3A3YB

Crystal structure of the sodium-potassium pump with bound potassium and ouabain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
278
structure length
265
Chain Sequence
b'RTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEQLQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Crystal structure of the sodium-potassium pump (Na+,K+-ATPase) with bound potassium and ouabain.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 54
structure length 265
sequence length 278
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3a3yB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 3a3yB02
3NFQA 4GT1A 2R5DA 1H88A 1GTWA 1S9KE 4RESB 3SWFA 1HUCA 1FAVA 3NXSA 3I5CA 3A5TA 3MD0A 1T2KD 2C9NY 3VMZA 2R5BA 4C7NA 1GZLA 2H7HA 5AVTB 3M91A 3OAKA 3KDPB 1KQLA 3KQGA 4AUWA 1H89A 3WGUB 3L35A 1SLQA 2JJLA 2WT7A 3TNUA 5AVSB 3VMXA 5APUA 5AVWB 3P7KA 1A02J 4B86A 2QM8A 5AW0B 1OWAA 2ZXEB 3A7OA 5AW5B 3L37A 3LIEA 1JNMA 2Z5IA 1FOSE 2P2UA 1FOSF 1CI6A 2VRSA 3IR9A 3NMDA 1CSBA 2YO2A 4AQRD 2WWWA 2XV5A 2WTYA 1H8AA 3MGNA 1X8YA 5CMZA 3O8ZA 5AW4B 5AW2B 5APWA 4KHXA 2W27A 5AW6B 3HE4B 5APVA 5AW9B 3VTPC 5APYA 5APTA 5AVZB 4JYBA 5APQA 5AVQB 5AW1B 3TK1A 4DZOA 3P8MC 1S9KD 4HYTB 1NWQA 2Q5UA 5AW7B 1DH3A 3HE5A 1GK4A 2R3CA 4EOTA 5APSA 1MV8A 2N9BA 2Q3IA 2P67A 3B8EB 4I2LC 4I6MC 4C7NB 3VYIA 3M06A 2XU6A 1GU5A 3VN0A 2E42A 3V5BA 1HBWA 3L36A 1IO4A 2WT7B 3M0AA 3TNUB 3M9BA 5AW3B 1GK6A 1OXZA 1J2JB 2P7JA 2QM7A 3UIAA 5AVRB 2BASA 3WGVB 2WPQA 3V4WA 2E43A 2YO3A 3HTKA 5APXA 1GU4A 5AVYB 3VMYA 3P32A 1SP4A 5AVVB 2WPRA 5AW8B 3TYYA 4C46A 2IPPA 1NAFA 3A2AA 2KP8A 1HJBA 1CI6B 4GKGA 4XE5B 3NTNA 2XZRA 1GD2E 1MFZA 1A02F 4JYCA 2ZFCA 2Z5HA 2YNYA 3A3YB 4RETB 1T2KC 2C9LY 3V4QA 2Q7CA 2R32A 4AYCA 3M9HA 2W6AA 1CZQA 1JUNA 4M3LA 5AVXB 1HWTC 3T97A 1MUUA 1YYCA 1G2CB 3HE5B 3HE4A 5AVUB 3LIDA 3M0DA 4LC1A 2WPSA
chains in the Genus database with same CATH superfamily
1L4AC 2IADA 1M1SA 1RPKA 5IHWA 1JYXA 1NDGA 2VN7A 3C6SA 2Q20A 5IVOA 1NKGA 2X3AA 4ZAKD 4M61A 2EEDA 4MCZA 3ZVVA 3PNRB 1AGFA 2UZYA 2IH1B 4NZJA 4FG2A 4X5WB 3TGUG 3KS0J 2OS7A 4QPEA 4HLEA 2JCCB 1PF3A 5T1KD 5I73B 3ZKXB 5EUOE 4J28A 2L4OA 1S46A 5L4MA 3BUTA 4MNQE 5D8JH 3ARED 2D31A 4K9EH 1JV2B 3MJ8A 5DRZB 1BSNA 3TH2T 1MG3C 4YHMH 3UCRA 2FIKB 1G6RB 4L0ZA 1MZ9A 2IDQA 2C7FA 1UCBL 1U8IB 5AFAA 2M0BA 3QXWA 5D5MF 3WLWD 3ARBB 3LRHA 2BNQE 4IOFD 3VFPB 4I2XB 4JHUA 4JKMA 3VD3A 5TK4A 2HP4A 5JPNB 1SFCD 4JFFB 3HE7C 1ZLWH 5FHAH 5E2JA 1D5BA 2WTYA 2WW8A 3IT8D 4HOMA 1SYVB 2WQAA 3L1OL 3RIKA 2GSIB 3KD4A 4QEGA 2QVFB 2XTJC 3FRPG 3MNMA 4JFSA 1KN4L 3CPLA 3G9AB 4HS6A 4MS6A 4P57A 3QUKB 2FVNA 5I1JH 4BELD 5IVNA 1BD2B 2NSMA 3O4LB 3E8UL 3DJRA 4JFQA 4R4MA 4ZRGA 2YPLB 2AQQA 2E7DA 2W60A 1G84A 3KYMB 4MA1C 4DSYA 4EIJA 1SJEA 4JDEB 3H9SD 3LKSA 1SEQH 2RMZA 1YJNP 4DKTA 1KXHA 1MCOL 1OZTG 2R27A 4LF3B 4R4BA 1KTLA 3ALXA 3F7YB 1IAMA 1LILA 2Y07H 2YRZA 3NPZB 4GJTB 2V0AA 4P06A 4QRAA 5IROC 4TVSa 2FWUA 2XZZA 2PO6D 4XPFH 2O93L 1K8AQ 1E4KC 4WU5B 1JWSB 2EYTA 2NY2D 2OTWB 2YMXH 4FQCH 5C97A 4RISL 4DGUA 1U6AL 1WV7T 3L75J 3K6SB 4Q9CA 3A4AA 5IP4A 3HI6L 1PV3A 4M7LL 1KYFA 1YSOA 2JIXB 3DMMD 3PIQB 1GGIH 3MBEA 4XOEA 1JCCA 4AZ8A 4PJHA 4PJ8C 5EPMB 3W57A 4GAGL 4AIZB 5AW8B 5JHBA 1OOAA 4N78D 2WSPA 4JLRA 3RY6C 3FO1A 1P2CB 2PKDA 2VO8A 5J89A 5EZLA 2Z1KA 3VFRA 3KMDA 1JVOA 1E3XA 3FHAA 1PAZA 2NQCA 3BHBA 5EOCL 1IZNB 2VW6A 4OB5H 3HHMA 2KZWA 1C7SA 2MQ3A 1BCIA 4FG4A 5KJ7C 4OU3A 3WJMB 1CU4H 1OW8A 4AL8H 1WBYB 4PLJD 5KVEH 4R7NB 4HIIA 2NY4D 1BBDL 5GGTA 4TSAL 3ARVA 3VI3B 3BP7A 1MUUA 3BPLB 4CMHC 3DGCR 5BUGA 3IBEA 2C9PA 3MV7B 1G9ML 4FCHA 2MOQA 3L17A 3WFDH 1HHGB 5IMKB 1X5XA 4PJEE 1DUYA 1XF5A 2WO3B 1JN6B 3VFWA 3S8FB 2H8PA 1QRNE 2OTUB 3CU1A 2LE9A 1VHPA 1BVLA 4GKSA 4GQRA 3TBYA 5AYQA 3TOPA 3D6GA 4UT7H 4R7XA 1L0LG 2H1PL 5IBTH 5IB1B 5F21B 2VM9A 3ZE1F 2JWAA 1QNZH 1S7XB 5I1HH 2FX7H 5ILTH 3UTTD 1ZS8A 3RL1B 1XH0A 1LDPH 4K55A 4BFNA 4CC1A 3IJYB 3LRKA 4KU1A 8FABA 1H0DB 4HJTA 3DHJA 1UM6L 4OT1H 1D7MA 4PLNC 5KBMA 3S98A 1KPVB 4HOZA 4WV1C 2GSGA 5K9QI 3P8CE 4X6CB 2M26A 2Q86B 1AFVL 1T7ZA 1BSIA 4X4KA 5DUMH 2VR8A 2DQEL 2ZKMX 4WJ5A 4D8PA 5MEND 3DC0A 1KT2A 4OZIE 4QMEA 4Z3EA 2BS9A 2OCJA 1O7DE 1A47A 4LCCA 1GZPA 1T03L 5CR8A 1SUHA 4JS7A 3JXAA 5D5MA 2O01J 4DEUA 4OCWH 4HU8A 4GO9A 4Z7OE 2VDMH 1U7JA 2O5XH 4M48L 1F11A 2H5UA 3WEBA 3G5ZA 1SQXG 1VQ5P 2A4CA 2WZ6A 1Z5HA 1OQXA 2VN5A 3C9NB 3TBWB 3OB0K 1TENA 5D1QB 1H6UA 2ZJSL 4PSRA 1MW0A 1OEZW 2EO9A 4OF5A 2P80A 4NLHA 4DN3L 3AS1A 4V1DA 2WBKA 2CK2A 2WZ7A 3GS4A 5EO9A 1FNHA 2R69A 1JD7A 5LN4A 1IIKA 5EBLB 3VH8A 4NNPL 3USSA 1JPTH 4DEWA 3DK2A 1UXLA 3V5DB 1IT9L 1H6EA 2YA1A 2LTQC 5C0JB 5I1KH 4WFFD 1J9SA 2YEZA 3QWOB 3A0HH 3H1KD 2DMKA 1UXWB 3DJZA 5EIIG 4XNBA 2X41A 1D5MA 2UZXB 3CC1A 3CVHB 4I0PD 1YJDC 3X1GA 2N7AA 1QLED 1ZLEA 1QLRA 5IB3B 3VFGL 3W2DH 5L2KD 4Z3IA 2HFGH 2AITA 3BE1L 1A4AA 2RFXB 3E6FB 4L3EB 5DMKB 3ZDXF 3QI9A 1C1EL 1FZGA 1QR1A 3QUYC 4OI7A 1YAIA 3EO1B 2YPVH 1XTLA 5K59E 1B4JL 4FLRA 4ZMTA 1PLGH 3EOTH 1EX0A 4MGXA 3F6JA 5HHOA 3M46A 4UI2A 4XNZC 5C6TH 5T1DL 5EA0H 4HWEH 3D12B 1OM9A 3RVWC 1HX0A 4JJ5A 1FLRH 4W4OC 3BCDA 2EADA 3ZK0A 5HBBA 2IXQB 4PV8A 3KPSA 3NN8B 