4SH 3D12B 1UZ6E 1R4XA 4UT9A 3N06B 4GT0A 1CGVA 3L45A 3ORJA 4YXKL 2NY0C 3SPJA 3QZMA 2XLLA 4PY7A 4FYTA 1NINA 1XB8A 3ECBA 5C0CB 1O7SA 1ETA1 1KV4A 1RHHA 2VLRA 2X3AA 1BXUA 1M7LA 1D5BA 3ET9F 4LDEB 1QNZH 4E9TA 1JWSA 4HEMA 4I77L 3CPWO 4JFHD 1R24A 1IK7A 1S7XA 1XVSA 1KIRB 4FQXA 4NEHB 1PG7L 1DUZB 1YMHA 2J4WL 5IFHH 3GXIA 2DQHL 4XPTH 4CN1A 1B2WL 2BWQA 3H1LG 4RISL 5KLIC 2CCLA 2D2CC 2F0CA 3CPLB 5JIDA 2I9TA 1W0VA 4W4OA 3UPAA 1Q9WB 3QQNA 2R4SL 2DTSA 5HHMB 1QAWA 5I82A 1CDBA 3CCQP 3MJ6A 4HD5A 5T1MA 5I2IB 3MZWB 1PZ5A 1AC6A 2Y7LA 3F12B 1HCVA 5T1KB 4WI0A 2E76C 4JRYA 1B0RA 4GFTB 1PBYA 2YARA 4F5CA 2Y7NA 3NP4A 1UWYA 2N1KA 4MMXA 5EUOF 2BIIA 1MHHB 5ID0B 3S36H 2YKPA 4FP8L 3RL0B 3E8VA 5FO9A 5GRUH 4Z3IA 4AWJC 1YPZE 1JTHB 4Q52A 3Q6GH 4YHOL 4IHOA 4K23H 1KBGL 3K2KA 4MNQB 4BQ6A 2HKHL 2DQDL 1AXSB 2WXJA 3ECUA 1L6PA 3JV5A 3OQRA 4IDJH 3H25A 1DQLH 2KSJA 3OKOB 5KYYB 5TE4L 1BDYA 3FHQA 3SE4A 1XGUA 2CLZB 2V0AA 4JHWH 1AD0A 4K9EH 1QLEB 4PH8A 4TLSA 4CRPA 2AJZA 3M0DC 3LRMA 5INDA 1WBYA 2PCPA 4GH7B 2NQ3A 4JFUA 4ZKPA 3ZO9A 1EZVE 4IEFA 4JZJB 4PWJA 4QJ3B 3V5KA 3US1A 3CXFA 3GPEA 1A14H 2WLYA 5IG7A 4OGYH 5EBMA 3QUXC 4LK4A 2QJPB 3IDYB 3FT3A 4U2YA 3IAGC 1H6FA 5LXGH 3ZE2F 3C6LC 2A9NL 3WEXB 4AYCA 4TVPL 3BCCG 4OUOA 3DI3B 4TVSa 1LTTC 3ZKNC 3ZE2E 3BP4B 5D7LB 3VXQB 4LT7A 2XKNB 1I7UB 4FFYA 2DD8H 4HS3A 4ZYKB 2A77L 3UJIH 3V55A 3GRBA 1XO8A 2YZ1A 1T1YB 4I88A 3AU1B 1ROCA 1BDDA 1O7VA 3WJLA 4FQ1H 5TQ2H 1HH6B 4NN6C 4UI2A 4JPQA 3GUTB 1WGOA 2FVNA 4KVPA 2OYKA 3VXSE 1W16A 2A9AA 3L75D 3EGXB 1EDIA 3V4PL 2QG4A 5GSRB 3FPYA 4J4PA 1FP5A 4DP1X 1NGPH 5E6UB 5KTEH 2WQXA 4AMWA 5ALCL 1T89A 4KKRA 1VZGA 1MCSA 5FECA 4ANVA 5HY9A 3VXMA 2GA1A 1WS7A 3W37A 4IBSA 1CN4A 4PWKA 2Y1AA 3PXHA 5HHVH 2AS5M 1GDTA 5DJAA 2MFNA 1MIEL 2AVFA 2PP7A 4CW1B 3ALWA 3CFNA 2VZTA 4HIIB 2HT4C 1OCOB 3MV8E 4XNMB 4NQSA 2CU9A 3IE4A 3CVIL 1QBLL 2BCMA 2HT2D 3GMPB 1QWNA 4NKMA 5EEXA 3T65A 1WLHA 2IXQA 3IFPA 5ECGA 3B1UA 3IAOA 4S2SB 5F1SA 1I9JL 4P05A 4MN4C 1T4KB 2W07A 3AXLA 1N6UA 1RY7B 3ARZA 3IJSA 5F7FA 3RNKA 3UG4A 2NR6A 2JI3A 3POCA 3FFCE 4RISH 4X7SH 4P9ML 