1M1JA

Crystal structure of native chicken fibrinogen with two different bound ligands
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
192
structure length
192
Chain Sequence
SCKYEKNWPICVDDDWGTKCPSGCRMQGIIDDTDQNYSQRIDNIRQQLADSQNKYKTSNRVIVETINILKPGLEGAQQLDENYGHVSTELRRRIVTLKQRVATQVNRIKALQNSIQEQVVEMKRLEVDIDIKIRACKGSCARSFDYQVDKEGYDNIQKHLTQASSIDMHPDFQTTTLSTLKMRPLKDSNVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha subunit
publication title Crystal Structure of Native Chicken Fibrinogen at 2.7 A Resolution
pubmed doi rcsb
molecule tags Blood clotting
total genus 58
structure length 192
sequence length 192
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08702 Fib_alpha Fibrinogen alpha/beta chain family
A PF12160 Fibrinogen_aC Fibrinogen alpha C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1m1jA00
2OYHB 1N73B 1LTJB 1RF0A 1LT9A 2FFDC 2FFDA 1M1JB 3HUSB 1T3UA 2HPCA 1FZEA 1FZAA 1W2EA 2HODB 2XNXA 1FZCC 1FZCA 1LT9B 2FFDB 3H32A 2HLOA 1FZFA 2HPCB 2OYIC 1JY2P 2A45H 2Z4EA 1JY2N 2HODA 2OYIA 3BVHA 3GHGC 2A45G 3GHGA 1FZCB 1RF1C 2A45I 1RF1A 1N73C 1JY2O 1LWUC 2H43A 1LWUA 1RE4C 3H32B 3E1IA 1LTJC 1N73A 2OYHC 1FZBA 2OYHA 1JY3P 1M1JC 1RE4A 2OYIB 1LTJA 1JY3N 1M1JA 1N86A 1RE3C 3HUSC 3GHGB 3HUSA 1FZGA 1RF1B 1JY3O 1RE3A 1LWUB 2Q9IA 1RF0C 1LT9C
chains in the Genus database with same CATH superfamily
3IN6A 3M0DA 2ZVOB 4D6TE 2YO2A 3L70G 1P84H 2FBWC 4U3FG 1KILB 5KJ7A 1NU1G 3V2PA 3CWBD 3E1IA 2KUBA 1DH3A 3I55P 1GZLA 4Y28J 1J1EC 4OGQB 4L74A 1VQ6P 1UIIA 2XNDH 3HE5A 1X8YA 3II6A 1OXZA 5AW9B 3AE8C 1OIPA 2AXTH 1S9KD 3M0DC 2W90A 2HYNA 2ZT9B 1NH4A 2I1JA 3FXEA 2E5YA 3QH9A 5KJ7C 1J1DB 3A5TA 3GHGA 1PGJA 3L70J 1BCCD 1TU3F 4U3FJ 3VMXA 1JOCA 1LTGC 1URQB 4D6TD 1NU1J 2ZFCA 2POHA 5AW6B 3LIDA 3EFGA 2P2UA 2JR8A 1M8OB 4PJ0H 2Y9YA 3VMYA 1WMKA 1X79B 1IK7A 2ZYGA 1FS0E 1KV4A 1XTCC 2KB7P 3SWFA 3TSIA 3A3YB 2KXPB 3H1HE 3WUVA 1K73Q 2NPSA 2IBZD 1S72P 1AA0A 5APWA 1NTZG 1J2JB 2KNCA 3PP5A 1VF5D 1YTZI 2V7QH 2FYUK 4NPEA 3RK2B 2B88A 4R4LA 3EWKA 3V2NA 4C46A 1DIPA 1W2BO 5CJ4A 2K1AA 3MIWA 4JQ0D 3AE4C 2A45I 2BEZF 4GOEA 2QA4P 2ITAA 1JY3N 2CPBA 5CCGA 3VMZA 1R8EA 4WB4A 1MUUA 1QVGO 1EDLA 2KSJA 3D6ZA 1SQPG 4GIFA 1JCCA 1NTKE 4L73A 2NPSC 4H44B 5AW8B 1IJDB 1QL1A 3RK3B 1BDDA 1GK4A 4AQRD 1SFCB 1NTZJ 3H1HD 1PPJD 3H1JG 2G3AA 1YYCA 2H8PD 3TNUA 2K9JA 2K37A 1YHQP 2D2CD 4ZKUA 1RE3A 2ZVNB 1LWUB 3CCQP 3A0BE 2M8RA 3M91A 2FYUG 1HUCA 1EQ7A 3AEAC 3EFFK 1JM0A 1PP9G 3HD7B 1SQPJ 2PP6A 5GTHE 2IFMA 4W7ZA 2E75C 2LR2A 3L35A 2HODB 1GU4A 3L71E 3N4XA 3L75G 1PGQA 1N7SA 3C9IA 4KHXA 1RE3C 3B5NA 3V6IA 3H1JJ 2Q9IA 2K88A 1Y47A 2KI7B 1M7LA 1L4AB 3G4SP 3I56P 2Q5UA 5APSA 2ZYAA 3PJSK 2VRSA 2FYUJ 2QG4A 1K9MQ 4WY4A 1KB9E 1FOSF 2BCCG 1KQFB 2IFNA 2OQQA 1N73B 1HWTC 3FWNA 4QMAA 3BCCG 3H1LD 1PP9J 3CL3D 2I8DA 1JTHA 1FOSE 3KHUA 1N7SC 1RF1A 1OFCX 3E7KA 3B5NC 3L72E 3L75J 1KILA 2WSFJ 1FZEA 5BU8B 3CCMP 3L71D 4YTPC 1SQVD 2A06G 3GW6A 1IFIA 5B66E 2FXPA 1EDKA 1X9VA 4WY4C 3CWBG 2FXOA 4ZMDA 1ZR4A 1HVVA 2WPRA 1M1KQ 1VQKP 2Y9ZA 2P1JA 2BCCJ 2XDJA 3L37A 2E76B 1JY2N 4TLFA 3BCCJ 3OJAB 2WSCH 1OZHA 2MJZA 2GM4A 1YQ4C 1Y9BA 5APYA 1T2KC 1IK9A 1CZQA 3GLMA 1ZRTE 1NGMB 4AUWA 1Q2NA 1URQA 3S9OA 1ZLLA 4B86A 2IYOA 3LW5J 3L72D 1BCCG 1YI2P 1G1JA 5AW2B 2YIUC 2O01J 3Q3DA 1NKZB 1S3JA 3CWBJ 3AE9C 4IL6X 3U1AA 1K8AQ 2N1TB 1L0LD 5B5EE 2K3RA 1NTME 3M9QA 2BEQD 1FDOA 1HGVA 1UIXA 3HUSC 3SFEC 3R2PA 2FYNC 2QJKB 3UIAA 1P84D 1SS1A 3IR9A 3AEBC 4PJ0E 1URQC 1BGYD 3T97B 2IBZG 1N8RQ 5AVUB 1KB9I 2WSEJ 1DEEG 2C9LY 5GTHH 3ZDMA 3MGNA 5APUA 5AW1B 3S4RA 3EQ2A 3CC7P 4PD4E 1YQ3C 1BCCJ 1H0TB 2J59M 1GMJA 2B9BA 1VQLP 2QRXA 4AYCA 3GF7A 3H1KD 5KJ7D 2KOGA 1DD4A 4WWIA 3L73D 3O8ZA 1VQPP 4GT1A 5KTBA 1Y8AA 2Z5HA 1GU5A 5APXA 4JYBA 1M56D 3MP7B 4GOFA 3L74E 4K35A 1KB9H 2O01N 3FGAD 2GUVA 2KSEA 3RK2C 1VF5B 1SFCA 2Z5IA 3VP9A 2IZ1A 2IZ0A 3O6QB 1PFIA 1FAVA 1BE3E 4L75A 3H1HG 1PPJG 4BXLA 1LTSC 3KPEA 4ZKPA 1E79H 1LWUA 1VQMP 1HH0A 1S2EA 1YBKA 1QGKB 2YMKA 1U7MA 1IFDA 5B66H 3HD7A 2N9BA 