3A3YB

Crystal structure of the sodium-potassium pump with bound potassium and ouabain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
278
structure length
265
Chain Sequence
RTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEQLQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
publication title Crystal structure of the sodium-potassium pump (Na+,K+-ATPase) with bound potassium and ouabain.
pubmed doi rcsb
total genus 54
structure length 265
sequence length 278
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3a3yB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 3a3yB02
5AVSB 2XZRA 2ZFCA 1HUCA 3MD0A 1T2KD 4RETB 5APUA 2C9NY 3NXSA 3HTKA 3M9BA 1JNMA 5AW9B 1J2JB 3A5TA 2Q5UA 4LC1A 2E42A 5AW2B 3VYIA 4JYCA 1MUUA 3VTPC 1CI6B 2WT7A 2ZXEB 1DH3A 5APWA 2E43A 2WPRA 2W27A 1HJBA 3O8ZA 2Z5IA 3L36A 4AYCA 5AVVB 1GK4A 1HWTC 3M0AA 3A7OA 4GKGA 2WTYA 1H8AA 1KQLA 4JYBA 3M91A 3VMYA 3V4QA 2W6AA 3A2AA 2WPSA 3UIAA 1A02J 5AVZB 1T2KC 1OWAA 3NTNA 3WGUB 2C9LY 3HE5B 1GU5A 3NMDA 1YYCA 5CMZA 5AW0B 2VRSA 5AW8B 4B86A 3HE4B 3P32A 1MFZA 1FOSF 1S9KD 1CSBA 4GT1A 4C7NB 4C46A 2Z5HA 3IR9A 2XU6A 5AW3B 3WGVB 1HBWA 1FOSE 2P7JA 3KDPB 3LIDA 2YO2A 3P8MC 1MV8A 1GK6A 3T97A 3HE5A 2R32A 4AUWA 4XE5B 2YO3A 5AW5B 4DZOA 1G2CB 2QM8A 2R3CA 5AVTB 3V5BA 2Q3IA 1CI6A 1SP4A 2WWWA 3KQGA 3M06A 1GD2E 2H7HA 4C7NA 3L35A 3SWFA 1JUNA 1CZQA 3B8EB 5APVA 5AVRB 5AW7B 3TNUB 3L37A 5AVQB 3P7KA 4KHXA 5AW1B 5AW6B 3M9HA 2XV5A 2Q7CA 2IPPA 1NAFA 1IO4A 5AVWB 3A3YB 3VMXA 3VN0A 1S9KE 2WPQA 2P2UA 4HYTB 5APTA 2WT7B 1H88A 1X8YA 1NWQA 5APXA 4EOTA 3TYYA 5APYA 3MGNA 3TNUA 4RESB 3V4WA 4I6MC 1A02F 2JJLA 3NFQA 3HE4A 5AW4B 2KP8A 1GU4A 2QM7A 1OXZA 4M3LA 1GTWA 5APSA 3VMZA 5AVXB 2P67A 3TK1A 3LIEA 5APQA 4I2LC 2N9BA 3I5CA 1H89A 1GZLA 1FAVA 1SLQA 5AVUB 4AQRD 2R5DA 5AVYB 2BASA 3M0DA 2R5BA 3OAKA 2YNYA
chains in the Genus database with same CATH superfamily
2VSCA 1ILSA 3C5ZA 5IROA 1F4HA 1OSZA 5BQDA 5I8KL 4NUGL 2G4EA 4G6FD 1FRGH 2PUQT 3ES6B 4N6JA 3KPLA 4O2EB 4NPJA 2D0HA 4L1HA 2A6JA 4M6NL 4N2MA 4KNTA 2P44B 4PRAA 2Q0ZX 3OKMB 3VFRB 1KJMB 4HUCA 1SY6A 4Y1AB 1IRAY 2JKTM 3QQDB 4U3FJ 2ATPA 15C8H 4QHUB 1MCRA 5AG8A 3GXPA 3B7UX 3IF1A 2PCPA 3CXDH 4HKZH 1NEZB 4MS8D 5DS1A 4XCFH 4ZW3A 3DUUA 3DROA 4NNYA 3RL1A 1VQLP 1T21B 1UB6B 1FDMA 2QL1A 3ZKMC 5E94A 1MEXL 4L4VD 1G6RL 1A4BA 2H0EA 1RH5B 2CXGA 2OQJA 1XF4B 2N1KA 5CEYA 4Y2LA 3R4DA 4JFDD 4DP6X 4GOEA 1J5DA 1O9ZA 4H26B 1RUQH 2XHNA 5CZVH 2XN9B 2JJSC 4PMFA 4FDWA 5I30L 3L72G 1Q94B 4PVNA 1HJBC 2WQAA 3WHE0 1REIA 4N2CA 2WLIA 2R0LH 3N85L 1BCCG 1URLA 3D69B 5KN5B 2R0KH 3IPEA 4UDTA 4OGXL 3RG1C 2R4SH 3B37A 4PJ9B 3O6KH 4JB9L 5A6IA 1SOXA 5AAMC 3RNKA 4JDZA 3TYFA 3O8XD 1PZ2A 2WV3A 3IVKB 2XWBB 4JGJA 3P73B 4FJYA 3E1RA 2B4CH 3K8KA 3NGBC 5DHXB 1S3RA 1ZHBB 3CV5A 5C6TL 4CJ1A 5K1VA 3FOLA 3ZL4L 4PJGB 1L0LJ 4Z5RA 2WWWA 2FEEL 3WXVH 1RIUL 3P11H 4WLCA 1HSBA 5AZEH 1QBLL 3U1PA 2I26N 2TRYA 5KSBB 1DJSA 3DDFA 4I9XA 2HA1A 4TL4A 4QRAA 1X3DA 2RALA 3ARBD 2F5AL 3DGGA 3IN0A 1IC1A 5HHOD 1JAEA 4JZJB 2X1QA 2BERA 4C47A 4L5FE 1OL0A 2J8OA 2JJVA 3MOAL 3REWB 5GQBA 3LSOB 1G9NL 4OJEH 4A2EA 1C5CH 2QSTA 4AYID 3L5JA 4Y5YB 4N24A 2JJWA 3JSSA 5GGUB 3QUZC 1OXZA 3DLQR 4JO3H 2Q86B 4MWFA 3CX5K 5E4EB 3TO4C 3WIIH 5DFVD 3VP8A 1ES0B 1MCFA 4UAHA 4D0DA 4PV1B 4NRZA 4PJFA 1OTSD 5E8DL 4I2LC 4WTZA 1RPQA 2X2YA 5DCCA 3ARUA 3HAEB 3L75D 1Z9MA 4TVUA 1TJIL 2PP6A 1KNOA 1ORQA 1O7VA 4FFZH 4QT5B 4PJAF 3AE5C 1OCOB 1Y6NR 2V9RA 2KOGA 2A06D 3E3QE 3CAFA 1QFUL 5KVFL 4ODUB 3KWTA 1M2VA 5I1EL 2VDKH 4AK2A 1DSYA 1RZFL 2G5BB 3G08B 1JZJA 1TKWA 4PJFF 2VLLA 1HU8A 1RQ5A 3CX5E 4GSDH 4NNPL 3AM8C 3GXTA 1MPAL 3FCTB 5INDB 2WW8A 1DQQB 5L2KD 4R26L 4A2GA 1KV7A 1YN6B 4EQ3A 1RV6X 1FG2B 2QVAA 4DH2A 1SXCA 1HH9B 4G7SB 3L6FA 1S9VA 2K9JB 5EPMB 1BAWA 3ULVF 3RDTD 1OGPA 3RBZA 2H47C 2VC2H 5EIIG 1LK3L 1C5BL 3H6JA 2NPSB 2J59M 2YA1A 1A65A 2R0WL 4XH2B 1FFQA 1NMCB 2NW2B 3NCJL 3UX9B 5I6KA 1H3PH 3BASA 1KDJA 4GKSB 4HJUA 1ZR2A 4LK4A 1P7BA 3BATA 3VRLF 4GH7B 3BXNB 4U33A 1VENA 3UTSD 3VRJB 4E9TA 4LSRL 4HIJA 4JO1L 1DCLA 1R5IA 2OMVB 5ETUB 1QHOA 2VXVL 4LLAA 2E27L 3T6XA 3WIFA 4JFOB 3AZUA 2BDNL 2Q2LA 1EGJA 3C75A 4MA3A 3S37X 4A39A 4Z8FH 1EBPA 3L3OA 4HUVB 2WXPA 5FECB 3TYGL 2QDWA 3RK3C 3FB8B 2MMXA 3KZIE 4RGNE 3RVWC 5L6YL 3BQUD 3FJTA 4WV1A 4Y8DC 4TQEH 4I0CC 2AK4E 3CSYA 1KIQB 5L4JA 3PXJA 2ZIDA 1Y6MR 4Z95H 2UX6A 3NJNA 2MOVA 3MNDA 3F64A 2HB0A 1FI8C 4KV5F 4XXDB 3HHRB 4HPYL 5DWUL 5F6HI 1PIGA 3BCCD 2CDFB 2N4IA 2N1TC 1MJUH 4Q4IA 2H0JA 1OW0C 1GOGA 1MJ8L 1NCCH 1CK0H 2UWEB 3LZFH 4A68A 1A2YA 4CMMB 1OWRM 4N0RA 2CO2A 1ETA1 4LIQL 3STBA 4KKBC 1KYDA 3AE1C 3RL0B 5IHUH 5BPPA 4HS3B 2XPZA 5TQ0H 2I32A 3IAGC 1NLBH 3OQ3B 2VRAA 4MLSA 5T1MA 2HT3C 4QRBA 2NT1A 3AEDC 4OCWH 5CN3A 3VMZA 1OP3H 3N3EA 4NUQA 3OAYH 4YXKL 3ETBJ 1BBDL 4ZXBB 2RHEA 3PDOB 3B43A 5FV1L 2E9IA 2WWKT 3OKDA 1H89A 1W15A 1NGXA 2PP9A 3F85A 5FO2A 1F6AB 2V4LA 5E00B 4FQXD 2WXNA 3QS3A 2IGFL 4OF0A 4DO5A 2NCEA 4IL6X 5DD3H 3X3FL 1IARB 2E76B 3IDMA 3WENA 5I1AA 1NJ9B 2EE6A 5JIHA 4X6DA 2NY0C 4DP4X 2OX5B 4H44C 1ED3A 5D96C 3CPWO 4TKWA 2GW5A 3O11B 1X9VA 1F00I 4GT0A 5KAQG 3DNKA 1HZKA 5CJQH 1QW9A 3FTGA 