3TPKA 3VJ6A 5BJTA 2IBZI 5D1QB 3U48A 3GQFA 4AGLA 3L4VA 5DJ0A 1NM9A 4BHUI 1GC1L 1H5BC 2DZEA 4HFUL 4KK6D 4LCIH 5EFIB 1SBSL 1AIZA 5DJXB 4UINH 2QGDA 3D39A 1S3KH 2OYMA 3JZ7A 3THMH 2ZYDA 3NK4A 4C7NB 2BVOB 4Y19A 2ZWSA 1JPGB 2DB8A 5HGHA 3H1HJ 4OM0H 4J2XA 3JCUH 1SQQE 3WKML 2EIZB 4OFQA 4N25A 1FAKT 3NH7H 4K9JA 1X7SA 3GSUA 1QUNB 1Q0YH 1KPUA 1R3IH 2YOAA 3RK3D 5IEHB 1OM9A 1S7RB 1JVLA 4WV1C 3VI3B 2WNGA 3QUXD 2WKOA 2NXZC 4X6CB 2KOGA 3BO8A 3IGAA 1H6TA 5D5MA 4G6JH 1PD6A 5DS8B 5F6IC 1MCDA 2C34A 4G6ML 5IVZB 5T5FL 3L73D 1URLA 3BKCH 4ZJ9A 1G7LA 3DUSA 2WCGA 5E7FA 1GMIA 3I3BA 1NTZE 4QHLA 4U6VL 5IBUG 2PUQT 1E27A 3KJ4B 2PW2B 1TEYA 1X4XA 2ZWZA 3I9GL 4ZTOL 4WAFA 1KXHA 5LGJB 1UXSB 1L0LE 2FLBT 1RUMH 4FG6D 5APWA 1MVUA 4W4NA 3OL2A 1KIPB 1IAIH 3KAAA 2LTQB 4TSAH 2JKJA 1L2PA 5C09E 3BVWA 4K94L 1CFBA 1I1AC 3IU3B 4F15B 1P6AB 2WZ0A 3ZO0A 4MA3B 3MQIA 4R97B 2KYIA 5H2BA 1TJIH 4Y4FD 1U0QA 4NC1E 3C5ZD 3OR7B 4KHXH 1XGYL 3WTTA 4N26A 2CHNA 2H43A 4GT1A 1GIGL 3FCGA 3HE5B 1F3DJ 1OW8A 2PYFB 1RHHB 1ZTXE 2EINB 2DIAA 1RUPL 1N2RB 3MNVB 4OLXH 4LEOB 4XCFL 3L6FB 2AXWA 5KVFE 1VEMA 5DQJB 3VFPB 5DHVA 4X6FA 5D6DC 3O6FC 3K72B 1KJ3L 1OO2A 3C5SB 5HHXH 4MCZA 5I66A 4ZXBB 2XN9A 5DD0L 3O9WD 1OX3A 7FABH 3SDCD 1HH6A 4TL5A 3TBWB 1T3FA 5DD3H 4DT2A 5KWYC 3DIFB 3QQDA 3V6OA 1NBCA 4XNBA 5BU5A 2KMWA 4X6DF 3SY0B 2F8VA 3HA0A 1P4BH 3EJCA 3T0BA 2OXHA 4L5FE 1JG9A 2WB7A 5E5MA 2VZVA 2EDFA 3RWFB 2WO2B 4OZFA 3U7WH 1HNFA 4PYHA 2AJXL 5I2IA 2D7QA 1NPNA 2QQKH 2GY7B 2ZXDA 3ATAA 3KPMB 2DW5A 2VXUH 4AGQA 1JWUB 4POZD 5I74C 4DQOH 4JS7A 4GSQA 2HJKB 3F5WA 3CC7P 3V4LA 2WUBH 3MBWA 1H0DA 4FNLL 4H0IA 4K3JH 3VG9C 1HINL 3DBXA 1H5BB 5E70A 2X2JA 2ADJB 1M71A 4NDMB 1JFHA 4O2FB 1MFAL 1BBJA 4AW7A 1BJ1J 2VISB 3I50H 2WVSA 5T33H 1W9XA 2VR4A 5I1EL 1TTGA 3BN9C 4V2BA 2ETWA 4WNQB 4U1IB 5CGBA 2OL3B 1PPJE 2YMXL 1P7QB 5DJ0B 3BDBA 3APMA 2ZG2A 2ITDA 3IFNH 1JNNH 1TETH 4G43B 1AQTA 1CGYA 5E4AA 3BXNA 4EXPX 4GEJA 3WIIH 3BRVB 2QRXA 1VEOA 5BW7A 4K07A 2FT8A 3VFSB 4MD5A 5L88L 4R8WL 4PRHA 1DJYA 2AJVL 4A2HA 4AUYA 5E7BA 5EEUA 2VSMB 4R3SA 4LASH 3SPVA 5J11B 1U58A 