1SQBE 4OVNF 3MTUE 1T3JA 2AXCA 3ITKA 1SFCC 2IX7C 3V4QA 3CCRP 2HODA 2QE7H 1LTTC 5CMZA 2ZXEB 1SQVK 4KJMA 3OAKA 4NPDA 2GUSA 2XKMA 3L74D 2JDIH 3AEGC 4UB6E 1JMMA 2D2CB 1L2PA 1A02F 3H1HJ 1OVRA 3VOPA 2NPSD 2WT7B 4HJGH 2XU6A 1L4AA 1JEKA 3M06A 5BU5A 2CK3H 3HD7C 3CXHH 1VQ4P 4PV1D 1N73A 2J5UA 4Y99B 4ZNCA 1FJKA 2JJLA 1LGHB 3H1IE 2R3SA 4IL6E 5TJHA 3TK1A 1NAFA 4PD4I 3H1LG 4C7NB 1VL2A 5B5EH 1SQBD 5KLVG 1KMIZ 3CC2P 5L8RJ 4L76A 3C8VA 2LXCB 4GKGA 1JCDA 1L4AC 1JB0J 5CBOA 3SWKA 1L0LK 1SQVG 2GA1A 1FJPA 2HPCB 1WT6A 2H7HA 2E75D 5CBNA 2YO3A 1N73C 1YJNP 3H32B 3AEEC 2OYIB 1FU1A 2WMMA 3U59A 4OH8B 4PD4H 1L0NE 3TGUG 2WITA 1X22A 3GHGC 3W68A 4DCKA 2PRRA 3AE5C 3H1LJ 1SP4A 2OYOA 1AQ5A 1KYOH 1VQ8P 5CHXA 3G6EP 3TYYA 1OW6A 3H1ID 1SQXK 5KLVJ 1H88A 5CJ0A 2M3EA 4N78E 1FZCB 5KAIH 1R5SA 3A2AA 1M90Q 1KFMA 3FX0A 1HGZA 1SQVJ 5AVYB 4LLHA 2YXQB 2RN0A 3B5ND 2R5DA 2E76C 2O1JA 3C1LA 4EYYQ 2N1TA 2NZ2A 5AVRB 2M5AB 2FFDB 2O01H 2KZIA 1L0LG 2WPSA 3G3ZA 5CCHA 1IZNB 5APVA 3TGUJ 2E74C 1Q81Q 1ZMEC 3FXDA 3R4YA 3CPWO 3F89A 3L70E 2FKWB 1RQVA 1FC2C 1EZVG 2YKOA 4U3FE 4GODA 3T97A 1YJWP 1BGYG 3Q2YA 1OMIA 5CCGC 3QWOC 4JBZA 4H13D 4ASWA 2N1TC 1H0TA 1SQXG 3A0HE 1EDJA 4N78D 1T2KD 5CCHC 4UB6H 5AW5B 3U1CA 3H1KG 2RH0A 2JWAA 2J58A 4EOTA 1L0LJ 1RH5B 3OA7A 3L73G 1PV3A 2KK7A 1J1EB 1NTKD 5AVTB 2C0WA 3PTZA 3F5HA 1VPCA 5K5GB 3HE4B 3O6QA 1JO5A 3BRTB 1Q7YQ 3M9BA 1IFPA 1S1CX 4IL6H 4BRYB 1BGYJ 4H0LD 1KORA 1LT9B 1NO4A 1Q82Q 2Y0DA 1VQ7P 2CPSA 1LJ2A 2WSSH 1NVOA 1MKMA 1SQXJ 2PGDA 1HJ0A 3N7NA 3AE2C 1ZXGA 1LTIC 2IPPA 2AEMA 3AE1C 4DOJA 3H1KJ 5KLIB 2W6BA 3L73J 3M9HA 1AQTA 1NTZE 1X0TA 4I7ZC 3KZIE 1LTJB 2W6AA 4MN4C 2KZJA 3BASA 1EC5A 2FXMA 2WWWA 3L36A 3CCJP 2H88C 5AVXB 2KLVA 3AE6C 2LXBA 1QLED 3I5CA 3IF4A 3L74G 1CI6B 2WT7A 2ZAEB 2H43A 4KT0J 2M3BA 1KN7A 3IAOA 2OYHB 2JO1A 1M1JB 2L91A 3CX5E 3NMDA 2XV5A 1SQPE 3VN0A 2M0BA 3RL0C 2E5TA 3SFDC 3PH0A 1QVFO 1RF1C 1KB9D 2QIWA 2V4HA 1LNQA 4JYCA 1VQ9P 4C7NA 3Q5SA 4RJTA 1KILC 1W2EA 2W6JH 2OTJP 4YPCA 1D7MA 3H1JE 2R5BA 2A45G 1GL2D 3P8MC 4HKZH 1EDIA 3CXHE 1NTZD 1S4XA 4OGQC 1RF0A 3SWYA 3L74J 4D6TG 3CCVP 2HPCA 2FYUE 2WQYC 1K05A 3H32A 2HLOA 5KKZB 4PV1B 1FZBA 4XFJA 2Q7CA 4ASVA 2ZT9C 1PP9E 1N86A 4WBAA 1QEXA 2I1KA 3G71P 2B87B 2PFXA 2Y0CA 1W5CE 2OARA 1J1DC 3A0HH 2P7JA 3CCLP 1SQPD 1FBMA 5AW0B 1NHLA 2JEEA 2Q6QA 3K5BA 1G2CB 4R4MA 3L75E 1FE6A 1RF0C 3V5BA 4IFMA 1DD3A 5EFWB 1ZRTD 1IFJA 3MD0A 1FZCA 2P10A 4YXDC 5DJTB 3H1JD 2RMZA 2E75B 1PIXA 1SVFA 3CXHD 4HB1A 1AVOA 4D6TJ 4DZOA 4DJGA 2BCCE 3E1RA 1HF9A 1GW3A 1PZQA 1KYOE 1H8AA 2MKVA 1MV8A 1QL2A 2M5AA 2FFDA 2YXRB 2K9YA 3S1KA 2XNXA 1NTKK 3MUDA 4M3LA 1L4AD 2WPQA 3AE3C 2QM7A 1N2DC 3WU2E 1NTMD 1PP9D 3JCUE 5KAIE 1JNMA 4IFFA 5TISH 2HG5D 3KDPB 3CX5I 2QJYB 5BVZA 4TT3H 2A06E 3L75D 2WTYA 3L4FA 3CCSP 2QJPB 3CWBE 1MFZA 3KZIH 4XE5B 3RL0g 1IFNA 4PD4D 1HJBA 3MUDC 1EZVI 4H44C 2P67A 3H6PA 3RK3C 2Q1KA 3CXHI 1OWAA 1HBWA 1AJYA 5GTIH 1NYHA 1KYOD 1KFNA 1DX7A 1YTZT 5AVZB 1S9KE 3CX5H 3GMAA 4C7RA 2YKQA 2QEXP 1NTKG 1JMBA 1OW8A 3VYIA 1SQQE 1LWUC 4LGDE 1FZGA 4BRYA 4U7JA 4H13B 3P8CE 1LT9A 1EXIA 2JWDA 2E74D 3GF3A 1BE3D 2A06D 1YITP 2C9NY 2E43A 1OW7A 2KS1B 1RQUA 3D70A 2BASA 1FDMA 1QX8A 1USDA 1FZAA 5CCGD 1YJ9P 1ZV8A 2YIUB 4DT0A 2WSCJ 5AVSB 2N1TD 2QVAA 3NFQA 5M1BA 1NTZK 1M57D 3A7OA 1AVYA 2IBZE 3W67A 1LTJA 4I1LA 3HTKB 5CCHD 1JY3O 3VP8A 1NTKJ 1KYOI 1LT9C 3HUSB 1T3UA 3RGUA 4H0LB 2WZ7A 3JC22 3L71G 1CI6A 1AV1A 2FYNB 1N7LA 1SQQD 1IO4A 3KXDA 2WSFH 1VQOP 2OYHA 1M1JA 2XZRA 3P8CD 5KLIC 4LC1A 3CC4P 3PHLA 2IYPA 2QSIA 1SQPK 1NOHA 3VMAA 1SLQA 1S5LX 4W80A 2NRGA 2Q3IA 3M0AA 5E79E 1LTJC 1G1IA 1NAYA 1VQ5P 1Z56A 1KTMA 3FWLA 1MFTA 2E42A 1FZFA 1PPJE 1GDTA 1KILE 3WU2H 1NWQA 3Q5RA 1U7JA 2FYZA 4I6MC 5AW3B 2OYHC 3D6YA 3JCUH 1M1JC 3L71J 2KP8A 3L72G 1MZ9A 1N7SD 2ZYDA 2R3CA 2KLUA 2N9YB 3LW5H 3Q1MA 1YIJP 1NTMK 3NXSA 1OX3A 2B87A 4JF7A 3OW2O 4WY4D 1L0ND 1G2CA 3PRJA 1VDFA 1GL2B 1NU1E 1JUNA 3KYQA 1LT1A 5KAFE 4W7YA 1RE4A 3RL0D 3TDKA 1CW5A 4CPGA 1ZN5A 4XA4A 5KKZC 2WSEH 4PV1C 4IOIH 3HRNA 3L72J 1KILD 1GTWA 2A45H 