4KMQA 5IESH 4J3OF 3K74B 4HWZB 5C8JA 1H5BA 2BP0A 3EGDB 4P9HH 3MTRA 3QRFM 2J1WA 4ZD3L 5DQDH 4XXDB 5I0DA 1A1NA 2XZQH 1XAUA 2CRMA 3SOBL 5DO2D 1CD9B 2CDGA 2QKIC 1E67A 2NZ2A 4H44B 2O5YH 2XRAH 1YTZT 1L0NG 3V6IA 2OR9L 3GZQA 3MZGB 4HK3J 3DUUB 1MJ8H 3I3BA 3L1EA 3IBOA 5HI4C 3T5WA 4ODSH 1T0NB 4G9FD 1ZT4B 2EAEA 3WIHL 5E6ZA 3IAQA 3B5NC 3NG5A 4HAKA 4PRAA 4B86A 1T2QL 2EQDA 4NO3B 4RWYH 1IGFH 3ABLB 4JPSA 3EFFA 1MNUL 2X4QA 3B9VA 4MKTA 3HBPA 2ZXGA 1KJVB 1TZIA 3EJJX 3ES6A 4LOEA 3KG5A 3O3BB 4PRHE 2JO1A 5I8KH 2EH8L 3PJNA 4GKZB 3NJVA 2XV5A 2CHDA 4M56A 4JMNA 4RFOL 2KHAA 5D7LB 3OZKA 3I6GB 5MEQB 1M6OA 1E42A 2B2XL 3DXAB 4F8LA 4JFZH 1JZGA 2K70A 3L9RA 4LHUG 4IFDK 1LTJB 3EO0A 3MNVB 2A99A 4DKFL 3MLVL 1T4KA 2V33A 4K7PY 4K23H 3TVMA 4MD5A 4BM7A 2F19H 3OHXB 5C6PB 4F9LA 3VRIB 4ODTL 3L74E 1CD1A 2HT4C 2EUXA 1NJ9A 2WYTA 2EINB 3P0YH 3RGBA 4PWIA 3A4FA 2XJKA 4R2GD 2R0LH 2E74B 5HGGS 1KILC 3RGUA 1HNGA 4IKLA 1DSYA 3V0WL 2YD9A 4HPOH 4PVLA 4F7MB 1T1YA 2PUQT 4RA0C 3HNVH 4RDQF 2QGBA 2ZCLL 4NOFA 5T5NF 3TPUA 1EQWA 3N04A 2CHNA 1EAQA 3RWIB 4HVBA 3DV4A 2NPLX 2VMEA 4EI5C 4BFKA 3DV6B 5J6SA 2DQMA 4FZ8H 1QHOA 4AK2A 4HIHB 4Y4HA 2GITA 2VQ1B 3MDJA 3N44B 4XCFH 4XBPB 2B1HH 4BH7B 2AEWA 4U3FE 5BPPA 5FUCE 4NCC1 4ONOA 4D2NA 1TTBA 2Q7CA 3ETBF 3BUQA 4OCLC 4ZK8A 5ADPL 3NABH 5DHYA 2WZ0A 3HBZA 4YDIL 2ZCHL 3RWJB 4LFHG 3O3EB 1ILUA 2SPZA 3II6A 4OSUH 4WY7L 1BAWA 1H8LA 1OAQH 2BX5A 4U1NA 5HHPB 4P49A 4YGVB 5G4MA 4KI5C 3MLXL 4NAMA 1YUHA 2KZ1B 3CDFA 5I5MA 1O5PA 1FGVH 5B66H 2WVRA 4K0OA 2PLTA 1AZCA 1EEZA 5KANI 2X4SB 2HFFB 1VERA 1EZVY 4WLCA 3T97B 1KCVL 1AIZA 2CPSA 1FFPB 2ITDA 1EZVE 3MODL 4M5ZL 3U4BL 3DETC 4A6YH 1U8NB 4GKLA 2QJKB 1BM7A 5IZ7A 1JRHI 5D4HA 1FPTL 1I9RH 3OL2A 5JW4N 3LIUA 3QZOA 4XBGA 2XHNA 4M7KH 5DMIL 1YG9A 3BGFB 3JWDC 4DGYH 3CSBA 5HGBB 3CUPA 4XNDA 4QOKA 2EDKA 1E5BA 3QULA 4KK6D 4PJCF 4TL4A 3IFNH 3VRJB 4CU8A 5GRVK 5D2NB 3BVXA 2JKNA 5BO1H 1DVFA 2O26U 5C9JA 4W68A 2VLME 5B1KA 1P7KB 5G4OA 1MFAH 3ECQA 5DFVC 1TDQA 2GHWB 1QSFB 1ZP0C 3CHPA 1ORSB 3SCMC 2VSKB 4KWUA 4PJDF 4AKOA 4JQXA 3HE6C 4ANXA 2AAVA 1EZUA 1VFAB 2A9CA 2ADIB 5DF0A 4UT6H 2W9DL 4N0UB 3V95A 1AS7A 5D70L 3TT3H 3QHFL 2P5ED 3LXCA 2FFDA 4Z1MH 1HINL 5EO1B 1V7MH 4KHXH 3FFCB 1EFQA 4LCYA 3WFCL 3H0TA 5BS0A 2NLJA 3BVDB 1KMGA 1A2YA 2JK5B 1HXMB 1YHQP 1SQVE 4P2RE 2E42A 4P5TA 3HS9A 5CF3A 3ECUA 5E94A 1KSRA 3POHA 4G6AC 1Z3GH 4LAQH 4Z7WB 2QSVA 3CLWA 1J2JB 3RWFA 3TH4T 4ZMXA 4QRRB 1OD9A 5FB8A 1IEHA 1KGCD 4GEJA 3QH3B 1J05B 4BFRA 4YBLC 2A7BA 5FK9B 3BFQG 4O51B 1KB5H 2CA3A 2VN4A 1LTBC 1U36A 1R0AL 2B4CL 3HG3A 1J87A 4G8GA 3SQBB 3N1PC 5BOZG 2UYLA 1CTNA 2IDCA 1XXDC 4LLVB 4YGAB 4NRXB 3RNKA 4WF7A 3AG2B 3BP6A 5BV7B 3ISYA 3LZPA 4PR5B 5C0RL 2AI0L 2NY6D 3RWEB 2CLVB 4YX2H 3QJFB 4NN7C 1AH1A 1HF9A 1NMBL 2XY2A 4GRWE 2WBXA 3TNNA 3KYOB 4NKMB 3VXUD 2IOOA 1FNGA 3CFJB 3CBRA 4KY1H 3VXSB 1VADB 1ROCA 1X4YA 4MQTB 2VN3A 2MPAH 3QJHB 5F70A 5D9SA 3RG1C 1F90L 2JE8A 3QG6A 3W11C 2P10A 4L5FL 4YDJB 5EEYA 5IOKA 1GW6A 1C5BH 4CVUA 1EFXA 3GHGC 1MVUA 2ZUWA 5DK2A 4LSTH 3FQUB 1AKJA 1ED3B 3V6ZB 4PV1C 1KQLA 3H32A 1X5IA 3LPWA 2NY7L 4GG8A 4MJ6A 4MXQD 2E9IA 5IEKA 1HNYA 1IGML 2MTPA 1SVFA 5BRPA 1L7IL 3DYPA 1MCFA 4W6XB 2JKRM 5LAPA 2BCCJ 4AQEA 1MIEH 3DUSA 2V2TA 4UM8A 2UY7A 2A6JA 1SM3L 4POZC 5CSGA 4P2QB 1FYTB 2JB5H 5TE4L 1BCCJ 3ETBJ 3T0EA 3U30C 5C0AD 1PP9J 1PZSA 2VISA 4YDMA 1G0YR 3CD4A 4EZMA 2XACC 4ZFOB 2YAQA 1TITA 2VRAA 2F1EA 2Z8SA 2ZTBA 4PJCA 4YSDA 3K2KA 1DBMH 2FRGP 2DQCL 1SRDA 1OT4A 5ITBH 4F8NA 2W6BA 2GJPA 1MN4A 5E4AA 1TZHB 2BNRB 4XPAH 3GIZH 1GDTA 1UD6A 5I16B 1UWYA 4TVPE 4WHYH 1DQML 3VUAA 1IGYB 4QXTA 2XQYA 1AOHA 4FFYL 4PJDA 3V8CA 1IM9B 2AANA 2ZNXA 2VC2B 2CLRA 1Z2KA 1BPLB 2UWEB 1UJ3B 3NJGA 4O5LL 3GKWH 4TQHA 4Y1TA 1ES0A 3CFIC 3MACH 5IWLC 4Z77A 3GSVA 4Y5XA 4BBWA 1JYVA 2JKIS 3SDCB 3N85H 4GW5B 4XCYB 1XF2B 1X7QA 1ID5I 3VCLA 1TEYA 1T1ZB 5F7DB 4NQDE 5C0BE 4HJIA 5KUKA 3VMYA 2ZYSA 4DCQA 2Z93A 2XCMC 1CLVA 2WNXA 5H37A 3ZKXC 3L9BA 4C59B 1N6QH 5AOMA 3SFEC 5I1GL 5IVXF 2F53E 1Q1JH 1B0GA 3BYYA 5CINL 3L72E 1GH7A 3CQPA 3GS0A 2X89D 3PWVB 4O2EB 4E41D 2V9TA 5A2JH 4Z0XA 5IQMA 3N40P 1MCWW 3VE0B 3WDHA 4KRMB 2W8ZA 1T20A 3PRZA 4R4FL 1EWHA 5SWZB 4AEHH 3FCSA 1ZCRA 3OAYH 4R5XA 3H1ID 5EHFA 4DJMA 3RB5A 2OMUB 3KLHD 5ESVB 3BIBX 3CH1A 1CZQA 1Q2NA 1MQKH 3JSSA 4XZUB 3MRIA 3O4OC 4P5SA 1B2WH 2CHZA 3WIHA 2BZ7A 3T4YB 5IOPB 5JPNC 4GXVL 1A6AB 2PYFA 3QDMA 4PRIA 4E0RB 4LC1A 4H4NA 4RFNC 1O6SB 3MR9A 1VQNP 1KLFA 5GZNC 4X6EB 3NJKA 1MF2L 4OCNC 1LEIB 3H1KG 4K3DH 4P46A 4RGND 3WKYA 5FYKL 2OJZL 4PRPB 1FL6A 2R2HB 3L71J 3ESUF 3Q8BA 2J59M 4KXCA 4XP6H 3HNSH 1ZE3H 4ZMLA 3WDIA 4Z3GA 1JPGB 3V4VL 2KYVA 1B9KA 4LSUH 1A66A 2QIWA 1DJXA 2A45G 3O3AB 3U0TB 1A6TB 4JDTH 1J1XH 4KKZA 1NU1E 2EZ0D 4NIKB 4U0QB 1SQQJ 3DX1A 2B14A 1NKZB 4M4RA 2IAAC 2CO7B 1Q9WB 1RUPL 5C08E 1U93A 4HIXL 2AJVL 1PL5A 5GZOA 2VJXA 1XF3B 3DX0A 2MCG1 1BZ7B 2QSIA 3AADB 4FMKA 2JJSC 4HIPA 1CYGA 2P2UA 2L04A 2QQKH 3CJJA 2VLRD 3GHEL 3IDMA 5JPMC 5E5MB 3BAEL 3K2IA 3WAJA 2WPVB 3HB3B 3L5IA 3V0HA 3RFZA 2YFOA 4PW3A 1YC7A 3E80A 1S5IH 1J0JA 4D0CA 2EVGA 3LV3B 2L91A 1P4IH 1NC4B 1J1PH 3U9UA 3BQUD 3P2DA 3BP4B 3C87A 5K69A 1Y6NR 1A5FH 4K94L 3D3VB 