1HTYA 3QEHB 3WIHA 3LKQB 2GQHA 1X5AA 2P1YA 2Q7AA 3MJ9L 3PWNB 4MA8L 4ODXA 5T1DH 3ZKXC 2HPOA 2B3RA 3QUGA 2DW5A 1G1IA 4DGIH 3S88H 2R2CA 4O5LL 4I8DA 1EO8H 1GW6A 1YEGL 2BIQA 3UTOA 2AXGB 5EC1B 1FZOA 2JSFA 3EW3B 3GHEL 1DJIA 1LO5A 5LG6A 2X89A 4BQ6A 5KS9A 2C0XA 3H4HA 5JXED 2Z4QB 1YQ4C 4JW3A 2WLNA 4P04A 5CCHD 4F9LC 3KPNB 5ERWB 5IZ7A 3H54A 4N8UA 2DZEA 2FJGB 3V0WL 3ZDWA 3NPSB 2ARJQ 4TLTA 1HE7A 3QPKA 4HAFA 3S97C 3O45A 2E46A 2GIXA 4JPIA 3LV3A 4AH2A 1FL3B 3CCUP 2IQAA 5F89B 1NTZJ 2V6HA 3H2WA 1C12B 4NQVB 3EBHA 4AUYA 3NEEA 3IFNH 2VMCA 3L70J 4HJSA 4UT6L 2KI6A 4LFHG 4XP4L 4CMHC 3KPQA 1NPJA 4DN3H 2DQEL 2VERA 1OCZB 2HFEA 4Q9QL 2XZQH 1KLFB 5LCVH 4OR1A 1DFBH 1YMME 3QXUA 5IQ9B 4YZFF 1I9RH 3HE5A 4W7YA 2QQNH 2YUXA 4YEFA 2GSGB 5HI4D 3GSRA 1MFMA 4FXKB 3U46A 1KD1Q 3IS1X 4K7FA 1AA0A 2ODHA 4QLWA 4OGYL 4G6JL 3HUSB 5DJZA 3ARYA 1FP5A 2EDTA 1IMHC 2Y7QB 2Z6FA 4HSCX 4HP5A 3S37H 1X79B 3T6WA 3V5HA 4KHXA 1JTOA 2CBPA 3IRZA 4S2SB 4E41D 4JE0A 3SFDC 5JHLL 2F74B 1D7DA 1N5YL 1F4YH 3MYZA 2YRBA 1QI4A 2ICWA 1S9KC 3BOVA 3S4SG 2ATKB 1JOIA 4ES8A 1FO0L 1YNTA 1NDGA 5D55A 1XH3B 3BWAA 4JN1L 3KBEA 2H3XC 4OGAC 1NBCA 1ZLEA 4ZOCA 2WB7A 1NKZB 4MDJB 3MGNA 3EZJB 4OKVB 5GRUH 3DMMA 2E74D 4PRPB 4JDVB 1NC2A 4FI6A 3SDXB 5CCGD 5AAWC 1R5VB 2Y07L 1JM0A 3CC4P 2KP8A 4W4OA 1U3HC 4G8EA 4WCYH 4DGVL 4ZNEA 5GS1B 3W0WD 1ZIBA 1KPRB 1RK1A 2BINA 4E0RB 1URQC 1CICB 1RERA 1RULL 1YNTF 3QO0A 3QIWA 1G7MA 4LZKA 1NCNA 4QRFA 2CNZA 4AQ1A 1KTDB 2W07B 2K4AA 3QIBC 1NTMJ 3LRLA 1BD2A 3QG6B 1E2WA 4H13B 2NNAA 1CBVH 3F8UB 3GIVA 1D5MB 1U9KA 1BLNA 1BMZA 5ISZA 5TDNA 3N42F 3KGSA 1KWGA 2ZUSA 2Q3ZA 4RMSA 1FNEA 4X50A 4H1LB 4UQIM 4NJAH 3ECVA 1ETZB 1SQQJ 3QPQC 3TBCA 2WWMC 1INQA 5I5JA 3SODB 1JB0J 3BX7C 4G8FA 5FYKH 3RKDC 1A7BA 2BOCA 4IL6H 1JNLL 1ZV9A 1BPLB 1S7RB 3WTTA 5SX5H 3CE1A 3ZW3A 4G5ZH 3ZDYE 5F7AA 2M3EA 1H3TA 4IMLA 1F90L 1CFSA 3EGSB 3SKOB 4YJZL 1EZVX 1YZZA 4CDGC 1QFPA 4X6CA 2X12A 4UDUA 1T6AA 1XGUB 1RZKH 1F11A 3GZOA 4J3WA 2BVPB 3P3RA 3ZKND 2BOBB 2XQBL 4LEOA 2VZTA 4CN6A 4AM0B 4JZNB 1JWMA 1NC4B 1A8ZA 2QSCH 3ISYA 4OZGA 5FGCB 1WAEA 4QIRA 1FZBA 3EF7A 1HS6A 4G6KL 1WCBB 3TU6A 2IWKA 3QEQE 5MENB 4X6CF 2SPZA 3RWDB 3D85D 1NQBA 2CHXA 3ZTNL 5J56B 2IANB 2JCCA 2AQ1A 3DOSA 4HKXB 1TFHA 3NCFB 1KB9K 1PFOA 1RL1A 4NQDE 3C9IA 3MV7B 1ESOA 2BSDA 2FSEB 3TOPA 5CSGA 5GIRA 4FQQA 3APNA 1UACH 4PYHA 5IT2L 1LP9A 4Q52A 2AJSL 3NFNA 4MD4B 2JCCF 3V2RA 1FNAA 4NUMA 3SE6A 4S1RL 5FKPA 3T0VA 5I1LA 4K3AA 2X41A 2H3NB 1OPGH 2EYTB 2RQEA 5EU7C 1NCWL 2EACA 4W1TA 1ZV8A 3L73D 1CLOH 1KN4H 3CK0L 3DK0A 2BCCJ 3G04A 3MVSA 1KB9E 4HW6A 4JANB 1H88A 4QMEA 1LWUB 1Q1JL 3NJVA 1LP9F 5IJBC 1KLGA 4CJ0A 2D7MA 2APWA 4K71B 4OCRH 3T8XA 1MF2L 2LR4A 5FFOA 4FRWA 2Q5BA 1SFCD 3MCLL 1U42A 4PBVC 5F8QC 5CGMA 4L76A 1I53A 2HRLA 3D30A 3QHTC 3S36X 2EYSB 1M71A 5C8JB 1CFBA 3EOAB 4RGNB 3O9WB 3TO2B 3QIUC 5E8PA 2FSDA 3CHQA 3U6RA 4Y4FA 1OF2A 3BDYH 4MXVF 3ZMRA 1OGTA 1SXNA 5TF0A 1J5CA 2Z93A 3OKEB 4MA7L 2GK2A 1T6WA 3BPNC 3BVVA 4KK8D 4U1IA 1T7YA 3CFUA 4PVMA 3FF7A 1YMHA 1WMKA 1EC5A 1ULVA 2FEDD 3RTQA 1RJYB 3WHE1 4OH2A 4JL2A 1AQHA 1JPSH 4NPFX 3LKOA 5B1CA 1DR9A 1L7TL 3UJJH 3OJDB 1JWUA 3V6ZB 2HFTA 2NUPB 3D25B 3KWVA 4LQFH 2FX9H 3ELQA 4LCVA 4MNQA 3CPLA 3EO0B 4NT6A 1F3RB 2FH6A 4PR5B 5I26A 5TF1L 3MACH 5CBAB 1J2JB 4W6WB 3LN5A 1FH5H 2X9YA 2VXQL 4JY6A 4NO2B 3W57A 1JY2O 1TJMA 2F1BA 3NDZE 3FT0A 5HJBA 1EXIA 3B5ND 2OZ4L 4B60A 4U6HA 1DLHA 2NY7H 1IBZA 1IE4A 5BUAA 4NO0D 3NIDF 4PJ5A 2IH3B 3QJOA 3FGAD 4LCYA 1S7VA 4UBDD 4WO4D 4Y16D 4CVZB 3NZUA 3VQLA 1WD8A 2XJKA 2YQ3A 5LBGA 2R7EA 3LW5H 1HN1A 1TR7A 4AXWB 2JEEA 1I3UA 2WUCH 4Z7VE 4YDIH 3S8FB 5DJYB 3OZ9H 3X13A 3TVMC 2B1AH 4ANXA 2PF6A 2NNCA 1DD3A 4OJFH 4C8XA 5H35A 1GGBH 1S9XA 2AJYH 3H7BA 2XRAL 1JOCA 3H0TA 3LX9A 4HIPA 3H1HE 3OHXC 3GXMA 1R3HB 3JT0A 4FAAB 3IEAA 3SCMB 3Q06A 1I8KB 1N59B 2C5DC 4NDMA 2FD6L 3A4AA 3QQNA 3ITKA 5LXGL 1AZVA 4X9FA 2NSXA 3OLDA 5LNEA 1N64L 1Q9LB 1DX7A 1FYTE 4I2XA 2GB2A 2BW5A 5BVJA 3CFEA 5I1DA 1GGIL 2D3LA 1A6WL 3LS5H 3K5SA 2XG5B 1BLIA 1UIXA 5SWSE 3UAJD 4PWIA 1FIEA 1MFDH 1X4XA 1DVFD 1HF9A 1KBGL 1OSEA 3EOYG 3PL6D 1O9VA 2CGZA 3ET9F 4S1SH 3L4XA 2F1AA 4NQCA 1G9MH 3PWUA 5F7EH 2EVGA 1IGTA 1A6ZB 2J57A 3CXHD 2H43A 2DLIA 4I18A 5EEUA 2A6KB 1IE5A 4F20A 4N5ED 4I6MC 2OYHA 1TYRA 2ZAHA 5I0XA 1CLYH 2FL5B 5DVPA 3F01A 4ETQB 1YMMB 2EIBA 2O72A 2TAAA 2HX7A 1HXMB 1JGVH 2KSJA 1KB3A 3KEDA 4GP5B 3I3EA 4AYBA 1HQ4B 4JZOB 3DX7B 1K8IA 1E8XA 3SJVE 4JPKH 1NEZG 2UVEA 2ZUQB 1R6VA 4R90L 1IQWL 3BZ4A 4HCGA 4JFTA 4IFDK 4XXWC 5DS2A 12E8H 4JN2A 2C9PA 1MRCL 3S36H 1FCCA 2Y69B 3TZVD 4U0RB 1KJVB 1KIPA 4PGZA 1HUCA 1UB5B 4HQQH 3DHPA 1UKSA 3IMRA 1CGSL 3GDCA 5GTIH 2VM9A 5E0FA 5CD5D 2RA1A 4FQ2H 4JM0A 1ZLWH 2Z65C 4EAEA 3M9BA 3FN9A 5IB5B 4FNUA 2VABA 4FHBD 5GS2H 4CU7A 1MREL 4TSBL 5H94A 1CD8A 1E4KA 3ARFC 4JFSA 5FF6A 5AZ2L 1PQZB 2HLFD 4G7VL 5A2BA 2QMKA 3N06B 4N2OA 5AEAA 4W9HC 1SQBK 1FDOA 3TEWA 1RPKA 5CSZB 4ZMVA 3J07A 2VXSH 3S0PA 4O58H 2WO2B 1FL6A 2DYPA 1RZ7H 3AUVA 3DURB 3F65A 3FFCE 1SN2A 1FJ1B 3FYEB 3P9MA 5JQ6L 1D7FA 1KZQA 3SDCC 4M1DH 2Y2YA 3BN3B 3CVHA 3N40P 4NOBA 1U6AL 5ALBL 4QRSB 3MV9A 4Y2OA 5F7HA 3RZCD 3H1JJ 2DQIL 1USZA 2YFNA 1JZHA 3HI5H 