2Q5UA 1QBBA 1QEWB 1TVBA 3EADA 5GISH 5JDSB 3T04D 5J06A 2RMZA 1G0XA 1S7RA 3DXAA 3VRLE 1MCWW 1EFXA 2QKIA 2XJLA 4UOW1 1PF3A 1T0NB 3DO7B 3TJEH 5IFJB 4KUCD 4FLRA 1OM3L 3NIDE 1OLZA 1F45A 2C5DC 2JKVA 1JE6A 4ZO8A 1OAUH 4JJ5B 3DJ9A 1FNGB 1T22B 1CPUA 2W9LA 1M6OA 2MNJB 4WCYH 1QFHA 4XVSL 2J8HA 2NQCA 3S9DB 3B2UC 5DMIL 1TTUA 5T1LA 3GXFA 4KY1H 4WFFD 5IMOA 2QMKA 5MEOB 2JFCA 2K45A 4XNXH 2XTJC 2J58A 3ARUA 5APVA 5APYA 5I6MA 1L0LK 1WISA 2I7SA 4TKWA 4YFLF 5D5ME 3QUZD 3UO8B 3QRLA 1IAOA 3TF5A 2OMZA 1AFVH 2DQEL 2OJZL 3DHUA 4NCDA 5I8OL 3PP3K 5IMKA 2GFBB 3SDDC 3VDBA 2ZOOA 3F7PC 2KT6A 2VMFA 3EJYC 3IFOA 3TIDA 4BGDA 1SJHA 1PJ9A 3O6FA 1SQPG 2AK4B 4NQVB 2I07B 3GXUB 1EO5A 2QA4P 1OHZA 2EDWA 5DZJA 3OAUL 5C0JA 1U8QB 3GJFB 5CIPA 1HL9A 3IFPB 1AXIB 1DVZA 3U4EB 3RVXD 1L4AD 4V11A 4MNQD 3KYOB 4PV8A 1MQ8A 1C1EH 3L6FA 4H8VA 4JDVB 3KPNB 5DQJA 1GYCA 3K4AA 3P77A 3KL0A 2FJSA 3SCMD 3UOAB 1DX7A 5BJTB 1R3KB 3ARRA 4LARH 4P2OC 3FFCA 1FLRL 1PL3A 5KJ7E 3T97A 2ICEA 3O0RH 2AI0L 5GRXG 3QYMA 1I8LC 2YEZA 2YQ3A 3AM8C 3IDIB 5IHBA 1OPOA 1IAIM 4EDFA 3GMNA 5D7JB 4GP5B 4WW2C 3PWJA 4QRQA 4YHPA 4AMKH 3L3HB 1TJMA 5ICXB 3OHXA 2A74C 2B08A 4L4JA 5D9SB 1HJCA 5H37A 4FABL 5E5MB 3N2JA 1UUSA 3D1MC 3IGUA 4MSWA 4E41D 4NQEE 3SBWC 5JW4N 4JG1L 2YKQA 1R3LA 5FK9B 4UF7C 5IP4A 5IM7A 3M46A 3KBFA 4PJ8D 3WDJA 1NCUA 1ZHBB 2R0KH 2XN9E 2PTVA 4I89A 2J6EH 3ZYJA 4S1SH 3TBYB 1NU1G 2I85A 3GI9H 4TTDD 1SQXD 3KMDA 3GSOB 3NIFF 5MENA 3MV9D 3PS6A 3MLZL 2DTMH 2EYSA 2SEBA 4KQ3H 4B3EA 3VMYA 3RPIA 1SN2A 4GRMB 1AZRA 5T33L 4IS6A 1Q8MA 4JM0A 3HJ0A 4ZS6C 1TZAA 2EADA 5E4EB 2YGOA 5CO1A 4U6XB 1NAMH 1BGXH 1E3FA 2FO4B 5I5IA 1JYWA 3BDXA 3FN0H 1EA9C 1VACA 3QNXA 4O02B 5CHNA 2ZX5A 3H1HE 4DCQA 1NAYA 5C0NC 2Y5TA 3VQ1C 2VDKL 2M26A 3LXCA 4KQ4H 1LEKB 1KTKE 1QR1A 3RZCC 1N70A 4M7JL 1KB9I 3QWOB 5EU6E 3CXHD 3VCLA 4C58B 3LIZA 5CLYA 2FTAA 4E68A 4KZCA 1QX8A 3TK1A 3ULUL 2BC4B 3OXSB 4RVBA 3CXDL 1XSJA 4X4KA 2UVEA 3DX9B 5IJBC 1A0QH 5KVMC 1BAFL 1NAMA 2UY7B 4RBPK 1TZ8A 3FO2A 4KJPD 2B88A 2FXPA 1TENA 2X53A 3ULUC 1F42A 3WLBA 1BMGA 2E47A 3WU2E 3FB5A 3BQUA 2IG2H 4YAQA 