2G0KA 3KLAB 3WNPA 1LT1A 5J56B 2YA0A 4M1GL 2QFPA 3MRCA 1VFBA 4F7TA 2KQNA 3EBHA 1RURL 2VLJB 3G04A 3VQLA 4BSWA 1KJ2B 5ICYA 4BH8B 1O7SA 3W0WA 3QNZA 4O2CA 4U0RB 4OGQD 3GPSA 3ECBA 2KS1B 5FYJE 3BT2H 2CIKB 1VEMA 1Q9OB 4DUVA 2RIKA 1MRCL 2AQSA 1PNDA 3P4NB 5TDPA 5JOEA 2WO2B 4KKPA 4XMKL 3BWUF 4G6MH 2CKNA 3K4AA 3CIAA 4KH2A 3SDYH 5LXGL 2W38A 4BEIA 1INEH 1IC5H 1CDGA 3BWAA 4PD4E 2JP3A 2Q7AA 4KX7A 4NQCE 3WMM0 2HRPH 3WLBA 1A65A 5B8CA 1ZK9A 1UB6B 4N4YB 3E1ZA 2BXYA 4FLQA 2WVVB 1XBDA 1ZTXH 4M6MH 1K5NA 2WXLA 3IDYB 3MRBA 3FB8A 3DVNA 1BX2A 3IJ8A 5EOTB 5IVXA 1L4IA 5MERB 3HEIB 4W9LC 2FLBT 3ZL1A 3QJTB 2F58L 3DVFA 4KTDL 2B1AL 4HULB 3MGOA 2KLSA 1WVZA 3KEHA 2WBWB 4NWUH 1GS7A 1KIPB 1Q90A 3G08B 5GS2D 4F37F 4ETYA 5J13C 2OGUA 3NFQA 1VZGA 3MV8A 4QO1A 1J12A 3MRPB 1ACYL 5ID0A 5FGRA 3RX8A 1GHFL 4PD4K 1IL1A 3EJUA 2AQ1A 2PGDA 4EZJA 2YAOA 5DHVH 1FN4B 4TF4A 1SMOA 3MPCA 3RVUD 2BOCB 1CG9A 1MFBL 2FWLB 5DZPA 4RX4D 4BUHA 4R9HA 5D1QC 4EVNA 2KIKA 1NCHA 1S78C 2WT7A 3T1FB 3VU2A 1ZHBA 4DP2X 2OJ1A 2Z7UA 2YLHA 4OZFH 4HQQH 4FG0A 4Y9CA 4AQ8A 4G59C 4WGKA 4PBDA 4D6TD 3J07A 4U7MA 4I89A 2VW4A 4PJ0E 1RZGB 2BSTA 5DJ8A 5D96B 3HZVA 3T0AA 5BJTB 2DEXX 4J3BA 2XV2A 3H9HA 1JNHA 5KLVE 2FJUB 5BNXD 3WTYA 3QWOC 1V27A 1VENA 2EACA 3ZT6A 3EFDH 2I9TB 3CZFB 2QVTA 4G8AC 5JQ6H 2WMMA 5DQ9A 2YO2A 2VMCA 2ZWKA 3GRWH 3Q6FB 4AMKL 2EUVA 5TH2A 3RKDD 4HUNB 1P84H 3CSYB 4HEMA 5I17A 1JFQH 1I3GH 4WFGD 4UTAL 4JFPB 5E6IB 1UIXA 4OIIH 1FZCA 1W80A 1J9RA 2W5PA 3I6SA 4ZUTA 5MI0B 5MENB 2DD8L 1NFIB 2FLRT 1JS4A 4KRPD 1EVTC 1SDYA 1ZV8A 4L8BB 4QRSB 1BQHG 1NICA 1WEJH 4UUJB 3HHSB 4W9ZA 4WVRA 4NZUL 1FIGH 2J57A 3P9MA 5AAWC 1S7VB 1FDMA 2WV3A 4I2LC 1ZVNA 2QJPB 4ZNEE 3H1LE 4F7PB 3V0DA 2H32B 1NIDA 1IJ9A 2R56H 3WN5B 4J1UB 5KLVK 5CNHA 2JH2A 2JKSA 2VH5L 1H3VA 2DJ4A 4XP9H 2X7LA 4XX1G 3I9PA 3UTSA 3LEVL 3EO0B 3NIFB 3MHZA 3MTUE 1Y1UA 3M1BA 4KXZI 1IAKA 1IFPA 5DK3A 1DJYA 1YEEH 4WO4C 1FH2A 5APXA 4ASVA 1FVCB 3MRHA 4F91B 1W9XA 5HI5C 3MRGB 2Y5EA 2UZPA 3FRUB 1HHHB 1HOCA 1DQIA 1L9MA 4APQB 1DEEB 3WUWB 1VF5D 4H44C 4ISVA 3O2WL 1CFQA 3MRMA 4KTEL 1J9CT 3O9WD 5IFJA 4PS7A 4GKGA 2GBVA 4PY8I 1CJYA 1FP5A 2BVEA 3BP5B 3DK0A 1IIIA 3GXPA 1OGAE 1LNQA 5H2FE 2V8LA 1D7CA 4I0PB 3V9FA 1EXJA 1H0TB 1QFPA 5E2TH 5BOJA 4HPHA 5HP5A 1RUAL 2BNUB 3QDJE 4BIKA 2IQAA 1OGSA 4ICXA 3KS0H 1JHTA 1FE6A 5DVOA 5T5FA 1HE8A 4AVJA 1L9QA 2IV9A 2ZOTA 1AP2A 1XTGB 4NRYB 1OTSC 5D6DA 4PGBA 2F08A 1KYUA 1JE6A 2EUZA 3MRRA 4N2BA 4Z6AT 4LLMB 5CD3B 5BCAA 2EYRA 1MI5D 1FAVA 4PGJA 4QRPD 3MD0A 4YHLH 3TASA 3WXVL 1JGVH 1UA7A 1UFGA 3P2BA 1LTJC 4IGBD 5H2BB 4OFYA 4XRCA 5D2LE 3KDPB 2YXFA 4LLQB 1UB5B 4F2ME 1NUFA 2RN0A 1I8UA 1FRGH 1UADC 4L9LA 2YA2A 4G7SB 1MEXL 2XWEA 3D0VB 1CFNA 3D06A 1TQWA 3ILQD 3F3HA 2B39A 4BKLB 5J0BA 3EYUL 1X9VA 1KYOJ 1Y6MR 2K3RA 4KKLD 1OK0A 4XN4A 3ZYZA 4GT0A 4G5AA 4FFYA 2I5YH 2CO6A 4GO6B 2WGXA 4HSAC 1NCDL 3VRLE 3WS6C 1LEKB 4MNQD 3CBJB 4JRYE 2CSPA 2X28A 2O4EA 3VXOA 5FS5A 4JAMB 4JKPH 3IDUA 5SWSE 3NJIA 3ARGA 4X80L 3HMWL 4WU7A 4Y16C 5DUBB 3TURA 4QRQB 3X12B 2QELA 4XBGB 2LT9A 4KQ3L 1INQA 7FABH 4NC0B 2WQYC 1Y07A 1CXEA 3ATFA 3PHQB 3ULUL 1IFIA 2BSSB 4L1LA 3OR6B 4KKBD 1S9KD 2FWOA 3IRCA 2EDBA 3UGEA 2BNQD 2Y5TB 2A1WH 4MAUH 2GI7A 4Z95H 3RYMA 3C60C 4FFTA 1YDPA 4W6WB 4W6YB 5BQDA 1IARB 2NR6D 1R19A 3CZUB 1KJMA 1ZHKB 4J2QA 3I6LE 2C7UA 1AV1A 4JN1L 4MVBD 4U1HB 3EXJA 1FYHB 1D9KD 3IU3A 4ODVL 5HDWA 1EJ8A 4LVEA 3QAQA 5D72H 1HCVA 3RTQB 1NVOA 3EBGA 5FO8B 4PRDB 5CJ8A 4NWTH 4LPVA 1I8KA 5JUEL 1YN6B 1KFNA 1WZ1H 3WFZA 1RF1B 1ZV5A 3TJEL 4FQJL 2HODB 3HAEG 4XXWA 2F1BA 3SGDI 4QTFA 3F7PC 1RZJL 2BFVL 2XA3A 3Q5TA 2ED7A 3N55A 3UAJC 1I8MB 1C9SA 3U79A 1R5WB 1K8DA 1GGUA 4DOHB 1QHPA 3H53A 3QEUA 3KL5A 2IPUK 5DK0A 5BS0B 5J12B 2KDYA 3CDGA 3SYQA 4E9YA 3FO2B 3NK4A 2NXYB 4GIOA 2EKSA 5D7SH 3N0PB 4KXDA 3KWWA 5DEJA 4HAFA 3NCBB 4MRCA 3GI9L 3UPCA 5IT2H 3INOA 1I31A 4WI0A 4DGIH 4HMEA 1AACA 4XC3L 3V4VA 4DAGL 1L6ZA 3BGFC 4MNHB 5AVXB 1N73B 4YPGA 3ISWA 2A6KA 3WIFA 5F3HB 3O81A 4U49A 4HJ1A 4X7SH 2G9KA 4MAYA 5EH1A 2ZKXA 1U8CB 5D2NC 3CCRP 4HBQA 5FA4B 4UILL 4XWGL 5GGRY 1MCRA 1ID2A 2A0LD 1GL4B 5DRWA 3BD3A 3C6LD 1EGJA 3REWA 1D6EA 1HEZB 3S5LG 5GS1B 5K93A 4JFXB 2K9YA 1XSIA 2X9XA 5GGTH 4B9PA 4MJHA 1T1WA 4JFWA 4MA8H 3AG3B 4IU3B 5FW6A 4N85A 4BXLA 3X1EA 4JPKL 4Q9RL 2OYPA 2FX8H 4J8RB 1H89A 4YHNA 3VNZA 4L8SC 4HS3B 5FHBH 1ACZA 4NNYB 4DEPB 3IJEB 2GAZA 3TNMA 4OZIB 4RZCA 4OCYH 5KS9A 1ODAA 3ARZA 4EDXB 2O01H 2JJTC 2IAMD 5EUOA 1WFIA 3P3TA 1UACH 1CXFA 2OW7A 4HF5H 4FQIL 5JLZA 1OVVA 1NH4A 3VXMB 1JF1A 2KZBA 1AHMA 4GSRA 4MNGB 4U1KB 1QOKA 4GQZA 1J1EC 2IYOA 1L6PA 1VFMA 2B7DT 3ARTA 1NTKE 1OSZB 1R3IH 2GJZA 2R4SH 3HLKA 1AO7D 2A4EA 1V3KA 2HG5B 3U1SH 2Y6SD 4HKJB 5I82A 5DMYA 1UD4A 3RK3D 1SDDA 1G4RA 4BFFA 5GRVL 3O6FD 3BIKA 3PDDA 4U3XA 1M6UA 1EEUA 5SX5H 5JZ7D 3MNWB 4XB3A 3WYRA 4NS0A 1YYLL 5BV7C 4F58L 2NUTA 5DC2A 3D07A 1URQA 5DD6B 4W81A 3GBNL 2C3WA 3AU1B 3LS4H 4M1CC 4HU2A 3S36L 2E7LC 3B34A 1I8AA 1KJ3H 2BJMH 4JG1L 3TIEB 4OGXL 4C7NB 2P8MA 3GMQB 3QWQB 3Q43A 3BCCG 2Y22A 2CU9A 3SSUA 4XVSH 1NTKK 2ESVA 3PV6A 1PKQA 4YHIA 4ECNA 1J10A 2MTAA 2HFEB 2QGCA 3H7BA 1RJYA 3WEAA 5C92A 1GXEA 5LN8A 3QE5A 5B39G 4XVTL 1BIHA 2Z35B 