5DJUB 2UWJE 4EIJA 2HR3A 2IBZI 1T8ZA 2QJKC 2YNYA 3B8EB 2G8YA 1U57A 4OGQD 3H1LE 3BRVB 1LP1B 5AVVB 3B4SA 3NTNA 1PL5A 1DEBA 5KLVE 1RE4C 1NTMG 1BSHA 1XTGB 2ZJSE 2HFED 1RHZB 1PGOA 2ZT9D 3L70D 1OVVA 4U3FD 4EDFA 2B89A 1SQVE 2W83C 1R5LA 1NU1D 3CMEP 3D71A 5APTA 1JY2O 5AVWB 1CSBA 4UB8E 1USEA 5H2FE 1URQD 5AW4B 1KQGB 1KQSO 3B71A 5TISE 1FDIA 1T6AA 4O9BA 3IFMA 3TGUE 4K3AA 3V4WA 2R32A 3SSUA 2AEFA 1SQBK 1VF5C 1ZP0C 2QM8A 4RKUJ 2LKMA 1JY3P 3HE5B 2QJYC 4RO0A 3RK3E 3VTPC 1AFOA 1NTMJ 2DW3A 3RBZA 2QJPC 1KQLA 1SQQK 2KIKA 1S5LE 3LIEA 5KLVD 4A7PA 3CD6P 5E79H 1NKNA 3GHGB 2R44A 5GTIE 3AE7C 3RK2D 2KS1A 3WUUA 2OTKE 1BE3G 2RKLA 3JSVC 1GW4A 1L0LE 2IDBA 3CMAP 3CCEP 1IFMA 4RESB 1Q90D 2L5GB 3V2RA 4GDOA 2PAJA 2Q3EA 3BATA 3TGUD 1P84E 1EZVE 3CLQA 2D2CC 2Z4EA 2YMYA 3HTKA 2V7QJ 3AEDC 3CCUP 4H13C 4HYTB 4H44D 1BGYE 1SQBG 4EI2A 3RK3D 3HUSA 1BDCA 2JP3A 2NPSB 3WMM0 5AVQB 5AW7B 2KNCB 2E74B 2FY8A 1SQXE 4N6JA 1SFCD 4OWFA 2W8ZA 4Y99C 1SQQG 2OYIA 3P32A 5KAFH 1HTLC 3H1KE 3AEFC 1BE3J 1ZW0A 2AXTE 3CX5D 1L0NK 3ABVC 3MZWB 5APQA 5C39A 2JKVA 3L73E 1WRGA 1Q86Q 2O1KA 1GK6A 3USSA 4BWNA 3HD7D 2ZXXA 4H0LC 3PLNA 1NJIQ 3A0BH 1GD2E 3H1IG 1KZUB 1E5WA 3TF5A 3AECC 1SQBJ 1EZVD 2H89C 3G9RA 2OYIC 4JPZB 3TNUB 3H25A 1ZR2A 2K9JB 3Q5PA 1SQQJ 3CI9A 3V2QA 2FYUD 1SQXD 1VQNP 2O3JA 2AEJA 3RBXA 3BCCE 1OVUA 2WVRA 4WVZA 3WUTA 2P58A 2KYVA 4Z1MH 4UB8H 1LTAC 2SPZA 5H2FH 2WPVB 2Y0EA 1A02J 1L0NG 2YKPA 4YXWH 1GL2A 1FZCC 1RY3A 1NU1K 1JY2P 4IFDK 3H1IJ 1K04A 4I2LC 1BSNA 1N7SB 2OGUA 1ZOYC 2FFDC 3B5NB 4I7ZB 1H89A 4HH2A 1P84I 3MHVA 1S5LH 3P7KA 3KQGA 1KD1Q 2OTLP 2BCCD 1LTBC 4WY4B 1EXJA 1LP1A 3BCCD 1GL2C 4N3YB 5KLVK 1IC2A 2E76D 3BVHA 1PGPA 3HE4A 4NPFX 1L0NJ 1JTHB 3RL0B 2W27A 2C0XA 1BCCE 1RF1B 1KC8Q 3GG2A
chains in the Genus database with same CATH topology
3M0DA 1LTIC 2IPPA 2YO2A 2R3CA 3UIAA 3LW5H 4DOJA 1KILB 3IR9A 5KJ7A 1NTMK 2W6BA 1URQC 3NXSA 3V2PA 4JF7A 3E1IA 3M9HA 1DH3A 5AVUB 1GZLA 2C9LY 1J1EC 3MGNA 1LTJB 4WY4D 5APUA 5AW1B 2W6AA 3EQ2A 3BASA 2FXMA 1G2CA 2WWWA 3L36A 5AVXB 1VDFA 2KLVA 2J59M 3HE5A 1X8YA 3I5CA 4AYCA 1GL2B 3II6A 2WT7A 1CI6B 2H43A 1JUNA 3KYQA 1OXZA 4W7YA 1RE4A 2M3BA 5KJ7D 2KOGA 3RL0D 5AW9B 1CW5A 1S9KD 2OYHB 1ZN5A 4XA4A 3M0DC 2HYNA 1M1JB 1NH4A 2I1JA 3O8ZA 3NMDA 2WSEH 4GT1A 3HRNA 2XV5A 5KTBA 1KILD 2Z5HA 3VN0A 5KJ7C 1GTWA 1J1DB 2A45H 3RL0C 5APXA 1GU5A 3A5TA 4JYBA 3GHGA 4EIJA 1RF1C 2GUVA 3RK2C 1T8ZA 3VMXA 1JOCA 4JYCA 1LTGC 1URQB 2YNYA 1SFCA 2Z5IA 3VP9A 4C7NA 3B8EB 2ZFCA 1KILC 1PFIA 1FAVA 1W2EA 2POHA 5AW6B 3LIDA 3EFGA 3BRVB 2P2UA 5AVVB 1LTSC 2R5BA 3KPEA 2A45G 3NTNA 3VMYA 1X79B 1GL2D 4ZKPA 1DEBA 3P8MC 1LWUA 1RE4C 1XTGB 1HH0A 1XTCC 2KB7P 2HFED 3SWFA 1RF0A 3SWYA 2HPCA 3TSIA 3A3YB 3H32A 2HLOA 3R2PA 1IFDA 3HD7A 2N9BA 5APTA 1JY2O 2NPSA 5AVWB 1CSBA 1FZBA 5APWA 2Q7CA 3MTUE 1T3JA 1N86A 1J2JB 4WBAA 2I1KA 3PP5A 1SFCC 1YTZI 2IX7C 1URQD 5AW4B 3V4QA 2HODA 1LTTC 2FYUK 5CMZA 3RK2B 2OARA 2ZXEB 1J1DC 3V2NA 1SQVK 2P7JA 4C46A 4O9BA 3IFMA 1FBMA 5CJ4A 3V4WA 5AW0B 3MIWA 1NHLA 2R32A 3OAKA 2JEEA 2GUSA 1G2CB 2XKMA 1SQBK 2QM8A 2A45I 2LKMA 1JMMA 1JY3P 1JY3N 2CPBA 3HE5B 1A02F 5CCGA 2WT7B 3VOPA 2NPSD 3VMZA 1RF0C 3V5BA 3VTPC 2XU6A 4IFMA 4WB4A 1MUUA 1AFOA 1L4AA 2KSJA 3MD0A 1IFJA 1KQLA 1FZCA 1SQQK 3M06A 5BU5A 3LIEA 4GIFA 1JCCA 3HD7C 1SVFA 2NPSC 5AW8B 1N73A 1IJDB 4Y99B 4DZOA 1QL1A 3RK3B 1NKNA 3GHGB 1FJKA 2JJLA 1GW3A 1H8AA 1MV8A 1GK4A 1QL2A 2FFDA 1LGHB 4AQRD 3TK1A 3RK2D 1NAFA 1SFCB 4C7NB 2XNXA 1NTKK 3MUDA 4M3LA 1L4AD 2WPQA 1YYCA 2H8PD 3TNUA 2QM7A 1GW4A 1N2DC 1IFMA 4RESB 1JNMA 2L5GB 3V2RA 4IFFA 4ZKUA 1RE3A 2PAJA 1LWUB 2HG5D 3KDPB 4GKGA 1JCDA 2M8RA 1L4AC 3M91A 3BATA 1HUCA 5BVZA 1L0LK 1FJPA 2HPCB 3CLQA 1WT6A 2H7HA 2WTYA 1EQ7A 2Z4EA 2YMYA 3L4FA 3HTKA 2YO3A 1N73C 4HYTB 3H32B 2OYIB 1FU1A 3RK3D 3HD7B 3HUSA 1MFZA 2PP6A 2NPSB 3U59A 4OH8B 3WMM0 2IFMA 4W7ZA 4XE5B 5AVQB 5AW7B 1IFNA 1HJBA 3L35A 4N6JA 2HODB 1SFCD 1GU4A 2P67A 4Y99C 2WITA 3H6PA 3N4XA 3P32A 3RK3C 2OYIA 3GHGC 1N7SA 1OWAA 3C9IA 1HBWA 1HTLC 1SP4A 4KHXA 1RE3C 1AQ5A 3B5NA 1KFNA 1DX7A 