3A3YB

Crystal structure of the sodium-potassium pump with bound potassium and ouabain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
278
structure length
265
Chain Sequence
RTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEQLQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the sodium-potassium pump (Na+,K+-ATPase) with bound potassium and ouabain.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 54
structure length 265
sequence length 278
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3a3yB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 3a3yB02
1CI6B 1H89A 2VRSA 4I6MC 1MV8A 3IR9A 2W6AA 2KP8A 1NWQA 2XV5A 4GKGA 2Z5IA 1GK6A 3L37A 2WT7B 5AVZB 2YNYA 3VN0A 4AUWA 2XU6A 4JYCA 4LC1A 2ZFCA 5AW5B 3HE4B 2Z5HA 3OAKA 1GTWA 5AVUB 3VMXA 1H8AA 1FOSF 5AVVB 4B86A 2WPSA 2P7JA 5APSA 1S9KE 3I5CA 3KDPB 1NAFA 5APXA 5AVTB 1HJBA 1FOSE 2E42A 2ZXEB 3B8EB 5APUA 5AVSB 1G2CB 3O8ZA 3V5BA 1JUNA 2R3CA 5APWA 3TNUA 3V4QA 5AVXB 3SWFA 4AQRD 1GU4A 3L35A 3A5TA 1GD2E 1JNMA 3HE4A 3NTNA 3TYYA 4RETB 3NMDA 5AW1B 2Q7CA 3M0AA 3WGVB 2R5BA 3M0DA 3HTKA 1MFZA 2H7HA 3VTPC 3HE5B 2P2UA 2YO2A 3M06A 1IO4A 2IPPA 3WGUB 1CZQA 3TK1A 2N9BA 4AYCA 4RESB 5AVQB 2R32A 4DZOA 3LIDA 2Q5UA 3M9HA 5AW8B 1HUCA 5AW2B 3P8MC 3TNUB 4HYTB 1KQLA 5AVYB 4GT1A 1A02F 2C9LY 2QM8A 3V4WA 5AVWB 3VMYA 4C7NA 1SP4A 2WWWA 2W27A 1S9KD 1T2KD 2WTYA 3A2AA 1GU5A 1YYCA 1H88A 4C7NB 1OXZA 3MD0A 5APTA 5AW6B 2WT7A 2QM7A 4C46A 2WPRA 3T97A 1J2JB 5AW9B 5APQA 4XE5B 3UIAA 5AW7B 3NFQA 2R5DA 5CMZA 2E43A 3HE5A 3LIEA 2P67A 3P32A 1HWTC 2Q3IA 1FAVA 5AW0B 1GZLA 3A3YB 4EOTA 1MUUA 2C9NY 2JJLA 1HBWA 5AW3B 3KQGA 1CI6A 3VMZA 5AW4B 1DH3A 3M9BA 3NXSA 3VYIA 1T2KC 3P7KA 5AVRB 1A02J 2BASA 1OWAA 1X8YA 4I2LC 1SLQA 3A7OA 4JYBA 3MGNA 1CSBA 1GK4A 4KHXA 2WPQA 3L36A 5APVA 5APYA 2XZRA 2YO3A 3M91A 4M3LA
chains in the Genus database with same CATH superfamily
2C3XA 2Z4QA 4EXPX 4FFWC 3MZGB 3AADB 3IDGA 4X5QA 3OKEA 5L8LB 2Z4TA 4Q97A 3TPUA 1A7QL 1PDKA 1BJMA 2VXQH 2LU5A 5G5DB 3VXUD 2UUDH 4GJTB 5T1MA 1TQCC 4QRRE 1F3DJ 3H9ZA 5GJSL 3I5CA 1MVFA 2ALWA 2XTSA 4UOJA 3ARGC 3TA3B 3W9DA 3FFDA 3SGDI 3DJSA 1ZTXE 1HT6A 4MD0A 3FS9A 3MODH 4I1PA 4KXAA 2FGWH 1N6QL 2ADGA 3Q8CA 4M29A 1LM8V 5I66B 2UY7A 1FN4B 3GMLB 4YSRA 3RWIB 1YUHB 4I1LA 3TYYA 2H26A 3B1TA 3QEQB 4G7RB 2DMCA 3PXHA 3UG4A 1QLRA 2B59A 4PJ7F 2AEWA 2LV4A 1L9SA 2YGVA 5D6DC 5IJBC 1C5CH 1KN2H 5CSBA 2BSSB 3HG5A 4MXWH 1FNEA 3GTTA 2B1AL 3IXAB 4CSSA 1Y18B 2OW6A 5D7IF 4QCIB 3O3EB 1USZA 3ZDMA 2R2BA 1TDQA 3WOVA 2N9BA 1HXKA 1D7MA 2FJHA 4J6RL 4UQEA 1HXYB 4XPAL 4EI6A 5K9KA 3Q05A 4U1GC 3PIQB 3DHPA 4U7KA 3KWVA 4KKAC 3GW6A 3V9CA 1FZAA 2HT4C 2XY2A 1QSFB 2X4NB 5SWZB 4U1IB 4CMHB 3ULVF 4BYHA 5ICZA 3Q01A 3R18A 1ZVSA 4G1EA 4TTDC 3MR9A 3UXFA 4U4IA 4URTB 4PJIE 1VJSA 2MKVA 2X89D 5DS2A 4PRNA 3F7LA 3M1BA 3IDXH 1XH3B 1QBLH 1X5JA 4UT9H 1G1JA 1YA5A 2J8UA 3UERA 2FYZA 2MIZA 2Z93B 4QF1A 1J0YA 4Z7UB 2W65B 1AGDA 1D2PA 3QFJA 3PHQB 4HF5H 2O1AA 3QB7C 4YLCA 3L71D 4UB0L 4FL4B 1WBXB 4X9YA 3UDWC 1K9MQ 1O7VA 4HIPA 4LPUA 2Q6WA 2CZNA 4IMLB 3HNTH 4PJXB 2C3VB 4WO4C 4U7SA 4GLRH 4JS7A 3Q5SA 3IJYB 1EUTA 5ESVB 3DO7A 1KJ2A 2V4LA 5D7LD 3OG4B 2JWYA 1NUNB 2PKDA 4KK5C 4JMXA 4F9PC 5FYKE 4N2LA 2NMSA 3QEQE 2FLBT 1KXVC 5AW3B 1I8MB 5FM8A 5JQ6H 1EXUB 4MWFB 3C5ZD 3TS8A 4OZHE 1VGEH 2AK4E 4WFHD 3ECBA 3L48A 2IH3B 3D09A 3PQYA 4OF5A 4TN9A 5EN2A 4U3HA 1OVZA 3CU1A 1MAML 3QP3A 1EIBA 4HUMB 4PJGF 5MEOA 1I3UA 4DO5A 2MKWA 1PZ3A 3OPUA 5I15H 1BXUA 4DKTA 4WGVB 5D7JC 1SQBD 1RZ8B 2VN7A 5DJCA 3T4YB 4PJDA 1R5WA 1RP9A 1LMKA 3GNMH 4X9HA 2CAKA 1VFBA 1UQSB 4L8SA 2ZFCA 1QBML 4M9PA 5T1LA 2WVVB 1VF5C 1J0IA 5CHNB 1RK0A 1UA7A 1F6LL 1KLUB 3QEGH 1BJ1J 3COOA 2CDFA 3M1OA 5JR1H 3RVWD 4DGYL 3BZ4B 2VNCA 2ADIA 4UQCA 3A6CL 4BZ1H 2IWEA 4YAQA 3VTAA 2KDGA 2MRYA 3BATA 2JKNA 5C9JB 2WQVA 3LB6C 4XMXA 2NX5D 1SJMA 4U6VL 3WMM0 3F65A 2BVPB 1BEXA 3D39A 5E1QA 5JIDA 3JUZA 5EUOB 5MEPB 1AXTL 1RUQL 4P2RB 1YY8B 1G43A 1U57A 4DZBA 3CHQA 4M6OL 1SPDA 3HUJE 3KG5A 3O41A 1C7SA 1FVDB 2MPAL 4TSBH 1NO4A 4K3JL 3VWJB 3QEHA 4LSTL 1FNGB 3EYFB 4HH9B 4YSPA 4FJZA 1XR8B 3NAAL 1TTAA 1TZ8A 3WN6A 2JELH 2A9BA 1KBBA 4JFDE 4ODVH 2VLRB 4XFJA 4TRPL 1ROCA 4WWKA 4OTXL 5HD8D 3FFCD 3CCHA 3O6KH 4XOBA 4B60A 2HP4A 4CADA 2P10A 5F3HB 5GISH 1YYML 2EDLA 3LQZB 3QUXC 4KTGA 1I1YA 2A5UA 2PP9A 3UBXB 5C1MB 3B37A 4MA1C 2D31B 3TCLB 1PSKH 5A2LH 3GIVB 4XMVA 2E5EA 4LGRB 2YKPA 1MCRA 1FAKT 3T0EA 2X7LA 5ESQB 1VQ9P 1BVNT 1Q9KA 2C9VA 4YHMH 3WUWG 1QRND 4NWTH 1DCEA 1XGPB 3UP6A 3ZIYA 1URQD 5GS1B 4YE0A 1VQ7P 4L74A 3FTGA 1OAZH 1I8LA 1T5WB 1X44A 4LLYA 2ICCA 4GIOA 1MG2C 5LN8A 2K4AA 2CRIA 1H88A 3K2UL 1Z9SB 2PYED 4Q9BA 4PJ7B 4J3SA 3PFUA 3LNHA 3MTUE 3GDCA 1E27A 2FHFA 4FYTA 4LLQA 4OZ4B 1P4BH 4XO4A 4DO4A 4E0RB 3T97A 4KJQC 3K6IA 3VWKB 3WDHA 2EVJA 1OALA 1S5HA 1U91B 5LGJB 4JFXB 5C8JB 2OZ4L 3PL6C 2GTQA 5LQBH 2F74A 3MACH 3LS5H 3EFOB 4M1DL 3EO9H 1CT8A 4X9IA 1ASOA 3NCEB 1PNCA 2XVBA 4KKBD 3EDEA 2FTAA 1Q1JH 3EO1A 5JXAL 4I2XA 3G5ZB 3Q2WA 1A3QA 4KGJA 4WI4A 1YPZA 4FTDA 3MCKA 2BNUA 3GDBA 3PWLB 1SFCC 3IFOA 1A21A 4MD5B 2WMPA 2OYHB 1KCLA 3LEXA 3RAJH 3J07A 3GBNH 4YEFA 5KLVE 1HH0A 1INQB 3ARWA 