1M1JA

Crystal structure of native chicken fibrinogen with two different bound ligands
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
192
structure length
192
Chain Sequence
SCKYEKNWPICVDDDWGTKCPSGCRMQGIIDDTDQNYSQRIDNIRQQLADSQNKYKTSNRVIVETINILKPGLEGAQQLDENYGHVSTELRRRIVTLKQRVATQVNRIKALQNSIQEQVVEMKRLEVDIDIKIRACKGSCARSFDYQVDKEGYDNIQKHLTQASSIDMHPDFQTTTLSTLKMRPLKDSNVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrinogen alpha subunit
publication title Crystal Structure of Native Chicken Fibrinogen at 2.7 A Resolution
pubmed doi rcsb
total genus 58
structure length 192
sequence length 192
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08702 Fib_alpha Fibrinogen alpha/beta chain family
A PF12160 Fibrinogen_aC Fibrinogen alpha C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1m1jA00
1M1JA 1FZGA 1N86A 1LWUC 2FFDB 1LTJB 2Q9IA 1RF1A 1FZCA 1M1JC 2HPCA 1FZCC 1JY2N 3GHGA 1LT9A 1RF0A 1RF1C 2HODB 1LWUB 1FZAA 2A45G 2H43A 1N73A 1LT9C 1JY3N 1M1JB 3HUSA 2OYHA 1FZCB 3GHGC 1RF0C 3BVHA 1T3UA 2OYIA 1FZBA 2XNXA 1JY2O 3H32A 3HUSC 1RF1B 2A45I 1N73C 3E1IA 2OYHC 2HPCB 1W2EA 2Z4EA 1RE3A 3GHGB 1LT9B 2OYIC 1JY2P 1LTJA 2FFDA 2A45H 1JY3O 2HLOA 1RE4A 2FFDC 1RE3C 1N73B 3HUSB 1FZFA 2HODA 2OYHB 1LTJC 1FZEA 1LWUA 2OYIB 1JY3P 3H32B 1RE4C
chains in the Genus database with same CATH superfamily
4YXDC 3KHUA 4NPEA 1SLQA 1VQKP 5CMZA 4NPFX 1FOSE 1BE3G 3Q5PA 2HR3A 3SWKA 4IL6X 1LT9C 4K35A 1KB9I 1LTSC 1URQB 1BCCE 3HD7C 2FFDC 2ZYAA 1DD3A 2Y9YA 1JEKA 1NAYA 1LTJB 2ZT9C 3IR9A 4OWFA 4C7NA 1S2EA 1LWUB 2Y0CA 3RGUA 2C0WA 4K3AA 2H88C 3L74D 2P58A 3NXSA 1LTTC 4H13B 2ZXXA 4TT3H 1NTMJ 1ZLLA 1MV8A 3TF5A 3O8ZA 2WSCH 4IFMA 3GG2A 3CXHD 4D6TJ 3AE7C 2WPQA 3B5ND 3A5TA 1GMJA 3RK3D 3QH9A 5C39A 3L70D 5TJHA 1PIXA 3H1HJ 2WSFJ 1S5LH 1SFCA 5APXA 1OXZA 3TSIA 1PGPA 3SFDC 4EIJA 1G2CB 1U7JA 2W6BA 4O9BA 1R5SA 2G8YA 1NTZK 2KLVA 1URQD 1WT6A 