1YTZT 5CHXA 5AVZB 2Q9IA 3TYYA 1S9KE 1SQXK 1L0NK 1H88A 5APQA 5CJ0A 4C7RA 1M7LA 1WRGA 2YKQA 1L4AB 2O1KA 3VYIA 4N78E 2Q5UA 5APSA 1FZCB 1GK6A 1LWUC 2VRSA 3A2AA 4WY4A 1FOSF 1KFMA 4LGDE 5AVYB 1HGZA 2IFNA 3HD7D 1FZGA 1N73B 1HWTC 4LLHA 3P8CE 1GD2E 1LT9A 1KZUB 1E5WA 2R5DA 3B5ND 2O1JA 2N1TA 5AVRB 3CL3D 2FFDB 2O01H 2C9NY 2OYIC 2E43A 1JTHA 1FOSE 1N7SC 2WPSA 3G3ZA 1RF1A 5CCHA 3B5NC 3TNUB 5APVA 2BASA 1ZR2A 1FDMA 3CI9A 3V2QA 1KILA 1FZEA 1FZAA 5BU8B 5CCGD 2FKWB 1ZV8A 2YKOA 3T97A 5AVSB 2N1TD 2KYVA 1IFIA 3NFQA 1NTZK 1X9VA 3A7OA 4WY4C 1LTAC 1LTJA 4I1LA 1ZR4A 3HTKB 5CCGC 5CCHD 2WPRA 1HVVA 1JY3O 3VP8A 1LT9C 1A02J 2N1TC 3HUSB 1T3UA 2WZ7A 2YKPA 1FZCC 1GL2A 2P1JA 1CI6A 1RY3A 2XDJA 3L37A 1NU1K 1N7LA 4N78D 1IO4A 1JY2P 1JY2N 1T2KD 5CCHC 2WSFH 4IFDK 5AW5B 3U1CA 4I2LC 2OYHA 3OJAB 1M1JA 2WSCH 2XZRA 1N7SB 3P8CD 2J58A 2MJZA 4EOTA 4LC1A 2GM4A 2FFDC 3B5NB 3OA7A 1SQPK 5APYA 1NOHA 1T2KC 1H89A 4HH2A 1IK9A 1J1EB 1CZQA 1SLQA 3P7KA 5AVTB 4AUWA 2C0WA 3KQGA 4W80A 2Q3IA 1URQA 3M0AA 1ZLLA 1LTJC 4B86A 1VPCA 1G1IA 3HE4B 1JO5A 1G1JA 1LTBC 3BRTB 3M9BA 5AW2B 1Z56A 4WY4B 1NKZB 1GL2C 4N3YB 3U1AA 1LT9B 2E42A 1FZFA 1NO4A 5KLVK 1GDTA 1IC2A 2N1TB 2CPSA 1NWQA 3BVHA 3HE4A 2FYZA 4I6MC 5AW3B 2OYHC 3M9QA 1M1JC 1JTHB 3RL0B 1HGVA 2W27A 3HUSC 2C0XA 2KP8A 1RF1B 1MZ9A 1N7SD 3N7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OYH B;  1N73 B;  1LTJ B;  1RF0 A;  1LT9 A;  2FFD C;  2FFD A;  1M1J B;  3HUS B;  1T3U A;  2HPC A;  1FZE A;  1FZA A;  1W2E A;  2HOD B;  2XNX A;  1FZC C;  1FZC A;  1LT9 B;  2FFD B;  3H32 A;  2HLO A;  1FZF A;  2HPC B;  2OYI C;  1JY2 P;  2A45 H;  2Z4E A;  1JY2 N;  2HOD A;  2OYI A;  3BVH A;  3GHG C;  2A45 G;  3GHG A;  1FZC B;  1RF1 C;  2A45 I;  1RF1 A;  1N73 C;  1JY2 O;  1LWU C;  2H43 A;  1LWU A;  1RE4 C;  3H32 B;  3E1I A;  1LTJ C;  1N73 A;  2OYH C;  1FZB A;  2OYH A;  1JY3 P;  1M1J C;  1RE4 A;  2OYI B;  1LTJ A;  1JY3 N;  1M1J A;  1N86 A;  1RE3 C;  3HUS C;  3GHG B;  3HUS A;  1FZG A;  1RF1 B;  1JY3 O;  1RE3 A;  1LWU B;  2Q9I A;  1RF0 C;  1LT9 C; 
#chains in the Genus database with same CATH topology
 3IN6 A;  3M0D A;  2ZVO B;  4D6T E;  2YO2 A;  3L70 G;  1P84 H;  2FBW C;  4U3F G;  1KIL B;  5KJ7 A;  1NU1 G;  3V2P A;  3CWB D;  3E1I A;  2KUB A;  1DH3 A;  3I55 P;  1GZL A;  4Y28 J;  1J1E C;  4OGQ B;  4L74 A;  1VQ6 P;  1UII A;  2XND H;  3HE5 A;  1X8Y A;  3II6 A;  1OXZ A;  5AW9 B;  3AE8 C;  1OIP A;  2AXT H;  1S9K D;  3M0D C;  2W90 A;  2HYN A;  2ZT9 B;  1NH4 A;  2I1J A;  3FXE A;  2E5Y A;  3QH9 A;  5KJ7 C;  1J1D B;  3A5T A;  3GHG A;  1PGJ A;  3L70 J;  1BCC D;  1TU3 F;  4U3F J;  3VMX A;  1JOC A;  1LTG C;  1URQ B;  4D6T D;  1NU1 J;  2ZFC A;  2POH A;  5AW6 B;  3LID A;  3EFG A;  2P2U A;  2JR8 A;  1M8O B;  4PJ0 H;  2Y9Y A;  3VMY A;  1WMK A;  1X79 B;  1IK7 A;  2ZYG A;  1FS0 E;  1KV4 A;  1XTC C;  2KB7 P;  3SWF A;  3TSI A;  3A3Y B;  2KXP B;  3H1H E;  3WUV A;  1K73 Q;  2NPS A;  2IBZ D;  1S72 P;  1AA0 A;  5APW A;  1NTZ G;  1J2J B;  2KNC A;  3PP5 A;  1VF5 D;  1YTZ I;  2V7Q H;  2FYU K;  4NPE A;  3RK2 B;  2B88 A;  4R4L A;  3EWK A;  3V2N A;  4C46 A;  1DIP A;  1W2B O;  5CJ4 A;  2K1A A;  3MIW A;  4JQ0 D;  3AE4 C;  2A45 I;  2BEZ F;  4GOE A;  2QA4 P;  2ITA A;  1JY3 N;  2CPB A;  5CCG A;  3VMZ A;  1R8E A;  4WB4 A;  1MUU A;  1QVG O;  1EDL A;  2KSJ A;  3D6Z A;  1SQP G;  4GIF A;  1JCC A;  1NTK E;  4L73 A;  2NPS C;  4H44 B;  5AW8 B;  1IJD B;  1QL1 A;  3RK3 B;  1BDD A;  1GK4 A;  4AQR D;  1SFC B;  1NTZ J;  3H1H D;  1PPJ D;  3H1J G;  2G3A A;  1YYC A;  2H8P D;  3TNU A;  2K9J A;  2K37 A;  1YHQ P;  2D2C D;  4ZKU A;  1RE3 A;  2ZVN B;  1LWU B;  3CCQ P;  3A0B E;  2M8R A;  3M91 A;  2FYU G;  1HUC A;  1EQ7 A;  3AEA C;  3EFF K;  1JM0 A;  1PP9 G;  3HD7 B;  1SQP J;  2PP6 A;  5GTH E;  2IFM A;  4W7Z A;  2E75 C;  2LR2 A;  3L35 A;  2HOD B;  1GU4 A;  3L71 E;  3N4X A;  3L75 G;  1PGQ A;  1N7S A;  3C9I A;  4KHX A;  1RE3 C;  3B5N A;  3V6I A;  3H1J J;  2Q9I A;  2K88 A;  1Y47 A;  2KI7 B;  1M7L A;  1L4A B;  3G4S P;  