4NI3A 3B2XA 4WKZB 4Z7OF 1S6NA 4Q6IC 3RPKA 1P5VA 2P5WD 2R83A 5DK3A 1LTXA 3CIAA 4JBZA 2WXRA 3PNWB 1NH4A 1AHWA 3D48R 3V0VB 3OW2O 2AQRA 4G2AA 4LCIL 1E9OB 2ZSWB 3T3PB 1IGJB 2IVFC 4AUUA 5JHDD 4M48H 4OLUH 5E2UH 3P4OA 3QORB 4MNQA 1WAAA 3Q8AA 1MREL 1SQPG 2R0KL 3EJUA 4J4PA 4KC3B 5ETUB 1S4XA 1R5SA 1AXSB 2JJWA 3WFZA 5HGBA 1WBZB 5E56A 1VDGA 4M5SA 3REWB 5C2BL 2E47A 4AV0A 5ISZB 2B3RA 1T03L 1FFPB 5KJ7A 2R0ZL 1Q81Q 4DESA 4OB5L 1JBJA 3P2DA 3OG6B 1EZVE 3X17A 4X0KA 3DXAD 5HHMB 3STZB 2F1AA 3U4KA 3IFPB 4L29B 2CK0H 4KVCH 3MFGB 3RY6A 4JGMA 2A4ZA 5DZAA 3UAEA 5BZWA 3NFSH 5GJTH 3WUWA 5KVGL 4NCDA 5JW4Q 2BDNL 2B4CL 4S0SD 4FQHB 3VDCA 1U8CA 2PWFA 2VDQL 4PD4H 3SGJA 1TKWB 4JKPL 5KAIH 3VVWA 4ABQA 3CUPA 3T2OA 2ZJSH 1P84K 1OAKH 4N0UA 5D7LA 4C83A 1WZMA 4OI9A 1WGOA 4O5LL 4PRBB 3JV6A 2VN6A 5FR3A 4N28A 4ZOBA 3CFUA 4R6UA 5TDPB 1PEZA 4PWEA 4OZGB 1GC1H 2OTWA 4GSDH 3KHUA 1HUCA 1H6UA 1P53A 2I07A 2WXKA 4MJ6B 4DEPC 5CD5D 2AMGA 3IMSA 3C8KB 2C0XA 3SO3C 2WUBH 5AB9A 4MMYB 3QUHA 4D3CL 3K0WA 2IBZE 1CGTA 3O2DL 4PREA 1QPKA 4NKMA 1XIWD 4CJ0A 4BV1A 1E8WA 2BNQE 3HI5H 2HRHA 2PPDA 3WUTA 2GCYB 3EUDA 1B90A 5J3HD 1SVCP 4H2AA 3QNYB 3VSUA 3WKPA 4HGWA 2L7UA 3OWEA 5H35B 3ABLB 1S7WA 1YEIL 4MVBC 4NKOB 4A67A 1I85A 5I30L 3NQIA 3UYPA 1J0ZA 1XIWB 3WNJA 4UINL 5KJ7C 4FZEH 2B0SH 2F15A 2P47B 2BPBA 4AYID 5FFLA 5DHEA 4DAGH 1ADWA 2XQ0A 1JGEA 3LRSA 4U3XA 1LMIA 2D8KA 2EZ0D 1MHPL 2HJFB 4FNTA 3MJ7B 5GHWH 5C0GA 5IIEA 3MLYH 1YNTF 1UENA 5INCB 3PPSA 4NS0A 1SOXA 3C2SA 3H42H 5BUGA 2ZONA 1GHFH 3L70G 2YAPA 2X6CA 5HHNA 2HRPL 1TJXA 1P69B 2ZOOA 3KPQA 2A74C 1TZIB 2N7AA 2X0WA 4ERSH 1FO0A 3VACA 5FM4A 1W9XA 4IEFB 2BS8A 1QA9A 3FFCA 3SBPA 4JYCA 4OGYL 2KB7P 1MCHA 3MNWB 1BZ8A 1U2CA 1LE5B 5LBGA 1WEJH 4O02A 1U58A 2H3NB 4AH2B 3IAQA 3QUGA 3IETB 2J1ZA 1M6UA 2OYKA 1UXWA 4X6EA 3T09A 3KPRA 3S34H 4PJ9A 2VLRD 3FUMA 2EICA 3MRQA 1IC1A 2OMYB 1TTGA 2R23A 3I2CL 5G4NA 3E1RA 4X4ME 1IQDA 2W9EL 2C1OA 3Q6GL 2AMUA 1UT9A 3NSFA 1U8LA 3QDME 3NIDE 3ZT7A 2MQ0A 3BP7B 2X1QA 2XZAL 2MNWA 1CTNA 1DLFL 2NY0D 4HJJH 4WI0B 5E8DL 3UTZA 3CTTA 4B41A 3K2IA 4FCHA 4MJHA 5KAFE 1Q0XL 3IDMB 4QXWA 3T0WA 4Q52A 4X50A 4JN2B 4Y4HD 5E1HB 4KI5D 3QWRA 6PAZA 1YTZI 4X0NA 5I6KA 1YEJH 4UILL 4YHIA 3LSOA 1ZRTD 2F54B 3FYIB 3Q44A 4XMKH 4XP6H 3QH3B 1A3ZA 1UACH 1J5IA 1ZW0A 3ELAT 5FYLL 5GZNA 4TSAL 1AE6H 2XZQH 4NQTA 2R51A 3MYJA 5KSUA 1VADB 4HFWB 5AL8A 3TA3A 4YPJA 1BVLB 3FFDB 3CSFA 4X80L 4ACPA 3VMYA 3IBOA 1X7TA 3OKLB 1D5XB 2R29H 2DL9A 2IBZX 1Q0EA 4H8PA 4D6TE 2BOBB 1ZV2A 4RFEB 4XODA 3TT3H 4RJTA 2BXZA 1ZGLM 2XRAH 3ALWA 1BQKA 5C3IA 3N7NA 2WPRA 1IFPA 2NW3B 1MXGA 4GI6A 5ALBL 3B5GA 3N6YA 3GC3A 4DEPB 1A5FL 1S78D 3QIWC 3T65A 3RIAK 3TH3T 3NJNA 4AZ8B 3VXNB 2ZKXA 2R59A 4GMSL 4GINA 3O2WL 4UT6A 4WNQA 4R4MA 2FNBA 5T3XE 2WSFJ 5KBMA 2ZNWA 2QMJA 3MBEC 1KXTB 1FHNA 3HZMA 4U1MB 3LNDA 5E6YA 5KANG 2Q87A 3VE0A 3L74J 1E5YA 1ZKAA 3Q2LA 2A6DA 3PV7A 5E8EB 2WLJA 1OP9A 5FAAA 1PLAA 4TNVF 4CBZA 1XQ4A 5K59F 4TL5A 4G70B 4RMSA 5I1CL 1E5BA 3D4GA 2YBGA 3MOBL 1GK4A 3N0AA 2XN9D 3FGAD 4NZJA 4TLSA 4XGZB 2I9TB 1CFVH 1COBA 1S4IA 4P3DA 1JF6A 3MJWA 3TP4A 1MCCA 1T66D 2ZKHH 5ITBH 1MXDA 3OXSB 3TYFB 4G6KL 1NCAH 3DMMB 5FO2A 2OMXA 5LCVA 3UYRL 3WD5H 4OJEH 1RIHL 1T80A 1SFDA 4KNUA 1QVGO 1ZXKA 2P8PA 3M8OL 2PCPA 4EZLA 5APSA 3MLRL 1S9KE 2N7SA 3G4SP 2Z8SA 4M7LH 2MPVA 1G9MH 1XGUB 2XWDA 2P24B 4Y2OA 7PAZA 2D03L 2VR6A 2NZ9D 5EOCL 1SYVA 3M9QA 4F20A 4NLAA 2NX5E 4BCXA 5EOQH 2CO6A 4K7PX 2TSBA 1J5HA 5BRPA 5FCUH 3MKGA 3BT2L 3QCTH 1YBKA 3L4UA 3V79C 1YN6A 2D73A 3CQPA 1PLCA 2XQYG 4KX9A 5L88L 5KYNA 1UH4A 2AJVL 3PAVA 4NYLB 2X05A 3TBSB 1UB6A 1N8ZA 4PHXA 1DCLA 4KOCA 4MB1A 2G5BB 2OYPA 3VA6A 2X42A 5D7EA 5IF0A 1S7QB 2YUXA 5IFAL 15C8L 1AGFB 3BN3B 3NEXA 4TQPA 5F9AC 5TGBB 2R32A 3LPGA 4HXAH 3LHAA 2WLLA 2VIRA 1FJKA 3CVHL 2WVRA 3ESOA 4LSSL 1OAYH 3EGXB 2J8UF 1X5KA 1SS1A 2IANA 4BFIA 2FJSA 2N0KA 3N44B 3VMPA 3AAZB 4K7PY 4TVSa 2BP5M 3H9SA 3BSZH 4OIIL 2O6EA 1DO5A 4ZAKA 4U1SB 4AYFA 3SPIA 3M1CA 5DVMA 5D6DA 3RPIA 5ADOH 1GGTA 2PR4L 4CC0A 2M1KA 2P5PA 3B2VH 4WCYH 3VI4B 1N7SC 3QI9A 4OFDA 3WL9B 4OZIB 1JV5A 4C56D 1WAEA 1XFPA 5EMYA 3NABL 1NC2B 2IG2L 4ZO7A 4FNPA 3U0TB 5I1JL 3GHBH 1JXKA 4JY6B 4Y5XC 1NTDA 4BHUA 3V7AG 1O75A 1NBQA 1ET5A 4G5ZH 4G3YH 2ADGB 1NTKJ 4S2SA 2HTKC 3KPRD 3OJMB 2VLRA 1EZVY 4J3UA 5DJAB 4G43B 3VI3F 4HSQA 4JKWA 1EGJL 1MW2A 1J05B 2CPBA 2CLRB 4NAJA 1UB5A 2XZCH 4DZ8A 1HYSC 1DQLH 3II2A 2GJRA 3KLSA 5KYXB 5L2KB 5BUAA 2QSQA 4EBQH 3KJ6L 1HS6A 5F96H 5AYUL 3GLDA 4CW1B 3CFNA 5KTEH 1OX3A 1AACA 4I5BB 3W9EB 3ECBB 3FZUD 5CJ8A 2HT3C 1CI6B 2VZTA 1BEYH 1PL3A 4GP8B 3GJEB 1HH9B 4X6CF 2GJZB 5K9QG 3KGUA 4WV1C 5FWRA 1K8IB 3QFJD 3CVDA 2FX7H 2P8LB 1UHVA 1B2WL 4M7ZC 1EEZA 1FGNL 4NKDA 3IMUA 2E4FA 3AECC 4FJYA 4JFXA 4OZFG 5C8JA 1S3JA 2JJTA 2OR9H 4LRIA 2KLVA 1XH3A 5BRZD 2P7JA 1IAOA 4W9CC 3OX8A 5EB9A 1L2PA 1KYAA 5EHFA 1ACYH 2HXAA 5F7MC 2NQ3A 2XZZA 3T0AA 2ZXEB 3TIEA 5JUEH 3MV9A 4X9GA 1P5UC 4FZ8L 3G6DH 3WELA 3E7KA 4Q89A 1B3JA 4PBXA 3G6AA 4TVPD 2H9GB 3PXJA 4LLUB 4QRPD 4ZMNA 1H6EA 4I0PA 6FABL 2WXPA 4JFZH 4ONHB 2E46A 4LSRL 1KC8Q 4D9RD 2VDNL 1LEKB 1ORQB 4ACTA 2J6EA 2AJYL 4QHKJ 4CU6A 1XL4A 2D03H 1WIOA 4IRJA 4N5UA 4AYCA 