3CCJP 5A1AA 2F7QA 3GSRA 4ZUUA 3SO5A 1LP9B 5EZPA 3IM1A 4TYUA 3KCWA 5FGCB 5EBGA 4AM0B 4UUJB 4URKA 2WUCL 3FT0A 4G59C 2GT9B 1KFGA 2VXQL 2CGYA 2YPVH 4LHUB 1D2OA 3LKRA 3CVDA 4XBPB 3SCMA 1HILA 3TBWA 3MROB 3BMVA 2HX9A 2FJFA 3L3IA 1Q0XH 1XL6A 1BDCA 4K2UH 4G5AA 1FIEA 5TE7L 1D9KC 2KBGA 1Y18A 2OSYA 4X5PA 5JHBA 4KZDL 5F7HA 2ZWLT 1P2CA 2ZAGA 3LNHA 2NY1D 2ITCA 4XNQB 3E1RA 5D93C 3WHE0 3G9AB 2ZXWB 3O3EB 4LIQH 4PJHF 4WW2B 5DYOB 4JN2A 2BJML 2B59A 2VXSL 3CN1A 5DVPA 3HS8A 5I16B 1E5AA 2DQIL 3FW6A 5AKSA 1LMKA 1SJHB 2A6IA 1QACA 4XC3H 3K2MC 3MRDB 2AK4A 4LOUD 1KYOJ 5GTHH 5AW8B 2C7UA 3LRSB 3LEVL 1MSPA 3FH5A 4D0DB 4OKVB 4EIGB 1U8QA 5CIPB 2P24A 2R5DA 1M05B 3UPCA 3RIAK 3P11H 3D4YA 4ZFGH 1YN7A 3KPNA 3QPXL 1EVTC 2X1XR 3K4ZA 4HCFA 4P3CH 3GJEB 4UAOB 3VGAC 1JRHI 2M8XA 4EI5A 1NKGA 4CSTA 4OY9A 3WU2H 3T0DA 1J48A 3QCTH 4AKQA 4FFZL 5C6PB 1CU4L 5FYJL 5CCJA 2JP3A 1XSKA 4MRCA 3DUHA 4YFLI 3O3BB 5JNYB 2ARJQ 4DHLA 4TNWK 4LGRB 2E8YA 1T2QH 1FOSE 4ODVL 5KS9A 1MJJB 5DUBA 1Q1JL 3P3UA 1PGOA 3MJWA 4LCYA 4CGTA 4Z1PA 3GUFA 1PV3A 1J87A 4O58H 1L6ZA 2AEOA 4X98A 5CJ5A 1KC5H 4ZOAA 1WFMA 1F4YH 4G7YH 2BEQD 1SQMA 2Z6FA 3KEDA 3N42B 4PB9L 4PRHD 4OGAD 3DXAB 2D31B 4M43L 3ZE0F 1M57D 1RURL 3HFFA 5I6XB 3A6BL 5F2FA 3EZJB 1PLGH 1X9UA 5CNHA 4LEEA 4DAGH 3T0VA 1M3JA 3P8CE 3FCBA 1HKFA 1MPAH 3QIBD 2EH8H 4KNUA 4Z8FH 4U0RB 2I5YL 3ZSSA 25C8H 4AG4H 2QQNL 5AW4B 3NJFA 3T3MF 2F54D 4HZAA 4MTMA 1I8AA 5ABAA 4F93B 3ME0B 4PJXF 1FI8C 1CDHA 5AB9A 3EHBC 3FN0L 5D7IF 1L9QA 1VERA 3K6SA 4M5YL 3G9VA 3HI6L 1UXLA 2H0EA 3M45A 4PRAA 3TBBA 5ACZB 2DQIH 4XMXA 3QCVL 3PTZA 4M02A 2QELA 5L2KA 1KTRL 1Q4NX 2P80D 2JE8A 3L5WB 4GG6A 2CPBA 1XQ4A 1PQZA 4Y1AA 1OAYH 1DBML 1E65A 4L1LA 4OZHF 1KJ2H 2W0LA 1OXZA 4XOCA 5ID1A 1E4KC 5IMKB 3B7RL 3KS0H 2J44A 3P4NB 3SDXF 4I13B 2CUIA 2WZPD 2VRKA 2YJQA 2I07A 2PFXA 2EAEA 1U95B 2O6FA 1CL7I 1Q94A 4MMZC 3AEGC 1NCBH 4LLWA 4NBXB 3QO1B 1E5CA 5D71H 4DOHB 1R46A 1ZHNB 3M86A 2AHIA 3TASA 4B53A 5D7JD 1DCEA 1R3HA 1A7RH 4V1DB 5BS0A 3P8CD 4EUPH 4AIXA 4Y16A 4P2RB 4HIQA 4Z7AA 3RX8A 2IGLA 4X8JA 4P5RA 2TRYA 4U0RC 4F7KA 3EH5B 