3I56 P;  2Q5U A;  5APS A;  2ZYA A;  3PJS K;  2VRS A;  2FYU J;  2QG4 A;  1K9M Q;  4WY4 A;  1KB9 E;  1FOS F;  2BCC G;  1KQF B;  2IFN A;  2OQQ A;  1N73 B;  1HWT C;  3FWN A;  4QMA A;  3BCC G;  3H1L D;  1PP9 J;  3CL3 D;  2I8D A;  1JTH A;  1FOS E;  3KHU A;  1N7S C;  1RF1 A;  1OFC X;  3E7K A;  3B5N C;  3L72 E;  3L75 J;  1KIL A;  2WSF J;  1FZE A;  5BU8 B;  3CCM P;  3L71 D;  4YTP C;  1SQV D;  2A06 G;  3GW6 A;  1IFI A;  5B66 E;  2FXP A;  1EDK A;  1X9V A;  4WY4 C;  3CWB G;  2FXO A;  4ZMD A;  1ZR4 A;  1HVV A;  2WPR A;  1M1K Q;  1VQK P;  2Y9Z A;  2P1J A;  2BCC J;  2XDJ A;  3L37 A;  2E76 B;  1JY2 N;  4TLF A;  3BCC J;  3OJA B;  2WSC H;  1OZH A;  2MJZ A;  2GM4 A;  1YQ4 C;  1Y9B A;  5APY A;  1T2K C;  1IK9 A;  1CZQ A;  3GLM A;  1ZRT E;  1NGM B;  4AUW A;  1Q2N A;  1URQ A;  3S9O A;  1ZLL A;  4B86 A;  2IYO A;  3LW5 J;  3L72 D;  1BCC G;  1YI2 P;  1G1J A;  5AW2 B;  2YIU C;  2O01 J;  3Q3D A;  1NKZ B;  1S3J A;  3CWB J;  3AE9 C;  4IL6 X;  3U1A A;  1K8A Q;  2N1T B;  1L0L D;  5B5E E;  2K3R A;  1NTM E;  3M9Q A;  2BEQ D;  1FDO A;  1HGV A;  1UIX A;  3HUS C;  3SFE C;  3R2P A;  2FYN C;  2QJK B;  3UIA A;  1P84 D;  1SS1 A;  3IR9 A;  3AEB C;  4PJ0 E;  1URQ C;  1BGY D;  3T97 B;  2IBZ G;  1N8R Q;  5AVU B;  1KB9 I;  2WSE J;  1DEE G;  2C9L Y;  5GTH H;  3ZDM A;  3MGN A;  5APU A;  5AW1 B;  3S4R A;  3EQ2 A;  3CC7 P;  4PD4 E;  1YQ3 C;  1BCC J;  1H0T B;  2J59 M;  1GMJ A;  2B9B A;  1VQL P;  2QRX A;  4AYC A;  3GF7 A;  3H1K D;  5KJ7 D;  2KOG A;  1DD4 A;  4WWI A;  3L73 D;  3O8Z A;  1VQP P;  4GT1 A;  5KTB A;  1Y8A A;  2Z5H A;  1GU5 A;  5APX A;  4JYB A;  1M56 D;  3MP7 B;  4GOF A;  3L74 E;  4K35 A;  1KB9 H;  2O01 N;  3FGA D;  2GUV A;  2KSE A;  3RK2 C;  1VF5 B;  1SFC A;  2Z5I A;  3VP9 A;  2IZ1 A;  2IZ0 A;  3O6Q B;  1PFI A;  1FAV A;  1BE3 E;  4L75 A;  3H1H G;  1PPJ G;  4BXL A;  1LTS C;  3KPE A;  4ZKP A;  1E79 H;  1LWU A;  1VQM P;  1HH0 A;  1S2E A;  1YBK A;  1QGK B;  2YMK A;  1U7M A;  1IFD A;  5B66 H;  3HD7 A;  2N9B A;  1SQB E;  4OVN F;  3MTU E;  1T3J A;  2AXC A;  3ITK A;  1SFC C;  2IX7 C;  3V4Q A;  3CCR P;  2HOD A;  2QE7 H;  1LTT C;  5CMZ A;  2ZXE B;  1SQV K;  4KJM A;  3OAK A;  4NPD A;  2GUS A;  2XKM A;  3L74 D;  2JDI H;  3AEG C;  4UB6 E;  1JMM A;  2D2C B;  1L2P A;  1A02 F;  3H1H J;  1OVR A;  3VOP A;  2NPS D;  2WT7 B;  4HJG H;  2XU6 A;  1L4A A;  1JEK A;  3M06 A;  5BU5 A;  2CK3 H;  3HD7 C;  3CXH H;  1VQ4 P;  4PV1 D;  1N73 A;  2J5U A;  4Y99 B;  4ZNC A;  1FJK A;  2JJL A;  1LGH B;  3H1I E;  2R3S A;  4IL6 E;  5TJH A;  3TK1 A;  1NAF A;  4PD4 I;  3H1L G;  4C7N B;  1VL2 A;  5B5E H;  1SQB D;  5KLV G;  1KMI Z;  3CC2 P;  5L8R J;  4L76 A;  3C8V A;  2LXC B;  4GKG A;  1JCD A;  1L4A C;  1JB0 J;  5CBO A;  3SWK A;  1L0L K;  1SQV G;  2GA1 A;  1FJP A;  2HPC B;  1WT6 A;  2H7H A;  2E75 D;  5CBN A;  2YO3 A;  1N73 C;  1YJN P;  3H32 B;  3AEE C;  2OYI B;  1FU1 A;  2WMM A;  3U59 A;  4OH8 B;  4PD4 H;  1L0N E;  3TGU G;  2WIT A;  1X22 A;  3GHG C;  3W68 A;  4DCK A;  2PRR A;  3AE5 C;  3H1L J;  1SP4 A;  2OYO A;  1AQ5 A;  1KYO H;  1VQ8 P;  5CHX A;  3G6E P;  3TYY A;  1OW6 A;  3H1I D;  1SQX K;  5KLV J;  1H88 A;  5CJ0 A;  2M3E A;  4N78 E;  1FZC B;  5KAI H;  1R5S A;  3A2A A;  1M90 Q;  1KFM A;  3FX0 A;  1HGZ A;  1SQV J;  5AVY B;  4LLH A;  2YXQ B;  2RN0 A;  3B5N D;  2R5D A;  2E76 C;  2O1J A;  3C1L A;  4EYY Q;  2N1T A;  2NZ2 A;  5AVR B;  2M5A B;  2FFD B;  2O01 H;  2KZI A;  1L0L G;  2WPS A;  3G3Z A;  5CCH A;  1IZN B;  5APV A;  3TGU J;  2E74 C;  1Q81 Q;  1ZME C;  3FXD A;  3R4Y A;  3CPW O;  3F89 A;  3L70 E;  2FKW B;  1RQV A;  1FC2 C;  1EZV G;  2YKO A;  4U3F E;  4GOD A;  3T97 A;  1YJW P;  1BGY G;  3Q2Y A;  1OMI A;  5CCG C;  3QWO C;  4JBZ A;  4H13 D;  4ASW A;  2N1T C;  1H0T A;  1SQX G;  3A0H E;  1EDJ A;  4N78 D;  1T2K D;  5CCH C;  4UB6 H;  5AW5 B;  3U1C A;  3H1K G;  2RH0 A;  2JWA A;  2J58 A;  4EOT A;  1L0L J;  1RH5 B;  3OA7 A;  3L73 G;  1PV3 A;  2KK7 A;  1J1E B;  1NTK D;  5AVT B;  2C0W A;  3PTZ A;  3F5H A;  