1WK0A 3W9DB 1IU1A 1HJCA 3IEAA 4I4WA 4IOFD 3CMAP 4HH9A 4NJAH 4X6DF 5E4AA 2CR6A 3KCPA 4F7TB 4E9TA 4PRHD 3LH2H 3G5WA 1EXIA 4FFVC 2GC7C 1PJWA 4ONOA 3TL5A 1RJLA 1U8PA 1MFAL 4Y8AA 1TQSA 1U8OB 1OE2A 1HHKB 2AZUA 1NINA 3WFEH 2ZYSA 1E9QA 1I1YB 2COVD 3QJHA 3UBXA 4A7VA 4P23A 4N2MA 1BBDL 4XMUA 2V33A 5D7IB 4ZOAA 1SQPJ 4FXLA 1NICA 2XWBA 3GRGA 1U2YA 4LBAA 5FOJA 3U2IA 1J1XH 4NHUA 5FYKD 2ADFL 1A9EA 5D93C 2K78A 5CMZA 1MF2L 1NGYB 3A4EA 2N9YB 4H13C 4E0RA 4F7CA 3A3YB 2WCPA 2PPAA 3RK2B 1PNDA 3AZUA 4KDTC 4WFFE 4GMSH 4K4KA 2DM4A 3QORC 1SJEB 2O01N 3ZE2F 3ULVD 1I8KB 3ARBC 4AG4H 2I07B 2NY6B 3EFOA 4NDMB 4BRJA 5E5MB 1MZZA 4O2CA 4QTIL 3ASOB 4GYBA 1SQVG 3L72G 3GSNH 2CHXA 1EJ8A 1FZCB 3SKMA 2KSJA 1U21A 3CXHD 1SFCB 2D7NA 1R8EA 5LWYL 1IAKB 2BNUB 2KYIA 3GGWA 1QSFE 2J5UA 1RERA 3P3RA 4CNIB 2YLKA 5FGRA 2Y0SA 1L5GB 4Q4EA 2V7NB 1KIPB 1I4FA 3GIVA 2Z31B 4TSAH 1F4YL 4BWTA 2OYIA 4PRDA 2IAND 2R7EB 3GUTA 1FCGA 3PG2A 4FG0A 4BQ8A 2IFGA 4KDTA 1S7XB 3CH1B 2APFA 1UUNA 2Y0DA 2Z64C 4ZAKD 1ZLWH 2DWYA 1PVHA 1CGUA 3KYAA 1S5IL 4LLQB 4BUQA 5SWQB 5IOKA 4HUCA 1Q0XH 3FXEA 5IJKA 1CE1H 1Q4NX 1NTME 4JHBA 4F7PA 2XZAH 3TTYA 5CBAB 1MLBA 1KXVA 4LGDE 5JYLA 1JPTH 1JO5A 5FKPB 2FXMA 2UZXA 1MELA 3B7RL 3WI9A 4J3OG 4X42A 3M06A 3WGUB 3DX4A 4S0HA 3VGHA 1UKQA 1AFVH 1QRNB 4GQRA 4M62H 3RL2B 3FU8A 1Q2NA 3WFEL 4Y5YC 5CD3A 3L73E 2OYHA 2AANA 3LEXB 1HE8A 2NPLX 1P4LA 3ME0A 2V7HA 4PD4I 4D9LH 2RMZA 3MMEB 4BRYA 2KUTA 1U93A 3NJMA 5KJ7D 1AGEA 5CLTA 4PJ9B 4K9EL 4FQQB 2YKKA 2AP2A 3TO4A 5AAMA 4E9QA 3DI3B 1HZHL 1UZ8A 2MHAA 5F97E 2HVBA 3HAEH 1I9IH 4IRZA 3DXAA 2PF6A 3GI8L 1KGJA 1XGRB 3UC0H 4XX1G 2WTYA 2C1OB 3DOHA 3S36X 1MJJA 2H32H 3O3AA 4P5SA 2CNZA 4JG5A 3SBWC 4APXA 4B95C 2HKAA 1QKZL 3MBXH 3AROA 1UXLA 1VFAA 3EYQD 4Z18A 4HH2A 2ZYGA 2WP3T 2CDEA 3KBHE 4UQ2A 3M86A 4Z3HA 5KSAC 3FQTB 3RWIA 3TNNA 3CSGA 1BFOA 4UTBA 2IALA 4I9WD 3F5HA 3T6WA 2E43A 1AKJB 5F3HA 1OAUL 3H1IG 1RUPH 2NW2B 3OZKA 5HYSG 4XBEH 2ZWNA 4YHIB 1MCOL 5LAXB 3SOTA 1G0DA 1A0QL 2EYSA 4A6YH 2B14A 2GSIB 5BZWB 3Q3GA 4LMQE 4UTBH 5FUCC 4WU7A 4UNUA 3IE9A 1F97A 1RLBA 1XAUA 4ODWA 1H5BA 3FTGB 3INOA 1TLKA 3SQOL 1KWGA 3LKNA 1B0GB 3D69A 3RZCA 3TEYA 4BFEA 4NNPH 2AAVA 5FHBH 5DD3H 5IUCA 2ICWJ 5D1QE 3GTVA 5I74B 1FE8L 2VLKA 3FTVA 1TQWA 5HI5D 3LKSA 1TEGA 2UXTA 1UD5A 2F2HA 3IR9A 3FUKA 4XXWA 3VFSB 3OGOE 2GIYA 4LASL 1WZ1L 5E00A 5HVHC 3S3JA 1SQVE 3B6SB 4NN7B 3IGAA 4ANUA 1ZANL 5LDSA 1P7QB 1LXMA 1QBAA 4MS6A 5JO5B 1GC1L 3CPUA 5E95B 1QO3A 1A14H 1VACB 1FOSE 2UVFA 3Q1MA 2H6PB 5IROA 3NJXA 2FSDA 2WMPB 4A37A 1L4AB 2Z1KA 1XMEB 3I55P 4PB9H 5LBSL 2HX9A 5E8EA 3L3DA 4PJCA 1ED3A 5DD3L 4XMPL 4PGEA 4G3YL 4BK4A 3MRJA 5D8JL 1EK3A 4D8PB 4G5ZL 3OTTA 3NA9H 4ZMLA 4HZAA 4ZPTB 3U1PA 3IWUA 4ZKPA 5EEXA 3O8XC 4E68A 5GSRA 5HJBA 5TE6L 5TE4H 3HTKA 2YUWA 4K3EL 4EUPB 4JVPA 5CCHA 2E59A 4P4RB 4L1HA 3R0NA 1A1OA 3ROOA 2HUEA 4J7RA 1HWGB 1CZQA 4XVTL 3HHMA 5ADOL 2R0ZH 4IBTA 4JFVA 2A6IA 2QKIB 1F02I 3L3OB 3DVGA 5IUSA 1EX0A 1OP5H 3STZA 5KKZC 3T3PE 4I7ZC 1UEMA 1C1EL 3BVWA 3MREB 2A45G 4RZCB 4UOQA 1YYLH 1LP9A 4QUOA 4AQ8C 1HKLL 4BK5A 2CO4A 3LSOB 4PJ9D 3A0HH 2QQNH 3GD1C 3U2SA 2W92A 4QDGA 4JDVA 5ISZE 2WVTA 4LHJB 1IBFA 3F6IA 3WNOA 3WFBH 5IMMB 1DJXA 3AG2B 1HOEA 3DUUA 3U4EB 1CGXA 4U4BA 4IFMA 1W6LA 1N8OE 3KLLA 3LZPA 2FEEL 4M6NL 1JZJA 2AABL 1G6RB 2N0MA 3MUDC 2WSDA 1ZWIB 1QSEE 2YGOA 1JCVA 2R23B 3II3A 1CLYL 4AQ1C 3O41B 1FAVA 2CD0A 1U8KA 3DLQR 1FVDA 1VENA 2ZVNB 2R1YA 1QWUA 4NQUA 25C8L 2QJPC 1LWUB 4ZTOH 1E7UA 5A2FA 4AL8H 3MBEA 2J55A 5TK4A 2PCFA 5LQBL 3H9HB 3EGXA 4P99A 3CFJB 4X8JA 5GZND 3CN0A 1URQB 3BGAA 3OJAB 4LU5H 2Z35A 5DVOA 3W82A 2YMKA 1ZHLB 1GYAA 3FKUS 3SDAB 4ZAKB 1YCSA 3MHVA 1J1DC 3OZ9L 4DGIH 1M42A 2E6QA 1DTUA 3NIGB 2MJWA 1RQVA 2B1HH 1V7ML 3BZFA 1S5IH 3ARBB 1JVLA 5MERB 3WJMB 3KE0A 1BGYJ 3AU0A 1E2ZA 4W81A 4FS0A 2CR0A 3I75A 1JY2N 4GQ9H 3F00A 2QLVB 3LD8C 4P3WA 3GTNA 3QZWA 4R0LC 1EC5A 5ESAB 2ZG1A 1JNHA 5GGSY 3S4SA 2BJML 1H8AA 3EH5B 5ERWB 2YXMA 2KI6A 2IEPA 5DUPL 1MW0A 1WA0X 2DQJH 4U1HB 1KB9E 5HJDA 5B3JF 3SYPA 4IRJC 4BA0A 3N50A 3B4NA 1DUYB 1L0LE 4TQIA 2PW2B 1YHPA 1LO5B 4A2EA 1OW6A 2FT8A 3LN5A 1UB5B 2PCPB 2FWOB 4WJ5B 2CCWA 2YXFA 4HUXB 4CVXB 1L0NG 1FYTB 3AXLA 2VM4A 5CFHA 3UPRA 1PZDA 3FQ1A 4I3SH 4H5SB 5D72L 2MQ3A 2R4SL 2R69H 2DD8L 2WM0A 3L1OH 1MPAH 3MCKB 3ZL2A 1OCZB 2R69L 2R4SH 3L1OL 1EXJA 1W8EA 2VCOA 4U6VH 1SQQE 1TSHA 4WENB 4KKZA 4Q9QH 2O93L 3QJQB 4O2EA 2OMBA 3OAYK 4WHTB 2WJ7A 4L3CB 5PAZA 3WTTA 1CO1A 4A7GF 3S35L 4M9OA 4H8UA 2WMMA 1KYUA 2OSLB 3NIGE 4YDJB 1AKJD 2VLLA 1QBMH 1HJBC 2EYRB 3FTWA 2O5ZH 4M8UA 4H44B 2C9LY 1OD7A 2MFNA 1TJIH 1XH1A 1CYXA 5F6HJ 1NL0H 4PVNA 3RVTD 4IU3B 3BZDA 1XVSA 4GQ9L 3RJDA 1V5JA 1T2KD 5IBLD 2FBRA 2GJ6E 3G6AB 5HI5C 1NM9A 3CCJP 1M4KA 4ZFOA 2OV0A 5E4IA 2O61B 3QDGB 4TNEA 1OKEA 4DEUA 3DV4B 2V4HA 3F7KA 5D4JA 4LL9A 3MLTB 5DF0A 3LRGA 3M46A 4O4YH 3C1LA 1H8LA 3QH3A 3KXFD 1D6VH 3P3UA 3ES6A 1SQXD 2Q3IA 1F42A 5FKAB 1OP3K 1LGVA 1CXHA 1S7VA 2W9EH 2OSYA 3H32A 4QXUH 1HESA 1SXZA 1ZE3C 2W88A 2GT9A 4AL8L 1Z1WA 1TJGL 4F57H 5AZ2L 4DSYA 4AGPA 1RK1A 1AR2A 3IDIB 1GRWA 5DZLA 3MVSA 1OF0A 2BNRD 3D7PA 2OULB 1ZTXH 3K7UA 1MOEA 3ELQA 3K8KA 3CNKA 1NJ9B 4NFCA 4LSVL 1DVSA 