4MB1A 3VD3A 1OEZW 4Y9CA 3LQAC 3FL7A 2PP8A 1EIBA 3QRGL 2GJZA 4R2GD 3P32A 1U8CA 2MJWA 2NT0A 1SUJA 2GFBB 4DZBA 4Q6KA 4U1NB 1SQBE 4IKNA 4XPFH 4HUUB 4FQJL 2NNFA 2P5EE 1JFQL 4HXAL 1FOSE 1FO0B 4HIEA 5EZIH 3FUFA 5F6HJ 5JA9A 3OTTA 5FXCH 5IQ7L 1A3QA 2DQFB 3PWPB 3QQ4B 1UH2A 1NKRA 1UXSB 3O3AA 2MCPL 3STLB 3B9EA 1JVLA 4E9RA 2NTFA 5C0CE 3H1ID 1HYRC 3TASA 4E5XA 3Q0HA 5KSVB 2CBTA 3ILEA 2C9UA 3JCUE 1IGML 2GCYB 3QHFH 3HAEH 2AKRA 5HPMB 1AIFA 1OE3A 5DRXB 3BO8A 5I8CA 1H0TB 4R0LA 3FO0L 2CXKA 1WIOA 4RZCA 3HAEG 3BCCJ 4CW1B 3ISRA 2FQFA 2VJ8A 1KCUH 1OOAA 5J1AA 4HCFA 1BCCJ 1RZPA 4LASH 4ZMAT 2ADYA 4QHNA 3TCLA 3HNSL 4PGCB 4JR9H 4Q6IC 3QSKB 5KLVD 3KL5A 4KFMA 2RH0A 5DMKA 3CLFH 2F53B 1U36A 1SQXG 1BFTA 1EZVD 4NC2B 4NQDB 5LBSL 4MMYB 3VXOB 1SQPK 2QJPC 1FJKA 5KS9F 3BSHA 1LT9C 3DRQA 1WFOA 4K3GA 3EO9H 2L7QA 2QLYA 3BT2H 5AYUH 4YUEH 1MQKH 4B7LA 5IQOA 1A6UH 5CLXA 2WN3A 3ZOAA 4R84A 2CNYA 3PWJB 3Q5TA 3OW2O 1M9SA 4GXUN 4KJYB 3W11C 1M1XB 4ZAKC 3TGUD 4NN5B 1EEYA 4AEFA 4WF7A 2GJPA 4MS6A 5D6DC 1EZVI 1DIPA 1Y1UA 4LPUA 1S9YA 1U3YA 2NY6C 1BIIA 4NRXB 4PI2A 1SDYA 4CSZA 3S9DB 5GJSL 2HUHA 4H0LD 1P2CA 1SQPE 3WS6A 3RK3B 1T7VA 4Z3TA 2ZT9C 1FLRL 3UZVB 4KJWD 2A74C 3QC6X 5J8OA 4D3CH 5BMFL 4J3XA 2FUTA 4FLSA 3FH7A 3KYMB 4LU5H 4M6OL 5E2TH 4H8UA 4AIEA 3ZTJG 4Y1AD 1RK7A 4QRTB 3SE9H 1N8ZA 4LGDE 2PCFB 4M3HA 4HS6A 4AKPA 1YITP 1JRHI 5DMIH 3HR5B 4PJ8C 4A63A 1CL7L 2JB6B 3HNVL 1GW0A 3EBIA 1Z5HA 1QABA 1G7IB 1NDMA 1CXHA 4JFXA 1AC6A 4AVHA 1JO5A 2DLEA 3T0EB 2Z4TA 4MAYC 4XHJC 2OULB 2ERJB 2WXHA 3T4AC 4YBHA 3U0PB 43C9B 3D39A 4UF7C 2EO9A 1NAMH 3FHAA 1BQHB 2L7JA 1CJYA 5CINH 3SE4C 4KK9D 1I4FB 1QRKA 1OLLA 4P2RD 3BAEH 4P5TB 5BO1L 1NICA 4DGYH 2I07A 3RFZA 3OD3A 2VR9A 1BQKA 1D7BA 4F7EB 2VDPL 2X0VA 5DHMC 5KVDH 3T97A 1KFAH 1U8IA 4DTGH 4K23H 4PJ9D 3DPDA 4WUUA 1JGDB 3V0EA 5K9QG 1MFEL 2CMRL 3H42L 7FABL 1E6OL 5D8JH 4G8GA 3GI9H 2FUQA 5DZOA 3HG3A 1RJCA 1DVUA 3LS4H 1JXKA 3GGWA 4YPGA 1WS8A 5I1JH 2DI9A 1MLCA 5BW7A 1HZHH 1QO3A 3Q7JA 4WDIB 4TNWK 1KIUA 1YPZB 4HC1A 5SV3A 4JG1H 5D96B 4NZTL 1U4FA 3L4UA 4LF3A 3DX1A 3SOTA 1MJJB 1PY0A 2UYLB 3LMJL 4Q0XH 2IFFL 3IFOA 4Z7VB 5IB2B 1FUNA 2D7TH 3REVA 4Y1TA 4BRVA 3QUHA 2VGLM 3ZKXB 2NLJA 3GLEA 1X4YA 4WFEE 3DIFB 3P1VA 3W5MA 5C70A 2DOCA 3B8SA 2EEBA 3PCYA 3UAEA 3UG3A 4M7JH 1KEGH 5DLMH 5IBTL 5JPMB 1I8UA 4WHTB 3FONA 1YLBB 5E8EB 4KHTL 1AZRA 5GS1C 2NZIA 5D2NA 4XR8C 5E4IA 4HD5A 2BHUA 5CIPB 1LTXA 3VGHA 4NBZB 4HGMA 1RUKL 4P2QD 5EZPA 1F56A 3IGAA 5CMAB 2W9DH 2CLVB 3ESNA 5TTRA 2PW1A 4J4PD 4K2UL 1AOHA 4X4XB 5F7BA 3ZHNA 1F8TL 1ET8A 4XCEB 4ZMXA 6FABL 5F9DC 3F00A 4XCYA 4X99B 1WD9A 1OCWH 4P5SA 3MRMA 3ECWA 3RIAK 5T3ZL 1GGCH 3PGCB 4JAMA 4ERSL 1F4WH 1D6EA 3H32A 2QELA 5GJTH 4E2OA 2UX7A 4EKJA 3RWJA 4P4KC 3WY1A 2MHAA 5IBLD 5A16A 1KGIA 3MNZB 5F21B 4G80A 2X7LB 2Z34A 1BXUA 1X5LA 4JKLA 1CFTA 5I17A 4W9CC 5FAAA 3ATDA 1CLVA 1ANUA 1YEWA 2C9RA 1ZN5A 3NAAH 3PGDA 5IB1B 3C5ZC 5IROC 1K8DA 5I16A 3QZNA 3ENEA 2Q3XA 4RRPG 3VQMA 4APQA 2WP3T 4BZ2A 2GJJA 5CJOH 3PRZA 1YY8B 2BCKA 1EPFA 1JS4A 4UNTA 3UYPB 3CN0A 4IOFC 4JRXE 3U83A 4AYFA 1UM4H 4IDJH 1AO7E 3Q5PA 3MFGB 3R7QA 5K59F 2O5ZH 1E40A 2ESVA 1LO4H 1S7UA 1LM8V 4XC1H 4Z3JA 1AC0A 3OX8A 3K1DA 2GI7A 2GJ6E 4WFFD 2YIUB 3CIAA 3U2JA 2PNDA 2OYIB 3CZSA 1SLWA 1WWBX 4YHKH 3VFNA 1MSPA 1U3HB 2ZCLL 5I8KH 4WB4A 1EO7A 1HHKA 3UZEA 2C0WA 4XMXA 3G4SP 4M6NH 3VI4E 1KCRH 1UT1A 3BC9A 3CDGB 3WNOA 2B77A 1AQKL 5C9JB 4UM9A 1B88A 3JWNH 1A7OL 4M7KL 2ZWSA 1IGYB 3DJZA 2ZF9A 1OFCX 1KZUB 3SBPA 1YEJL 2FBJL 4HK0A 2OSWA 4AK1A 4D6TD 5EBGA 1X9QA 3QYNA 1KB5L 1H5BB 4EKXA 3BW9B 5I9QC 2Y1ZA 2HTKC 1TVBB 3LKNA 4X8JB 4QOKB 3JTTA 4DGUA 5BRZA 1EXUA 3CBKB 3RBXA 5I1GL 2XX1A 1D9KD 2MWCA 4LPYA 1HYSC 4PLKD 4H1LH 4G7QB 4AMXA 3O2DA 3L2MA 2E9BA 4BFFA 4L5FH 3TBTB 5EULV 4DW2L 3JVGA 3MMEB 1FC2D 4JFQA 4J8RA 4WWKA 2P5EB 4TVPE 3N85H 4U1LB 2G3MA 2BO0A 4OGXH 2YD4A 2HJLA 4ZUTB 1XIWB 4JB9H 1Q81Q 1EO5A 1VZHA 5IIEA 2GEQA 1QBMH 3DJSA 3AEFC 5TDOB 5C0CB 4ELME 3RJQB 3Q9PA 4YHIA 4GLRI 5C6TH 3HMXA 4HISA 5EC2B 1AR1D 4LCWE 4LLHA 3ZL4H 1I8LA 2G2RB 1WZMA 2I7OA 1RIUH 4HLJA 4IIQA 1D5ZA 4AL8C 2PFXA 5IFHL 1J1EB 2P5WE 3PP5A 3VSVA 1OIPA 1DUZA 3BUPA 3TC9A 3L7FB 3GSOA 4U1KB 5AYQA 4WNQA 3QUXD 2E76D 3R2PA 2VLRA 3GZQA 4KPHH 4OQTA 1ZTXE 1O5DT 1ZD6A 4LBEB 2I1KA 3CX5H 3KCWA 4UZGA 1JZ8A 3VYIA 5GHWH 4EI5D 1CO1A 4HDIA 3DXAB 5DR5H 4LLWB 3DHUA 2DV6A 2W27A 2H2PD 3DUSA 1S5HB 1VACB 3HG0A 5AVVB 5DA4A 1G9NH 5E6IB 1GMJA 2OMUA 3FC8A 4FYQA 4JHVA 3ULVC 1K6QL 5EDXA 1BGYD 2VRKA 4JPVL 1S5IL 3CCEP 1UCTA 1R5WA 5AL8A 2D2OA 3MA9L 5EUOE 4W9ZA 2O61A 2PYEB 2BS8A 1BFVL 1RUML 2EINB 3RVTD 4HG4J 2KZBA 1BZ9B 3FTZA 4NCDA 5GGSY 3NFSH 3HB3D 1CB4A 1LTSC 1MCOH 3BSZL 3BFQG 4QF1B 1RZIA 1TJIH 3IETB 4XTRC 4PGBA 5E9DA 5I82A 4E9YA 1BOYA 1UXWB 2Z5HA 2P8LB 4FXLA 3L3DA 4LVNC 3THML 2L0DA 2XPGA 3T0DA 5IVZB 2WO4A 4GAJL 3HD7D 1OK8A 1ZHKA 3WE6A 1AGEA 1I3RA 1RZFH 3O4LE 3AG3B 1GK6A 3QIUB 3ELAT 1OM3L 2NOYA 3NG5A 1MPAH 2OYOA 1MI5B 1L9RA 5HY9B 2PPFA 3A21A 1NANI 3BPNB 1GPOL 1GD2E 2CZNA 4D0BA 4ZS6D 1T22A 3IMBA 4GP4B 1IFPA 5APVA 1KZYA 1P7QA 1A9EB 4M5TA 4UTBH 4FFTA 4YDJB 1ZLVK 1XB3A 2OTJP 4N22A 2RBLA 4LDOB 2HT2C 1MW2A 5TPWL 5AYTA 1IO4A 1V10A 