1VPC A;  5K5G B;  3HE4 B;  3O6Q A;  1JO5 A;  3BRT B;  1Q7Y Q;  3M9B A;  1IFP A;  1S1C X;  4IL6 H;  4BRY B;  1BGY J;  4H0L D;  1KOR A;  1LT9 B;  1NO4 A;  1Q82 Q;  2Y0D A;  1VQ7 P;  2CPS A;  1LJ2 A;  2WSS H;  1NVO A;  1MKM A;  1SQX J;  2PGD A;  1HJ0 A;  3N7N A;  3AE2 C;  1ZXG A;  1LTI C;  2IPP A;  2AEM A;  3AE1 C;  4DOJ A;  3H1K J;  5KLI B;  2W6B A;  3L73 J;  3M9H A;  1AQT A;  1NTZ E;  1X0T A;  4I7Z C;  3KZI E;  1LTJ B;  2W6A A;  4MN4 C;  2KZJ A;  3BAS A;  1EC5 A;  2FXM A;  2WWW A;  3L36 A;  3CCJ P;  2H88 C;  5AVX B;  2KLV A;  3AE6 C;  2LXB A;  1QLE D;  3I5C A;  3IF4 A;  3L74 G;  1CI6 B;  2WT7 A;  2ZAE B;  2H43 A;  4KT0 J;  2M3B A;  1KN7 A;  3IAO A;  2OYH B;  2JO1 A;  1M1J B;  2L91 A;  3CX5 E;  3NMD A;  2XV5 A;  1SQP E;  3VN0 A;  2M0B A;  3RL0 C;  2E5T A;  3SFD C;  3PH0 A;  1QVF O;  1RF1 C;  1KB9 D;  2QIW A;  2V4H A;  1LNQ A;  4JYC A;  1VQ9 P;  4C7N A;  3Q5S A;  4RJT A;  1KIL C;  1W2E A;  2W6J H;  2OTJ P;  4YPC A;  1D7M A;  3H1J E;  2R5B A;  2A45 G;  1GL2 D;  3P8M C;  4HKZ H;  1EDI A;  3CXH E;  1NTZ D;  1S4X A;  4OGQ C;  1RF0 A;  3SWY A;  3L74 J;  4D6T G;  3CCV P;  2HPC A;  2FYU E;  2WQY C;  1K05 A;  3H32 A;  2HLO A;  5KKZ B;  4PV1 B;  1FZB A;  4XFJ A;  2Q7C A;  4ASV A;  2ZT9 C;  1PP9 E;  1N86 A;  4WBA A;  1QEX A;  2I1K A;  3G71 P;  2B87 B;  2PFX A;  2Y0C A;  1W5C E;  2OAR A;  1J1D C;  3A0H H;  2P7J A;  3CCL P;  1SQP D;  1FBM A;  5AW0 B;  1NHL A;  2JEE A;  2Q6Q A;  3K5B A;  1G2C B;  4R4M A;  3L75 E;  1FE6 A;  1RF0 C;  3V5B A;  4IFM A;  1DD3 A;  5EFW B;  1ZRT D;  1IFJ A;  3MD0 A;  1FZC A;  2P10 A;  4YXD C;  5DJT B;  3H1J D;  2RMZ A;  2E75 B;  1PIX A;  1SVF A;  3CXH D;  4HB1 A;  1AVO A;  4D6T J;  4DZO A;  4DJG A;  2BCC E;  3E1R A;  1HF9 A;  1GW3 A;  1PZQ A;  1KYO E;  1H8A A;  2MKV A;  1MV8 A;  1QL2 A;  2M5A A;  2FFD A;  2YXR B;  2K9Y A;  3S1K A;  2XNX A;  1NTK K;  3MUD A;  4M3L A;  1L4A D;  2WPQ A;  3AE3 C;  2QM7 A;  1N2D C;  3WU2 E;  1NTM D;  1PP9 D;  3JCU E;  5KAI E;  1JNM A;  4IFF A;  5TIS H;  2HG5 D;  3KDP B;  3CX5 I;  2QJY B;  5BVZ A;  4TT3 H;  2A06 E;  3L75 D;  2WTY A;  3L4F A;  3CCS P;  2QJP B;  3CWB E;  1MFZ A;  3KZI H;  4XE5 B;  3RL0 g;  1IFN A;  4PD4 D;  1HJB A;  3MUD C;  1EZV I;  4H44 C;  2P67 A;  3H6P A;  3RK3 C;  2Q1K A;  3CXH I;  1OWA A;  1HBW A;  1AJY A;  5GTI H;  1NYH A;  1KYO D;  1KFN A;  1DX7 A;  1YTZ T;  5AVZ B;  1S9K E;  3CX5 H;  3GMA A;  4C7R A;  2YKQ A;  2QEX P;  1NTK G;  1JMB A;  1OW8 A;  3VYI A;  1SQQ E;  1LWU C;  4LGD E;  1FZG A;  4BRY A;  4U7J A;  4H13 B;  3P8C E;  1LT9 A;  1EXI A;  2JWD A;  2E74 D;  3GF3 A;  1BE3 D;  2A06 D;  1YIT P;  2C9N Y;  2E43 A;  1OW7 A;  2KS1 B;  1RQU A;  3D70 A;  2BAS A;  1FDM A;  1QX8 A;  1USD A;  1FZA A;  5CCG D;  1YJ9 P;  1ZV8 A;  2YIU B;  4DT0 A;  2WSC J;  5AVS B;  2N1T D;  2QVA A;  3NFQ A;  5M1B A;  1NTZ K;  1M57 D;  3A7O A;  1AVY A;  2IBZ E;  3W67 A;  1LTJ A;  4I1L A;  3HTK B;  5CCH D;  1JY3 O;  3VP8 A;  1NTK J;  1KYO I;  1LT9 C;  3HUS B;  1T3U A;  3RGU A;  4H0L B;  2WZ7 A;  3JC2 2;  3L71 G;  1CI6 A;  1AV1 A;  2FYN B;  1N7L A;  1SQQ D;  1IO4 A;  3KXD A;  2WSF H;  1VQO P;  2OYH A;  1M1J A;  2XZR A;  3P8C D;  5KLI C;  4LC1 A;  3CC4 P;  3PHL A;  2IYP A;  2QSI A;  1SQP K;  1NOH A;  3VMA A;  1SLQ A;  1S5L X;  4W80 A;  2NRG A;  2Q3I A;  3M0A A;  5E79 E;  1LTJ C;  1G1I A;  1NAY A;  1VQ5 P;  1Z56 A;  1KTM A;  3FWL A;  1MFT A;  2E42 A;  1FZF A;  1PPJ E;  1GDT A;  1KIL E;  3WU2 H;  1NWQ A;  3Q5R A;  1U7J A;  2FYZ A;  4I6M C;  5AW3 B;  2OYH C;  3D6Y A;  3JCU H;  1M1J C;  3L71 J;  2KP8 A;  3L72 G;  1MZ9 A;  1N7S D;  2ZYD A;  2R3C A;  2KLU A;  2N9Y B;  3LW5 H;  3Q1M A;  1YIJ P;  1NTM K;  3NXS A;  1OX3 A;  2B87 A;  4JF7 A;  3OW2 O;  4WY4 D;  1L0N D;  1G2C A;  3PRJ A;  1VDF A;  1GL2 B;  1NU1 E;  1JUN A;  3KYQ A;  1LT1 A;  5KAF E;  4W7Y A;  1RE4 A;  3RL0 D;  3TDK A;  1CW5 A;  4CPG A;  1ZN5 A;  4XA4 A;  5KKZ C;  2WSE H;  4PV1 C;  4IOI H;  3HRN A;  3L72 J;  1KIL D;  1GTW A;  