4HH2A 4UB6E 1IFMA 5GTIE 2KOGA 1SQVJ 1EZVD 1AFOA 1U7MA 5KJ7A 1EXIA 2AXCA 1P84I 3O6QA 1K73Q 1FJPA 3MTUE 3N7NA 1S72P 2NPSB 2W8ZA 3M0DA 4B86A 1YYCA 4PV1B 3Q3DA 1J1EC 3BRTB 3VOPA 3L70G 2ZFCA 1JCDA 2FYUK 2J5UA 3TNUB 1EDLA 1DIPA 2HODA 2WWWA 2B87B 3L72G 3B5NC 5APTA 1SQXD 3RK3C 3G6EP 1KYOE 4U3FG 2IPPA 3AE1C 1BGYJ 1NU1E 2O01H 1NTZG 3KZIH 3TK1A 1WMKA 2YMYA 3MIWA 3H32B 3OAKA 1ZR2A 4EYYQ 2B89A 1S1CX 4QMAA 1YTZI 1URQC 3TGUE 2OYHA 2JJLA 3SWYA 1OW6A 2W6AA 2G3AA 3LW5H 3B8EB 3CWBJ 1FBMA 1CW5A 3JSVC 2XU6A 1KFNA 3F5HA 3HUSB 4H0LB 3CLQA 1LTJC 2OTJP 3AE3C 2K9JA 2R3SA 3A7OA 3AE8C 2QSIA 1DH3A 2ZYDA 3CX5H 1X9VA 2JKVA 1QL2A 5APWA 4YTPC 1L0NG 1RF1B 1NGMB 2FXOA 5CBNA 2NPSD 3H1KG 3HTKA 4KJMA 1L0LD 1MZ9A 5TISE 2IYOA 3ITKA 1FZCC 5KTBA 4LGDE 2H7HA 3HE4A 4D6TD 1ZRTE 2KXPB 2Q1KA 3A0HH 2K9YA 2KS1B 1H88A 2GUSA 1U57A 1IK7A 3H1HD 2Q3IA 3H1LG 3GW6A 2Z5IA 2Q7CA 3SSUA 3D6YA 4N78D 3E7KA 3EFFK 1ZP0C 1OWAA 2A06E 1VF5B 3AECC 2YO3A 1NTZE 4LC1A 2IFNA 1L0LG 1SQQJ 1SQVD 3AEAC 2IBZG 2GA1A 3V4WA 2YKQA 2HPCB 1Q82Q 1HWTC 1FZFA 1BE3J 2E43A 2NPSC 2BCCD 2FYZA 3WUVA 2R5BA 1IFNA 3CCSP 1SFCD 2R44A 4ZMDA 2HG5D 3P7KA 1K9MQ 3L71E 3NMDA 1GL2B 1FC2C 2E75B 3S9OA 3CX5D 2NRGA 2FYUE 1SQBG 3FWNA 3AEBC 2KLUA 2O01N 1M1JA 1ZN5A 1R5LA 1NOHA 4I6MC 1KMIZ 2KZIA 1BGYD 1N7LA 2W27A 2N1TB 3BCCE 3D6ZA 1VQ8P 2FY8A 5KKZB 3I56P 4UB6H 1WRGA 2PP6A 5GTIH 2FBWC 2E5YA 5BU8B 4N3YB 3IF4A 1LT9B 4C46A 4ZKPA 2JWDA 3G4SP 5AVWB 3HD7B 1YI2P 2FFDB 1JTHA 1L4AA 3PLNA 3T97A 3GF3A 2PFXA 3N4XA 1VQ5P 2ZT9B 1FJKA 1T3UA 1OVVA 1SFCC 4JPZB 1GTWA 3M9QA 3NTNA 3QWOC 2CPSA 1CI6A 1NAFA 2QM7A 1FOSF 3I55P 3L4FA 1KYOH 4WY4A 1ZXGA 3V2QA 4W7ZA 2OYIA 2QIWA 3JCUH 3H1JG 5KJ7C 3L36A 1JY3P 3U1CA 1ZMEC 1Y47A 2N1TD 3L70J 4IOIH 3VYIA 1YHQP 1BCCG 2ZAEB 1RF0C 3M0DC 1KB9E 5E79E 1AVYA 3L72J 1IFIA 1LP1B 4U3FJ 2W90A 4BWNA 3MUDA 4TLFA 3AEDC 4H44D 1SQQD 2WPVB 2RKLA 1KC8Q 3CD6P 3G3ZA 1N7SD 4I1LA 2L91A 5CJ0A 1BE3D 