3V7AE 4QXTB 1AQKL 3R4RA 3TA3B 1INDH 1QBAA 3MRDA 2IOMA 3D2UA 2H88C 3HIZA 3KPRB 2MNJB 2OYIA 3ZIYA 2H2PC 1Z0NA 1NEPA 1P84D 2HSIA 4JPWH 1F1GA 2VDRH 3TO2A 4CSTA 4PBWD 2XXGA 2GC7C 4YSOA 4ZMVA 3SYOA 3O11B 4P2OA 1N7LA 2YNYA 1XL4A 1WHOA 2WBJA 3RZCB 5JXEA 2YGPA 5F7KC 1P0SE 3BT0A 1F97A 1U8PB 3K6NA 4OH2A 3K0YA 2X6VA 1H6FA 5I30H 2NY3C 5EN3A 5DJAB 3CX5I 1SOQA 2O6CA 3T9WA 5ENWA 1I82A 4R0LB 3MCLH 1MWAA 4YSCA 3LIDA 5C71A 5K9QG 1J1DB 1I9IH 4J5VA 1AHWC 2VDMB 3VFVA 4PGDB 5IFHH 1OE2A 5IHUH 5KBDA 1NTMG 2NRDA 2QSCL 2KZIA 1EXGA 5FEBA 1G6VK 2CR0A 2DBLH 3ZKMD 2XUWA 2OMWA 5I1DA 1MHPL 2DZEA 4JN2B 3ULUF 1WCBB 2R23A 3OZLA 4JCMA 4KKAD 3CMEP 2CBMA 5MP6H 4P3DB 2HVJB 3GUFA 2XU9A 3FHQA 3AE9C 3KQGA 1YYML 4ZSOB 3UYPA 1DN0B 4PRIB 1GL2B 1FORL 4I18A 3SJVE 3IJSA 4AQOA 1JZ3A 1FNEA 1KTDA 2IBZD 3VMXA 4ZUUB 4GP4B 1QRNA 3S96A 3O2VH 3EF4A 4PRBA 1OAXL 2XWBA 3D39A 3FQTB 5HPOA 2DWYA 4UAHA 1UJ3C 3UBHA 2BP5M 2FSEA 1VJSA 1JHKL 3TZVD 4JO3L 3HMXL 3H3PH 3UH8A 5GS0H 3TT1L 1Q94B 3V6FB 1N0XL 3ZT7A 3ZTJG 4LVHC 3H1JG 4N1CA 5A3ID 2P5PA 2YXMA 3O41B 3S9OA 4B9IA 3OAUH 1TSRA 2VRSA 3CCEP 2RALA 4ZO6A 4GP8B 2YN3A 5E8DH 1SOSA 1T5KA 4GSXA 2H6UA 1TZGH 5AW9B 1NBYB 3GSOA 5CHNA 3P77B 2B5IB 1H3PL 5IJVA 5FYLL 1S4XA 5EEVA 3H2WA 4J27A 3ESOA 4BK5A 1C7TA 2WXNA 3DIFB 5GS3A 4P23A 1QL1A 3SDAA 3AZUA 5D7JB 3U7YL 2KC0A 1E8WA 2PF6A 1CR9H 5SX4H 1T80A 4ASWA 3H4HA 1I9JH 4FP8H 4KKCD 4XNMA 1X5ZA 4D6TG 3D25B 4A7PA 1WUZA 2DQDL 4FYRA 5FFGA 1DUZA 2YUVA 4P5MB 3TYGH 2WKOF 3PGFH 4XN9A 2GUSA 3K5SA 2X5PA 1CFVH 4K2UH 3WGVB 3OSKA 5C0NC 5I1LA 2AJSL 1JXJA 4YDVA 3CDZB 4P04A 5KSBE 1IMHC 2J3SA 4TSBL 3BSZH 4CL7A 3Q44A 4QNPF 5LQBL 1ICTA 5J57B 2W65B 5BW7A 1YO4A 2FD6H 5FGSA 2UVFA 1ZXGA 1SFHA 1IBZA 4OI9A 5EFIA 2OSWA 5IV2A 3UO1H 4XMLH 2OTJP 1YEHL 4BKSC 1DX7A 4R6UA 2FYNC 1AZZC 3VXPB 4I3SL 1OCRB 4WWIA 2Z5HA 3PQYA 3S5YA 3FXDA 3N41B 1A22B 4Y28J 2OX5A 3Q2CA 3T0BA 1TIUA 4RRPM 1VEOA 1GGTA 3RGHA 1F58L 1LWRA 1KLGA 2AVFA 2XBDA 3P02A 1P4BL 4PJXE 1VPCA 1IBGL 4XODA 5F89B 4NQEB 2GTQA 1EMTL 1E28B 4JR9L 4RMTA 4HJJL 2V4HA 1CGVA 2G30A 4U3SB 2O61B 3G5YA 5L88L 1YNKL 3OF6D 3HB3C 1SPDA 3MRBB 1NTZG 1OTTC 2X0WA 3WLWC 5ACZA 2YSSB 4L8DA 3CXHJ 5LBSA 3UJJL 1SFCC 3ATEA 2CXGA 2KB7P 4OZHB 1UCBH 1SEBB 2XTJE 3MOQA 4Q6IC 3LJ3A 1XB3A 1KB9E 5FYKE 1S7WB 3LSOB 4LDCA 1NOAA 4WFEE 2QVAA 1NLBL 3N9GL 1KCKA 1Q8MA 3TONA 5DWUL 1JY2O 2XJLA 4EIUA 1IKNA 1Q72L 1HHKA 5FA3B 3L1OH 5J3HD 2WLMA 4J3OH 1VA9A 5E79E 1KN4H 1EJOL 2J72A 3MBED 4TLFA 5I8EB 1HCZA 1IAII 3Q5RA 2XZCH 1KBGL 2RH0A 4AC2A 3E8UH 3F8UB 1CFSB 5EMYA 3RVTD 3MREB 4B9GA 4FF9A 4G8IA 4OBRA 2KNCB 4JVUA 5FYJH 3KYNA 4LVOC 1G9EA 2NY2C 4IRJA 1MCOH 5E99L 3ZKNC 5IR1A 4G8FA 4HYTB 1GZHA 2R1XA 4KNTA 3HE5A 3IDYC 3IFPA 3DMMC 3SOTA 2X10A 3B56A 4XH2B 4WY4A 1FZJB 3SGEH 1K2DB 2XNXA 1BQKA 1DJSA 2E3VA 4RISH 2VN6A 2WYZA 3ECWA 1CW5A 1UOLA 2YWYA 1FZOB 4KX9A 2XX0A 3HI6H 1RK7A 4JGJA 4M7LH 4MYPA 1Q0YL 4PB9L 4C4UA 2OZ4L 4QT5A 2Q5BA 4ZUTB 2H8PD 3FU8A 4GAGH 3T77A 3GZOA 4HIEA 1ETZA 1R75A 5KJ7E 3TL5A 5TF0A 2V17L 1NDMB 2BMKB 1JP5A 4X7TB 1BVNP 1JBJA 3OM3B 3STLB 3NCXA 3P32A 2NY4C 5IF0B 2YKLL 2APSA 4ABVA 2H6PB 5EOCH 3H6PA 5DJYA 2NX5E 2ITCA 2WKOA 3Q9QA 2DB8A 4OGQB 1AE6L 4LL1A 4JO5A 1SQVD 1LO2H 1BJ8A 4Y7MA 1BBDH 4TSAH 4NKOB 2B87B 4ZX3A 4XHJD 1J8SA 5KANG 2ZFCA 2WSFJ 1JF6A 2YUZA 5LAXA 5GGSB 1CMOA 3FMGL 2WKLA 4DESA 4L76A 3FU7B 1G9MH 3ROOB 2IZ1A 1KC5L 4PY7B 1AGBB 4BRYA 2F54E 2BWQA 3CIQA 5EC1A 4ZUVB 2C3VB 4DHLA 4L29A 5AENA 5BUAA 4H5SB 1E5CA 5LNDA 5T3XE 5ANME 2HT3D 1S8DA 3DOSA 5FDWA 3NCFB 3EKCA 4O4YL 3DI3B 4NFDA 2BOLA 4O9HH 1OANA 5TDNA 1YHPA 2FDBP 3KLDA 3MRJA 4JM2D 4WKXA 4W9GC 1ZK5A 5E6IC 1JUFA 5ICZA 3KPMA 1SQ2N 5EU5B 5MI0C 1QX8A 2ORBL 4X98B 5IB4A 4RGOH 4ZYKA 3GZKA 2DWDB 4V1DD 4YQXL 3W81A 3TEXA 3TEYA 4AUWA 1AFVH 1OK8A 1PG7L 3MGTB 4PCTA 2DQEH 4FZEL 3OKYA 3UTQB 3DWTA 1A7NL 4EUPA 1FVEB 3MRNA 4U1SA 4Z23A 3WN5C 3G9RA 3OBAA 2XV3A 4KK8C 1T03H 4LVNC 4LBEB 1KTMA 1F86A 5I6PA 5T1JA 3VM5A 2DEYX 2YC1B 1KIUB 3G6JB 5CZRA 1E4XL 2D3LA 4YXLL 2OKMA 4G70B 1N70A 3OVUB 3NRPA 3OZ9L 3L4YA 4M48H 4QTHB 3KGRA 5CMAB 1KIRA 3UBXB 3HZKA 5EBWB 5CJ5A 4MB5A 5GHWL 4E2OA 4A7QA 2XNAA 4Y99B 2IAND 4APQC 5EU6B 3MBWA 3IDJA 3C8VA 3QI9D 4YDKL 4DH2A 2CALA 4GB9A 5C09B 1CL7L 3QORB 4DN3H 4BQBA 2E75D 1XTMA 5JIIA 2CZNA 3L3DA 4ZFFA 3PAZA 4NNPH 1MRFH 3ZYJA 1KDJA 4I0PC 5F44A 1IT9H 2VRQA 3JWOC 2GJ6E 3WO4C 1H9VA 3BGAA 5KZCB 5IGXL 4OY9A 4MN4C 4W9IC 3KPSD 2BOBB 3D18A 4JRXA 3FN3A 1WD9A 2XFXA 3B9KA 3ZL4L 1KQGB 5H2FH 3DURA 2ZX8A 5F9WB 2WAHA 5ERWB 4G80B 3AG1B 3VFGH 4AW7A 4F15B 3L3OA 2BDNL 1DQJA 1D5XA 1FG2A 4Z7UE 3BE1H 1N6VA 3PP3H 3MNDA 4NZTL 5KYXB 5EUKB 1UM5L 2ZWNA 3L2MA 4HUUA 3RURA 4DVBB 5ADOL 1B4JH 3OGCB 3PPSA 4QJ3B 4S1QL 1F1AA 1CI6B 4D3CL 5KSAA 5CJQL 1QPKA 3QXAB 3FONA 4UQDA 5T1DH 3FO9A 3MP7B 1N8RQ 1TCRA 1JIBA 4HP5A 4Z7NF 2PPAA 3F05A 1BGYE 1WRGA 1N64L 1V55B 2VGLM 5H37H 2X38A 4XOCA 2Y36L 1TVDA 2A9BA 3IKCA 4HGKC 4NXSA 1FL5B 1VF5B 4ZD3H 3BXNB 2J88H 5HHQB 1VEPA 1OB0A 4IBZA 1AVAA 2G75B 4ATTA 2D2CB 3HMXA 1X79B 4JFHD 4CC4C 1P7BA 2CR3A 5JDSB 3PWJA 1QBLH 3OKOA 4KOCA 1HUCA 5JHDE 5CHXA 1KELL 2DQHL 3WIHH 3TDKA 5HDOA 4X5XA 1IBYA 5HY9B 1S7UA 1L3WA 1T2QH 