2A45 H;  5DJU B;  2UWJ E;  4EIJ A;  2HR3 A;  2IBZ I;  1T8Z A;  2QJK C;  2YNY A;  3B8E B;  2G8Y A;  1U57 A;  4OGQ D;  3H1L E;  3BRV B;  1LP1 B;  5AVV B;  3B4S A;  3NTN A;  1PL5 A;  1DEB A;  5KLV E;  1RE4 C;  1NTM G;  1BSH A;  1XTG B;  2ZJS E;  2HFE D;  1RHZ B;  1PGO A;  2ZT9 D;  3L70 D;  1OVV A;  4U3F D;  4EDF A;  2B89 A;  1SQV E;  2W83 C;  1R5L A;  1NU1 D;  3CME P;  3D71 A;  5APT A;  1JY2 O;  5AVW B;  1CSB A;  4UB8 E;  1USE A;  5H2F E;  1URQ D;  5AW4 B;  1KQG B;  1KQS O;  3B71 A;  5TIS E;  1FDI A;  1T6A A;  4O9B A;  3IFM A;  3TGU E;  4K3A A;  3V4W A;  2R32 A;  3SSU A;  2AEF A;  1SQB K;  1VF5 C;  1ZP0 C;  2QM8 A;  4RKU J;  2LKM A;  1JY3 P;  3HE5 B;  2QJY C;  4RO0 A;  3RK3 E;  3VTP C;  1AFO A;  1NTM J;  2DW3 A;  3RBZ A;  2QJP C;  1KQL A;  1SQQ K;  2KIK A;  1S5L E;  3LIE A;  5KLV D;  4A7P A;  3CD6 P;  5E79 H;  1NKN A;  3GHG B;  2R44 A;  5GTI E;  3AE7 C;  3RK2 D;  2KS1 A;  3WUU A;  2OTK E;  1BE3 G;  2RKL A;  3JSV C;  1GW4 A;  1L0L E;  2IDB A;  3CMA P;  3CCE P;  1IFM A;  4RES B;  1Q90 D;  2L5G B;  3V2R A;  4GDO A;  2PAJ A;  2Q3E A;  3BAT A;  3TGU D;  1P84 E;  1EZV E;  3CLQ A;  2D2C C;  2Z4E A;  2YMY A;  3HTK A;  2V7Q J;  3AED C;  3CCU P;  4H13 C;  4HYT B;  4H44 D;  1BGY E;  1SQB G;  4EI2 A;  3RK3 D;  3HUS A;  1BDC A;  2JP3 A;  2NPS B;  3WMM 0;  5AVQ B;  5AW7 B;  2KNC B;  2E74 B;  2FY8 A;  1SQX E;  4N6J A;  1SFC D;  4OWF A;  2W8Z A;  4Y99 C;  1SQQ G;  2OYI A;  3P32 A;  5KAF H;  1HTL C;  3H1K E;  3AEF C;  1BE3 J;  1ZW0 A;  2AXT E;  3CX5 D;  1L0N K;  3ABV C;  3MZW B;  5APQ A;  5C39 A;  2JKV A;  3L73 E;  1WRG A;  1Q86 Q;  2O1K A;  1GK6 A;  3USS A;  4BWN A;  3HD7 D;  2ZXX A;  4H0L C;  3PLN A;  1NJI Q;  3A0B H;  1GD2 E;  3H1I G;  1KZU B;  1E5W A;  3TF5 A;  3AEC C;  1SQB J;  1EZV D;  2H89 C;  3G9R A;  2OYI C;  4JPZ B;  3TNU B;  3H25 A;  1ZR2 A;  2K9J B;  3Q5P A;  1SQQ J;  3CI9 A;  3V2Q A;  2FYU D;  1SQX D;  1VQN P;  2O3J A;  2AEJ A;  3RBX A;  3BCC E;  1OVU A;  2WVR A;  4WVZ A;  3WUT A;  2P58 A;  2KYV A;  4Z1M H;  4UB8 H;  1LTA C;  2SPZ A;  5H2F H;  2WPV B;  2Y0E A;  1A02 J;  1L0N G;  2YKP A;  4YXW H;  1GL2 A;  1FZC C;  1RY3 A;  1NU1 K;  1JY2 P;  4IFD K;  3H1I J;  1K04 A;  4I2L C;  1BSN A;  1N7S B;  2OGU A;  1ZOY C;  2FFD C;  3B5N B;  4I7Z B;  1H89 A;  4HH2 A;  1P84 I;  3MHV A;  1S5L H;  3P7K A;  3KQG A;  1KD1 Q;  2OTL P;  2BCC D;  1LTB C;  4WY4 B;  1EXJ A;  1LP1 A;  3BCC D;  1GL2 C;  4N3Y B;  5KLV K;  1IC2 A;  2E76 D;  3BVH A;  1PGP A;  3HE4 A;  4NPF X;  1L0N J;  1JTH B;  3RL0 B;  2W27 A;  2C0X A;  1BCC E;  1RF1 B;  1KC8 Q;  3GG2 A; 
#chains in the Genus database with same CATH homology
 3M0D A;  1LTI C;  2IPP A;  2YO2 A;  2R3C A;  3UIA A;  3LW5 H;  4DOJ A;  1KIL B;  3IR9 A;  5KJ7 A;  1NTM K;  2W6B A;  1URQ C;  3NXS A;  3V2P A;  4JF7 A;  3E1I A;  3M9H A;  1DH3 A;  5AVU B;  1GZL A;  2C9L Y;  1J1E C;  3MGN A;  1LTJ B;  4WY4 D;  5APU A;  5AW1 B;  2W6A A;  3EQ2 A;  3BAS A;  2FXM A;  1G2C A;  2WWW A;  3L36 A;  5AVX B;  1VDF A;  2KLV A;  2J59 M;  3HE5 A;  1X8Y A;  3I5C A;  4AYC A;  1GL2 B;  3II6 A;  2WT7 A;  1CI6 B;  2H43 A;  1JUN A;  3KYQ A;  1OXZ A;  4W7Y A;  1RE4 A;  2M3B A;  5KJ7 D;  2KOG A;  3RL0 D;  5AW9 B;  1CW5 A;  1S9K D;  2OYH B;  1ZN5 A;  4XA4 A;  3M0D C;  2HYN A;  1M1J B;  1NH4 A;  2I1J A;  3O8Z A;  3NMD A;  2WSE H;  4GT1 A;  3HRN A;  2XV5 A;  5KTB A;  1KIL D;  2Z5H A;  3VN0 A;  5KJ7 C;  1GTW A;  1J1D B;  2A45 H;  3RL0 C;  5APX A;  1GU5 A;  3A5T A;  4JYB A;  3GHG A;  4EIJ A;  1RF1 C;  2GUV A;  3RK2 C;  1T8Z A;  3VMX A;  1JOC A;  4JYC A;  1LTG C;  1URQ B;  2YNY A;  1SFC A;  2Z5I A;  3VP9 A;  4C7N A;  3B8E B;  2ZFC A;  1KIL C;  1PFI A;  1FAV A;  1W2E A;  2POH A;  5AW6 B;  3LID A;  3EFG A;  3BRV B;  2P2U A;  5AVV B;  1LTS C;  2R5B A;  3KPE A;  2A45 G;  3NTN A;  3VMY A;  1X79 B;  1GL2 D;  4ZKP A;  1DEB A;  3P8M C;  1LWU A;  1RE4 C;  1XTG B;  1HH0 A;  1XTC C;  2KB7 P;  2HFE D;  3SWF A;  1RF0 A;  3SWY A;  2HPC A;  3TSI