2VN5A 3HG1B 4PFEA 1FVEB 1F18A 4G43A 5F72S 5KLIC 3ZMNA 4UDUA 2H32A 2ENPA 5E08H 4HWEH 2XVGA 4JJ5B 3VFMA 3W3BA 2NYYC 4HFUL 5DUJA 4LVHC 4ASWA 3IDXL 3TTSA 4QJ3B 4FXKC 1EAOA 3MTXA 2AEQH 4ERSL 1ZLSH 2ZCHH 4HHGA 4PREB 2RFXB 3GQFA 3D06A 2A9NH 1CWVA 1RKRA 1ZK5A 5FX3A 4C56A 4JGUA 5FYKL 1Q72L 3ARDD 4N20A 2XN2A 2ZCLH 4YDZA 2YK1L 1U7MA 1HKLH 3HZMB 4RMWA 3VE0B 1NTZJ 1C1EH 4HJTA 2FSEA 2OXHA 2P8LA 1DUZA 4CILA 4ORGA 2APXA 3D70A 2RIKA 4PJFA 4ZMPA 1KCSL 3V0IA 5C2UB 1XCWA 5HD8C 2NTFA 5CCHE 5AOKA 3NZHL 3C5JB 3BXNB 2FE0A 2XA8L 3L75E 3EH3B 3I6GB 1C5CL 1KN2L 4JPQA 4NRXA 2IFNA 5EU3B 1QGKB 4FZEL 1BYPA 1OK0A 3P4NA 1N5YH 4AT6A 1A25A 1E4KA 2P43B 2QR0A 3MV9B 3QQ9D 5TE4L 5TE6H 4DT0A 4RSVA 2ZYAA 5CP7A 3ZK0A 4IMKC 3C12A 5E6IB 4L3EB 3BN9D 3C08H 2F5BH 5D8JH 2E76C 1J05A 2FEEI 4ZO6A 3WIAA 1AYRA 5CSZB 5IVNA 3SZKC 3VP9A 3GUFA 2HPTA 3T0VA 1KLFB 2I27N 2Y5EA 3NJVA 1XGUA 2QMKA 2JDIH 2GUYA 5JOFA 1EAPB 1S9KC 4PRDB 5HYSB 1KXQE 2G5UA 4GKSB 3RVWC 2CO6B 1N4XH 2X9ZA 5BRZA 3MLUH 2W6JH 1I1FB 2PWHA 4X7FC 2E7DA 1EQ7A 2VQ1B 2C4FU 5LO7A 5HYEA 5D5ME 1NCOA 1F4WL 2BSRA 2AK4B 3V52H 2VERA 2F1EA 4HJIA 3WO3B 2J4WH 2YPLA 3B9VA 4LCWD 5DWUL 3NACL 4FE9A 5GZNC 2EVFA 4HISA 4XVJL 1QEXA 3KPOA 3FB7A 1CDUA 5JXEC 1U8MA 2K6ZA 1OSEA 2VDQH 1ZOXA 3QUYD 4V2CB 1T6BX 4NC2B 3STBA 1DE4A 2OMWA 3L70D 3TF5A 1HILB 2NQDA 5CAYB 4WWKC 4IRJD 5AG8A 3QCVH 4Y5VC 1FBIL 3MV9E 3G5YA 4G9FA 4LDCA 4AJVA 3NT0A 4MMXB 2BP8B 2JJVA 1JNNL 4L3EE 1BVKB 3SDCC 1OSZA 3BW9A 2BW4A 2Y72A 4WUUD 1JDDA 2JQMA 3TO4B 5CUSH 4ZFQA 1NH6A 5DHVH 3SDCB 4U1KA 1FH2A 4J3XA 2WQWA 5E2UL 2IZ1A 3QJSB 4OD3L 2BM3A 4WDIA 4P2QE 4RFNB 5HI4D 4LCIH 4QO1B 3OKLA 4PS4L 3V2RA 2NPSD 4ANKA 1N73B 4NQXB 3BO8B 1RJLB 1U8IA 1U8PB 4JM0A 3MJ6A 2R9HD 5EIVA 5IB2B 1IB5A 4AC2A 2LR4A 1GTWA 1AKJA 3IT8D 4ZW7A 2HMID 2KLSA 4B86A 2ZPKH 3C6SB 3DKHA 3PFQA 1VAHA 2OMNA 1E9QB 2V7NA 1T5XB 2Y06H 2VDRB 1KIPA 5GGSB 1TZGL 1PW3A 4YXKH 4DP8X 3GUTB 2QADD 3VXQB 1ZLVH 3MUDA 4XOCA 2VZUA 1H5BB 1D5MA 2G9HA 4RNRA 3QXDA 1KWKA 4KZDL 2EC8A 5DTFA 3UCQA 1NIFA 3OKDA 2Q7CA 5ITFB 4EDWH 3L3GA 4J3OC 3M0DA 5LDUA 1IIIA 5D4QA 5AOZA 3QRLA 4NM4H 1T1XB 3Q6FB 5HHVH 1ZPUA 1Q82Q 3MO1A 4MDJA 1K8DA 3ZQXA 3AG3B 2BVOA 3FQWB 3ZJAA 4D0CA 1QFUL 4MJ4A 4Y16D 1I3GL 1I8IB 1DIPA 4ZDHA 1OXYA 3P8MC 3EJCA 3TEUA 1A1MA 2J56A 1FO0H 1ZHBA 3D85D 3RL2A 1J5OH 1D2OA 1VQ5P 3QQXA 4P46C 3QH9A 2X9YA 1FZOA 2ISDA 3MLZL 5A43C 5HGHB 1WISA 2AJUH 3KYKH 1KTCA 2W27A 1G6RH 3QNZA 3FZUC 4MQ7B 2BNQD 2I7SA 3T0BA 3T3MF 2HFEA 3PAYA 3D34A 1NCUA 1MCQA 2ZUSA 2P44B 2E7CA 1PQZB 2WITA 2KSEA 2XVKA 3KH3A 4NQSB 1PIXA 3SD2A 5AW7B 2X0VA 1Z9LA 1PGPA 5FO8B 2FXPA 3EG9B 3KGSA 4KK8C 3NBNA 5SWQA 3L1EA 4RIRA 4JQ0D 2MEJB 3TBSA 1GZLA 1CR9H 3EZJB 1WJ3A 5I75C 5I8OH 3Q5YA 1MLBB 2ZZUT 4ZJ9A 3MOAL 3GYRA 1BQHB 3GJFH 1DLFH 4HJJL 4Y16B 5E03A 5E8DH 3JSSA 5H37G 4D7BA 4DP0X 4Y7MA 1KF9B 1UWXK 4YPGB 2YSSA 2ADFH 1UWXH 3Q43A 3BD4A 1BD2E 2XZRA 1DQQB 5DFVC 3QWRD 4IBVA 2DQHL 1UM5H 2FWLB 3VI4F 1NKNA 1PYWA 3HC4L 4JFFD 5E8NB 3VFPB 4PMEA 1IRAY 1PZQA 1I82A 2IOIA 3O6MH 2V5YA 4UNIA 3V4PH 3PGCB 4GIPD 5K33A 2XV0A 1JDCA 3INUL 2HKFH 5LBVA 3X1BA 3FF7A 4X6DB 1LO4L 3APMA 1SGKA 2YPLE 2FCBA 3MN8A 2DQUL 3KDPB 1OCOB 1P4IL 2NY4D 3TCTA 1NTMD 1AMYA 5JW5A 4EZMA 3WY3A 2XYBA 3MFFB 1XL6A 5F7EL 3OGCB 2R0WH 4PTUB 1D5ZB 3CBKB 3CFJA 3F58H 4X8JB 3OB0K 4FQ2L 5B1AB 3AEBC 3QDMD 5JPMA 3M7FB 3VX0A 2KLUA 2VLME 3JT2A 4N8VB 3RBGA 5H37A 3G3LA 4H44C 3HNTL 2E7LA 2F5BL 1OZTG 3QUYA 3C8VA 3HI1B 2FHBA 1RZKC 4OM0L 4RRPA 1HL5A 1E6OL 4WUKH 5KSBF 3DSFL 3KBPA 3RK3E 3NZ8B 5HGDB 4DAGL 1OOAA 2YUVA 4RAUA 3WTVA 2IJ0C 3BT0A 4NN6B 3Q8FA 1Z66A 1X9VA 9PCYA 5EEYA 1AJ7H 1PGOA 3V7MA 4H7VA 3CH1A 5I18H 1WWBX 4ALAH 3RFZB 1WZLA 1WBYA 2CG9X 3NZHH 1HH9A 3HUJF 2H4EA 1N59B 4UTAA 2LU4A 4OGQC 2WN3A 3WV0A 1F0LA 1DVFC 3KWUA 4QLWA 5E99H 2QV4A 2VMEA 3AXIA 3TJHD 2QM8A 1ZCRA 4PU2A 2UWEB 4WSJA 3MZWB 3KEHA 4RX4A 1MY5A 2XDHA 4BSWB 3O6QA 3EAKA 4RZCA 1Z5YD 3L72J 2IYOA 5F7KC 5T1KB 2JI2A 1BEYL 2WUBL 2A45H 3VAEA 4WEEA 4CVZB 4Y5VA 2AEQL 3ENEA 5I0VA 5KTEL 4QJ5B 4LPCA 4XB3A 3S3DB 1IM9B 5JIPA 2H9GA 4LLUA 2PAJA 5TPWL 1JUFB 2IBGA 1K4CB 2VT0A 5CCJA 4J1UB 3V5KB 1FGVL 3DC0A 3ZTJG 4LMQI 2MOVA 4KKPA 2F54D 1MUUA 1HQRB 4O5LH 3QQ4B 2AC0A 2EDJA 1OAJA 2FGWL 3QQNA 3Q9PA 2AITA 1KELL 1M3IA 2Y5TA 1H9DA 4FKHA 3WSQL 1KD1Q 2PXYD 3B5ND 3RK3B 2PFXA 5B38G 2DL2A 5B7FA 5ICXA 1FFTB 4JQXA 2GTZB 4X7TA 1Y07A 1NSNH 4XO5A 3IYLW 4N8VG 3RX7A 3WE1A 3QQDB 3LKOB 2IBZY 3KPTA 3NABH 3QR1A 3NIDB 2IQAB 5ACZA 2X9XA 3CXHI 2OMTA 3JWDL 1NWQA 4GMTH 4H26B 2BHUA 1CDIA 3AT0A 3CPWO 4NPJA 5LXGH 2FIKA 3CSPA 2G0KA 2LTQB 1QSFD 1T1YA 3SGKA 3VD5A 4AQ1B 1RF1C 2XWTA 4NQQA 1KT2A 4QHKI 2XBDA 4YL4A 3QPQD 4N1HB 2DWSA 2AXGA 3WEAA 3H9SD 3D85A 1FFQA 3D08A 4K3GA 3PUCA 3VMNA 1NMCC 2R1XB 2WGXA 2FECI 3F85A 3KM1A 2KK7A 2CWRA 2R27A 4EAEA 3F7RA 1DJHA 2F08A 4HXAL 4WY7H 2ZIDA 1N5AA 1IGFH 1G5GA 5D9SB 5AFAA 2VRQA 2OZNA 32C2A 1N7SD 2ZT9B 2WSSH 2B89A 1BXAA 4FQXB 3EJTA 4RA3A 5E5MA 6PCYA 1OVVA 1MLCA 4H0LD 3BAXA 5GGVH 3KW7A 3A23A 5DHVA 1SFHA 1JP5A 2MCG1 3ZVVA 5JXAH 3SPJA 4ZUVA 3L3OC 3UIZA 1X5IA 4GFTB 2VR7A 3T04D 1IC5L 3H9HA 1VB9A 1KJ2L 2HT2C 4F33A 1GZHA 3APDA 5KJRL 5K9KB 5E4EC 