3IE4A 3QDGA 1KYOI 3SKUD 3WE1A 4G42B 2BHYA 1MNUH 3LIZL 4L37A 1IJDB 4X4XB 3C12A 3GJFH 1GC1C 4YOKA 4JNXA 2N1KA 3OPUA 3O0RL 4PJ5B 2C9UA 2X4NB 3ZDYF 1S9YB 1E40A 3RTQC 2FGWH 1SF5A 1C08A 1TJXA 3GMLB 2EH8H 5LGYA 4NN5B 3H1ZA 3HI1B 1LO5A 2VDQB 3VXRA 1GTNA 4RFOH 4IGBB 4G72B 1JTOA 4FQXA 2B2XH 3QEGL 2HMIC 3D8MA 3S4SA 5JO5B 4E5XG 5AL0A 4Y4HD 4PJ7F 1FSKB 4DKFH 4PP1D 3MLVH 1H15A 5LXVA 1NU1D 1GSKA 1KILE 2J1YA 2P4AB 3V0IA 2Y0SA 4K9EC 4RMWA 2ETWA 3Q5SA 2H26A 5J12C 5HTSA 1YPZE 4AGNA 4ODTH 1X5JA 4G5ZL 5EUOB 4PWGA 3FQRA 4IOIB 2Y1ZA 4MNQB 5FF6B 2APBA 5F7HA 4UB6E 4AQ1B 1IGTB 5CEYB 3A4EA 3NACL 1PSKL 1X5HA 3WD5L 5IJDC 4UNUA 4YXKL 3V0WH 5CZXD 1CE6B 5FW7A 3NVQA 3X14A 2ZCLH 1SMAA 5DHXB 5AAMA 2FX9L 4HAGA 4Y9EA 2LFEA 2BNQB 3QUXB 3PWLB 2LHAA 2EILB 4H40A 3IXTA 5EU4A 3UTPD 3E38A 5KYWB 1Q9LA 4YHPA 4WUUA 4J3OD 1USDA 5CN3A 1I8LA 2Q2LA 3FB6B 3OXRA 3AY2A 2YGOA 5FM4A 4CJ1A 5CCGA 3QUML 5HYSA 3HC0B 3JV0A 4Q4EA 4OWFA 3DSFL 3BN3B 3S3BB 2FE0A 4KI5E 4F7EB 3GBML 5ACMA 1I1RA 3GTNA 4YDIH 2ZCHH 3MFFA 5DJZA 4LCWA 1P4UA 2N56A 4PS4L 3RHWK 43C9B 4NQDA 1FNSH 1VZHA 4WY7H 4QOKD 1JGIA 1S7RA 2FGZA 4LXFA 2EDQA 4HV8A 1JK8A 4YPJA 4YSEA 5F3BB 2Y7QB 5C07A 1J8HA 1M1JC 3MLXH 1DVFD 1QFWL 3ARUA 4JG0L 5DA0B 3W5MA 4NZFA 2ZWLT 1NCCH 1SVBA 2XWJA 4KBPA 1UM4L 3OMZA 4GINA 4NQSB 4OJDH 1QUNB 4XNQB 3FAWA 2ICEC 1AXSB 3DBXB 4P4KB 2XPGB 1ZT7B 3L2NA 3NFPA 2R7EB 1KCVH 5CBAA 1Z9SA 3E9TA 3L4VA 3MODH 3IF1A 4MZIA 4M5ZH 4NFCA 3U4BH 5J9PB 1QASA 1WSST 3MNZB 4FXGA 1T1XB 4N90D 4PFEA 1T2KD 1T8ZA 1LE9A 1FPTH 4XMUA 1LO3H 5E8PA 1I1FA 3OLEA 2LU7A 5H4ZA 2Z4QA 4AL8C 1RMFL 2CCVA 1U7MA 2X1XR 3KXFA 2J5UA 3ML8A 5DMIH 1WD8A 3ARFB 1BP3B 1MKFA 4P5TD 2FLMA 4Q9BA 3Q3GA 5D6CA 3P11L 1CD0A 2YHGA 4PRNB 4QHNA 5FCUL 2XLLA 4FTVA 4R3SB 3TFKC 2O6FA 2FUTA 5E2WL 4U1MA 3GMRB 2QVKA 3I84A 3RJQB 4IBQA 2CIIA 4OR1A 4YS4A 4HUWA 3L75G 2JKWA 1DLFL 3K71B 1MLCB 3CLEL 3D51A 5LNEA 1VGKB 1JZJA 2YBRA 4PJEB 4MDJA 4G8GD 2XVKA 5FGBA 2OZ4A 1F3JA 1KV4A 2W9DH 5D70H 3QIWB 3QHFH 4PJ9A 4RH4A 1I3RA 1HINH 1N12A 2F8OA 4AQAB 3WV0A 5DYOA 3IDNB 3T4AB 3WFCH 4I7ZC 3E7KA 1CGYA 4PJ7A 3WNLA 2VDOL 4OD3L 4AI7A 3TF5A 2AXJA 4I9WD 5CEZL 3TBTA 3RZCC 4K35A 3KGSA 1NO4A 4F1SA 3LQZA 3N91A 4PJFE 1WE5A 1BCCD 1RJCA 2DQTL 1ZAGA 4WTWA 5INCB 1EDHA 1PP9D 3AB0B 3L4TA 3QJQB 35C8L 3WTVA 1S7TA 1J1DC 3NRQA 4E9VA 2NY6C 2A9NL 3LKQA 5CHNB 1R0AH 1I4FB 2B4CH 2XNDH 1DTUA 3FT4B 2QM7A 1A6ZB 1S3RA 1GGCL 1EFXD 4DQOL 1J18A 2VCOA 5B38B 1AKJD 4BK8A 1XGRA 1R3HA 2IC2A 5C0RH 1CDHA 2AI0H 3HR5A 2JB6A 3H1LD 4L48A 4Z7OB 1WTGT 4EDFA 1RJZB 4FQLL 1U95A 1ETA1 1CFMA 1NMBH 1KDIA 1GL2C 4YE0A 2GHZA 4ELME 1EVUA 4JYCA 3CU7A 3GXDA 5DC4B 3VFUB 5KSVB 5A2BA 3T0ED 4NQCA 3SZKC 2E5EA 5A16A 1W8OA 3BZEA 4M3LA 1KYDA 2PP7A 4LL9A 3T8MA 3AE2C 3L13A 2BVOA 4DCKA 3MUGB 4L5FH 3BRTB 4KNSA 1IGIL 2F74B 2NY5L 3ERXA 3N42F 2SEBA 4O58L 4O02L 1FE8L 3T2NL 3WNKA 7PAZA 3S9DB 1FC2D 4LNRA 2D73A 1YMME 2QQNL 2WQUA 3C5ZB 1BQUA 3QH9A 4K73A 1DE4B 3FB5B 4CPGA 1AFOA 3ZGHA 2NY7H 2VL5B 1IGMH 4KJPD 1L7IH 4UMGA 2BCKB 1RULL 2E4TA 2B5IC 4ZX4A 4B95C 1QEXA 1BG9A 1RLBA 3CCJP 1SM3H 1TJMA 1QSZA 2WIMA 5TE4H 4X5QA 2W88A 5J4MA 1BBJB 5EEWA 5D7JC 4Y19E 2A83A 2VITB 3RK2B 3FRPA 5KSUA 5APUA 5BZXA 4I9XA 4CA4A 1M56B 1SJHB 1X9UA 1X44A 2PW1B 3ARDB 2VE6A 3GF8A 2GCYA 4OGAD 3V9CA 1HL5A 4ZPVB 4L4TE 4HMCA 1BFOA 1W72L 1G87A 1SHWA 1W0YT 4N86A 1QPXA 5DWPA 2DQCH 1T66C 3LQAL 1JV5A 1UG9A 2ZSVA 3F2LA 2XOTA 1M90Q 2MHAB 2AZUA 4N9GB 4X5PA 1QL2A 3RFRA 1PQZA 3L71D 3BVVA 4Z7QE 4WNQA 1M7IA 3UDWC 5BQ7A 2X4UA 1DQMH 1X5YA 3T2PA 5LGHL 3NRFA 1N7SB 2E76D 1E8ZA 4FFYH 3ZTDC 2ZG3A 2Z31B 1WBXA 3RUGF 2KZKA 1SQQD 1OZUA 3BUYB 3GMNA 4O5LH 5E2VL 3VAEA 5JOPD 1YY8A 2G9HA 1EUTA 5HHNB 1EDLA 3MYJA 2MQGA 2ZAIA 5IQLA 4O2FB 1R9FA 5HJDA 1VDGA 2YKOA 3KDMA 1ZWIB 3JCUE 1KTRL 2DQIL 5E51A 4BZ2L 5MEPB 4P46D 5FYLE 2R1YB 4GLRH 3KCWA 1CYXA 1FFQA 1HKLL 2DLTA 2X2HA 5DUJA 2Y6TE 1HAUA 3S37X 5I1GH 3QT2A 4PGCB 4PRHB 5CINH 1NCIA 2R59A 1UVQA 3CN2A 1S5LH 4M43H 1OW0A 4I2XE 4Y2DA 1IRAY 2BVTA 4R4FH 1BE3E 5KLVJ 1OT2A 5I74C 4CN4A 4EXKA 4PTUB 4BCZA 3L7EA 4RFEB 3LVTA 3AUWB 4FJ6A 3EGSA 5DRNA 4ODUB 4B50A 1FV1A 5IFAH 3C1LA 1A3LL 3VVWA 4Z9KB 5KS9F 1OLLA 4RGNC 4N2MA 4GXVH 1G7QA 5GZOD 1X6NA 2YPLE 3VXQA 3W9EB 3RGVA 3WL9A 3BCFA 1JGEB 3CZGA 3M9HA 3LIZA 2XY1A 4H25A 1MF2H 3KPNB 1TU2A 1YEWA 3MCG1 2EXTA 1KB9H 5FYKH 3CHOA 3VWKB 4G82A 3KPOA 1C8QA 1UURA 5IMLB 4A04A 1A7OH 3TIDB 2EZ0C 1NUDA 2GK0B 4AUUA 4MMYA 4UT9L 4U6TA 5E03A 1LNUB 4Y1AE 3LRLA 1ITCA 3RWDA 3GSUB 3V4VH 4HIQA 1HS6A 3HUSA 5JW4M 5CGYD 5TISH 3EOAA 1I8IB 5IW1A 5E4EC 1DQLL 3SKNA 4EIZC 5AOIA 5FKAA 4DO4A 4YSRA 3WKML 3V4PL 3L70J 1QNIA 3X3FL 1RUPH 4QLWA 2AJVH 2N4IA 3W0WD 1XEUA 2OMNA 3CFUA 2Z4TA 3EADA 1IZKA 1GY2A 3PDOA 3SEPA 1L0LJ 3NZSA 3GHEH 5ICXA 2IDTA 2AAAA 5BRZA 4Y0GA 1KBWA 3B6SB 3AM8C 3BAEH 4AGOA 1EAJA 2PP6A 2ZYAA 1N5AA 4P2CG 4OLVL 1L9TA 5DEFB 4UBDD 2JF1A 5KLIB 4HUXB 2EDHA 3P4OB 3T3PF 2IG2L 4CVXA 4NPEA 4PJAE 1YNTF 1I1AA 3JWNG 3AXLA 3HS0B 4IBYA 5MHSE 3W5NA 2QRXA 3IMSA 2DEWX 5AW2B 1YMHA 4WWNA 4F3FA 4IKKA 1T83A 4K94H 4WJKB 2KSJA 4OGQC 5GTIE 4A2DA 1J5OL 1R5IB 1RURH 5C39A 1MH5A 3HTLX 3BDXA 3FU9A 3LKPA 3AACA 4YSSA 1HDMB 3M8OL 4ZT1A 