A;  3A3Y B;  3H32 A;  2HLO A;  3R2P A;  1IFD A;  3HD7 A;  2N9B A;  5APT A;  1JY2 O;  2NPS A;  5AVW B;  1CSB A;  1FZB A;  5APW A;  2Q7C A;  3MTU E;  1T3J A;  1N86 A;  1J2J B;  4WBA A;  2I1K A;  3PP5 A;  1SFC C;  1YTZ I;  2IX7 C;  1URQ D;  5AW4 B;  3V4Q A;  2HOD A;  1LTT C;  2FYU K;  5CMZ A;  3RK2 B;  2OAR A;  2ZXE B;  1J1D C;  3V2N A;  1SQV K;  2P7J A;  4C46 A;  4O9B A;  3IFM A;  1FBM A;  5CJ4 A;  3V4W A;  5AW0 B;  3MIW A;  1NHL A;  2R32 A;  3OAK A;  2JEE A;  2GUS A;  1G2C B;  2XKM A;  1SQB K;  2QM8 A;  2A45 I;  2LKM A;  1JMM A;  1JY3 P;  1JY3 N;  2CPB A;  3HE5 B;  1A02 F;  5CCG A;  2WT7 B;  3VOP A;  2NPS D;  3VMZ A;  1RF0 C;  3V5B A;  3VTP C;  2XU6 A;  4IFM A;  4WB4 A;  1MUU A;  1AFO A;  1L4A A;  2KSJ A;  3MD0 A;  1IFJ A;  1KQL A;  1FZC A;  1SQQ K;  3M06 A;  5BU5 A;  3LIE A;  4GIF A;  1JCC A;  3HD7 C;  1SVF A;  2NPS C;  5AW8 B;  1N73 A;  1IJD B;  4Y99 B;  4DZO A;  1QL1 A;  3RK3 B;  1NKN A;  3GHG B;  1FJK A;  2JJL A;  1GW3 A;  1H8A A;  1MV8 A;  1GK4 A;  1QL2 A;  2FFD A;  1LGH B;  4AQR D;  3TK1 A;  3RK2 D;  1NAF A;  1SFC B;  4C7N B;  2XNX A;  1NTK K;  3MUD A;  4M3L A;  1L4A D;  2WPQ A;  1YYC A;  2H8P D;  3TNU A;  2QM7 A;  1GW4 A;  1N2D C;  1IFM A;  4RES B;  1JNM A;  2L5G B;  3V2R A;  4IFF A;  4ZKU A;  1RE3 A;  2PAJ A;  1LWU B;  2HG5 D;  3KDP B;  4GKG A;  1JCD A;  2M8R A;  1L4A C;  3M91 A;  3BAT A;  1HUC A;  5BVZ A;  1L0L K;  1FJP A;  2HPC B;  3CLQ A;  1WT6 A;  2H7H A;  2WTY A;  1EQ7 A;  2Z4E A;  2YMY A;  3L4F A;  3HTK A;  2YO3 A;  1N73 C;  4HYT B;  3H32 B;  2OYI B;  1FU1 A;  3RK3 D;  3HD7 B;  3HUS A;  1MFZ A;  2PP6 A;  2NPS B;  3U59 A;  4OH8 B;  3WMM 0;  2IFM A;  4W7Z A;  4XE5 B;  5AVQ B;  5AW7 B;  1IFN A;  1HJB A;  3L35 A;  4N6J A;  2HOD B;  1SFC D;  1GU4 A;  2P67 A;  4Y99 C;  2WIT A;  3H6P A;  3N4X A;  3P32 A;  3RK3 C;  2OYI A;  3GHG C;  1N7S A;  1OWA A;  3C9I A;  1HBW A;  1HTL C;  1SP4 A;  4KHX A;  1RE3 C;  1AQ5 A;  3B5N A;  1KFN A;  1DX7 A;  1YTZ T;  5CHX A;  5AVZ B;  2Q9I A;  3TYY A;  1S9K E;  1SQX K;  1L0N K;  1H88 A;  5APQ A;  5CJ0 A;  4C7R A;  1M7L A;  1WRG A;  2YKQ A;  1L4A B;  2O1K A;  3VYI A;  4N78 E;  2Q5U A;  5APS A;  1FZC B;  1GK6 A;  1LWU C;  2VRS A;  3A2A A;  4WY4 A;  1FOS F;  1KFM A;  4LGD E;  5AVY B;  1HGZ A;  2IFN A;  3HD7 D;  1FZG A;  1N73 B;  1HWT C;  4LLH A;  3P8C E;  1GD2 E;  1LT9 A;  1KZU B;  1E5W A;  2R5D A;  3B5N D;  2O1J A;  2N1T A;  5AVR B;  3CL3 D;  2FFD B;  2O01 H;  2C9N Y;  2OYI C;  2E43 A;  1JTH A;  1FOS E;  1N7S C;  2WPS A;  3G3Z A;  1RF1 A;  5CCH A;  3B5N C;  3TNU B;  5APV A;  2BAS A;  1ZR2 A;  1FDM A;  3CI9 A;  3V2Q A;  1KIL A;  1FZE A;  1FZA A;  5BU8 B;  5CCG D;  2FKW B;  1ZV8 A;  2YKO A;  3T97 A;  5AVS B;  2N1T D;  2KYV A;  1IFI A;  3NFQ A;  1NTZ K;  1X9V A;  3A7O A;  4WY4 C;  1LTA C;  1LTJ A;  4I1L A;  1ZR4 A;  3HTK B;  5CCG C;  5CCH D;  2WPR A;  1HVV A;  1JY3 O;  3VP8 A;  1LT9 C;  1A02 J;  2N1T C;  3HUS B;  1T3U A;  2WZ7 A;  2YKP A;  1FZC C;  1GL2 A;  2P1J A;  1CI6 A;  1RY3 A;  2XDJ A;  3L37 A;  1NU1 K;  1N7L A;  4N78 D;  1IO4 A;  1JY2 P;  1JY2 N;  1T2K D;  5CCH C;  2WSF H;  4IFD K;  5AW5 B;  3U1C A;  4I2L C;  2OYH A;  3OJA B;  1M1J A;  2WSC H;  2XZR A;  1N7S B;  3P8C D;  2J58 A;  2MJZ A;  4EOT A;  4LC1 A;  2GM4 A;  2FFD C;  3B5N B;  3OA7 A;  1SQP K;  5APY A;  1NOH A;  1T2K C;  1H89 A;  4HH2 A;  1IK9 A;  1J1E B;  1CZQ A;  1SLQ A;  3P7K A;  5AVT B;  4AUW A;  2C0W A;  3KQG A;  4W80 A;  2Q3I A;  1URQ A;  3M0A A;  1ZLL A;  1LTJ C;  4B86 A;  1VPC A;  1G1I A;  3HE4 B;  1JO5 A;  1G1J A;  1LTB C;  3BRT B;  3M9B A;  5AW2 B;  1Z56 A;  4WY4 B;  1NKZ B;  1GL2 C;  4N3Y B;  3U1A A;  1LT9 B;  2E42 A;  1FZF A;  1NO4 A;  5KLV K;  1GDT A;  1IC2 A;  2N1T B;  2CPS A;  1NWQ A;  3BVH A;  3HE4 A;  2FYZ A;  4I6M C;  5AW3 B;  2OYH C;  3M9Q A;  1M1J C;  1JTH B;  3RL0 B;  1HGV A;  2W27 A;  3HUS C;  2C0X A;  2KP8 A;  1RF1 B;  1MZ9 A;  1N7S D;  3N7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...