2M0BA 5JPNB 3LS5H 4LLUA 3L5JA 1FRGH 4EBQH 2HJLB 4HIEA 1G9ML 1UM4L 4RA3A 4JM2D 3CH8A 1PEWA 1RZPA 2YXVA 2QGBA 5FECB 4S1RH 4DZBB 3CNKA 4MAYB 4IBWA 4MVBD 3QO0B 3SE3C 1DQQA 1ZXGA 3K80A 1DVXA 1KXVC 4BRYB 1CDUA 3AB0C 3HG3A 3F6JA 5D1ZA 4DP0X 3RVVD 1DJZA 5FYLH 5JQ6H 3KYMA 3B2PA 1T03H 1FNLA 4AEHL 2VXTL 2D7OA 2Q6QA 3HZKA 1UWXH 3MRDA 3EH2A 2I69A 4MBRA 5DEGB 1PD0A 2M83A 3LN5B 4ODUA 4YDJA 5F6HJ 5CD5C 5I18L 4BFRA 5EOTB 5K33A 4LLHA 2CKBA 5FO2A 4FQXC 3IJSB 1YJDL 2GC4C 3NFPB 1CG9A 1BG1A 3L70E 2X1OA 4KO7A 3MKKA 4KVNH 3FU7A 4KY1L 5B7FA 1BGYG 2PP9A 3UZEC 2VQTA 2CXGA 5IHWA 1KQLA 4JRXA 5IMMB 4XP1L 3VOPA 2GJPA 4FTVD 3H1HD 2GK0B 4EI6A 1IQDA 2EVIA 1YMMB 2N59A 3EH1A 3TO2A 5FFGA 2P48B 2WQWA 3O11A 3ILEA 5KBPA 2YPLB 4Y2DD 1F4YL 4G7YL 1TITA 2UY7A 3GYRA 2FYZA 3KH4A 1I8IA 4FN0A 5CWSA 4TV3A 3VI3A 3WLBB 4W9JC 4YSPA 5E0QA 5E9DE 1CLOH 3SYAA 3LZRA 1JYXA 2MCAA 3QIUA 3R4YA 2E6PA 3CLFH 1PZDA 3BH9A 4XXDB 5KBLA 4JZOB 5CSBA 4LRIC 5EO0B 1VFBB 4A6YA 5F0PB 4AEIL 3LRKA 4XBPA 1ZIBA 2WW8A 4U3FG 1EERB 1PKQE 3K0WA 3BPCB 4G11A 1KYOH 2OR7A 2Z3FA 1Z9NA 1PG7X 4DUWA 3VXSA 3HG1A 2WXKA 3CU7A 3LXAA 4O9HL 3T0EC 1G7IB 4AJYV 3RDTA 3CWBJ 1BVKA 1KIQA 1F90H 1QSEB 3KBHE 4TXVB 4OJYA 4Y1AB 2MCPL 1P1ZB 2Z0BA 3RVUD 1BZ9A 5I15L 5LLIC 4PD4E 2A6JA 1T21A 1DL7H 4GPVA 5EBLB 3G5ZA 5D7SH 1L0LD 1PX4A 4QYAA 1U93B 5CEYB 1WAEA 1AY1L 1JGEB 1S46A 2DWEB 1U91B 2K8MA 3PWUA 1OP5K 3STLA 1A6PA 3KPOA 4GKZA 2P24B 2XX1A 4FC3E 4HHAA 3U4BH 3K81A 2ZAEB 1JJUA 2BOCB 1UD6A 4DP4X 2CPCA 3ZDWA 1PS3A 3KYNA 4HWEH 1KPVB 1J9QA 4HUVA 1KYDA 2R8SL 4YK4C 4Y16B 4UOZA 2ZCLH 4U1JB 2J57A 1IFPA 4FCHA 4LVEA 3EJZC 2CRMA 4Z7NF 3FT1A 5ELIA 3W9EA 1AJ7L 2WQAA 4Y99B 3STZA 4MX7B 4RAVB 2O01H 1NCCL 3MCG1 3FRPG 3QQDB 3WKMH 3AUWB 5T3XL 1NDMA 3KL5A 4UM9D 4W9ZA 5GRVL 3ZL2A 5JNYA 2WLMA 5C0AB 4GAYB 5A2JH 5JHDA 2HODA 4YXKH 1XL4A 1UOVA 2OXHB 4BH8A 3NIGE 3OSVA 4LCYB 3WXWH 3T77B 3EDKA 5KLVE 3RUGF 1KYOE 2K70A 3CDZA 1JUNA 2M2DA 3PIQA 4O2CB 4WUUA 1Q90D 4PLOB 1X0TA 5MEPB 4IBUA 1KCVL 4M93C 5BU8B 2K7QA 1KGWA 1RK0B 2LR4A 1M42A 3ARGB 4X7SL 4Z7WA 2QL1A 3SGJC 2R8SH 5GZNC 