5AW8B 3D71A 4HYTB 4M3LA 5TISH 1Z56A 1NTKK 4IL6E 2LR2A 5APYA 4Z1MH 1NJIQ 3AEGC 3CL3D 4WVZA 4WBAA 1RQVA 1UIIA 3GHGB 4R4MA 2O1KA 2MKVA 3L75G 1MFZA 5AW9B 1BSNA 5AW6B 1ZW0A 1L0NJ 3B5NB 3K5BA 1T2KD 1OVRA 4JYBA 3H1KJ 2P67A 3BVHA 1J2JB 1X22A 1Q2NA 2WSCJ 3RK3B 1A02F 3M91A 1KYOD 5KKZC 1KILB 2IX7C 1YBKA 2A45H 4DOJA 1KV4A 2LKMA 2R3CA 3H1JE 3PP5A 5AVRB 2K37A 5APSA 1NHLA 5CCGA 2BEQD 4H44C 5K5GB 3PHLA 3WU2E 3KXDA 1NTKG 1N7SC 1X79B 1IFDA 3H1LJ 1JB0J 2WITA 1PPJE 1MUUA 1JO5A 3L35A 5BVZA 5APVA 2B87A 5AVYB 3V6IA 1KN7A 2Y0DA 3CI9A 1FE6A 1L0LJ 2LXCB 1IO4A 1FDMA 1NU1G 5AW3B 3LIDA 1GDTA 2QRXA 4GOEA 1FZCB 3USSA 3M0AA 1JY2O 1HTLC 1T2KC 2RN0A 4WWIA 3W67A 3VMZA 3BRVB 1CSBA 1L4AD 3TGUG 1PGOA 2OYOA 3ABVC 1KILD 2QEXP 3CX5I 3L75E 5AVUB 1FZBA 1SQBJ 4NPDA 2KI7B 3M9HA 3UIAA 5B66H 3L72D 2KNCA 1VQ6P 1E5WA 5AVZB 2O01J 4U3FD 1GW3A 2FYNC 1M1JC 1S4XA 3MGNA 1M1KQ 4WY4D 1VQPP 3CC2P 1NTZD 1AJYA 1K05A 2J59M 2M5AA 3LW5J 1IC2A 1Q7YQ 2Y0EA 4AUWA 1RE4C 2BCCJ 1S9KE 5CJ4A 1KTMA 5AVTB 1NTKE 3GHGC 2CPBA 1HUCA 2Z4EA 1EXJA 4JF7A 1Y8AA 5APUA 1EDIA 1L0ND 1L4AC 3I5CA 2A45G 1PP9E 3CPWO 1KILC 3H1KD 5E79H 1SQXK 3CCLP 4CPGA 1NYHA 2A06G 4C7NB 1PL5A 4MN4C 3GLMA 1GU5A 2HPCA 1EDKA 1JMMA 2WSSH 1KD1Q 1Y9BA 1SQPK 1OW8A 4KHXA 2IFMA 5KLVK 3A2AA 1YIJP 2W83C 4WY4C 3FGAD 5DJUB 3CCMP 2OYIC 3R4YA 3C9IA 4XE5B 1DEBA 1X8YA 2WSEH 5GTHE 4ASVA 1BCCJ 2WZ7A 1GL2A 3L71G 4Y28J 1PGQA 4IL6H 3H1LD 3P32A 3MHVA 3C1LA 1JOCA 2FYUG 3GF7A 4OGQD 1JM0A 3A3YB 4I7ZC 1ZR4A 2OARA 1SFCB 3C8VA 1FZEA 2OTKE 1HJBA 4PD4E 1NO4A 2XV5A 3RK2C 4UB8E 2IBZD 3MUDC 1G1IA 3BCCG 2YMKA 1NTMK 5CHXA 3E1IA 5KAIH 1QLED 2M0BA 4DT0A 2DW3A 2C0XA 2SPZA 3CXHE 4YPCA 1AQ5A 2K3RA 1SQPG 2Q6QA 5KLVG 1VQ7P 1H0TB 3F89A 1HF9A 1K04A 3CCEP 4ASWA 1SQBD 3L73G 3RK3E 1W2EA 4U7JA 3Q2YA 3CCVP 3WU2H 1T3JA 2JEEA 3A0BE 3RBXA 1OX3A 1KYOI 2IZ0A 2HODB 1N73A 3PTZA 1EQ7A 4OGQC 3Q5SA 1OW7A 2AXTE 1SQVK 1KQSO 3CMEP 1A02J 1AVOA 2I8DA 