3ATAA 3UDWA 5D1ZI 3J7HA 3H1KD 4R4ND 4L0YA 3U0PB 3LV3A 2VB5A 1NEUA 2F53A 4KQ3L 1T4KA 5AYQA 1LYQA 2AK4D 2D0GA 4G9FE 3MNVB 4CDGC 3NCMA 5HI3C 3CHPA 3FUIA 3E3QE 1ZSDA 3SZ6A 4NENA 5LGHL 5FW7A 1OF2A 3MR9B 4XPTH 3HI6L 2VKWA 3TCXA 3ARRA 1WRFA 2OP4L 4PG2C 1DL7H 3R1GL 3SYOA 4K3AA 4PCSA 1JOCA 3FYEB 5DR5H 3L2LA 2OFQA 2VL5B 3ARVA 2Q76B 1EHNA 1L4AC 3UROR 3EBAA 5K9OB 1J9CT 4HUWA 4ZFZA 3M7OA 3MSPA 1DDHA 1SMAA 2OP4H 3LKQA 4UU9B 5BZDA 1DEBA 2AJSL 1YYMH 2DEXX 3MV7A 2JLLA 4XPTL 4YH6A 2YAFA 2WXOA 1JGVH 1NGQL 3DVGB 2XN9B 5KSVA 1RUML 2QQLH 3ZYJA 1UWEL 1NAMA 4LVOC 1LJ2A 5F9WC 1HWWA 1KB5H 1KLFA 5IW3A 3MV9D 3GHGB 2W90A 1FDIA 5SWZD 2ZX8A 5LGYA 2BIOA 3DETD 3WLBA 4PYGA 4GBXC 4XXDA 4Q9CA 3QDMA 3L3KB 3UCRA 1RK7A 4N9GA 3DPBA 1RURH 2L0DA 4JKNA 4QRPA 4LVEA 5ADPL 5IJVB 1P4UA 3FH5A 1KNOB 2Z91A 4KNTA 1IM3B 3EXJA 5TDNB 5ICYA 4OFIA 5GGVL 1MFBL 5B66H 3CD4A 4PG2A 4QXTA 1YQVH 1BGYD 2P46B 1NU1E 2Z1PA 1BLIA 1S7UB 4M6NH 1JGLH 3FUEA 2W07A 4N0CD 3RWDB 3IE4A 3D0VA 4QOKD 4RISL 4GW4B 1JNLH 1UJTA 3DXAB 4YBHA 1XB8A 2BRRH 1V55B 5F9WB 2Q86B 4LC1A 3FO0H 1HGVA 1H0TB 1R47A 3FFCE 3LXAA 3OAKA 4X80H 5T1KD 3VQ2C 4F9LC 1L0LD 1RK0B 2PCFB 5AG9A 4TSCL 3MU3A 2AQ1A 3VDBA 2Q7AA 2RGSA 2V37A 1ZHLA 3VTTA 3WJLA 3Q0HA 1Q86Q 4RX4D 2DI8A 5JOPE 1JHKL 4JQIA 5FUZL 3FU7A 1LTIC 3NIDF 1T3UA 1M57B 1XB6A 2ZX5A 4D8OA 3BH9B 3TO2B 4GMTL 1YNTA 4W70A 3SCMB 3TJHC 2FHCA 5DZ9A 3KDMB 4AKQA 3MRFB 2EE3A 4I48A 4KJQD 4PUBH 1RE4C 4PJEA 5LUMA 1FC2C 3EBIA 2BIIA 4JFEB 4KY1H 1QW9A 1MHEB 3PWVB 1RPKA 3IDIA 4WI2A 1JPST 3QC5X 4CA4A 2PW1B 1MRFH 1HH6B 1QI5A 1Z0NA 4NQCE 5DRXA 4K71C 5DD1L 3HG1A 1YUHA 4A1RA 3ULVC 4QAWA 3ARDA 5IW1B 3LZRA 3BGMA 2A6JA 1LWHA 3T77B 1LO3H 2WWKT 1A9BA 2CJSA 3N1PC 5H2BB 1YLBB 1PGJA 2IPTH 4FXGB 1CD0A 5GGTA 3T0EB 3S8GB 1MY7A 4AMXA 4XNMA 1QHOA 2I32A 3F12B 2ATKA 5C0FB 4GKSA 3T08A 3ZDZF 1F11A 1WCBA 3QZLA 1A6UL 4E5XB 3F62A 5LVEA 1FAIH 1AHMA 2JB6B 3MD0A 2AVGA 2XN0A 5CWSA 3I02B 4GNKB 2WQ8A 3L74G 1DZ0A 1QSFA 2OXHB 2DV6A 5JXEA 4IHOB 2Q3ZA 3VXUA 1O6VA 1YC7A 3P2BA 5GHWL 3PL6A 3TVMC 3DJ9A 1S5HB 1Z5LA 4NO2A 3VQ1C 5EU4B 3ARZA 3OA7A 3KZ8A 4YDJA 1CURA 2BHZA 1A6PA 2FO4A 4H8QA 4XPAH 5H4YA 3MO1B 4MDJB 3AACA 4JZOA 3Q5RA 4JGJA 4RFOH 2QR0B 1N0LB 4JF7A 2VXTL 5E79H 5C6TH 2FGZA 4I2XB 1BWWA 2OBGA 1K85A 2WTOA 3G5ZA 1KYOH 2WXGA 2UXGA 2H5UA 1WA2X 2JKJA 4TNVK 4KDVA 1T66C 1FZCC 2NNAB 4U1LB 3G5YB 1HEZB 1T1ZA 5EFIA 3R8BB 2Y5QA 4RGOL 3OSVA 2I25N 4AVKA 2FVNA 1L0NJ 3PWPA 3S36H 1BVKA 2IQ9L 3BDYH 4LCWA 2CM6A 3BCFA 2OI9B 4NQDE 5JHLH 4E9SA 3ETSA 4D94A 4XBGA 1F2QA 3NEOA 3EH4B 2WHVA 4O02L 1UD4A 4OFQA 2HB0A 1ETJA 4RSYA 5HGBB 2ZTBA 4CUCA 1GGBL 2AK4A 1F5WA 3VB9A 2DQGH 4KTEH 1AQHA 4MS8D 4NQXA 3BO8A 1TO4A 1OARH 4LPYA 3IB4A 1FVEA 1QFWL 2VL4A 3QEQA 4C55A 1BGYG 1FFRA 3LRMA 2E3VA 4X98B 3F7PC 1FL5B 4J23A 3WN5A 1JY3O 4J3OF 1MQKH 4YDNA 5BO0D 2CMRH 2LQRA 1E3ZA 5KYWB 2VMCA 1NGPH 4IOIA 4N2EA 2R5BA 3I50L 1E4WL 3RIFK 3OV6A 3FN3A 3H56A 2BC4B 1LK2A 4HQQH 4EOWH 1IX2A 3HZ3A 4MMXA 1OP5K 4Q9RL 2GK0A 4OWFA 1IKFL 1UXSA 3AWGA 1ZDQA 2ZVOB 4RDQG 5SWZA 3VXOB 4OM1H 1YIJP 5FO7B 1NLBH 2FR4B 2X0UA 3RVVC 3AEFC 1GGUA 1DLHB 1A64A 1HVXA 4U3FJ 1C5DB 4NRXB 2Y23A 3PQYD 3KYMB 1KB5A 1GYCA 4LLVA 5HHMD 1IFHL 3H1IJ 2FYVA 2B5IC 4B5ZA 5IOPA 4B3VA 5J12B 1R5IA 2XU9A 1U2HA 3ILPA 4FNLL 5D2NA 1UZGA 3R8QA 3VYOA 4BWWA 1U95B 2VAJA 3GMMB 1H15B 2DQTL 3RL0B 1K2DA 3RL1B 4LQFL 3WFCH 1IC0A 4ELMF 4WU5B 2WIMA 5EBMB 5CZRA 3BWAB 2FRGP 4BK5C 2NZ2A 3IKCB 5EZJA 3L13A 2NSQA 4HUXA 1VDFA 3TCLA 3GMNB 4CVXA 1RE3A 4KFMA 4PW4A 2YLHA 3CXDH 4J3VA 2YARA 3SJVB 1P84J 2F7OA 3WY4A 3S3SA 1XGPA 1JPSH 2YC1B 5DMGC 4BUHA 2FJFA 1IGCL 3BQUB 3T2NL 3WEMA 1JHKH 2WQAA 1HCYA 3OLDA 2NUPA 3K6OA 3MROA 3EG9A 2WBWB 4JKKA 5EBGA 2HT3D 3X13B 1JGEB 3LRSB 3NCBB 3IAOA 2WLZA 3D39D 3TV3L 4MQTB 4BEIA 3T0DA 2CO7A 2EDRA 2Y9RT 5F7DA 2VDRL 3MRIA 3RVUD 1LDPL 5DEJA 4L8CA 4YGVB 3OAZH 2FYUD 1G7MB 3GBMH 5ANMA 4EDWL 1P4BL 1J1XL 2DICA 1FFOB 4JDTL 2CUAA 4YSTA 1MFMA 1G7HB 2BNQA 2DLFH 2QEJA 4RISH 5CLZA 1AQ5A 5F88A 4YS4A 4WWKD 4FG6C 4KY2A 5L4MA 1JN6A 2F7QA 3IU4L 2D4FA 3AT8A 3ESNA 5TD4A 5GGQL 2Z4QB 4HEPA 5GGRA 1K4CA 2D2OA 1RPUA 1QRNE 2XWCA 5I2IA 3X14A 2APVA 3O0RH 1IUZA 3CV5A 2Y2YA 3UJJL 1SYSA 3U48A 1P5VB 1YEHH 4KO9A 4E9XA 5IMOB 1HQRA 4K0OA 4RAVB 1V3LA 3GBEA 3U82B 3PDDA 3MRQB 3GZPA 4L37B 2XWZA 1R3JB 1NBCA 4K5NA 4PGDB 1KULA 2YZ1A 1HTLC 3OB0H 2LU7A 3ZPDA 3V4PB 4DUXA 1TFPA 4J3BA 4MD0B 1K73Q 3BX7C 2FYUJ 4HAFA 3WYRA 3GMOA 3ARGA 1M3JA 3MRHA 5CR8A 1DJZA 4PJGA 4Y5YA 3L75D 1FFPA 1JI1A 4JDEB 2CKBB 1NJ9A 4JQIL 5AZEH 1L9PA 3U4AA 3PP3H 4E9VA 1E5ZA 4JFFA 4RBPK 1YDPA 2VW4A 5HGAB 1HN1A 1LO2H 3FWLA 4H44D 3MBED 4YDLB 3FUNA 3ZE2B 3HI6H 5CEXB 4IKIA 4QCIA 1FBIH 4BZ1L 4EIUA 4PJHB 4PVLA 1SQ2N 3VFOB 1CI5A 3BCCG 1UWYA 2OYMA 3DSNA 3MNDA 4PJFF 4WI9A 4FMFA 4C7NA 3ZZSA 1KPRA 3OKDB 5B7EA 4AGQA 1M56B 4I3RL 4D9QD 2P5WA 2KLRA 2Z8WC 5L8KB 2PCXA 3A2AA 5C0RH 1RULL 2HPCA 1K5NB 3QT2A 1D6EA 1QQDA 1UM6L 4C4KT 2V7QH 4FA7B 1QZNA 3CLEL 1TPXB 2J7LA 1JV2A 3QGVA 3CHSA 4P9MH 4X5XB 1CT8B 4J4PD 2I60L 4PJFE 1F4XH 2R29A 1B4TA 3LX9A 3AFLA 3HHSA 4OZHA 4XPHH 2E74D 3KJ6H 3QW9A 3DXAE 2JF1A 3QWOB 2AEMA 1FIGL 5DD0H 5JHLA 3OGCA 3SKJH 3JUYA 