1EUTA 3KPRB 2BIPA 3MJ8A 2WBWB 5C08E 3AE8C 2P5WA 3AQZA 3F7VB 1CI6B 1DANU 2QMJA 3BKYH 4PG2C 4LQ1A 5HI3C 3MMEA 2WAHA 1HH0A 2NR6C 4X8XA 2DMHA 2BZDA 4XPGH 2KK7A 2NTFA 1LJMA 1CFNA 2AEIT 3VXOA 2HFFA 4S0SD 3MV7D 1X5HA 4BD4A 3PAUA 1OGAB 3TPUB 1KCLA 1S4IA 2YGVA 4KKCD 3MV11 4R84A 4OCSH 2UWEF 2HVJB 5BVJB 2ZG1A 3RL0D 1HXYA 1HHJB 4RMVA 5HJ3B 5DJ2A 3PGFH 3AEDC 2ADGB 4N8VA 15C8L 1ACZA 5KAIE 2ICWB 2FXOA 4X80L 4LGDE 3P4NA 1DJHA 3D6ZA 1RD6A 5CR8A 2DM7A 1LHZA 3ELAT 1N8ZA 2WBJA 2X2YA 4L1DA 4PJGA 4Q9RL 2ATKB 4DEPC 2K6YA 3DV4A 3DX8B 4LOEA 3DX7B 2XTJB 4B9GA 5JW5A 4YFEA 4JDEB 2YAEA 5DD0H 4BJLA 3ZU8A 5HYFA 3CCLP 3CVHB 4NKOB 1HYSD 3Q8CA 3S3JA 3B2MA 3VFRB 4FGMA 4XRCA 1JN6B 2ZXQA 4Q14A 4YXDC 2NYYC 3EOBA 1L0NK 3ZRCC 4YHYC 1IGMH 2D7TL 1OB1A 3BH9B 5EEVA 1T1XB 4ZO6A 4D9QD 1C16B 2AXJA 1M6OB 4JAMA 4ELKB 2E76B 3QCTL 2BOBA 1M2VB 3VRIB 3HC0B 2IFFL 3BT2L 4PY8J 5DK0B 1F2XK 3VD7A 6CGTA 2JO1A 1CQYA 3VXSB 3MOAH 3L17A 2X6CA 3IRZA 1Z5YD 3NCJL 4U6YB 5JORB 1MELA 2CBOA 5IBLC 4KDTA 4CDHA 1U8IB 3GMAA 2GUOA 1ORQB 4O51A 4PP2B 4C56B 4PW4A 1WWBX 1ZOYC 2AXGB 1DQKA 5F97E 4XO4A 3RA7H 4BRYA 1H0TA 3PFUA 1S7WA 5GS3A 2NY5C 3TZVC 1U8NA 2CJUH 4Y4HD 3IJEB 1UUNA 4WO4B 4JFDE 1MIML 3IU4L 1F2QA 1RFDL 4JMNA 4U1NB 2X0VA 4NQVA 1GS7A 1V3KA 1X5YA 1BYNA 4OLZL 1N2DC 3IS1X 3VFNB 3FGAD 2Z31D 1UACL 2MQCA 1QP1A 3MXWH 5D1XE 4GLRH 4WU5A 4FERA 2G2PA 1CG9B 5C3IA 1NGPL 4N9GB 1NCAH 1RZJH 3FU7B 3AREC 3FFCB 4U1GC 1RURH 1UQSA 3BSZL 4Y5XB 3LH2L 3N7NA 4G70B 4N0UB 4M1CC 1MFVA 1FDLL 4OD1H 2F8XC 1BQLL 1FFTB 2OYHB 2BP5M 1PPIA 3TX4A 2DQFB 3HG2A 2GITB 1EV2E 4Q6YA 1MFEH 2JB5L 3T77A 3SWYA 3S5LB 1NGZA 3K2UH 4MMZB 1MDAA 2LLLA 3EOAA 3MRKA 3ZUCA 2HPOA 4LASL 3V52H 2Y36H 4N85A 2NW2B 4QAWA 4XCEB 1T0OA 2VAAA 4TUOB 5EZOL 3L70J 5ISZD 2KDGA 2E86A 3LB6C 4Z7VA 4UTBH 1JGVL 4WEMB 5HDBB 1R17A 3NRQA 1AIFA 1DE4B 1MVFA 2IIJA 1RZIB 4FL4C 3IT8D 4H25B 1S72P 3QUYD 3HBGA 4UQ2A 3X11B 4AE0A 1YEGL 1NAKL 1ZLWH 3GO1H 4RLDA 3D4GA 3MUJA 2OM5A 5DRNA 3IR9A 4AIOA 3KLLA 1VACB 3QNXB 4O02A 3C12A 5CHNB 3JSSA 1A4KB 4Q6IC 5FFLA 1SZNA 3V2RA 1KB9J 3ISWA 3MYJB 4OZGB 