1EZVE 3VMAA 1LNQA 1FAVA 1S3JA 3P8CE 4LLHA 2V7QJ 1NTKJ 2C9LY 3Q5RA 1VQOP 1K8AQ 1PGJA 5KLIC 2HYNA 1LP1A 4IFFA 1BDDA 1M7LA 2K9JB 5KJ7D 4BRYA 4ZNCA 3H1IG 1JY2P 3CCQP 1NU1J 1SQXE 2POHA 2P1JA 1YJNP 1H8AA 2E42A 2KK7A 2P2UA 3HTKB 1ZOYC 2XZRA 3CCJP 3H1JD 4OVNF 1SQPE 3VN0A 5KLVE 2W6JH 3TGUJ 2UWJE 4DZOA 3PRJA 4H44B 1LJ2A 3L73E 1BCCD 2V7QH 1N7SB 4EDFA 2E74D 2WT7B 2B9BA 3RL0D 2A45I 3B5NA 5B5EE 2KUBA 1KQLA 1JY2N 2JO1A 4HB1A 1M56D 3RL0g 1NTME 4JYCA 1VDFA 2O1JA 2Y9ZA 3SFEC 1LTAC 2XNDH 4D6TE 1HBWA 5H2FE 1URQA 5EFWB 3CMAP 1S5LX 3V2PA 2J58A 1KFMA 3L75D 2ZXEB 1LTJA 1DD4A 2AEJA 5DJTB 1LWUA 1PPJG 3H1HE 3IFMA 5GTHH 1YQ4C 1T8ZA 3H1IE 3U1AA 4W7YA 2FYNB 3EQ2A 1M1JB 1NTZJ 2YXQB 2E74C 2LXBA 3RL0C 1SQQK 1CZQA 4L75A 1FZCA 1SQVE 4PD4H 2M3BA 4UB8H 3WUUA 1DEEG 1OFCX 4BXLA 1LGHB 1YTZT 2OYHC 1NTKD 1W2BO 2HFED 4RJTA 3L71J 3CXHH 2FYUJ 1G2CA 3FX0A 3CX5E 3CC4P 5AW5B 2QA4P 1SS1A 1JTHB 1L4AB 1QVGO 1YQ3C 3T97B 1USDA 4OH8B 2N9YB 4C7RA 1NU1D 2IBZI 2E76D 4GT1A 3AE4C 3M06A 1PZQA 2AEMA 3Q1MA 3BCCJ 1N2DC 2KSEA 1BGYE 1X0TA 2WMMA 1QX8A 1QEXA 1CI6B 2JR8A 1GK6A 1M8OB 1JMBA 2QJKC 4GKGA 3E1RA 2FKWB 1DX7A 4WB4A 3CCUP 3TGUD 2NPSA 1MKMA 2AXTH 4WY4B 1VQ4P 1P84E 1HJ0A 2OYIB 4AQRD 2YXRB 5CBOA 2QJYC 3CCRP 3TNUA 2YIUC 3L73J 3CWBE 3MD0A 5BU5A 1NWQA 3VMYA 2NZ2A 4I7ZB 2ITAA 1PP9G 4DJGA 4I2LC 1QVFO 3HRNA 3TYYA 4PD4D 3RK2B 2D2CB 1OIPA 3FXEA 1N73C 3H32A 3U59A 3P8MC 1IFPA 1ZRTD 1QL1A 1G1JA 2E76C 2Q9IA 3G71P 4PJ0E 2H89C 2IYPA 4W80A 3H25A 1W5CE 3HUSA 5KAFE 1LTIC 3AE2C 4AYCA 5AVQB 3AEFC 3HE5B 1LTGC 2KZJA 2PRRA 5AW4B 2MJZA 1PV3A 1RF1A 1J1DB 4GDOA 2QE7H 4A7PA 1BSHA 3H1IJ 2A06D 5AVXB 3GMAA 3V2NA 1EC5A 2XNXA 1EDJA 2BASA 3FXDA 3L74G 2Q5UA 3B4SA 5B5EH 3OA7A 4OGQB 1SQQE 2N9BA 1H89A 3AE6C 5AW1B 1VQ9P 3RBZA 2WSEJ 2KS1A 1FDIA 1FDOA 4Y99C 3EFGA 3P8CD 1BE3E 2GUVA 2KIKA 1RE3A 3PH0A 3W68A 1HVVA 1H0TA 3RK2D 2D2CD 3MZWB 3L71D 5M1BA 4HJGH 3JC22 2Q3EA 2FYUD 5H2FH 4H13D 