3ILQC 3EYOB 4JHWL 4WV1C 4OF8A 3WSQH 3RI5K 1BFOA 3NCJH 2BPBA 2PR4H 4D9QE 2J20A 3ESVF 3MIWA 4JFUA 4LPCA 5E2WH 2NUTA 2I9LA 5CJ8A 4XMVA 3WD5H 1PNDA 5APXA 2YMTA 5CP7B 1I8IB 5GRVL 1JK8B 4HFUH 4Y4HD 2H41A 4K8RC 3U0TB 4XPGL 5D5ME 4K9JA 1AVAA 1FFPA 2J8HA 3G6JF 4ZUUA 5BJTA 2VXVH 2E27H 3MUDA 2EIDA 4CPGA 2BDNH 4GRWF 2FFDA 2WBJA 4PRPD 4TSAL 3GSXA 5GSVB 1B0WA 2NY4B 1GIGH 4X7TB 5HYQA 3HRPA 5MHSD 1RZGB 2POHA 3HZKA 4PRNA 1FCGA 5APQA 2Y1VA 4ZPVA 1MHEA 3MFFB 2CJ3A 4YBQC 5A2CA 4H25B 1GOHA 1HWGB 4N0CD 5A2AA 2CHWA 3CSGA 2WXQA 4I4WB 1QSFE 3MUY1 1U2YA 4IRZA 4PY8J 1DVYA 1MW3A 3SE3A 5C97A 1TZHB 3FFOA 3B9KD 3INOA 5IW6B 3WHXB 2LKMA 5GRJL 1T2KD 5LO7A 1N2RA 3AE8C 4X5LA 4TUKH 1D7CA 4H13D 2P8PB 4LOUD 4HPYH 5D7EA 5DWUH 1ZV5A 2VSKB 3GBML 3VTMA 2FHFA 4KH2A 3ISWA 4HJ0C 5IKCB 3S34L 3QNXB 2JQMA 4FA7B 3D34A 1SY6L 1N7ML 3CDZA 4XOAA 4MN4C 4RX4D 4NFDA 4AVJA 2B7DT 2Y4SA 1UEMA 4BSVA 1CFQA 3SE8L 3E3QC 1M53A 5DUBB 2VDPB 1A7QL 3II2A 5EN2B 2IF7A 5B8CB 3SO5A 3HC0B 1YECL 4IOIH 5E4AA 1UM6L 1BP3B 2Q8AH 3BVNB 1KPVB 4M61A 1DBML 3IDYB 4GSQA 2XWDA 3M1BB 4YXKH 4EMZA 1ZLUK 3SZ6A 4ZO8A 5F7WC 2ED9A 3SYAA 4LSQH 1GU5A 4W93A 1ZGLA 2FYVA 5JIMA 1F58H 3WCYA 2CKNA 3VWJB 1LNUB 2B2XL 1KXHA 2ENPA 2FX7L 2ED6A 2B0SH 3PV6A 3X3FH 4PHZA 4F91B 4MDIB 4W9KC 3ZQXA 3I6LD 4PB9L 4KTEL 4UQEA 1S4IA 3ARBA 3KPMA 4XNXL 4PRHD 5HHOA 2WLZA 5MEND 1EMTL 5C0EB 2E4TA 3WV0A 1UEYA 4OV5A 4R7DB 4MA8H 3MJ9H 3V6OE 5F9OL 1T5WA 1WSST 2GHWB 2CLZB 2WSFH 1D6VL 1ZIAA 4O5LH 4QLRA 3MV7D 2X4UA 1YEGH 3JTSB 2EIKB 5T5FL 3TJHC 4NNXB 4ZTOL 2DWYA 3INUL 5DZJA 3RYMA 2YLKA 1A47A 1I7UA 1TXKA 4X80L 1NM4A 4P2OB 4XWOD 3VD5A 5AVWB 3VMXA 5AUMA 1PGRB 4BKTC 2N0KA 2HVJB 3DX8A 4I48A 5C07E 5D4HA 3CX5I 4KMLB 2FGWL 3TSIA 3LW5J 3TBVA 4NN6C 4M00A 1KIRA 1O0VA 1BSHA 2GJ6B 2VDOL 3QCUH 5C0RH 5KLVJ 2ENSA 1TMQA 3BZEB 1ZXGA 4GT7A 4YHPB 3TEXA 1LWHA 3QJFA 2YAEA 2NXYC 2DICA 5AL0A 5DZPA 2DQEH 4NOFA 5DT1L 3VI4B 2KPNA 3BKCH 2WHVA 1T4KB 4AL8L 1RHZB 3NA9L 1S46A 2JIXA 3ETSA 2AEQL 3GXUB 4P3CL 3NQIA 1SHXA 4U6XB 5FYJE 3SDCB 1XCTA 1ND0B 1UHVA 1BGXL 3DMMC 4MHHG 1WAPA 5F1NA 3WY4A 4FFYA 2R5BA 3OAKA 5BU8B 4JFED 4OGYH 4W4OC 3BGAA 5D1ZA 3O6QB 4AYDC 4HIIB 4B9PA 3QIWC 4JDEB 4TLSA 5IR1B 3H9SE 4B3EA 2OMTA 4AQ1C 5JHLH 3A0OA 4N4YB 2R8SL 4L2LA 3D0VA 1CXKA 2DD8L 1J9SA 3ULVL 3UTSA 1FO0H 2VLKD 3E9TA 3Q3DA 4O02A 5IHBA 4TLUA 5ABZA 5CXPA 3O6ML 1BG1A 1FZCB 2V5TA 1VFOA 2AI0L 3L7EB 3W81A 4K5MA 2XNAA 5DA0B 5B39B 2OMWB 2DJMA 3VH8G 2Y07H 2UZIH 2WSDA 3NDYE 5DJ8A 4XNBA 4MD0A 1TO5A 1EAPA 4YSSA 4JQXA 3U4EA 3WXWH 4BZYA 4WK0B 1YQVL 2BVEA 5T5NF 3VXSA 3E2HB 5TGBB 2XKSA 3L1OL 4QRUB 3VB9A 1UWFA 3HZYA 2R2BA 1JZIA 4YHLH 3F84A 3MV8E 3U0WL 1U8HA 1Z9SB 2P5WB 3D18A 1E2ZA 4JJ5A 4B96A 1NOAA 1KB5B 1KGCD 3II1A 1KTLA 4Q6IB 5AQ0A 1G1CA 3GTTA 2EDNA 3BUTA 4XP1L 2YZ8A 4ODSH 1VFBA 4OW6A 4OFKA 1QFOA 5KJRL 5KZCD 1DBKH 2EILB 2WOYA 1EGJL 4KO5A 3ASNB 1TCRB 1LT9B 1WG3A 4FERA 4QRPA 5CZRA 3KLSA 1WTLA 5F0PB 3X14B 1DD4A 3O4OB 2OKMA 5IBUB 4X5XA 1UG9A 2NQ3A 2ZWZA 3PHQB 4GW1B 2M3BA 3D7PA 2DEXX 3NIFE 3TWCH 3A67L 1Q8MA 1WK0A 4WTQA 1X6LA 5D2LB 4I87A 1VPCA 5KAIE 1IU1A 4FTVD 1IGIL 4Z3FA 3N7NA 2F7IA 3WS3B 1F90H 4G3YL 4H8HA 4K8RL 3RPIB 2IPUK 4AQAB 1BWMA 2NY6B 3OXRA 2V9UA 2YFOA 3EO1A 4OQ1A 3MTXA 4FZ8L 2XKMA 1KB9H 5DHVA 4H2AA 2HVBA 1XQ4A 2A74B 2J6EH 4FQXA 5GGQH 5IOKA 3QFJE 3CL3D 4HS8L 1L6XA 3FCBA 1CFNA 3W2DL 3VTAA 3Q8EA 4G6KH 4DGWC 3SKMA 2A45H 1I82A 2WAHA 2DMCA 3F6IA 5C0JA 25C8L 1TJGL 2XZCL 4PJ8B 1ZVSA 1JHTB 2A45G 1ZWIB 2VZ1A 4LLYB 3HBZA 1HX0A 2F7OA 3TXAA 4E9QA 3D06A 4NERA 3ZKMD 1MWAA 1M56D 4MAYB 4NIYE 1CQYA 3O6FC 4ES9A 5JXEA 3TF5A 2AJSH 1E79H 2MFNA 5CCHA 3C08H 4V1DE 2WMMA 5C3LD 1NL0L 4S1RH 3QUMA 1GTNA 3L3HB 1FGVH 4WEBL 1LO3L 2ICEA 3ZDXF 2V7NA 3TNNA 1EFXA 3ZGHA 5L8RJ 1BQHG 2H6UA 1C16A 1Q4NX 1YYML 5D5MB 1GVIA 3VSUA 3WIHL 1Q1JH 1YDPB 3RTQC 3SDDB 4XMTA 4JGMA 1I7TB 3AC0A 2EUWA 5F0JB 3AY2A 3AITA 4AJWA 3A7OA 4PV8B 2R56L 4IBSA 4U49A 3RAJL 4XGZA 2JTDA 3C12A 4FKEA 4JVWA 4P4RA 4HUXA 3BSGA 4XO8A 1DUYA 4O2CA 1AS8A 4LHQB 2GBAA 4PB0L 3QPXH 3EG9B 4MA7H 3L9EA 3NMDA 5J13B 2X2IA 3E6FB 3U2SB 2WSPA 5KYWB 5IM7B 3WFCH 1GL2B 3D51A 1CE6B 4E41A 1CU4L 1C5DB 3WJMA 2KLUA 1E5CA 4KVPA 4WWOA 3RNQA 3L3KB 2HUEA 1OAYH 1QLRB 1BM3L 1GXEA 2F08A 3B83A 1FZMA 3WMSA 2ZOKB 1E27A 2R1YA 3EDJA 1IEAB 4WI0B 1PSKH 3UGEA 1HESA 1PPJE 3VGAC 2VXQH 4GW5A 3TO4D 5CIPH 3PWPD 1JN6A 1EDYA 4OJDH 3VFTB 4JPWL 5GXBB 2OZ4H 2Z9TA 4F7PB 4M8VA 1DN2A 3QWRA 4JCWA 3HLAA 5BZWA 1J0IA 1HEZA 4JKPL 3VNYA 4AE1A 4WRLA 4KHXL 4NQEE 2OYMA 2JKJA 4JO5A 4WU7A 4XPBL 4ILDA 1IL1B 1HHJB 4N2IA 3U4BH 5M95B 3NOIA 1ICTA 5FOBA 1DANT 2AERT 3FCSA 4P4KB 4IBVA 3OKKA 2QGEA 3BPOB 3FN3A 1KF9B 2VN3A 2E8ZA 3F5WA 1IUZA 4XOBA 4AC4A 3FTSA 2YA2A 1W2KT 1OSZB 2XRAH 2PXYC 1DBBL 4ZK8A 3KPLB 1KFMA 1HQRA 5CBEA 2A6JB 3D2UD 2F53D 1K5NA 2GVYA 4PRAB 2VUOA 1UA7A 4YC2C 2FD6H 5EHFA 4I18C 2YUZA 2R4RH 5DQDL 4TNVF 2OYHC 3B2UC 5KUKA 1N64H 2WQWA 3JV6B 4HJGA 3T71A 2D3JA 3IF1B 2PCPB 3H1ZA 3LHAA 1GGIH 3DUUB 1A6WH 4NNYB 3RL1B 4AIZB 3GRWH 4KOBA 5C2UB 1SN5A 1U8OA 5C07B 3R7RA 2YD6A 4XZ4A 5CEYB 2ZP9A 1KBGH 3TJEH 3NH7L 5B3JE 1SQVK 4CVUA 5ESAA 2XTLA 4OUUB 2EXYC 3RWCA 1KULA 3TV3H 4EOWH 3RK3D 