3VFGL 3Q3GB 4LFHD 1QR1B 2IYPA 1FL6B 1MHHA 2WQRA 3OAYK 3WD5L 2N1TD 2K9YA 4F7MB 1WBYB 2ADGA 1O5PA 4K7FB 4N8VB 4F15C 4JJOA 1IKFH 3L3JA 3HB3C 1AR1C 3V5KB 4HAKA 2E4FA 3BH8B 2IH3A 4G6MH 3L95A 1RIUH 3FKUS 4JPKL 1QKZH 2BS9A 3V79C 4K3EH 4E9VA 1NAMB 5A2BA 3FYEB 2LXCB 2ZUSA 3G6JF 2WIIB 2DYPD 4Q6IA 4O02H 2VH5L 3FT9A 2ED7A 4BRJA 5CCKL 1N19A 4YTPC 2W92A 4RETB 4DGYL 1P84H 1OL0A 2DJUA 3I6KB 1Q38A 4WHYG 1HUCA 3GLEA 2DD8L 1M9SA 5DEJA 5DFTA 4ZUUB 4ZUWB 4N8UA 3UJIL 5E1HB 2AAVA 4ZMQA 5HYSA 3EOBB 4AMKL 1AHMA 5I9QB 3HHSA 1K8IA 4JPIB 1EHAA 4XPBH 5DVMA 2ENJA 2AI0H 5CMZA 4KRNA 4V2CB 1YA5A 1LL1A 5KSAA 3U9WA 5FA4A 2LABA 5F8RC 3A0BE 4HPOH 3KDMB 3P9MB 1CE1H 5E9AA 3ULVL 2C9LY 1LTAC 1A6WH 2YS4A 4JVPA 2ESVB 3V5DB 4EOTA 4J5VA 2R15A 1QPKA 4HIHB 3QUXA 1J5CA 1GIGH 1L9TA 2P28B 2R7EA 3CDZB 4NCC1 1B4RA 5I6OA 2AXGA 1LTJB 1NLDH 1W72H 4MJHA 1SEQL 1G0YR 4N87A 5EIIA 4HCRA 5GS0D 4CMMA 4YNYA 4OLWL 3DGCR 5BOJA 3T71A 3VYPA 4RDQG 3QHFH 5E6IA 4H20H 4L8DA 4Z76B 3F7VA 4GRLC 4X4MA 3DYOA 4KMQA 1MIEH 2RBLA 4GBXC 5I19H 3FN9A 1ZVHA 1FF5A 3OV6A 2JKIS 4K15A 1NQBA 1XD1A 1LT9B 1KBKA 4NZUH 4N9GA 3RVXC 4PAZA 4XCYB 3ARBC 3BAEH 4AQAB 5B3NA 3I56P 4YSDA 3OX8B 4GP4B 3BFOA 4ZUTA 1KGJA 1Q81Q 4XODA 4QRUB 4GAGH 4HIJA 2C3WA 2Q7AA 5CINH 2GAZA 1BSNA 3JBG7 4W9FC 2XG5A 4KX7A 3OGCB 4QO1A 4EYYQ 3AT8A 1FQ9C 4G9DB 4XNXL 2DQFA 1ID5I 1O7DC 4N5UA 5GGSA 1IO4C 5JPMB 1MW2A 2EYTA 4L9LB 1Q0YL 3L75E 2ALWA 1BD2D 1L0QA 5TF0A 3THML 4K3DL 4RA0C 5AZUA 1N0XH 1AVAA 4AJVA 1RLWA 1AZNA 1MCKA 2AQ3A 2WGNB 5F9OH 4JYBA 3RPBA 5CF3A 4XBMA 2L3BA 4CGUB 2D3JA 1F8TH 1BQHA 2Y06L 1M6UA 3UABA 3OPUA 1E2ZA 4HPOL 5E95B 2OQQA 3V4VB 1KG0A 3U9PL 3W38A 3TFBA 1EO7A 5AOJA 1LP1B 4AQ1A 1T1XA 1UGKA 3R8BB 3MREA 4PJ7B 4JO2H 5D7LD 3BPOB 4Y19B 2RFXB 3EJPA 1SQBG 4YVUA 3SEPA 4WY7L 2LAAA 1IC5H 2OSXA 2MEJB 3CXDH 3VP9A 2DI7A 2Z4TA 4R6UA 4IMLA 5AYQA 4PRAB 1JWMB 4I2XA 3WL9B 3VXUA 1IAIL 1KIPA 4TSAL 4BE5A 3DUUA 2ZFCA 3MRRB 5D5MB 1PZAA 4HZLB 3G08A 3BIKB 3DOIA 1QNIA 4PD4I 3PGCB 2ZJSE 4PJFA 4QCIA 3EFDL 2Z91A 2A2QT 2TRHA 1J05A 3INUL 1FH5L 1G7LB 3DUSB 1XH2A 5ES4B 4Z3EA 