2CRYA 5DVMA 3UC0L 4LSVH 5SWSA 2AS5M 2ENSA 1PZ2A 1E3ZA 5EIIA 1Q90D 3U6RB 1MCDA 2AZAA 4MQ7A 3B8EB 4N2EA 5DJCB 1DANT 2AGJL 3SKMA 1SYSA 3RUGA 2XWTB 3OKMA 4KVPA 1SQXJ 3I75B 3QUZB 1AQMA 3U2SB 1XGPA 3B7UX 4HKZA 2OI9B 3VXTB 5FLUA 5CD5D 5LXGH 3DSNB 3DTXA 3KW7A 4UIKH 3L3HA 1EQ7A 2BP3A 4PJBF 3SDXE 4YBHA 3ZTEA 2EE6A 2YK1L 3TA4D 4N0YL 1IK7A 5IHZB 1H8NA 1SBSL 4Z78B 4N26A 5T3XH 3SKOA 2XBTA 4C56E 5IEHB 2PWGA 2NY0B 3DX3A 4BZ1L 4IDJL 2F58H 4IHOA 4KTDH 2B1AH 2G5UA 3KE0A 5GIRA 1KZYA 4G6JL 4OKVB 3NIDE 3H1HE 2AJZA 1BQSA 4FLSA 3HG1E 1HJBC 2PTVA 4N8UA 3RVUC 4XB8A 1ACYH 2VAJA 3ZHLA 3TWCL 2QJDA 3EJCA 4WI4A 1GHFH 3D4ZA 1G7MA 1U3NA 3SBWC 1AG6A 3U4EA 4L3CA 4MCMA 2UXTA 1T21A 4LP5A 1QUPA 4P2RB 1U8OA 2MCPL 4D0BA 1Z9LA 2WQSA 2Z92B 2MQ0A 5AZ2L 4KRLB 4MD0A 3A6CL 1JM0A 2IDBA 1MFBH 4CKQA 4M5TA 3KVQA 4X99A 3HRZB 4Y99C 5C0GA 3QDHA 5A6LA 4MJIA 3ZQWA 1OGTB 1F4WL 1NCBL 4HK0A 3I5CA 3CD6P 5H94A 3O6QA 3QORC 2R5BA 3IKKA 1N2RA 1DQVA 2AXGA 1S7QA 2WNWA 4OFIA 4BWUA 1MHHB 4URKA 1ZVSB 5AWNL 4ZFZB 3VI4E 4CMMB 3Q5YA 4V33A 2ICWA 1B4RA 2YARA 3ZPDA 2X4RB 5GGRA 3RKDC 3D70A 1DR9A 4PUBL 4AH2B 4JM2B 1K8IA 1THAA 3WNOA 3RI5K 3TO4B 3M7FB 3AVEA 1HGVA 5DFAA 5EZIL 5ITFB 5DHEA 4AMKH 1YZZA 4GRWB 2YOCA 5C2UB 4LHUA 1L0NJ 4CN1A 2I25N 4KRPC 1NAML 3P9LB 3TGUE 1UKTA 3WKQA 3JBG7 4UTAH 1G43A 3NGBB 4GG6F 2GFBA 1PCXA 4F15C 3ISRA 5H35A 1G7JB 3M07A 2DD8H 1KACB 2XVBA 2YJQA 1IKFL 1LEGA 5DJ2B 2Q6WA 1B0RB 3SBRA 2BWIA 1HH9A 1BOGB 1KFAL 2UY6A 5C0IA 2KUBA 5T3ZE 3FTYA 4NZUH 2VDRB 2FR4A 3A67L 1UKQA 3QR0A 4JG5A 1GOGA 2DYRB 1IC7L 1MCSA 3BO8B 3FQWB 4A2GA 2ICWJ 1YNTA 4JG9A 5E5UB 1EZVI 3IJHA 4P3CL 5KN5A 4NPKA 3FT9A 3VWJA 5KVDL 2N1TA 1WT5A 2CO4A 2VH5H 3CN1A 2JCWA 4GAYA 2IANB 4PWKA 1KYOD 1HH6A 1JI1A 3LEVH 4YZFF 3FQNA 3V5KA 2P5WA 1RSYA 1G7HB 1BYPA 2N01B 2OMVA 3NSDA 1WBZA 1VF5C 1FZMA 3ME0A 2G5BA 4TNFA 4H13B 4JPVL 2H26B 3EYQC 3O9WC 4NENA 3WMSA 4UNVA 5LDUA 2DLFL 1KNOB 4N22A 3WHE1 1QSEE 2ITEA 4HGWA 2D2CC 2BC4A 4PCSA 5E9DA 1F1DA 1QVOB 1UA3A 3F04A 3O2WH 5DJ6A 2OMYB 3PWUA 2ZZUT 2WPQA 4KTEH 1FO0B 1KTKE 4Z8FH 4YK4B 4OFYD 4H0LD 5A6IA 1U2YA 2XG5A 4O02A 1VL2A 5T5NG 1VKXA 2O6PA 4PJBA 1IM3D 1O5DT 1XCTB 4NUJA 4C46A 2A4ZA 5GRUL 1RUAH 3OJDA 4V2CB 1FZKA 2FEDD 1XGZA 2W07A 4PIRF 4ZMAT 4G9DB 1SXBA 2W8CA 3GI8L 4JFDA 4YR6A 2BCCG 2FQGA 1T89A 4X4ME 2CE6A 4NN5C 5HGHA 1DD4A 3I02A 2NNCA 4IGBC 1T2JA 1IC0A 2R0ZH 3NEOA 3KVPA 3CXHH 3QXDB 3ARGD 3GB7A 1JVKA 1QA9B 1IGCL 4HUVB 2Y1AA 1UKSA 3WXVH 3OKNB 1BOYA 3CMGA 1ZXQA 2CLZB 3GSWA 5I0WA 1E30A 1NBVL 4GUPA 2BP8A 3W9DA 1R5SA 3ILQC 5F1IA 5IBLD 5C0BB 2LAAA 2E8ZA 4QHKI 5A40E 4KKLC 4PTTB 1WDAA 2DYSB 3QZWB 2F53B 3DX6B 4YMPA 5GPRA 3T0XA 5GSVB 1HILB 4AQ1C 2AVGA 2G2NA 4IRSA 2EO1A 4FLOA 1GYCA 3P4MB 3EOBB 1NCDH 5GISH 4PB0L 1DQDL 2OL3A 3QHTC 3QEHB 3ESVF 2NNFA 1S9WB 4H0GA 4RRPA 4KKBC 1S9KC 5AKSA 3QUXC 3HMWH 4X80H 3VM7A 1LHZA 2IQ9L 3UZQA 4KQ3H 4MVBC 4E9LA 5JW4Q 4DP8X 1XSJA 2AMGA 1D9KC 1NANH 1XR9B 3QNFA 3T3MF 4ZTOL 3ULUH 2HJFB 3N7NA 1ZE3C 1XZWA 1UIIA 1HI6B 4N2LA 2R51A 2ED8A 2W95A 1ZHLA 4JN1H 2XTSA 4UOZA 3PYCA 4IS6B 3ZE0F 4GG6A 1BA9A 5EBMA 3ZDZF 5F88A 4ONHA 4L0YA 2C1PA 3QQDB 4LK4A 2LQRA 2E5YA 1IB5A 3QNXA 1FAIL 4PLOB 2Q3EA 4PP2A 1XTCC 3NQIA 5JUEH 1NGQL 1QYGL 4E42A 3IETB 4FQHA 5GGQL 3KCPA 3TJEH 3HRPA 5FOJA 4FQJH 4IRZL 3B2DC 5C08B 1A4JA 4OAWA 2ADGA 1RZJH 4JRFA 5DYOB 5ESQA 1B4LA 2K3HA 4CU6A 4QRUA 2OULB 3BZFB 2QZ5A 4L1TA 1UEYA 1PFOA 2O1AA 3BRDA 3FWLA 2FYUE 5DEGB 4N0FA 5DQJB 5GJSL 4DUXA 1GMIA 1JY3N 2A9DA 2PW2B 5D1XA 4MA3A 3UAAA 2X4OA 4L2LA 4UT9A 3VQMA 1GPOL 2PXYA 3NA9L 2PTTB 3QPXL 4MWFB 4QKTA 4XC3H 7CGTA 4DAGH 3PAUA 5F8QC 4XMTA 1M05B 2A0LC 4HC1L 3C6LC 3HLAA 1S5HA 3ARFC 5CP3H 1YTZI 1N67A 2F2HA 3APFA 1N7MH 4IHBA 2HLEB 3FN0L 3V4PA 4UILH 3V4QA 1L4AA 1JY3P 4N3YB 2IWGA 5KOVC 5I0VA 3HR5B 1TETL 2JNZA 3VB8A 3BAIA 1PY0A 4PJ6A 4CC0A 1UJTA 2FATL 4B9CA 4PS8A 1KCUH 5B22A 2V3DA 3OD3A 2FYUK 2V7NB 1CICA 4UIMA 3TV8A 4MB1A 3I85A 2AJYL 5DRXB 4JPKH 4Q9RH 2IAMC 4EDWH 1Z9NA 3VO0A 2HJKB 1GJIA 3KL3A 1URQD 3T4AC 3VGGA 1V7NL 1FAKT 1G7IB 4YC2C 5CEXA 3ZR5A 4X6DF 5IG7A 3MV9A 4GYBA 1VQLP 4FQIH 3RVVD 2EEFA 5EZJA 4IEFA 4WO0A 4JL1A 5IIEA 7PCYA 2ADJB 4UB8E 6PAZA 1S3JA 2ESVD 4I48A 2IGTA 2R29L 4FADA 1J0ZA 2DLGA 4Z5RB 3HE7A 4ZO9A 2M3EA 2J73A 3QRGL 5JZ7C 5DDHA 3BRGC 5I1IL 4H8UA 5HGAA 4QLRA 1XR8B 4S11A 1J5DA 4KITB 4HB1A 2XN0A 2OYHB 4U1LB 1P5UB 4MKMA 3VNYA 3D2UD 3GD1C 1SBBA 2VQUA 1YYLH 4DQAA 4EUPH 4F58H 2JXMA 1JSYA 2K9UA 1SQBE 3M45A 3GBNH 3JTTB 3S36H 4EN2A 1JWMA 5I15H 3GIVA 4P2OD 5APTA 1N10A 1NGWA 4JG1H 2ZUXA 4MRBA 4OGXH 2M5AA 2GCYB 5FYKU 3T65A 5HYJE 1OM3L 4MHHI 2DQFB 1X7SA 5JR1L 3Q9PA 4HJUA 1HHIB 2P7TA 5LVEA 2PMZA 2UUDH 4A63A 1E4KA 1FJKA 3K8MA 1NAKL 1LTSC 2QJYC 3II3A 4N9OB 1KIQB 1DQKA 1OW6A 2OPCA 1KBKA 2ZG1A 2R2BB 4NCDA 2BIOA 1JMMA 5DI8A 4XVTH 3VMPA 4Z3JA 5TDOB 1E9QB 4MB4A 1QPPA 1JTHB 1AQKH 3OX8A 1U41A 3WCYA 4CNIA 2I9LA 4PJ8A 4I3GA 5D7IE 4D0DA 1GK6A 4LLUA 2DTML 1H8SA 5AVRB 2BIHA 3RY6A 3FYIB 1MHCA 2G9HB 3RL2A 1LD9A 3MYJB 5B5EE 5FKPA 5IVZA 3BATA 5ISZA 3VFOA 4BWTA 4K9JA 1SP4A 2V9UA 1PGJA 1M1XB 3WEXB 5KJ7A 3D39D 3RWGB 3ZR6A 32C2A 1AJYA 1CE1L 1N3NA 3FUFA 2V37A 1A02F 5CM1A 4ZQKB 1SQPK 