2A7BA 1MY5A 3KPRD 3RVWD 2WLIB 1J8SA 3VDBA 4ZQKA 4UB8E 3HVNA 2V3DA 3D85A 3OJVC 4UDTB 4W9EC 5I6XB 5IJCC 1X0TA 4TQ8A 1BGYJ 3UABA 2C7FA 4DKTA 1A3RL 1WT5A 3RNKB 4JDZB 5F0MB 1J88A 3D52A 2VN5A 3RUGE 3TYFB 4HVBA 5I9QB 3ECUA 3IDGA 4UV7L 5IJDC 3HMWL 2GSMB 3KGRA 4RISL 5EN3A 1E4KC 5DRWA 4JUSA 1ZK5A 4ESKA 1KB9I 3DK2A 3EDFA 1IQWH 1LEGA 1Q0XL 1SQVE 1X5FA 2XA3A 3FOLB 5INCB 1ZT1A 4F37K 5JOPD 4Z5RB 3FW6A 4JFZL 2FBWC 2A73A 5ANMA 1MRCH 3T0ED 2N1TD 3T65B 1HSBB 2A45I 3VQ1C 4GMTH 2EDYA 3T4YA 2J5LC 1FA4A 1HSAA 1BJ8A 2KS1A 2AEOA 3AADB 3S35L 3UBGA 3MRKA 3OXSB 2ICCA 2Z31C 4KKBD 3C6LB 5FYLL 2J5UA 2FIRT 2JJUA 4PJHE 1SQBG 3DGGB 4XB8A 4GXVL 1SBSL 3UDWA 1FVCB 2VDOB 5AW5B 4L0PB 2EE9A 4AC2A 5FB8A 4TSBH 4QRRE 5I1HL 4L4JA 1CBJA 1V54B 2MEJB 4G7VH 4XMLH 5AZ2H 3WFHB 5HYFA 2ZKXA 1VL2A 3K71A 3JCUH 4G71B 4Z7WE 3WUZA 1NBYA 4BXLA 3ZLQC 2H88C 3CZFA 1BBJA 2Z1PA 3BRVB 4MWFB 4IOSD 2MCMA 3T6QC 3FQ4A 2VL4A 3RWGA 2R83A 2IDCA 2BC4A 1CVRA 2FWOA 2VXTL 2XXCB 4QWWC 4RFNB 3QZPA 4ZO6A 5JQ6H 1ML0A 2YAPA 4NRZB 3AG4B 4PJFB 3T1WA 3MV8B 2GTQA 2DB8A 4W68A 5ALBH 5C09E 1Z6JT 1XH1A 4GW4B 1PCXA 4H44D 2DQIH 1JK9A 1HFUA 43CAA 1MIML 1KNOB 4A2FA 5DJAA 3QRGH 2PTTA 4OZGE 1MCWW 5HDLA 2B9BA 2APTA 2VIRB 3KWUA 1M2VB 1EERB 1RD6A 4XNYL 4YSOA 1JFQH 2X70A 4Y28J 5E8OA 5FK9A 1TKWB 3JWDC 2VLLB 4NWUL 5SWZE 2OCFD 3NJHA 5E99L 3EBAA 4PD4K 3RVVC 1VF5B 2YSSA 4QXGH 1FAVA 2YSTA 3W37A 2XTJE 3L1FA 2IQ9H 3CGTA 1L0PA 4YO0A 4LVHC 3VFPA 4YXWH 2K0RA 4TPRL 1HEJC 2PRRA 3ZYOA 1TTRA 2OSXA 2YQ2A 4OI7A 3VD1A 4LVNB 1HC1A 4FG2A 2DWEA 3GUTA 3QRFM 5GTHE 2G5UA 4MJ4A 4WO4A 1NHLA 3RVUC 5EFIA 3AXHA 4JYCA 3CSTA 4I9WE 3QFJB 4PD4E 3SWKA 3T1FA 1J8HE 4KQ3H 4TV3A 5KYYB 4HIJB 3HNSH 1R5IB 4CGUB 1SQPG 2D3NA 4GNKB 3M0AA 2CKBA 4UM8B 1BA9A 3X11A 3VCLA 2A1WL 2XZZA 1FAIH 3D4ZA 3QZWA 3LY6A 4LHUA 5IVXE 2X1PA 1PAMA 4OLUL 1E6JL 2VYRE 1JPST 3L3OB 5K93A 2Z0BA 5LBSH 3WS6C 4FLRA 3WUVA 3V9EA 4PJEA 2BIOA 2JI3A 3TIEA 4FLQA 1LTGC 2E56A 4L9DA 2IOIA 4X8XA 1S9KD 1IM9B 2V5MA 2WXIA 4V1DB 2XACC 2NW3A 4N0FA 3AECC 4CVXA 1NH6A 4OGAD 2EDRA 4R7NA 3RUGF 4J39A 4PJEF 3V10A 1N10A 3ATEA 3BKJL 1YJWP 2NX5A 2QQQA 3EFDL 3CX5J 3U36A 1HH6A 1U3HD 1A2YB 4ZMYA 5BMFH 3HVDA 3L35A 1URQD 1KBVA 2CDEA 3L3JA 4EBQL 2QT6A 5L7XL 4GDOA 2M26A 4ONFH 3GMNB 4ZS7L 4GBXA 3JVFC 5BZDA 3B7SA 3ZVVA 2V9TA 2GHZA 2WQUA 4ELDA 3BIBX 3LJ3A 1CL7H 3QIBD 1BSIA 3MZTA 4KY1H 1Q90D 1A7PL 1XD1A 1TF4A 3FQWA 3JQOB 1X5JA 4PJ5E 4UMSA 1OAJA 5DURB 4JRYE 4DWHA 1JHKH 2O5YL 4HHWA 4O2FA 3VXQB 3NJJA 4QOKD 1H3VA 5BW7C 3QPQD 3IDMB 1RIVL 2WWMD 5J89A 5I1AB 4X6DB 1DN0A 3BMWA 1ED3B 3RKDD 2WVRA 2FKWB 1BVLA 5BO1H 4PRID 3FTGB 2VDPH 1NA8A 3BAYA 4KGJA 4NWTL 5FEBA 1RZJC 4BA0A 1P6WA 3L1EA 2HRGA 4ODXB 1WBXA 3GUFA 3US0A 2EH7L 1MFEH 4GKLA 3KJ4B 7FABH 1E6OH 2JFCA 4KROB 4LNRB 4IFMA 3UEZA 3TFKC 1FZOB 2JKXA 1LO5B 4PGDA 1SOKA 1E4JA 5KS9B 4PTTA 1L9TA 5IV2A 4I1LA 2WTOA 4ONGH 4XA4A 4M6AA 5D2NC 1KGYE 2QVIA 4Z3EA 1PLBA 2Q5UA 5BUGA 4NZTH 2GKIA 1M7LA 1U8LA 3O45B 4JPIB 3LMJH 4M1GL 4AH2B 2E9WA 2IQAB 1MZZA 4P23B 3RGBA 3H3KA 2B14A 4OD3L 3BP4A 3ABVC 2ENQA 3APMA 3LNHA 4FKHA 1DJWA 2DBJA 1FZKA 3HFMH 3QA3A 5CS7A 3VM5A 5D71H 2ARJA 3DXAD 4OLVH 5EZLA 1E5UI 1QRND 4YHYB 1YEEH 3PQYA 4AVIA 4L8DA 5IBTH 2IPKB 4U2ZA 3LNIA 2JK5A 2F58H 3HTLX 4M93B 1W8NA 3NCBB 1XTCC 3HE5B 1PG7X 3SN6N 4BIKA 4NPEA 4S11A 3GSRB 1IKNA 3U46B 4F8LA 3CVHL 5JHDE 1T1WA 3VMOA 1QW8A 4M56A 2R2EB 5DJZB 3S5LA 5C0AE 4ENEC 2PYED 5C9KA 3U48A 1S4XA 3V5HB 3NRQA 4BYHA 3BVTA 4BDVA 4N0UE 1TEGA 5HHMB 1N6QL 1MV8A 2NXYB 4FCHA 3DIDA 2ICWB 4FQCH 3NIGE 5T3ZH 4ERSH 2DJ4A 1R8EA 1YNTB 3ULUE 4K5OA 3ZZSA 2J2ZA 2ZX8A 3BWAB 5KVEL 1EZSA 4QYOA 5AB9A 2W91A 3QIUD 4DKFH 3UFIA 5D7KE 5EU4A 1NC2B 2IADA 1K73Q 2VJ0A 2Q7CA 4FMFA 4G8EB 4XBEH 4WW1A 1RK1B 2L3BA 4QKXB 3T3MF 3UZEC 1E5BA 4FG0A 3QO0B 3QIWB 2X9ZA 2EXSA 4ISVA 4AQ1B 1YAZA 3WNPA 2AJUL 2ISDA 1U92A 4NZDA 3DV4B 2YBGA 2JCWA 2WLLA 3JWDL 4N2KA 3VXRA 4WHYH 1HKLL 5FGBA 4X7CC 2LGNA 2NNAB 5AOZA 5DZLA 5TDNB 3GIVB 5CEXA 5ISZB 2PABA 5CNHA 4PWKA 5IEKB 4IRSA 5CJXA 4TVPH 2KUBA 1FNEB 5KBPA 1F97A 2P67A 3B7YA 2ZCLH 4KI5E 4F3FA 2VLME 4GS7C 1INQB 4QRRB 2VW7A 1NGPL 2EQDA 1BECA 1PZ3A 3S8GB 1AFVL 2NY4D 5B39G 5JA8B 4AJ0A 3JVGC 3Q5OA 2WSFJ 1A7OH 2V17H 1U8NA 4AZ8A 2N0MA 3VFOB 4Q97A 3MD0A 4PGEA 3ESPA 8CGTA 2HLAA 1YEJH 1ZT7A 3F6JA 4KZDH 5F7MC 1EX0A 4IMLB 3QORB 2FBJH 1CFSB 4U4BA 3D05A 1KB5H 1SPDA 4UDUB 4X6CB 1QWNA 1T1ZA 5C09B 4RQQB 4AMKH 5LGJA 3TVMD 1CFMA 1F11B 2XQ0A 4DK5A 4OIFA 1YJDH 4LEOB 3IXTA 4NEHB 1EWHA 1JWMB 2AXHA 2AV7A 4OZGB 3SKUD 2AQQA 1I8LC 5I0WA 5I28A 4DW2H 3QNZA 2H9GB 3AE7C 1LTTC 4P2RA 5EO0B 1TVHA 5JW5A 1M2OA 2XIBA 5IHZA 4ADGA 1CL7I 2JCCB 1BM7A 1QOKA 2XV0A 4OD1L 1IFHL 5IBUG 3WAKA 4ALAC 1I7RA 2X3AA 3ZUNC 4P2CG 4B53A 3BN9C 3RK2C 3QP3A 2YBRA 1N86A 4DP0X 3WN6A 5I66B 1QEXA 4I3SL 5GIRB 4FQQB 1A7NH 3Q8AA 5E2UL 3R8QA 1LP9B 4YNYA 3N1MC 4ZSOE 2QQLL 3OR6A 1SQ2N 4ZFGH 2O6PA 5IFHH 4ECNA 4GI6A 5DFAA 4X9HA 5FKPB 4YLBA 5I1LB 3O3BA 3OAUL 2EIZA 2F5BH 2R2HB 1L9SA 2X1OA 4FCAA 4IKJA 3K46A 4GQ9L 2CJUL 4V2BA 1PG7H 4ICXA 1F86A 3G04B 4GUOA 3V0VA 3P8CD 3LRSA 3QEGH 2XYBA 3OC8A 3PHSA 2J8UE 3T8XB 3AXLA 5HHPB 1FPTH 2IGLA 4WWPA 3UPAA 5IVXB 2R1XA 