5AW0B 1EQWA 4JO4L 1VGEL 3DO3A 1I7TB 4D9RE 4NIYE 4LL1A 1ZRTE 4MD5A 3ZL4H 1R3IL 1M53A 3DDFA 3V5KA 1T3FB 2F53B 2W6BA 4PJIB 1VGKA 1LE9B 5G4MA 1NCHA 3HPLA 4L23A 2DRUA 3D05A 4N4YB 2X4SB 3VXSA 1OY3B 1D7DA 3JQOB 2GFBB 4N2CA 3LS4H 4DQOH 1A6ZA 1CSBA 1DANU 3GJFK 5DRZA 4HIEA 1QASA 5BZXA 5LXGL 3L54A 3ZE2E 1ETZA 3EYUL 5EUOE 1IARB 1WUNT 1F6AB 1HSAB 1YEGL 5IHZA 1NEPA 1OW8A 3QXUA 4I18C 1KEGL 4PJXE 4X4YB 4AC4A 1AZVA 1JMZA 2CBQA 4X6CE 4MCMA 2XA8H 1QD0A 2OSXA 3A67L 1RZ8A 5DJCB 2CU9A 3QIWB 1KCSH 5F1IA 4ZD3H 2JSFA 3UTSE 3QPKA 5IMKA 2FWSA 3BSZL 2XKMA 4PI2A 3GS0A 1NKGA 3HC3L 4Y2OB 2HLEB 2ZKYA 4KVPA 3JXAA 4WHYH 3VRJA 5J8OA 1OTUD 2UZPA 1NM4A 3CVHH 1ML0A 5FYKH 3E80A 4OAWB 2A9NL 1ZLVK 2PXYA 4AGLA 1GIGL 3SDXE 3D2UA 2EINB 2Z4EA 2VXSL 43CAA 3TBWB 2ZF9A 4IL6X 3VRIB 5C08D 2AV1A 4KQ4L 4QHNB 4YVUA 3THML 3O3DB 2WK2A 2JNZA 3CX5K 1HL8A 1LTSC 3TBVA 3D39B 3V5DB 3KXFA 5E08L 4OT1L 3ZHDA 3AG1B 5FYLE 2VR8A 4J27A 1MCDA 1WT5C 4XWOD 5DHXB 1RSFA 1CXEA 3CXHE 1DJWA 5F2FA 1BLNA 1QRKA 1AR1C 2XXMB 5TGBA 3WIHH 1JZ4A 4YFLF 5KZCD 1U8HB 2FATH 2GTZA 4FQ1L 4X7TB 4Y9CA 5CGYD 3ZTEA 1ESOA 1O0VA 3GT6A 4E5XG 4F57L 3FU9A 1HHGA 2HMIC 1BJ1H 4GI8A 2EEBA 1G9ML 4BKTC 2VE6A 5JZ7D 3UADA 3G04A 3M8OH 1N18A 4M7KL 1ZHKB 2KH2B 3N1FC 3UYRH 1HQ4B 2VDMB 3HUJB 2OL3A 3B5NC 4FG4A 3HMWL 3P9WB 3VFUB 4PRIA 3CX5D 1EJOH 5EORL 5ESQA 4WZ9A 4L4VB 1N7SA 5GRZA 5I71C 3GF8A 1PZUB 5FK9B 1PAZA 5JPNA 1FNSL 3N06B 3K6SA 1OGAE 3EKCA 3LS4L 3NSDA 3JVGA 3QQ3B 4RQQB 4ZOCA 5E1AA 4DQOL 3C8HA 1TJIL 3U36B 2VSDA 3EADA 1SY6L 4K94C 1J0JA 3ZKND 4F8OA 1YHQP 2FO1A 2NY7H 3FO9B 4KROB 2XUWA 4OLYH 3O6FC 1M1JA 4W9GC 3MRPB 3S35H 4YSAA 3BWSA 4F9LA 2TRHA 2X4OA 4YZFE 2CLRA 3DGDA 1ZIAA 2F53D 4BSWA 5AVRB 3ULUF 3ZRFC 1A02J 1LWJA 1QFOA 4XAKD 4A04A 1PZSA 4AOFA 5I26A 4YHKH 1EFXB 5SWSB 4GUQA 2X28A 3A7OA 4JFHE 4AKOA 1MFCL 2QVKA 3NN8A 4Y4HA 5D72H 1CFTA 4K3DL 4N9GB 5EIIB 2FQDA 3O6ML 1BCCE 1JK8A 1UIXA 4KMTL 3VQLA 4OVNF 1P6WA 2F58H 4G6AC 4LSPL 4CSTA 2PPEA 1PY0A 2HJLB 4M6AA 5C0RL 5HXMA 1G7JA 1PGRB 4AUWA 4LCCC 4R4BA 3HFML 4PJ0E 4NENB 2WLNA 5DC4B 1E9OA 1TNMA 2ZSWA 3MV7D 1TYEB 4PRHE 1CLZH 4KZ0A 1B4JH 4NZUL 4N90D 1B0IA 4YO0A 4EVNA 1LQBC 4NB7A 1JY3P 3CMOH 4ZKUA 3QRGH 4JZOB 1AE6L 2L7QA 3BRDA 2YD0A 2WWNA 4RGNB 3TIEB 3WKNA 1MIML 2WGNB 5CJXC 5D1QC 1OGAB 2YPLD 1XF2B 3Q5TA 4Q14A 4A7SA 3LJ3A 3FRPA 4NI6A 4ADGA 1NU1K 2UVEA 4DJMA 4Z0XA 3EFFA 3DROA 3MUY1 4AENA 5EBWB 3E9TA 2B1HL 4F7MA 4H8HA 1BQHA 2D2CB 3KLAA 1QTYT 3TXAA 5KVFL 5CEZH 1T0PB 3USSA 3HIZA 1XGQB 4P5MB 1EDYA 1SDAB 4UAOB 1SMDA 4XO8A 4V1DE 1UFUA 4W9EC 3VFVA 2H3KA 2JJUA 1BA9A 2ZOKB 4G9FD 1TENA 5KSUB 4LOUC 3BRTB 2LW3A 2AJZA 1KNOA 2FEJA 2Z91B 3OWRA 5E8NA 5C07E 2NY5H 3D4ZA 3M9HA 3TGUD 4PWKA 5HHME 5IBUB 2QJYB 2UUDK 2CLVB 4LCUA 4WUUA 1CLYH 1PP9E 3VSQA 4JRYE 1A02F 4HWBL 3L5XH 3Q2VA 1EWHA 3QZOA 1G9HA 3CC1A 4X6CA 3B7SA 1QFUH 2VYRE 3MUJA 4KVNH 4Q6IA 3H7BB 3BKYL 2UYLA 3O81A 4KXZH 5BS0A 2FEDC 1DBJH 3QDJD 1RMFH 2HH0H 1VQLP 3N42B 2NPSA 3W67A 2ENYA 3PP4H 1INEL 1DJYA 1OT2A 3GBML 1XR9B 4XI5C 2Z8VC 4XCCH 1DD3A 4OVUA 1B4RA 2IANE 1Z2KA 4U1MA 2FD6H 4F2EA 1EV2E 3V2AR 3CZSA 4EN3C 3I02A 4YTPC 5H35A 5DMKB 2ZJSE 1AVOA 4K07A 4UMSA 3MRRA 1ZSDB 4WNSA 2A0LD 2V5MA 4OLWH 2WC7A 3K4AA 4RA0C 5AW4B 2K6YA 3ZMRA 5MEQB 5A6IA 3SODB 4K7PL 3ULUC 3WU1A 2NXZB 4UZSA 1EZSA 3NSYA 5IW6A 1JZ5A 3GHPA 3KVDD 1CFQA 2P7TA 2VLKE 1HOCA 4L1BA 3KBFA 4PP2B 5IM7A 1GS7A 4AITA 3LZQA 3FRUB 2O1KA 2OTJP 3QDGE 3IPFA 5EOTB 2YO3A 3A0HE 3FQ4A 4M3LA 3ECVA 3FQUA 3QG7L 4MZRA 1IL1B 4LQFH 3ZKNC 1WFNA 1SOKA 3OJVC 3H1ZA 1NFDE 3H1KJ 1X9UA 5DJZB 3U7WL 1OP3H 3RYMA 3L5JA 1Z7JA 2EXTA 3DURA 2VDPH 1TZIA 2K1MA 3HZKA 3PL6D 3G3ZA 2EYTB 5C0FA 3AS0A 3LYRA 1NMBH 3L73J 2QSCL 2Z6FA 1IKNC 3BQUA 5I19H 3KS0H 1ZRUA 3VGEA 4GSDL 4OJFH 4G8IA 3UGXA 5CWSB 4OM1L 3OXRA 3U25A 2CKBH 2W0KA 1BAFH 5D1ZB 2XT1B 1I8LC 4FFTA 4HJEA 3C5XA 3JWNG 1JNMA 4JKLA 3GI9L 5GRXG 2PYEE 2F8XC 1CDGA 3ZZLA 1B0RB 3NMEA 3B9KB 1E4WH 1AQDA 4JFOA 4N3YB 1S7SB 1T20B 2LVEA 1GDTA 4PAZA 5EU7E 5HDBF 5ICXB 5KYYB 1CXKA 1U8LB 4NNPL 5FHBL 3ZTNL 1Z9PA 4PRAA 5DJ8B 4NZ8A 1RL1A 1NDMB 5EO9B 3P9MA 1CL7L 2RJMA 3UTTA 4E41E 2ZKMX 5EULV 3ZT5A 1A0QH 1U8JA 1F41A 1P4LB 3ME0B 4FHJA 4PYHA 4LVHB 4WW2F 5T3XH 1BAWA 3X14B 1IE5A 4ONFL 3RPIB 4P2AA 1KQLA 1KJVB 5TFSL 3T3PF 5A16A 5I1AB 2O01H 2KERA 1U6AL 3HZYA 4X99B 4FQQA 3ATDA 1JOIA 2VDPL 4MDIB 4S1DC 4S1RH 5CINH 1SN0A 2R0KH 2G75B 1JYWA 3BGFB 3MRLB 4APQD 4K7FB 4OJCA 4LEXL 4L73A 3RG1C 3RIAF 2CUIA 3BDYL 3DYMA 2YMXL 5A2KH 3WJLC 3I3BA 1WWAX 4UYQA 3ROLB 4AYGA 1ZLEA 3IFMA 4HOXA 2WLKA 2NT1A 2MOQA 3BESR 4GY4A 2BOBA 5J6HA 1IEHA 2IALB 2HG5A 1JWUB 4M6MH 4LB8A 1DBML 4FOMA 3CWBD 4X98A 4UAHA 4M02A 3CN4A 1MLCB 3PYCA 5HGAA 1KQSO 2WXFA 1L4IA 2VXTH 5LAXA 1VKXA 1JPEA 3HVDA 2BO0A 5KYXA 2F68X 4LIQH 3MI6A 4RFOL 3BUQA 1L6XA 3KPMA 4MGXA 4LE8A 3WTWA 3EBHA 4G80B 1F11B 2NR6A 1FZFA 3JWNH 1W72H 5C0BB 4IL6E 3L95B 2GYSA 1N64L 1PZ5B 5J12C 1IGML 3GM8A 3LS5L 3UBHA 1NOFA 1SLQA 3MNZB 2DI9A 5HYQB 2UZYB 3ZE0B 4JFTA 1D3CA 3SGJC 2BNRB 2ZG3A 4L9LC 2BEQD 4BSJA 4N0FA 3JWNE 5HHXL 3U83A 3BISA 3K2UH 3MRGA 3FUFA 3WHXB 5D2NE 4EKJA 1OAZL 4O2CB 4IBLT 4FLOA 4OUOA 2HTLC 3EOTH 2N4IA 1IBZA 2VSCA 