1F56A 3F83A 5CBOA 4KFMA 5KAFE 3UGEA 5LG6A 1SEBB 1S9YA 2Y1YA 5KVGE 4NO0B 3SDAD 1BFTA 1GGTA 2OBGA 3X13B 5I1CL 4U1HA 1CD9B 3L3KB 3RX9A 1R3HB 5BS0B 1U6AL 1XIWC 4PRPA 4GKNA 4OCXH 3D25A 2YMTA 2DQGH 4GG8A 1D5RA 3ZQWA 4KK5D 1YMMD 3U0PB 1W2KT 4G5ZH 1DD4A 1OFCX 4D6TG 2CDEA 3KPSE 3WKYA 2R56H 1TQSA 4HWNA 4OF5A 1ZANL 3JWOH 5IQ9B 3OJVC 1IZKA 5I8EB 5FPIA 5D1ZD 1R75A 1JPEA 2WC7A 2P10A 1QSFA 1D6EB 3KJ6L 2RQEA 3I5CA 2AERT 3U30B 4ENZA 5IR1A 4KBPA 5AZEL 1C08A 3L4XA 4PMFA 1FZAA 1OF0A 4MAYA 3IKCA 5EORL 3TCTA 1LILA 2OR9H 3P3TA 3WU1A 1RIHH 1EXHA 3BOVA 2Y06H 4NP9A 2ZOTA 3CZKA 4HXAH 4PJEF 1LO0H 4JQVC 3GDCA 5I1AB 4EKJA 2JWYA 1L9OA 2IV8A 5HJDA 4JEGB 3RX7A 3VA2C 4LHUD 4MB5A 4LOVA 5DC9B 1NPUA 3AE1C 1JEKA 3ZDMA 2ADJA 5DUML 3UJJH 4PJ0H 3C08H 2G5BB 1EMTL 2BSSB 2N3JA 4Z77A 3I9PA 2DEWX 2ZCLL 3CLEL 2RMNA 4QY8B 4RQQA 3RZWA 1NKZB 3D9AH 4Y9CA 5AW9B 1UYWH 1CZQA 3SFEC 1KJ2L 1OK0A 1T1ZA 3QRGL 5J1AB 1Y1DA 2YOCA 3F05A 1ZT7A 1IJ9A 2EH7H 3BAJA 3MOBL 4BFEA 2IVFC 1A6TA 1MCOH 3RY6A 3SDCC 3UGUA 3F5HA 5GS1B 5C0GA 1TQBB 1ONQB 4M56A 1S5IL 2IADB 3QXAA 3TV3L 4G7VL 5JQHC 4PREA 4OFKA 4PGBA 2EC9U 3LPOA 4AQ1C 3ASOB 1HC1A 3FQUA 2CDFA 5LWYH 5D1QE 2DYPB 4HC1H 1YJWP 1UCBH 2ZZUT 4PJ9C 4TNGA 1L7IH 4EI5D 2Z4EA 1MQKL 3WY1A 3ZHNA 1E4HA 3BN9D 3FRUA 1HWGB 2N7AA 1FJPA 2WVVA 5B38A 4ZZFA 3QSKB 4PS4L 3L5XL 4KDWA 5CUSH 3N9GL 1N64H 3QJRB 3RVTC 3FHAA 4KK5C 5LN4A 3POHA 1HZLA 4JO2L 5ALBH 1KB9E 3N43F 4HW6A 4LBEA 1N7LA 4WI6A 4B9FA 3K74B 3VTTA 4PLJC 2JJVA 2QFPA 5DZAA 1F8TL 2DYSB 4QNPE 3LSOA 2I27N 1JF1A 4MQTB 5I0ZA 3N4XA 3O8ZA 5DHVH 3FZUC 5IIEA 3KDPB 3VD1A 3X14A 3DO7A 4HC1L 3V0FA 3VG9B 4HFUH 4LCIL 4TSBL 5EU3B 4IFMA 1XXDC 2BH0A 2GFBA 3B7TA 2KS1A 5A3IC 1NJIQ 4QXUL 3RL2B 2V2TA 1W0WB 3NPSB 4NQXA 1XAUA 1KN2H 5C7XH 3B9KB 4XPHL 4JO5A 3KWUA 4HJGA 1VA9A 1G84A 5AAWA 3D3VE 3P0VH 3LN4B 5ITBH 2EIKB 5ILTH 1NL0L 1URQA 1TG8A 2MOVA 4OZ4A 4XHQA 2N7SA 5CGMA 2IBZY 2X4TB 4PTUA 4GIFA 1CXHA 1SM3L 4YDKH 3FH7A 1AS6A 5KW9L 3IMSA 3MRQB 4AQAA 2YD1A 4IKKA 4Z18A 5CEZH 4DKFH 4UB0L 1E9QA 2WNWA 5GXBB 4Q7DA 3SO3B 5I9QC 4XMWA 1HXKA 3AQDA 1AGCA