3VQ2C 4FTDA 1F02I 3VGEA 4HZAA 4RMWA 2P58A 5KTEH 3WU1A 2IYPA 3VI3A 1AXSA 3CC7P 1MG3C 3B56A 1OQOA 5ES4B 1K6QH 3BP7A 5E8PB 3W9EB 1W0WA 3U6RB 3BAWA 5DJUB 1OF2B 2KMWA 4JPVH 4Y4FB 1ORSB 3HG1D 4DKDC 3GJFA 5FR3A 4L75A 3A6CL 3EJZC 4HC1L 3FS9A 3MA9H 4OLZH 2D7NA 4Y7OC 4U1IB 3UPRA 5D72L 3UBXB 4UINL 3A6OA 1K5WA 1YMHB 4WKXA 3RTQB 4WI2A 4RAUA 3LKOB 1LE9A 2F68X 2K3RA 1WFIA 2J43A 3MLRL 1IO4C 1P5UA 4YE4H 1TQBC 4J3BA 1JWUB 1OGAE 3ARFD 1DSWA 1MRFL 4ZX5A 2BH0A 1ZLVH 4X7SH 1NFDE 4MNQB 3CPLB 4TQHA 3MLSL 3QR2A 3NIDB 5T3ZD 4LRIA 4Q9RL 2HKHL 3LN5B 4LBAA 4JY6B 2CPSA 4L3EA 1JVOA 3OBAA 1IC4H 1UA6L 4BQ9A 1IFIA 3SDCD 1IGJA 4U6HB 4UB0H 3MUDC 4PJXE 1DLHB 2FFDC 4OM0L 1TQVA 1MH5A 3IDNA 3TBYA 4N26A 5E1AA 5CP3A 5EUKA 5TPWH 5KBKA 1TMCB 4PJ5B 4LCYB 2NDGA 1S7VB 4JRYB 2JH2A 5D7SL 5HD8C 4N8VB 4OLXL 3ZE2F 1O5PA 1VRSA 2R7EB 3B9DA 4X98A 3HUJA 3ZR5A 3O8ZA 1KB9J 1Z9OA 4ODVL 3A6BL 2WXGA 2WO3B 5TE4L 3PHAA 3MOBL 1AANA 4GPVA 4LESA 4XPGH 5DUPL 3VGAB 4LB8A 1L0ND 5H35B 1NCUA 4X9GA 1TTBA 3H1KE 3VXUE 1JZ6A 1L0YA 5IVNA 4A7TA 1BZEA 1T2JA 4XP5L 1NU1K 2A4EA 4TSAH 1DBJL 2XQYA 1CE1L 3B2PA 3FB6A 4NDMB 4TNFA 1S7SB 4U7JA 4BZ2L 3H6PA 3CTTA 4KK6C 3ZTDC 1SMDA 2BSED 3HE4B 3SGEH 5BVJB 5I1DB 1IC5L 4JFPA 2R59A 3SQOL 3BDBA 3TM6A 2BWQA 4A67A 3BESR 3AMKA 5GRJH 1DVTA 3MLZL 5CKAA 1JY2N 1AZUA 1ZXQA 3KXDA 1PZDA 2P4AB 4G9FE 3IJ7A 1NU1E 3IMVA 4NQCB 3FU5A 3PWUB 4QY8A 1IGTB 3NVQA 4YL9A 4XNMA 2YARA 4I18B 1HHHA 1JUFA 3P0YH 5ELIA 4RRPM 4AV4A 4F2ME 2YD0A 3OKNA 4XZUA 3G71P 1N7MH 1R33A 5HYIA 2GPZA 1Q72L 4XOCA 3MJ8A 3L70E 1WEJL 3IJYB 1JTPA 3DX4A 3W11D 1Z2KA 1YECH 3R0NA 1BF8A 4WI7A 4M7LL 1UM6H 4U6TA 4ZAKD 5DQJB 5LN4A 1UWEL 1MG2C 1DBMH 3QG7L 3WTWA 1N7SC 1K8IB 5JHDB 4XNZB 1TZGL 1KBWA 3BZ4B 5C0AB 4QDGA 3AROA 5D1QE 2BS9A 2DQGL 4JN2B 2NY6D 4AM0Q 1GGYA 1L7IH 3O2DL 2EXWC 4RSYA 1MFCH 4N0UB 3QNFA 3TN0A 2B2XH 5KYXA 1AQMA 2FX7H 3VYNA 2ZT9D 1KIPB 4Z7UA 3UEQA 3NSYA 1HJCA 5J1SC 2VW4A 2G9HA 3QUXA 4CADA 4UILH 5ACMA 1TJHL 5E03A 4XNXH 2HPTA 5L0QB 4EI5A 2JVUA 1EMTH 2VABB 4NGHL 5FYJH 4LL9A 5H94B 4PJ8D 1NGZA 4G1EA 4DP2X 4GMSL 2YNYA 3SKJL 5F9OH 2IEPA 3MJWA 1D6VH 1JF1A 4Y19E 1LTBC 1MCIA 4D9RD 4X7DC 3TX4A 3HMXL 4L48A 2ZG3A 3EOTL 1GH7A 2Y3AA 4FHJA 1FL6B 2DYPB 4KKCC 1I1CA 4MAYD 4X80H 2VAAA 4XHJD 3L2LA 2O4EA 1WUNT 2CO3A 3P9MB 4N1HB 2J5LB 5K1JA 4GG6A 1TU3F 4HT1L 2YKQA 3MV9B 4Y2OB 4D7BA 1RUAH 4ALAL 2X4SA 4OQTL 2NTSP 1UM5H 3SGJC 3C09C 4Y4KA 3BUYA 2CGYA 4GKGA 2GJZB 2VDOH 1A14H 5D1ZC 3VU2A 1U8CB 4BE5A 4M1CC 5CR1A 3MLXL 1EJOH 1KXQA 4DZBB 2X5PA 2BP0A 1BF2A 1OW7A 1UWXK 3NJKA 4GG6F 4RIRA 4MD5A 2W0PA 3QDMD 4JFHD 5BXFA 3DVGB 3Q9QA 2Q8BL 2Z7WA 4AL8H 3LDBB 4P3DA 1XZ0A 2AEQH 1LP1A 4P3CH 1PGJA 1SQQE 1ZEAL 3ETBF 3O3AB 3QDJA 3JT2A 4UQAA 3ZDZF 5HYSA 1BGXH 1SXAA 2CJSA 3KWXA 3ZYZA 3G5WA 4E5XB 2KYVA 3P77A 3M17A 1Q1PA 4OCYH 2ZTBA 3GO1L 2WXJA 5IGXL 3I02A 2AKRB 4X9YA 5E1GA 1AIFB 2YO2A 1MHPL 3BO8B 3A47A 5I8CB 2IBZE 1AGBA 2EDWA 4R0LB 4G83A 4RZCB 1NOFA 1F2QA 1WZLA 2R8SH 1GYAA 3VFMA 1BX2A 2DD8H 2XWTA 4MVBC 4ENZA 5J1AB 3ULVH 2IXQA 2I60L 4YVNA 3TCLB 1K3IA 1FDLL 3O6MH 3QWNA 1F3JA 3LEXA 4A7QA 4U1GB 5DMKB 4JRFA 2AI0H 5KAFH 3HBGA 5D70L 1AGCB 2VR3A 4AIXA 4PJCE 3GZPA 2C4XA 4C4KO 5EEYA 4K5LA 2W0KA 5F1IA 1S5LX 3DRQB 5D7LD 3D6YA 1RJLA 2ITDA 4FA6A 3LEYL 4L05A 4ZDHA 1YQVH 2TSBA 4PGJA 2Y23A 2OFQA 3QS2A 1J9TA 2CPUA 4PG2C 3IFMA 5E7BA 2CUHA 1RU9L 3POHA 1CMOA 4N6QA 3B9KA 3U0WH 1EEYB 2ADGB 5HHQB 1JTHA 4NP9A 5I6PA 3DTDA 3UO1H 4P4KD 1YYLL 1SQBJ 1DVZA 4W9FC 4I1RA 3FU7A 4IGBB 3QISA 5EO9A 1S9YB 4JO8A 2X1XR 1XGPA 1BXAA 1BIIB 1P2CB 1AP2A 1EXJA 1EGJH 3C5ZD 3IRCA 3FSZA 3O41A 4HGWA 3ZE0E 1UZGA 2ZUXA 4B0MB 4EUPG 3IJ8A 4YAQB 5C08A 1OY3B 5JQHC 5CD3A 1F4XL 2X9XA 2ADFL 1Q9WA 3FRUA 4DPCX 2BCCE 4LGSB 1OB0A 1KILE 3SGEI 3GKZA 4KKNA 4DJGA 3A67H 4JO4H 2IPUG 4RMBA 1N8ZB 1E7UA 1IC2A 3QHZL 4IOFD 1YN7A 3KMDA 4HS6B 2VQ1A 2J58A 3IGUA 4IRZL 2VLJA 3SD5A 3HCVB 3KYOB 4H4NA 3WFEH 2FXMA 3KPSD 3QULB 4GAYA 4HPOH 5IF0B 4JFXB 3H1LD 2D4FA 1BIHA 4OCXH 2IALB 5CGBA 3X1EA 2X38A 2YUWA 1KCBA 5D4QA 1HWTC 2KPWA 2BP3A 3D39B 4LOFA 1OGAB 1LGVA 2OTUA 5EU5A 1TEYA 1MAML 1SJMA 3AY4A 3W2DH 2OL3A 1QFWL 1U30A 4E42A 3VFVA 3CX2A 3RFZB 2ICEC 2I07B 3ZYIA 8PAZA 5E6RB 1XXFC 6PAZA 2X2JA 1MAKA 4WUUB 5AW0B 5C2BL 2YKPA 2ITCA 3VSQA 2X4QA 4H7VA 3JV0A 3PWLA 1RHHA 2HTKD 3GGWB 4Z18A 3DJTA 4YPGB 1QVOA 3D3VE 2AVGA 2UVFA 1HYSD 3LXBA 4LLQA 1JY2P 1KIUB 3Q3GA 5T1LB 3VVWA 1JMBA 3AB0B 1ZOXA 5C7ZA 3R8BB 4LF3B 3C60B 3HE7A 4L4VE 4WEBH 2HYNA 3IFOB 2QM8A 5HP5A 4MBRA 3TV8A 4JFDE 3REVB 4HEPG 1MKFA 3LYRA 1YEFH 4CNIA 4KQ0A 4N3UA 3S1KA 5KBNC 4J3OH 1B6DA 4I0PA 3G5VA 3RWIA 1PPJG 3VFGH 5FO9B 7TAAA 3FONB 1HCZA 4ZX4A 4JCMA 4J3OG 4N90D 4HOWA 2KQMA 1UT2A 2RFXA 4C54A 2BSRA 5C0IB 5D2NB 1WPCA 3L4FA 1DQDL 3SSGA 5APYA 1T0MB 4Q9CA 4NCC1 4F9PA 3T04D 2PW1B 2X53A 2WVTA 3U4AA 2QBWA 4EZLA 1Z5LB 1CU4H 3BAKA 4L4TA 4XCYB 4G8AC 5E2VH 2I24N 1DP0A 1S5LH 5E8NA 5HDBE 4C59B 1R9FA 1XGZA 3SEPA 4JAMB 3NSXA 4ZTPH 1D6EB 3H32B 1RH8A 3SDAC 5IMMA 1HNFA 1KTKE 1T66C 2MHAB 5A16B 4IRJA 1M9WA 4JRLA 4XWGH 3VYPA 3ULVD 4LEXH 1LEIA 1I85A 2WNWA 5I17B 3VMPA 4KTGA 5IJKA 1CFTB 4JBSA 4DN4L 1VF5D 3PTZA 5B3SB 2WYZA 3PGDB 5I16B 1K8DB 