2CIIB 2KQNA 5L4IA 4PV1D 1CLOL 4HKXA 2EE6A 3QWOA 4JDZB 2E86A 1A3LL 4NWTL 4WO4D 4YHML 1JY2P 1NCDH 4HUUA 4NHCL 3DX6B 2EKJA 1YECL 1JN6B 4QRSB 2VMDA 5D6CA 5B1JA 2WQSA 1IGYB 1Y7VA 5C0BD 1QR1B 1SLXA 2IH1A 4IKLA 4JAMA 4KPHL 1SQXG 4G1MA 1OIOA 1T5KA 1VGKB 5GIRA 4P3CL 3NA4A 3SDDB 3K5SA 1LE9A 2HA1A 1D5BA 5HDOA 3X1GA 3RZWA 1ZVYA 2DJSA 3H6JA 3ZHFA 4EI0A 1GGIH 5D4HA 3WNMA 4G59C 4HDIA 4P2RD 5GTIE 2LXBA 1RUKL 4LAQH 3VI3B 2BW5A 3CBJB 3RK3D 4B7LA 1R34A 3GWJA 2OZ4A 2OQQA 4I4WB 4ZOEA 5CLWA 1AXTH 1RUQH 1NPUA 1IAIL 4DTGL 4JY4B 3TK1A 3N85H 4KTDL 4QXTB 2K70A 5E5UB 4ZMXA 1BQLL 1UVQB 2OM5A 2COQA 4LFHG 4DPCX 1DSYA 5F7DB 1FIEA 2WYZA 4F7PB 1HIMH 3HCVA 1ZHNA 3APNA 4ZRGA 3RA7L 5EOCJ 4NWUL 5AW8B 1BVOA 1M1XB 3FCUB 4K8RL 3DVIA 5AOMA 1X9RA 4KKLC 4P5TC 2YRBA 2J8HA 4NSKA 5DLML 4J6IA 5KYWA 3O6FD 1P7KA 4WKXA 2AEIT 1GKOA 3KZIH 1S9KD 3CD6P 1BYOA 2R56L 3HFMH 4I89A 4UQDA 1YNKH 3RQ3A 4AY0A 1USEA 5SWSE 1JERA 2VM3A 4WI7A 5C92A 3EGDB 2ZG2A 2BIHA 3MMEA 3BH9A 1THCA 2Q6QA 4J12A 3VI4A 3K74B 5LKNA 2A83B 3QJFB 5GRYA 1DLHA 4G9DB 2Q2EB 1T83C 3H1HG 1ACCA 3B9KD 3TJEH 2IWFA 5FYJU 4Y4KC 5IOPB 3S7GA 4MXVF 3RHWF 3PJLA 2Y7QB 5DUML 2GKIA 3BAEH 5FDWA 4FEIA 3Q5OA 1HHGB 1P84H 3GZOA 5J0BA 2J44A 2YJLA 4Y88A 4HKJA 4XCNB 2DBJA 1ZT7A 4ZUTB 1EAQA 4IDLA 1JS4A 3QUZC 1HF9A 4JFDB 2BJMH 3L72D 5C3TA 2AJSH 1EH9A 4YDVA 4BD4A 1A9BB 3HC0A 1QFPA 2QG4A 4LSRH 5DUBB 1HEJC 3Q3GB 2BEZF 1NCJA 5IFHH 4QHMB 2ATKB 1EDIA 1MHHB 3V9FA 2IADB 2FJFB 2OLDA 1Y6NR 4NPEA 5E2JA 1JHTB 2ZXQA 3S4SB 2P5WB 5D93B 1NLDH 4HT1H 2EXWC 4KQ3H 3GLMA 4NFDA 1MAKA 2IIJA 1S5LX 4J8QA 3TO4D 1BQHG 1M7LA 1GH7A 1I1CA 3QSKB 5C7XL 1MUJB 2A06G 2E0PA 4KRMB 2P8MB 2WNXA 1IGMH 3IFNL 25C8H 2ZSVA 5JYMA 2FATL 5EZPA 4TQEL 2CBTA 5IMKB 1CL7I 3I74A 4NZDA 4B53A 3NGBC 1LVEA 3V2NA 1BFVH 4JPWH 3E1IA 1OVUA 4YLBA 4RBPH 4D0BA 3VO0A 3GXNA 4M5YH 1VACA 3KLQA 2FX8L 2XCMC 2XNAB 2HG5D 4JL1A 3LNEA 4EBQL 3BI9X 4NUQA 3DJZA 4X2UA 2RN0A 5D7IE 4ZMAT 3DX2A 3SDYH 4HOMA 3S9DB 3QO1B 3GPEA 2BSBA 1G7JB 2ITFA 2AW2A 1CU4L 3KNBA 4PGJA 5C0IA 4LSDA 4NIKB 5IMOA 1U93B 3P3SA 5GS3A 2ZYHA 4PJ5E 1AGEB 1F1AA 1SRDA 5GGTH 4OF8A 3S37H 4LEXH 2WB7A 3QIWD 5KG9A 4M4RB 1IV8A 1XGRA 1KTDB 4EN3A 1WAAF 3L4VA 4S1RL 5JIIA 2BVYA 1IBHA 2KC0A 1AR1D 3NP4A 3GMOB 3MRHB 4WTWA 3RJOA 2RR3A 3FTZA 2XQBH 2WWWA 1I9RL 2X2HA 3A67H 5I1JH 4RMUA 1GU5A 2F19L 1MW1A 4QOKA 1I9JH 2EECA 2FB4H 1F2XK 3S0PA 1SVZA 2FB4L 4CC4C 5E1GA 2C9RA 4GRMB 5C08A 5IY5B 2XQBL 4V1DB 2CGRL 2X3AA 4OBSA 3LIUA 1I3VA 4GG8A 4WO4A 2W60A 4OSUH 2R5DA 1RZJC 3TFBA 2RALA 1MFNA 1N67A 4HLJA 1EEUA 3RGBA 2VITB 2ZOKA 5TISH 4OQTA 5MI0B 4ZQTA 1A7RL 1B0GA 3D69B 1KELH 3RZCB 1AMXA 3DSNB 2YMTA 5FWQA 4PJ0H 1R3IH 3VFWB 2EDNA 2UWEE 1Y0LB 1PX3A 4Y1AB 5BW7A 3FO9A 3SKJL 3MGTA 1LP9E 1XCXA 3SDYL 3L75J 4WRLA 1R3HB 2VH5H 4WWNA 2NY0C 3RGVC 1ZD6A 3Q06A 5BMFH 4L4TE 4GS7C 1NU1D 1M2OA 4F5CE 4P4KC 1CGWA 4NQVA 4IBQA 3UTQB 3JTSA 3TM6A 1R1CA 2YQBA 2VXUH 5B1JC 5ACLA 1GZHC 5FECB 5IFJB 1JCKA 2AQTA 5FC9A 2JKXA 1NTKE 2H6PA 4IMKA 2Z35B 4LLMA 1ZMYA 4HAKA 3HE4B 2CUHA 4I3RH 2ITCB 5EOCH 1YO4A 1J8KA 3P3YA 4GUCA 3QG7H 4XNZC 1SVFA 1Y8AA 1T3FA 2XX0A 2C3HA 4MNGE 4HEMA 1A4AA 2BOCB 4KKCD 4R4BB 4FI8A 5E6RB 4Z8FL 3MRRB 3IF4A 2VDKB 4PJFB 1N7SB 2UWEF 1AS8A 2ZP0T 4QRFA 1OCWL 1ACZA 2OTUA 5EC1B 5IREA 2YA1A 5DK2B 4U3FD 1XAKA 2KYVA 2H0FA 4UIKL 4UOW0 2ZAHA 2WBJD 4HS3B 4PJDE 4C4BA 4JQIH 4EF3A 4F7EB 3O6LL 2AV7B 4ODXB 4UUJA 3IFLH 2EH7H 3DARA 5CCGA 2JTDA 1RZFH 1L4AD 2DDQH 3FT0A 1G7MA 5A2JH 4AIOA 5I8EB 3BVUA 3DX8B 4ZUSA 5KVFE 1LP9B 5CHXA 5JW4M 1INEH 4PY7B 2XV3A 5JOFB 4IKJA 4ODTL 1PZ2A 4K9EH 1E43A 1P4IH 2DQUH 2EABA 2VSMB 3NN8B 4B9PA 4JDVB 4WEBL 2BCCE 2QKSA 3X1NA 3UJJH 2D3LA 2J5WA 1NUGA 4HK3N 5BQ7B 2AV1B 1IFJA 1SEBB 4PBDA 2PYEB 3PWPD 2P28B 5ALBH 4XB7A 2RH0A 5CGTA 3CHXA 4OCNC 2VISB 2OYLA 2W8ZA 3LMJH 3LQAC 5T3ZD 5EBLA 4XMZA 1UM5L 5A6MA 4GG6F 3KPSA 3W0WB 3QFJE 2K37A 3SPVB 5LHDA 1J2JB 1P6FA 4WFGD 3PJSA 4BSVA 1SM3L 1YITP 2J88H 4W9LC 3RI5K 1U3ZA 3ECUA 4H20L 3VM7A 5FV2A 2DW5A 1WAAE 2VDRH 4XNYL 5JZ7C 4TUOB 5DVKA 3TV3H 3MOAH 3QEQD 1HAWA 3CWGA 4F80A 1VQNP 5DJ6B 3FOLA 3V9EA 4XZ4A 4IIQB 4JG0L 1O7DE 4OVVA 2B15A 4UM8A 1PFOA 4JG0H 4UB8E 3CVHB 3R7RA 5IB1B 2WZ0A 4ABWA 4KH9A 3L73D 3NIFE 4PD4E 3HKZA 4IU2A 3T71A 1F4YH 1KTMA 4PJHA 2NZ9C 1NTZG 2L8AA 3DI2B 1SQPE 3EFFK 1RUKH 4LAQL 4M43H 3SKOB 3DIFB 1XXFC 4Z1MH 1JPGB 1MV8A 3I3DA 4Q6YA 4H1LG 4NT6A 5BS0D 5DMYA 3L37A 1J87A 4NBZB 3HR5A 1RU9H 2GBVA 4WUUB 4JM2F 1KGCD 1D6EB 3BLKA 1CICA 5J9PA 5AVUB 1X5GA 1FZKA 3DECA 4LSPH 1A4JB 1AFOA 4KMTH 4ZW6A 1KILB 4AE1A 3OL2A 4A2DA 3LN5B 4Y9FA 4OZHB 1YAZA 3CSYA 3TV8A 1DFBH 1VKXB 1CFBA 5DHMC 1Z6JT 4Q7DA 2X2UA 4HKZA 1FG2B 1QI3A 4M1GH 5CU5A 4J2QA 2VO5A 2BRQA 3GSVB 7CGTA 4Z23A 2FFDB 4G83A 4NQEB 1CYGA 4MASA 5JDSA 5AZUA 1L0ND 2XPGA 3AS3A 2HAZA 1VA9A 3H0TA 2A9MH 3GPSA 3WS3B 2OJ1A 3QISA 3HPLB 2Y2WA 4R97B 2TSAA 2EH7L 2X1XR 4OKDA 3UPCA 3UZEA 5GZOC 1EA9C 5F6IB 4BWUA 3ZTJH 4FC3E 2HTKD 2ZWYA 5DRZB 3VGDA 1A02N 1CBVH 3JYCA 4PGCA 2EYRA 4P59H 1TZGH 2XACC 3WXWL 5IHHA 1JMXA 3C87A 2Y06L 4HUUB 3JSVC 4LDOB 3I6LD 1DHKA 3NCYP 1OCWH 2DTMH 4OQTH 4BELD 3GB7A 3II6A 2DQGL 5D6CB 4C47A 2HRLA 3BQUD 1TQVA 3GXPA 4NC1E 