3TN0B 2Q6QA 3FT1A 3KNBB 3ZKMC 1UWEL 3D48R 3ARDC 1RZ8A 5EV7A 2M8XA 4KKAC 2AEQL 3CC2P 1EXUA 1I7ZB 5KYYB 1JPEA 1T7YA 5CP7A 1XZ0B 2A74B 1MHPH 4UM9B 2V5YA 3HI5L 4OLZL 2XDHA 3DPBB 4LRIC 1CWVA 1NAMA 1QD0A 1UYWL 2X3BA 3T8VA 8PAZA 1YYMH 4WFHE 3TZVC 4PD4I 1OOWA 3CQQA 1NFDE 2NDGA 3SIKA 4A1RA 1DL7L 2G3NA 5DR5L 4LNVA 1A9VA 4P23D 3PV7A 1OAXH 5A3IC 3DTDA 4WV1A 1R5LA 2O01N 4PJGF 5F93C 2DDQL 5BMFL 4N2FA 1JHKH 2XWXA 5A2AA 3F5WB 2WXHA 3HMXH 5E6UB 5JNYB 3TT1H 5C0DB 2A06D 1N0XH 1OGAB 3IFOB 4JFEA 2ZOOA 5JHLA 3Q6GL 4B0MM 4OM0L 4PVBA 2B59B 2LR4A 3O6LL 3QDJB 4X6DA 3EFOA 3CAFA 1XGYL 5SWZE 2A6DB 2WXGA 2VMJA 2TRYA 5IW1B 2Z5IA 1T3FB 3VGAC 3ZTNL 5E08H 2EIZB 1F13A 4QYAA 3PWPE 3JCUH 3T08A 1HEJC 1H3PH 2X0UA 4OF8A 1AC6A 4AQRD 3NZ8A 5FYLH 4AXWB 3CXHD 2AQNA 3WE6A 4RIRA 4KKCC 3CHQA 4JCLA 5BXFB 4U6HB 1F8TL 3L5WB 1N0LB 2CPUA 1LGHB 4XAWL 2P8PA 4MDRA 3FUMA 3PQYD 5D7KE 3U7YH 2ZXDA 3VDCA 1LDSA 1QEWB 3U48A 3K91A 4FXTA 4GRMA 2E27L 4JHAL 5D2LB 2IH3A 3CPUA 1GS6X 2O1KA 4F2MB 3NJLA 3CDYA 1A6VL 3BH4A 1KXTB 3OKEA 1PJ9A 1VGEL 1ZJBA 3CSTA 3DRTA 2AJSH 4XC1L 1TXKA 4UMSA 4L4VA 2Q8BL 1LP9F 1CN4A 2GIYA 4GRLB 5KYNA 2NZIA 3K46A 5LQBH 3AQZA 2CKBL 4HUMB 4JRYB 3O3DA 3GPEA 2QEJA 5FGCE 2QLVB 5GRJL 4ETQB 1RP9A 1NM4A 3BVHA 3CZKA 3GJFB 3D0LA 4DWHA 2E7CA 3QUYA 3ULUD 2FEEI 4BXSV 1UT1A 1XIWB 2EXWC 1N8ZA 2VLKA 4LSPL 1ZR2A 2YMYA 1P4BH 5J6HB 2IH8A 4RMQA 1IBGH 2W6JH 4X8JB 4GUOA 3II2A 4XCNB 5EO0B 4JR9H 4BYHA 2C9RA 4FAAB 3OG6B 4RMBA 4YXHL 3LD8B 4W4OA 5F7NC 3AEDC 4MTMA 1FL3A 3QIBB 5LGJB 1RE4A 1ECZA 1IE4A 5L88H 2HPCA 1A7PL 1YNKH 3GHPA 4H8QA 3QIUA 5DD5L 4HS8L 5KLIC 2NW3A 4FI7A 4Z7IA 3VJ6B 3CXFA 4KOBA 1A14L 3ZSSA 5CSZA 5F97E 2GIXA 5GGVL 3VU1A 3UJJH 4IRJD 1D3CA 2QKIA 3CNKA 1B4TA 2DM7A 1G6RL 5J3HC 5C0EA 5E8OB 3H9SE 5HJ3B 3TX4A 1NLBH 1NGPL 3OKKB 3N9GH 1P5VA 4WY4D 2VERA 3HD7B 3NIGE 1FH5L 1W8EA 3BPNB 1G7MB 3B5NA 1UC6A 4JFOB 1Q72H 1O0VA 4L3CB 4JVPA 3T2OA 2GM4A 2YR3A 4WTZA 2OFQA 4NRZA 3HC3L 1EJOH 1MLBA 4YO0A 2HT2C 5DJ0B 3S7GA 1BVKA 4CRPA 4EN3A 5CJXA 5F9JB 1KBGH 2VR6A 3CFBA 5JHDA 4HFUL 1PTZA 2OI9C 4PJGA 1A02J 4B7LA 4ELKA 1PPJG 3P0VL 1S1CX 3FCGA 2NY1B 2P48B 2MKWA 5AW5B 1SF3A 1DCLA 2KI7B 3NP3A 1S7QB 2Y7SA 4XP4L 5E99H 4IRZA 4KJWC 4M7ZC 4N78E 1FCGA 5EC2B 5EU7C 2LOEA 4NT6B 3FC8A 2JKVA 1PZ5A 1JGUH 4PYHA 5ETUA 2EDOA 1JZDC 3VGHA 2DTSA 2Q0ZX 3EH5B 3QQ4B 5DZLA 1TVBA 3C5SA 3CFDB 4JY5L 1AR2A 2R0KH 1JF5A 2WCGA 1PLAA 2HVBA 3WHE0 3IFMA 2Z64C 4JMXA 4PB9H 1Q0YH 1A21A 3VGDA 2JELL 4N2IA 1M7UA 4OF6A 5BVPL 2DLHA 1PZBA 4BFGA 2FH6A 4MDIB 3QGVA 4POYA 4NQXA 2HYNA 1U2HA 2R4RL 2V17H 4AG4L 3FB7B 4UB0L 1CLCA 3F7VB 1QX1A 1KCBA 3CMAP 2PYEA 2YKLH 2XKSA 5D7EA 4EI5A 3E7JA 2Y7OA 2J56A 3LNIA 4XHJC 1IGJB 3U36B 4B60A 3E1RA 1AE6H 4JDZA 4X8GA 3GBDA 4WI7A 3NJHA 3QR1A 4HW6A 1WFJA 3MRFB 1UD3A 2XIBA 3SKJL 3BUIA 1F3DH 2F9BT 1LP9A 5CJ4A 3OLIA 2D7TL 2CUMA 3NSFA 3UTTE 3WY4A 4ZUSB 3ECVA 4S0SD 2OJEA 2Z9TA 5TGBA 3MLTA 3LAFA 3UZVB 5KWYC 43CAA 3FMGH 1JMXA 3MO1A 2ZOWA 4JJOA 3MA9L 1NUGA 1KC5H 2BY2A 2VUYA 3BEVA 4KRNA 5GRXG 1RIUL 3S4RA 3NA4A 3DBSA 4WHYG 3WY3A 1QFWI 2YUWA 5JQIB 5MENE 4JM2C 3GSNL 1CXIA 1B6UA 5I24A 1U8JB 1YQVL 2AJ3B 3QYNA 2POHA 3QR2A 3FSOA 2QSTA 4G7VL 4OLXL 3ZRFC 1G1IA 4KDTA 3BOVA 3LEYL 2K88A 3SYPA 3LKOB 2R39A 3OR7B 3BASA 5I9QB 2R29A 4PVMA 2ORBH 3L9YA 2KH2B 2W0FA 4NQVA 1XGQA 4M8QB 4K5LA 2FJHA 4CW1A 1WG3A 2FQDA 3B5TA 3NEXA 4YQXH 4N0CD 5I6KA 1EO7A 1PG7H 2V3FA 4JHVA 1CLYL 2CDEB 4FZEH 1QVGO 3S48A 5I5IA 3G4SP 3GUTB 1ZLVK 1A7NH 4IU2B 3BYTA 1HESA 4OBSA 3NCEB 4AEEA 5T3ZH 1U58A 1LJ2A 3D34A 3PDGA 4JRXD 1IQWL 4JGMA 2OMZB 3B9KD 4YXLH 1E4XH 3S3CB 1CTOA 1JK9A 4L73A 1A9EA 1GOFA 3OZ9H 4WFFE 3AROA 3GGWA 3QO1A 5CKGA 3QI9C 2BRQA 5ALBL 2Y1YA 1P7QB 2FZ3B 4H13C 4LPYA 3H1KE 1I7UB 4PJIB 2E75C 5DMGD 4EF3A 5GHWH 4OI8A 3LN9A 2BS71 3ZIMA 1FOSE 4YDKH 1RK0B 3INUL 1CL7H 1I9EA 5EOQL 2XG4A 1QTSA 3SCMA 2H0FA 5L2KE 3NMDA 3HE6A 5KSAD 1E2VA 1TT6A 4OM1L 4PCYA 1IU1A 1LWJA 4F2FA 2LFGA 1PY9A 1TKWB 1H5BC 1MCQA 1M2VB 1UOWA 3DO7B 3RE0A 5IB2A 4DZBB 5IGXH 4Y4FA 1UH3A 1U3HA 5EZOL 1R3LA 1BXXA 2ZPKL 4TQEL 3SODB 3FUNA 1ZEAL 4AYFA 3X13A 3ZL4H 2JLLA 5GS0C 3SJVB 3F7QA 1MUJB 3HAEA 2JCCF 4PGEB 4WW1A 1UUSA 3H3KA 1ZA3B 4XPTL 5E00A 2Z65C 2BDNH 1CLOL 2YMKA 1ZHLB 4K3AA 1YJWP 5T1LA 5IKCA 3QFJA 5DTFA 1NSNH 4NZTH 5CJBA 1UM5H 3EUDA 4JY6B 5F7BA 1JZIA 1QW9A 4FNLL 4NN6B 1F45A 5ADOH 1AVOA 4D3CH 5HDRA 5CJQH 4EQ3A 3CHSA 5C70A 3TBVA 4WSJA 2C5DC 4PG9B 2F5BL 3D30A 3SPCA 5AVVB 4G9FE 1N64H 2K9JB 2O61A 2OQJA 5I2IA 2Y36H 3J8F7 4AT6A 4ODWA 4Q97A 1MFZA 2P8LA 2CJUL 3L4FA 3L73J 2JSFA 4H0LB 1BXVA 1YEKL 4FQXD 4LPUA 4OZ4A 3S5LA 1EXHA 4R5VA 4F9LC 3FL7A 4KJYA 2VDNH 1IM3B 2OTKE 1KQSO 3F12A 1PFIA 2BVPB 1OPGL 4UDTA 3OXSB 4CSSA 3FT2A 3BKCL 1A1MB 1KELH 5C0CE 2DQHH 4WSKA 3M0DA 2ED9A 1YITP 3JV6A 1FNFA 1N26A 4JPIA 4JW3A 4MJ5A 3R1GL 3JT0A 1DVYA 1JRHL 1XVSA 1NEZA 2CWRA 3TYFB 4BK4A 3QQ9D 3LIZH 5KSBB 4LU5L 1MJJB 4KO5A 3RU8L 3NBNA 3DVGB 5E70A 4BSVA 5DSCB 3ZOAA 3QZMA 5EN2A 4NO5A 1HHJB 2UV3A 3HBQA 1V10A 4PP1C 4QCIA 3SE4A 4DOHE 5J6GA 1G94A 4XMXA 3QEGH 3ILPB 3LZFL 4APXA 4HJ0D 1BGXL 5DCCA 2C1OB 1UCTA 4OUUB 4PJXB 2PETA 5C3LD 3BJ91 3OTTA 5CCGD 5KYUA 2EYSB 4G5ZH 5CEXB 