4LL1A 3MRGA 4FFYL 1LTJA 2FTAA 4JPWH 5JDJA 1U8PA 1MJ7L 1QWUA 4APQB 3LVEA 1F45A 3QR1A 2BCKB 3LH2L 4JKPH 2KZJA 4H20H 3DECA 3WLWC 4XTRD 4LPXA 1MKMA 2ZUTA 2UY6A 4AYFB 4Z7OE 3OG6B 5D1QB 2XYCA 2E7CA 2COVD 1UATA 2F0CA 3PDDA 3QQ3B 2ESVB 1S7UB 4L1DA 3U9UA 4O02L 3L75E 1T3FA 4MCNA 3SBRA 3FT3A 3OX8B 1C9SA 2FQEA 4H40A 4LKCB 3MLVH 4CDHA 5JO5B 1OZHA 2A06E 3GXIA 1Q38A 4NKOA 5BZXA 1PKQA 3OLEA 4TULL 3VFNB 2QPEB 3AREA 1R3JA 1DBBH 2WMPB 4I88A 5F9WB 4HWEL 5DK3A 3DX3A 2ZCKL 3QEUB 4PJ7E 4JMXA 1JMZA 5L2KE 1P1VA 2BNQA 2HT2D 3KYNA 4Y19B 4YR6A 4UM9B 1IAMA 3ILQD 4Z7IA 4ZO7A 2CLRB 1HBWA 3MR9A 4FTVA 9CGTA 4D2NA 4OJYA 4YQXL 2WANA 3IJHA 2YMXL 1WT5C 4HK0B 4QXTA 3FXDA 3DBXB 1SQVG 3OB0K 3NACL 3QDGA 3LKNB 1TO4A 4NN7C 4FP8H 1NCGA 4K8RD 4TUJA 1Y18B 4XAWL 2VZOA 4GS7B 2P47B 2B20A 4BEIA 4BGDA 2OXHA 3UTSE 2AJZA 4XMPH 3Q44A 3K5RA 4GIAA 1FYHB 4JFQB 4J8RB 4WWKB 2KZWA 4M5YH 5DF0A 3K4ZA 1SS1A 3CLQA 5F1SA 1P1ZA 3B6SA 4YBQD 2HJLB 3QWOA 3O3DB 3BH8A 2D3VA 2N56A 4KU1A 3UDWC 3IJSA 4G11A 4AYSA 3TYYA 1TTCA 1ZKAA 3WFDH 1VLXA 1XEDA 5FDYA 4YHIB 3RWHA 4TNEA 5L2JB 4EYYQ 1WGVA 1Q0XH 5KTBA 3A0HE 1QEWA 2YPKA 1G0DA 2XU9A 4IIQB 4RDQF 4JFZH 2RMNA 3PUCA 3QUYC 5E5RB 1DUZB 4HJ0D 3GSOB 4XP6L 5G4MA 4WNQB 1UOVA 2VLRB 1UUNA 4MLIA 3S35H 2BSTA 3Q6FA 3P02A 4XNQB 1UGKA 2QQKH 3BCCE 2UZYB 2X6MA 3GSVA 4HDIB 3S3BB 1HHGA 5L88L 2BHZA 3BIAX 3RK2B 4K73A 4E9WA 1QBBA 2R9HC 2OK0H 3DUSB 4LVEA 3CH8A 4PBDA 2F7QA 4NRYA 1MWAL 1AJYA 1DJHA 3AT0A 5E6YA 2VXUH 2B87A 2IMNA 2XWJA 4QAMB 1CC3A 3T3PF 3UTZA 3FT2B 1HDMA 1OB1A 2WTRA 2X89D 4TN9A 1R5WB 1U3NA 4PYGA 2VXTH 3QUML 1DH3A 2WNGA 4J1UA 3T2PA 4OFQA 5DJXA 4PD4H 3V4LA 1PDKA 2ORBH 4N3TA 1FNGB 4WUKH 1JYWA 4NAJA 4ZUSA 1RZIB 3HC3L 2V5YA 5CSBA 1MIMH 5E08H 1L4AC 4HWBA 3I9GL 5E9DB 2LLGA 3FQTA 3IWVA 4PLJC 5AWNL 3L3DB 3COOA 1NZRA 2XPGB 3ARRA 4ACPA 4NZFA 3SIKA 4BFBD 2WKLA 3WE6B 1AGEB 1LO0L 1I3RB 2AZAA 2DDQH 4XNYH 4RMRA 1SOSA 2UUDK 3TJHD 1TQTA 1MNUL 2HFED 2ZOUA 3GMQB 3V0FA 4NFBA 1KILB 3QUZA 4P46A 1OAQL 1JXDA 1MZ9A 4QMAA 1T22B 4N2GA 3CDFA 2FZ3A 1CFVL 2XT1B 1OXYA 3FF8A 3FU8A 1T5XA 1P7QB 1ZK9A 3VJ6A 4RLDA 1BZOA 3S3PA 4QNPE 3II3A 4YWGH 5EDSA 1A1MA 4X5RA 2DLFL 4J23A 2Y7LA 3VA2C 2J72A 4OIBA 3UBXG 4M4RA 5EZJB 5HGDA 4FYTA 4GRWB 1BFOB 5C39A 3LPGA 1OAKH 2NUTB 3MBWA 3UC0L 3CHXA 4MFHA 2I9LB 5HHMD 2NXYD 5D7IE 1OOWA 2AJXL 3B8EB 4IS6B 1KXVC 4NIKB 2VKXA 3BE1H 3C6SA 1FFPB 5FV2A 3FN0L 3MX0A 2DQDL 4UNIA 4KZEL 2AK1H 1GYCA 1JIBA 2A1WH 2V2WA 2ZXWB 3VU1A 5F88A 4G6FB 3B2XA 3DMMD 2FFDB 2WBJB 4OLUH 5HYQB 3D2UA 2I9TA 1IAIM 1KENH 3HZKB 3I3DA 4PRNB 1DVQA 3BZDA 4P59H 4ZPVB 5HI3C 1AHWA 3WFZA 3LB6C 5DD5L 4Z7NE 4OFIA 4ZOBA 4FKKA 3QFDA 2ICWI 3QIWD 1Q9KB 5IWLA 4U05A 3FUJA 4GBXC 4N9GA 4PS7A 3FQNA 1LMIA 1MCEA 4TUOA 5I5MA 3UJTH 3TA3A 4N8VG 1N2RB 2K45A 3Q48A 4YDMA 2I85A 1BD2D 1MRDH 4E41E 4ADJA 3BPLC 4L8CA 1JWSA 2MOGA 4DUVA 4HKZA 4KVNL 4ZW5A 2WAQA 2G8YA 2Z8SA 3LZQA 3CVDA 1AXIB 1R1CA 4XFJA 1KXTA 3ML8A 1RVFL 5A7EA 3LZOA 1ITBB 3CDZB 1GS7A 3KPRA 4OY9A 4QRQB 4WK2B 3DYPA 5IW1A 4M3JA 5L7XH 1G9EA 4PJBA 1PX4A 5GZNA 2FWSA 4ZS7H 4BSVB 1CFQB 4IDLA 3D50A 4FQHB 5CCGE 5I5IA 4DVRH 1CYGA 4FNLH 4UU9A 3O8XB 3F7VA 1A7RL 4QTIL 3W0WE 3WUWB 3CPUA 4M61B 3S96A 1HL9A 2HFFA 2WJ5A 3H9HB 4JHZA 1N4XL 4PW9A 5DYOA 1F1AA 1ZGLB 2DS4A 2V2XA 3W38A 2XTJC 2XOTA 4RGMC 2FYUD 2O5YH 4P06A 1KQLA 2N1TA 3HPJA 2PO6A 1IV8A 5F6IB 2W6AA 3CC2P 3PV6B 2CH8A 1OW0A 4Z0BL 5HDBB 3ZK0A 1QVGO 5F1KC 3HFFA 2CSPA 3WFBL 2ZYRA 3ARBB 3KPMB 2P9RA 2A9ML 5HHOB 4UTAA 1ZA6A 4FQ1H 3OF6A 3B5HA 4GODA 4NWTH 2FO8A 2HT4C 5FYLD 3Q2YA 3TBSB 3T9WA 1V7ML 4UZSA 5ACLA 4OV5B 5D7JA 3ULSA 1ACZA 1T5WB 2EH7H 1EAQA 4BFIA 4LSPH 1DZBA 3LRGA 2YUVA 4J3UA 1KY6A 2X4UB 5LQBH 2VR5A 2J3SA 1U7MA 1XX9C 3LKSA 4DHLA 1D7MA 1T7WA 1KJ3H 5BVZA 2CHNA 2YEVB 3J2PA 3PYCA 1UJTA 3ZZLA 1Z1WA 4GB9A 4BFEA 4Z23A 2IG2H 3ZRFC 4OLEA 5I1IL 2NY5H 4MJ6A 2WGNB 3OSVA 4U1JA 2KSEA 1W2EA 4LP4A 1A25A 5AUMB 1VKXA 4DZOA 4I48B 5IQNA 1IKNC 2ZSVA 5A2KH 4HEME 5JMRA 1A5FL 3ULUH 4M1GH 2V2TA 1KIRB 1T80A 3FTYA 3G3LA 3L4ZA 4HSQA 4OD3H 3TDKA 2WXLA 2OA9A 5GRXG 4Q2ZA 4MJ5A 1I3GH 1VADA 5M1BA 3QJFB 1X5KA 1IAKA 1UVQA 4ZZKA 4WBAA 3ATBA 1I75A 1AGFB 4PJ7B 3NT0A 2JIXB 4EOTA 1EDHA 3CZGA 4AITA 4DNLA 5L2KB 1CTNA 2IH1A 1XCTB 5CLYA 4NFCA 3SBQA 1X9UA 4F9LA 2QPDB 2YPLA 5J0BA 4PD4I 2WQXA 2I1JA 5F1NB 1MOEA 3F7QA 4F27A 3RP1A 2XUWA 5EU6A 3SFEC 3C09B 3EWKA 3NP3A 5HYJA 2VE6B 3RDTB 1TQUA 5BV7B 4FADA 2KZIA 4UYPA 1ZRTD 2F1EA 3RTQD 1DDHA 3TT1L 4OH8B 1N6QH 3H56A 3CXFA 3MRNA 1NKOA 3U9PL 2MKVA 5H2FE 3EYFA 3D0VB 2R5DA 2AQ2A 3UTSB 3ARSA 2FY8A 3FQXB 3UTTD 3L73E 4Z7NF 1W2BO 1NGWB 3FUKA 4OVVA 5I6LA 2ZWNA 5AG9A 2YK1L 3IS0X 3W9DA 5K9KA 3SY0A 2WYIA 2XNAB 3G5XA 4IRSC 5ESQA 3UBXI 1P4BL 4XVUC 2BNRA 2OTPA 3EH1A 1SRDA 2E59A 4XVOA 5D1XA 5DJ8B 4CU6A 2A6DB 4MXQC 2KHAA 1ROWA 3A5TA 1EAPB 1VFUA 4JX0A 4MD0B 4PQXA 4W9IC 4OIIH 5DJCA 3U4EB 3WELA 4F8NA 1IFJA 1GJUA 3DOIA 3H1LJ 1C7SA 4FQLL 2L8AA 1U8QA 3HZMA 3U7WH 3PGFL 4PMEA 3HZYB 2R2BB 3NZHH 3RU8L 1U8HB 3D18B 3EFFA 2GEEA 1KTLB 1FL5A 5BS0A 1P7KB 4BXSV 4CC0A 1M7UA 4WWIA 5DU7A 4APXA 2CKBL 1JXFA 2GUYA 3JBG7 1RP9A 2WKOA 5GGRA 5ICZB 4G6ML 3IDJA 3V4PB 2EDOA 4QRPB 1JYNA 4WHCA 1NGPH 1SF3A 