1TR7A 4NJAL 4QHUA 5I1EH 1YTZT 4AENB 1FVCB 2CM5A 3H3PH 3PGDA 1FL6A 3FO2B 1E4XL 4TXVB 5F7NC 3N44F 5B8CA 5DMJB 1KILE 4FNUA 1LEIA 2EO1A 3VB8A 1Q94B 3LRLA 4N22A 4FG6D 3DV6B 3L71G 2FYNC 4FFZA 2R69A 4Q0XH 2IH3A 1SOQA 4BQBA 5T33H 5IMMA 1QSVA 2P5EA 1NFKA 1WIPA 4NUJA 6FABH 1RK1B 3QJUB 2FYNB 2CGYA 3QR2A 3CQFA 3TN0B 3ZUNC 3QHZH 2JFCA 2QPEB 3G6DL 3BFOA 3CZEA 4ZNCA 1R5WB 1DQJB 5JUEL 1CL7H 2JKTM 4APQB 3OPZL 2ETWA 1MJUL 2EACA 3L71J 1ZEAH 1G84A 3SKNA 4P46B 3QIUC 4ZPVB 4HIHA 2BZ7A 2LLNA 1U3HC 3MRCA 4L4JA 5CZKA 5L2KD 2ADJB 4W9ZA 3JV4A 2D7OA 1QNIA 2LLGA 4JO3H 3LKRA 2QQKH 1ZTMA 4EIZC 2W6AA 4WY4D 3BRGC 3N43F 2OW7A 3EBGA 2WSCH 2GC4C 4X5RA 4DCKA 2V5TA 1DUZB 2X4NA 4RWYL 3RIFF 3GHEH 5CZVL 5H2FH 1HX0A 2ZYRA 2NUTA 2AVFA 1N68A 5J1AB 1B2YA 3P77A 2O1JA 1RH8A 5LBSA 1KG0B 3L7FA 4JPZB 5MEQA 5B1KA 3BXNA 1I9RH 2O6FA 1N4XL 4PRNB 4U1KB 2RBLA 3D4CA 3QQ3A 4PJ5B 2EKSA 2EIBA 4P05A 3S97C 1GL2B 4U7JA 3HMXL 4OZIE 4HK0B 4QWWD 1EGJH 1ZY9A 5FB8A 3WFHA 1GXEA 4P57B 1AVYA 4R4FH 5I66A 1E28B 1H5BC 2CPUA 4DUVA 4PTUA 3FDWA 5E2VH 3EYVA 3JZYA 3Q2CA 3EOBB 1A1NB 2E7MA 5I82A 2OX5A 1TETL 1E3XA 1XT5A 3AE8C 1J8HE 4QRQA 3GHBL 4NOFA 3MLWL 3ZHLA 2IBZG 1DQIA 2DB8A 4EIJA 2AXFA 4BQ6A 4JCWA 4XXWC 5K5GB 4OCXL 4A7PA 1NFIB 4HXBH 2DH2A 4HWZA 2KQMA 4PJBE 2NY3B 3L95A 3PHOA 3QXDB 4MVBD 5EN2B 5FUZH 1PZ5A 4AEFA 1WFTA 2CBMA 3CZNA 3L5HA 2K45A 4HKBB 4I18B 3Q1SH 4P9ML 5DS8B 3OJ2C 4WVRA 1N59A 3UG3A 5J56B 4XRCB 3VXSD 4ETYA 3QA3A 5DMGD 4M1DH 1REIA 4LLDB 2YK1H 1I7ZB 1TCRB 3BD3A 1OM3L 1SP4A 3M0DC 5J1SC 4LP5A 1UFGA 4Y1AE 2J8UB 4TTGA 3D8MA 4JE0A 3HE7C 4QF1B 3MNMA 1EDQA 2OQJA 3QUXA 2P48B 2RQ8A 2W5PA 4PN6A 4G8GE 2JCCE 1TG8A 4OCYL 1I7UB 1L9NA 1AIFB 3IRPX 1HILA 2BIQA 2YD8A 1EO7A 4RVBA 3CX5J 2PP7A 4OJYA 1CDCA 4NUPA 5LNEA 3OQ3B 1BOGA 2I9LA 4HV8B 2Q9IA 4ZFOB 5T3ZH 2OK0H 1VZHA 4PV9B 2IH1B 4JAMB 1U8JB 1PSKL 4FNRA 5DMIH 1ZTXL 3KLAB 1PL5A 1C08B 3KNBB 4F1ZA 5EWIL 5EOQL 5A16B 3QQ4A 5EEUA 4X99A 5GISL 1JL8A 5EUOA 5MEPA 3CXFA 3QJFA 4ZQKA 4QI3A 4JQVC 4QJ4B 4L5FH 1KB5L 2CHWA 3CFKA 2Z92A 1JWSA 3D18A 2H89C 1ONQA 1ZS8B 4EKXA 1HZKA 1J9SA 2X6AA 2WZ7A 3QIBB 4M8QB 3EO0B 1IBBA 4TOYL 4HZLA 4XBPA 4ABUA 4N2GA 5DEZA 3AE5C 1NEZG 1QL1A 1S72P 3OLGA 2P3YA 5I8CB 1KV7A 1MCBA 1VCAA 2XXCB 4DFIA 1Q1PA 3CCHB 2H32B 2F9BT 4U6YA 1WFOA 2WT7B 5KWYC 1VFBB 5IKCA 2EXYD 1M7DB 1KYFA 3QDGD 5AALA 1NTKD 4Y16A 1T5XA 5BS0B 2XWRA 4JZNA 1M8OB 5JW3H 2XWTB 4U3CA 3CFTA 3ZDXE 4CC1A 1T0NA 1U8NB 4GBXD 2W0LA 3WAJA 3KPMB 4H4NA 2R56H 5ICUA 2CA4A 4PD4K 3VXQA 5I5IA 2F54E 2IADA 1BPLB 2W59A 3D25B 3HBZA 4DGYH 5JR1L 3BLBA 4Z3TA 3KLDA 2Y25A 3T1WA 4ZW3A 1MCWM 5DJXB 2RKLA 2X6MA 1Y0LA 3UO1H 1B9ZA 4PRID 2C0WA 3GSXA 3G5XA 2HFED 5H94B 4TLUA 2QL1A 5I76A 2YPVL 4PTTA 4AL8C 1LP1B 3RU8H 3HLAA 3TN0C 5J89A 2J58A 4YC2B 4XC1H 1I7RB 4U6XB 4GUPB 2WQYC 1BREA 3EHBC 2P5ED 3TIDB 1MFZA 5CIPH 2ZCKH 1KENH 2CIIA 3EYFA 3DX7A 1M05B 1I8IA 3EO1B 4V11A 4LXFA 4FQPA 2YR3A 2GQHA 3O11A 1FZMB 2PPFA 4GKZA 1JF1B 2JQAA 4QRSA 1FJ1A 1ZHBB 1IL1A 3EJYC 3F3HA 3CN2A 3SBWA 2VLJB 5GIRB 3SDDA 1JI2A 2GITA 2QPUA 2CK2A 5KVDH 1FDMA 4X9BA 3VGAB 5KLIB 5SWSD 1FZEA 4L18A 2VXVH 2VABB 1N3NA 1MJ7L 5KG9B 4NHCH 5I0XA 1IFHH 1LTAC 4WW2A 4OCWH 3I84A 4WNJA 1YEJL 4UILH 2KNCB 3BHBA 4WY4A 1A3LH 5D55A 3RLSA 12E8L 3ZKSD 1CLOH 4G8IB 5CZXC 2V5SA 3MRDB 1V7MH 3FB5B 1RIVH 3M17A 2A6KB 4Y5XA 4HLEA 4HIJA 1GS8A 1Z32X 1RAMA 3PU7A 4KRLB 4N2BA 4XP9L 4GSRA 1PLGH 2MQCA 4CGUB 2KZIA 3L5WA 1GW6A 4KK9C 1GGYA 5HI4C 1S7SA 1T20A 2F7IA 4HQQL 3UJIL 4GRMA 5I6XB 3VA2C 5KYYA 3DX8A 4ZUSB 2C9PA 1BHGA 4NSKB 1NGPL 1W15A 1CICC 2NNFA 3FCBA 3S34L 3RNQA 4XCEA 4JM2D 1KEGH 5CEYB 3QJTB 5TDNA 5ICYB 4EN2A 3SO3B 3H1JE 4S10A 3NCJL 5D71L 3W0WE 2M26A 1NCGA 1BM3L 2FL5B 2H41A 3S88L 5DHYA 5A1AA 4MDIA 1VQ6P 3IU3B 1HHIB 3AE2C 1KTDA 2QT6A 3HFFA 2YMXH 2Y6SD 1CD9B 1K5WA 5JHLL 2PXYC 4GKLA 4YL9A 4UV4H 6CGTA 3VYNA 4P06A 1O6SA 3LQMA 3N55A 2H26B 3IPBA 2WSFH 5J57B 1JUNA 4YSSA 1VEPA 1R6VA 2BMKB 2FQGA 4JG1L 4ESKA 5I73C 1JRHL 1NBVH 4HJUA 4IIQC 4N68A 3FU7B 3QUXD 2GJ6D 4XVTH 3SE6A 4DIXA 4LKXB 2YFOA 2OKMA 4UINH 4L3AA 2X7LB 1LEGA 3JZ7A 1SHWA 5DJUB 2C9XA 3C75A 1JCDA 4ELDA 5D2NC 3LIZH 3VDAA 4LLYB 3ZTNH 4N0YH 4GXUN 5CIPB 4A7TA 4FQ2H 2WYHA 1AA0A 1U3JA 4YZFF 3B1UA 2R0WL 1YEKH 4N0FB 4NZTH 3ZL4L 4JE4B 1JZIA 3B5NA 2QDWA 1KILA 1RZKL 2A6JB 1OB1A 2BNRE 2ZSVB 3DGGB 4MYWB 1BF8A 1JDAA 2DS4A 1GS6X 2CKBL 2W0FB 3NJIA 3PCYA 4QT5A 4EZJA 1G9MC 1A66A 1AZRA 4J8RB 3UP1A 2H8PA 3A0BH 4AUYA 1Y6KR 4XI5D 5I19L 1HXMB 2IPTL 3MC0A 2I7OA 4K8RC 2F61A 1PCXA 4ELME 1K3IA 3GSVA 3QXAB 1LT9A 2C3VA 3QDJE 2HVJA 1OXZA 4Y4KB 2G4GA 1BM7A 4NZRH 3TA3C 3MOQA 1MDTA 2WBJA 1NA8A 1TQCB 1ZR2A 3OMIB 1DVTA 3A21A 3V0VA 3PL6B 1EXHA 2IPUG 2QPFA 2FNWA 2W94A 1IGTA 1OK8A 4KGLA 2HFGL 3SPVA 3KS0J 4EI5B 4PGCB 1NCTA 1F1DA 1HINH 4K55A 3BSHA 4MRCA 4NNXA 4HALA 5I8OL 3H4HA 1PPJG 4JFEE 3ZR6A 2J20A 1CR9L 2EE9A 3AWFA 4OLWL 3HD7B 1I1AC 3RX5A 3TZVA 2QTEA 1L7TH 4X8CA 2YEQA 3HS0B 3BVTA 3WN5C 4JO5A 3M91A 4N1CA 3CWBG 5CHNA 4PY7A 1QKZH 3OSKA 1KLUA 3WLBB 3B2PA 4UIMB 4GKGA 1KBWA 2IPUK 4IEFA 4Y99C 4FQHA 2B3IA 3LY6A 4NFBA 4OZFH 2VITA 3D85B 5CGBA 2A7BA 1WWWX 3C2AL 4GO9A 4DK3A 1RMFL 2HH0L 1SXNA 3LN9A 3SDDD