4I8DA 2WOBA 5FOBA 5CZXC 4G7YL 3G3ZA 3EYFB 5KBKA 3VI3F 3QEQA 1Y9BA 2RA1A 3NACH 4LCWD 2CKBA 1PSKH 3WD5H 4YXKH 3SY0A 5DS2A 3MRLA 3KJ6H 3ZLQC 2DV6A 4ODHL 3SPJA 5CCHA 3OA7A 1E2WA 2IALA 1D5ZA 1J8HD 2I07B 2XTJB 4HZLA 4X9BA 4Y4KA 5C07D 4J3OC 3V79C 4TNWK 1JCVA 2ZAEB 2PR4H 1QO3B 1CQYA 1HXKA 3L7FA 4UV7L 2OSLA 4MZ2A 4FEMA 4HUCA 1AI1H 4YLQT 3P9WB 4IJ3B 4R7DB 3V0GA 4S1DD 4TL5A 2K0RA 2IH1A 3QUMH 5IB5B 2Z7YA 2JCCA 1ADQL 1ZLWK 1OTUC 4ADGA 3M0AA 4I0CC 4IIZA 5KVFL 3DSFH 3RDJA 3MX0B 1CXKA 3C08L 3GBMH 4AEFA 1I7RA 2GB2A 3LMJL 4OZGE 5CJOL 4G6FD 3BCCJ 2VM4A 3ARWA 4X6CF 1TR7A 1DVFC 3KXFD 4PS4H 5A7BA 1JV2A 2IBZX 3MUZ1 4IW4C 3BPOC 4HKZH 4TMPA 5DRZA 3O2DL 4XXCA 5J06A 5AB2A 2FIKA 1G6RA 2XA8L 3TS8A 3TM6A 1SY6L 4JG0H 3AG4B 4FTVD 1F4AA 4XVJL 3UEQA 1ZGLM 3DRQB 4QHLB 1SN0A 4E9QA 3ARBA 4X5LA 1K73Q 4IIQB 3VFPA 2QSQA 4I2XA 5JPNA 4JFFA 3S8GB 1T2KC 2QADD 5KVEE 5GZNA 1DFXA 1SYVA 2VLLB 3N2JA 2GSIA 4XGZB 5BU5A 3RI5F 1W0VB 5I71B 2JI3A 3JT2A 3QUKA 1OAKH 2OYHC 2JKLA 1P5UC 4LARL 4PJ9D 5GQBA 2ATAA 1ZS2A 1BD2A 1P4LB 3O4LA 3A6OA 1H88A 2YPLA 1RMFH 2WXQA 3PL6B 3KYMA 1COBA 2Z0UA 5F3FA 2VZTA 3LDBC 4JDEA 2BSBA 4UF7C 2P5EE 2WUCL 3GLEA 1YEFL 2NX5B 4LF3A 2BVUA 1D2OA 2ALAA 3F7YA 2FY8A 1AGCB 2OARA 2ENYA 3P11H 4NI6A 5FCUH 1WFOA 3PNWB 1QVFO 2WB1A 3IJ9A 3FNKA 2KERA 3K0WA 1ODUA 2VDKL 1JVLA 1JWSA 2OTWA 4HWBL 4WU5A 4NBZB 4ZOEA 1WMKA 2IO5A 2OMTB 1AQDB 1I7TB 4BQ8A 1KULA 2FT7A 2QL1A 3CLEH 3RVXC 2JJSA 1ECYA 3NT0A 2LABA 5I1LB 2F54B 4U2YA 2W80C 1KGCE 3GEWB 2WLLB 2JIXA 4R4ND 5E7FA 5H8DA 4YE4L 5I19L 3PIQA 1AGDB 3ZN6A 1K4CB 4X6BB 5EPMA 4AIZA 3EDJA 1A0QL 4MLSA 1P6FA 5ANMB 4C4KT 4RAUB 4Y5YB 1LP1B 3U0PB 2X2UA 4ZW8A 1P2CA 2G60L 4QUOA 2XT1B 2VDOH 4OD3H 4ZMZA 1UATA 1X8YA 2ZUQB 3NESA 1EAPB 5CEZH 1QLFB 3MTXA 3DIVA 1X22A 1F4YL 1VAHA 2VZ1A 3K6OA 4LASL 4W1TA 3H1JJ 5APYA 5AW1B 1E3FA 3WJMA 3KYQA 5GGUB 4TUJB 1GAFL 2H2SD 1WBYA 2DQTH 2DQJL 4NJAL 4R7NA 5DVPA 5TD4A 5B5EH 3I9GH 3VI3A 3TEZA 1JXKA 2WOYA 3VXUE 1IEBB 1Q9KB 1OCWH 5ELIA 35C8H 4AGMA 1W2EA 3TN0C 1RCYA 3BSHA 3ZRCC 2H4EA 3MV7A 3H54A 5IMKA 3MCYA 1AD9B 1HHGA 4OJCA 3REVB 1N4XL 4DIXA 5F96L 1ZLDA 1JN6A 4RIRB 2GT9B 2G4GA 4DQOH 2YEQA 5EORL 3BWSA 3RWHB 1NBCA 2OTUA 1MCKA 1WJ3A 2YN5A 3F5HA 1T7XA 3K3QA 5IB1A 2KK7A 3A0HE 3KPLB 3H8NA 4FQLH 3ZZSA 4GNKB 4MLIA 1S7XA 4G2AA 4GFXA 1ZRTD 3DJSA 1E27B 1GU4A 3RL1A 3HZ3A 2HH0L 1XGUB 3IJYA 3DRTB 4J3SA 3QA3B 3FULA 1RHFA 1H0DA 1CVSC 2LTQB 5BO0D 1YN7B 2YRLA 4GIPD 1KPVA 4L05A 4ERSL 5GXBB 2VM3A 3GM0A 1FC2C 2Q86A 4X6CA 3VSTA 5HYEA 4KKRA 3FUHA 1IGIH 2LVEA 1KCRH 4O58H 2GJ6B 1NGXB 2WXJA 3IWVA 3PUCA 3CWBJ 1KV7A 2H0PA 2QMJA 3DECA 4KJPC 4WWKB 5C0AE 3T2NH 3MZTA 4U3FG 4AV4A 3MRKB 2QQNH 1JNLH 4ZS7L 4FFWD 1YYCA 1MFVA 4HHAB 2LLNA 4M03A 3JTBA 4DKAA 1U8KB 2HPOA 2YGQA 2FL5B 3PJSK 1RULH 1URZA 5D4IA 3UL4A 2HLFD 2ENJA 1M7DB 3HG1A 2DYPB 3C9NA 1VIWA 4XNZB 3TBWA 3US9A 4Z7UB 3AE4C 1EJFA 3KVDD 4Z7VE 5D1QA 4OGAC 1SLUA 2HLAB 4H8HA 3S3PA 2NYYD 4LLYB 5F0JB 5KVMC 4H8WL 3SY6A 3SWKA 1IC1A 4P59L 3FZUC 5INDB 3S6CA 5EBLA 4WAFA 4LKCB 1W0WB 3GXNA 1W72H 2A45I 4ZFOL 3V5DA 1MFUA 5C0JA 5AVSB 4GKNB 3LQAH 1EZVG 1XH2A 2L7JA 1M8OB 3QWOA 1KORA 2E76C 2X44D 3N44F 1UXWA 2WSDA 4RWHA 2XXFA 4NI3A 2UZXA 3CVHA 3IMUA 2H6OA 2J6EL 4Y2DD 4QTIH 5LGHH 1IVTA 1OSEA 4XNYL 3U7AA 4ZODA 3WSQL 2LLGA 3GXIA 4MCNA 4M3HA 3A6BL 2P1JA 4YIQB 4MBOA 4E41E 3ATDA 4AEHL 4YO0B 2VC2L 5E2VH 3F65A 5CMZA 2RFXA 2OMXB 3E6FA 3EYSL 4K71C 5DMKA 2XETA 4P46C 3V2NA 3L70D 1XIWC 2CGYA 4FKHA 5AAWA 1EEYB 3EO1A 3H1IE 5F1KC 1GIGL 2X1OA 4CDGC 1BVZA 4NYLA 1HCFX 4OLYL 3RGVD 4FGMA 4ONFL 1KMIZ 1FHGA 4BZ2H 3RPBA 3TBSB 3PAVA 2KXPB 1L0LD 5CBNA 1XH3B 1L5GB 4G83A 1EHLL 3LD8C 1DFBL 4LIQL 2IXQA 2WXOA 3NN8A 2L7EA 2ATPB 3WMPA 4HWZA 2PFXA 1T6BX 3KLQA 3EGDA 1PLCA 4RGNE 1NC2B 2CPBA 3H25A 1Z1WA 4XXDA 2DRUA 2XYCA 2Q8AH 3SGJC 1CGXA 3AGVA 3WTTA 5GZOC 2C3XA 4R96B 2Y23A 4FS0A 1OWRM 4MA7L 4OLUL 3MLWL 1A3LH 4MMZB 2VB5A 1EDIA 3IAGC 2COVD 3DUUA 1KILB 3CFNA 1EDYA 1M53A 2LV4A 4RLDA 4ZX6A 1T0NA 1T6WA 1ZIBA 1ZT4A 1YPZB 4NBXB 4ZW7A 4A7VA 3RFZC 4H20L 1RZPA 3QVAA 4FLHA 2XICA 5CGTA 3IGAA 4NO3A 2FO4B 4B7IA 3MVSA 1NPUA 4U31A 1WK0A 3CMOL 5BRZD 1ZMEC 3KHOA 1SQXD 3QZPA 1KJVA 5CGYC 4HCRL 3O3BA 1HT6A 1AIFB 3EHBD 2VLRE 4GKZA 1PKOA 2NY1C 3FFOA 4LEXL 3WS3B 5D7LA 2WLKA 3I6GA 2MKVA 1DDTA 5MEQA 3MCKB 1K4DB 3DXAA 4RAVB 3DPDA 2OXGB 2MEJB 3QS2A 4GP5B 4GT1A 1CS6A 2B89A 1LTJA 1MAML 1TTAA 2DM4A 2V8MA 3MNVA 4X4MA 3V4PH 3WKMH 3LPPA 3U46B 3X3FH 2VZOA 1EO5A 3OHXA 5CFAA 1V3LA 3NFNB 3ROLB 3VRIA 4Z7WF 4YUEL 1RLWA 1VCBC 3IN2A 4MSWB 4A7TA 3CHRA 2WSEJ 2R2EB 2G8YA 3EJRA 1FNAA 1MFDL 3R8BB 2Q1EA 5B8CC 3IDXL 1MREH 2Y72A 4OLVH 5K9JL 1SLQA 3S2CA 3NSYA 3PE9A 1PIFA 4F7MA 1NEUA 3WS6A 1C5DB 1G9NH 2IG2H 3HPLB 2W91A 2QG4A 8CGTA 1NTME 1UGNA 2PCFB 4B41A 1DD3A 3RWIA 1ET8A 2PPEA 3DV6A 4TT3H 3CZEA 4HIHA 2FSDA 2VQ1A 1J5OH 1RZIB 2CDFB 4XBPA 4L9DA 5AAPA 4BH7A 1SFDA 3M8OH 1KJ2L 3DROB 4JREC 3UC0H 2W27A 3HE4B 1JYWA 2AGJH 2G4EA 2VXUH 4JZOB 1OW7A 3ZE2E 4PV9B 3RWJA 3O3EA 3O2DA 3FTXA 3LNDA 1KXVC 3RA7H 1LK3L 3LH8A 1WFTA 3V6OE 2VMDA 1IK9A 1L0ND 3D9AL 1SY6A 1MV8A 2YK1H 5HHPA 1HZHL 3IDGB 4YGVA 3FW6A 5EF0A 1U8LB 2EJ1A 1VLXA 1DSWA 2R69L 1SBSH