3RWFA 3QEQD 1URQA 2L04A 3FKUS 3ZKSD 1AFVH 3ESMA 2WSCH 1N73A 3OWEA 4BSJA 5EZOL 4JG5A 1HCYA 1KPUA 3GSUA 4MSWA 4UQ3A 3WO4C 1GYVA 2JQZA 2WKOF 3QIBA 3T2NH 2SEBA 4ZUWA 4OB5L 1UYWH 5I1KL 5IFAL 2W60B 5JUEH 1WAAE 1Y07A 3L5WA 3EO1B 2EVHA 2G3XA 5ITFA 1B9ZA 2ARWA 2WQSA 5AAPA 4FQXB 5I75B 2NSQA 2C4FT 2IFMA 2PXYD 4X4YA 3SZKC 4PJDE 3M9HA 4NQCD 2J55A 1CFNB 5SX5K 3EJSA 2ZXCA 1QPXA 4ICWA 2V4HA 4IBLT 5AB0A 1I8AA 1G2CA 3B2UD 4M29A 4OD1H 2NQCA 3PUUA 3LD8B 5DZVA 5F97E 5KBMA 4PV9B 1E9PA 2XWXA 3AE6C 2XZAL 4S0TD 4ZODA 3BIKA 5D4IA 2QDVA 2AJ3A 5GGRY 3CXHK 2IC2A 5MP6L 1MWAB 3OLGA 1UD8A 4ZMWA 3GDBA 2IIJA 2YGOA 5FYKE 1NCOA 4MZRA 5E2UH 4FYRA 2Q76B 1UJ3A 1BOGA 2YA0A 3VD7A 2FLBT 3VOPA 2IFNA 5DQ9B 1MFUA 5KAQF 2D8KA 4BUGA 3QUMB 5ID1A 3DKHA 3GF7A 2Z92A 1AH1A 1CDIA 5D7IB 4GQ9H 2V7NB 2CJUH 2DMKA 2VO8A 1EFXB 3C8KA 3SYQA 1C16B 4AT6A 4XVSL 4MMXB 4YSTA 1GZQA 1U41A 1E4XL 3CXHE 4HHAA 1KLUA 4N2BA 3JV4B 3DVFA 2NSMA 3WBDA 1O9WA 3QJUB 4ZMNA 2AXCA 4QTFA 3UBHA 1UASA 2A6IB 3P4NA 4I5BA 4P4RB 3S8WA 4HUXB 1YI2P 4F7CB 5T8IA 4HJIA 5GGVL 2R69A 4AZUA 4LRIC 1DUYB 3PLNA 3ARGA 3FHEA 4DP9X 4MJIE 3R19A 4HC1H 1FHNA 5L4IA 3PHOA 5D72H 1N0LA 4UINH 4AY0A 4F8TA 4H5SA 4NUJA 2Z31D 1AE6H 1QA9A 3MV9D 3UYRL 2JLPA 1JF6A 4E41B 2LXCB 5C0NC 3B1TA 2EEXA 1U2HA 1B0RB 1MRFH 3RHWF 2IBZX 3OB8A 1WTGT 1E27B 2R1YB 4UOW0 3S4SA 1YYCA 5ALCH 3H1KG 5KJ4A 2A5UA 3K6DA 2HKHH 4YX2L 1W5CE 2DJUA 2E74B 4GW5B 3BLKA 1BG9A 1TETL 1NBZB 4NQSA 3H1HD 2Q20A 4QWWD 1KACB 3X1FA 4YSUA 2A0LC 3PXHA 4OBSA 2WQVA 1VESA 1TU2A 4XC3L 1BQRA 1MXGA 1P84D 1HEZB 3BVXA 3F3HA 3HE6C 4PS4L 4JFFA 5IK3A 2VQ4A 4WU7B 5HHXL 1FYTD 2L4OA 1Q0YH 3ABKB 1KCVH 4ZOEA 1V7NH 1UUSA 1PF3A 3OVUB 5ECGA 1IT9L 4R5VA 3UTQA 2FYYB 1INEL 1GYUA 3OKKB 4MYPA 4ODVH 3E8VA 3T77A 5SWSD 1NU1G 4FZEL 3SQRA 2WZ6A 3RVVD 4C56A 3MOBH 5JXAL 1T0NA 4LPWA 1EA9C 5D7HA 1NMBH 3DC0A 1DL7L 1BJ1H 3CSBA 1LE5A 3PP3K 3TGXA 3HC4H 1HQRB 5AOLA 5JPNA 3RY5A 1DBJH 3L70G 3MBXH 1K5NB 1CE1H 1WC7B 1UH3A 3VGDA 3NK4A 3GM8A 5FKAA 3CUPA 1JTTA 5DK2A 1HCFX 4ELMB 4EIBA 1MAJA 1XBRA 4HJGB 4OZIE 4CSPA 5KLVK 3JWOC 1BDYA 5DJ6A 3RVUD 1NSNH 1IC5H 4O4YL 1KSRA 1IEBB 3SJVD 1U8OB 1V8HA 1F6LL 4L1BA 1JD7A 3MLZH 3ALXA 4KOCA 4D0CA 4DT0A 3FQRA 3NFPB 1XCQB 4M03A 1GZLA 4N9OB 4F7TA 3I3BA 5B38G 3W68A 2YAMA 2F2HA 3GBEA 1XEUA 1EEZB 2WD0A 3KXFA 4X0NA 2HMIC 3KCPB 5ESAB 4JK0D 1AAJA 4HGKC 3F7YB 3KBHE 3TN0C 3RWCB 4XB7A 1SVCP 3V7MA 2EDXA 5BOZG 1TPXC 1Q72H 5KLVE 1E67A 4ZQKB 5H37A 3D85B 3CMOH 3P3SA 1NYHA 4U1MA 1WEJH 4BK4A 1VQ6P 3L5HA 4EIUA 3W39B 1FZJA 1EZVE 5J11C 2FBRA 2Z91A 4RKUJ 4JJHA 2HSIA 3JV4A 1IVTA 3IDGB 2E43A 3G5ZB 4GIOA 4NN7B 1X9LA 3QG7H 3FPXA 5JQIB 2ZG1A 4R4FH 3C2SA 4ZI8A 2A73B 3O2DH 5ANMB 3TGUE 1EDIA 1NAKL 5IROD 4ZQTA 4Z6AT 4NHUA 1X5XA 3KR3H 4ANVA 3T4YB 1NWPA 3D39D 2KS1B 5KJ7A 2ZP0T 3QCTL 1BQ5A 4FL4B 4KITB 3I50L 3V0HA 4IQHA 1SDDA 4NGHH 1QLEH 5FB8B 1SFCB 1D5XB 4DPRA 3L4YA 1LVEA 4U6YB 1R3IH 1OSPL 1Z5YD 2GT9A 2A77L 2OJZH 4ORGB 4UMGA 3SKJH 4WUUD 3WL9B 4DKEL 4WFGD 3K71B 3VFUA 1AZZC 2Z0UA 4Y1AE 1SVBA 1NBYB 2RTTA 4G8GD 3HMXH 3WN5B 4B9JA 3CZFB 3QXWA 1BBJB 3W56A 2A9CA 2G3AA 4MB4A 1SJHB 3Q5YA 5TD4A 2LQRA 1ZLWK 2BC4B 2HVKA 2FWOB 5C86A 3TPUB 2R3SA 3QUKB 2H7HA 4DO4A 1DQKA 3GBNL 5EA0H 2IBZG 1SXBA 2IJ0C 2ICWJ 4ALAH 1JK9B 1AKJA 1F4AA 4OQTH 2ZNWA 3ARTA 2VDRL 1SUHA 2J5WA 5CUSH 2H6PA 5DJAB 1JGUH 5FCSH 1E4HA 3HHMA 1WH0A 3R1GH 3MLXH 4RZKA 1GSMA 2WZPA 4L8SC 1LD9A 4Q6YA 4AUUA 5DSCA 1TQCC 2NY2C 1N0XL 4HYTB 3AEEC 5E8OB 2X70B 5FK9B 1RURL 3BFOA 3MKKA 4BKLA 2YXQB 2BVTA 3TFKD 2ZXBA 2YSSB 2Q9IA 4CRPA 3VD0A 1VGEL 1FBIH 3HHSA 2K1MA 4W9LC 2G0KA 1P4IL 1H3GA 3TF4A 3LQZA 2BY2A 4YO0B 4DKAA 1SQVJ 4WSKA 5HHVH 1E5ZA 3MAWA 1BYPA 2AGJL 3VMNA 3GO1H 5IGXH 2X4PB 5B66H 3EJYC 4HBCL 3WDIA 3AS1A 4B97A 3NN8B 1QYGL 2DWEB 1NEUA 1I31A 3MKGA 4WO4B 4HXBH 1ITCA 3M0DA 4YIQA 4F2FA 3T1FB 1A3LH 4LL4A 2CO6A 4UV4H 5KSBE 2HPCA 2ZFCA 4W70A 1J0JA 1DE4A 2CKBB 3UERA 5A6LA 3P3TA 1G4RA 4NM4H 3X11B 5FDWA 3VCLB 4JHAL 1YC7A 2CK0L 1IQDA 2BCCG 2FX8L 5DXWA 2H89C 3VG9B 4ENED 4B5ZA 2Q1EA 3IDXH 2E7BA 3FAWA 4PJEB 3N41F 4XN8A 4ZBJA 2X9WA 3ARQA 4KUCF 3TIEB 5KW9L 2WZ0A 2VH5H 4P2QE 1W0VA 3IKKA 1IC7L 1KGXA 2ZPKL 2O5XL 3GG2A 1BZ7A 2NW3B 3CFKA 3PAYA 2MCG1 2OSLB 4URKA 3MYJA 4N0FB 2ESVD 1YYLH 2GK0B 2ZCZA 1E3ZA 2VKWA 3ABZA 1NBQA 4KRPC 5BUPA 2AHIA 5ILTL 1IFGA 2ZKMX 3FAXA 3K2KA 2EVJA 4R7NB 4IU3A 3VB8A 3BUDA 4RWYL 2JB5L 2NX5B 2Z4EA 3G3ZA 2ZUWA 1HH6B 3V2NA 3M7FB 3MZGB 3X12A 2AJVL 4MQXD 5JORA 2XETA 1UCBH 3AAZA 3QFGA 4HIXL 4MAUH 3EH5B 2VWEC 2YEQA 3O2VL 4KX7A 4XN9A 3AY4C 3V9CA 3AEBC 1IBGL 1FH2A 4GBXB 4UM9D 3QHZH 3V4UL 4OT1H 4O2EA 3D1MC 4IRZH 3CN3A 4A04A 3VFRA 2EABA 4ZAKA 1J8RA 2YZ1A 3K80A 4GRMA 4KTYA 3EYVA 5EFWB 2ZNXA 1TZAA 3IU4L 1U58B 3QQDA 4KXBA 1JUNA 4NQXA 3FQWB 3VSTA 1UGNA 3N1QC 3HPLB 3V0IA 4F8OA 1BJMA 4CU8A 1CZQA 1FAKT 1URZA 3MODH 1NEZA 4M43L 4PD4J 4HJEA 4ZMPA 4GFXA 5BRZD 1CLZL 3HUJE 1EZVY 4XT1C 1I1AC 3RPBA 1HNGA 5D93C 3KE0A 3B3BA 1MAMH 2D4DA 3WTXA 1DN0B 1RLWA 1XF4A 2VMJA 5FWRA 1QFWH 1PGQA 3VXTA 2WT7B 1ZVNA 3JWOL 3HE7C 2F9BT 4WWKD 3CH1B 3D70A 1G7LA 1S3KL 2IBGA 2XN9A 1CCZA 1O7SA 1Q94A 2AF2A 3GMAA 1WBXB 2J4WL 5C2BH 5KN5A 4I0PC 1AIZA 2Y72A