1RF0A 1OMIA 1JNMA 1OVUA 1BDCA 5KLIB 1KB9H 2JDIH 4EOTA 2B88A 1L0NK 2C9NY 2WQYC 1JY3O 4IFDK 1KQFB 2WSFH 2ZVOB 1FZGA 3BCCD 3H1JJ 2QVAA 3JCUE 3S1KA 2CK3H 4YXWH 1Q86Q 1QGKB 4JQ0D 1EZVG 1AQTA 3H6PA 1SQPD 1RQUA 5KLVD 3VP8A 4XA4A 1VQLP 3L73D 1VPCA 3VMXA 1GW4A 4N6JA 1NKNA 3L37A 2KSJA 2WVRA 1HGZA 2KP8A 1LWUC 2R5DA 5CCHA 1HGVA 1NH4A 2KNCB 2D2CC 2N1TA 3L74E 2H43A 1SQXG 2YKOA 1VQMP 1L0LK 4H13C 5CCGD 1T6AA 4GIFA 3S4RA 1Q90D 5APQA 2K88A 1YJ9P 1GK4A 2QJPB 1NTMD 4PV1D 5L8RJ 3AE5C 1XTCC 1LT9A 2M5AB 3O6QB 1LTBC 2OTLP 1JUNA 3L75J 3SWFA 3HD7A 3AEEC 2FFDA 3NFQA 1N7SA 1KILE 1KB9D 3L70E 1P84H 2WT7A 2ZVNB 1J1DC 1SQBK 1M57D 1FU1A 4HKZH 1XTGB 3KYQA 3L72E 3H1ID 3R2PA 3D70A 2L5GB 4U3FE 1PFIA 1LT1A 2WPSA 2E74B 3V2RA 4XFJA 3RL0B 3V5BA 3BATA 1NTMG 4H0LD 1FZAA 2FXPA 1USEA 1L2PA 2ZYGA 3V4QA 4D6TG 2HLOA 5CCGC 3II6A 1KZUB 2OYHB 2K1AA 2R32A 3M9BA 3AE9C 2KYVA 2E5TA 3IAOA 2IZ1A 1GU4A 4PV1C 1R8EA 4PJ0H 4GOFA 3VP9A 3WMM0 3H1HG 4RESB 2JWAA 5KAFH 1PP9J 3B71A 2OQQA 1L0NE 3VTPC 4PD4I 2RMZA 1KQGB 3H1KE 2GM4A 1VQNP 2AEFA 2VRSA 5AVSB 1SQVG 3BASA 2RH0A 3FWLA 1RE4A 1TU3F 3CXHI 2QJKB 3HE4B 1MFTA 1NKZB 1P84D 1S5LE 3GHGA 2BCCG 2QJYB 1AA0A 2YIUB 4H0LC 1VF5D 3HUSC 2PGDA 3CWBD 5B66E 2M3EA 1PPJD 2XKMA 2WPRA 3H1LE 2P10A 4ZKUA 2H8PD 2I1KA 2JP3A 1YITP 1KILA 1RF1C 2KB7P 3WUTA 1KORA 4EI2A 3L74J 2M8RA 1L0LE 2QJPC 1BGYG 1YJWP 1N73B 4RO0A 2IBZE 1EZVI 5AVVB 2V4HA 1GL2D 2ZJSE 2QM8A 2E75D 3CC7P 4RKUJ 2QG4A 2E76B 3G9RA 1D7MA 4R4LA 3OW2O 1RE3C 1HH0A 3LIEA 5AW7B 3CWBG 5CCHD 1SP4A 1GZLA 1E79H 1SVFA 2Z5HA 1SQBE 2BEZF 1RH5B 1Q81Q 3KPEA 4N78E 3OJAB 2IDBA 3IN6A 1AV1A 3ZDMA 3KZIE 1VF5C 4L76A 1IJDB 1IFJA 1N86A 4BRYB 2P7JA 4DCKA 1RY3A 3TDKA 2FXMA 5AW0B 5AW2B 1S9KD 3PJSK 4GODA 3HD7D 1IZNB 2PAJA 1UIXA 2XDJA 3KQGA 2BCCE 4Y99B 4KT0J 2ZT9D 1ZV8A 2I1JA 1JCCA 1GD2E 2WTYA 1GL2C 1IK9A 2E75C 1JY3N 3HE5A 1OZHA 1J1EB 1PP9D 3EWKA 1M90Q 2YNYA 1SQXJ 4JBZA 3A0BH 1FS0E 5CCHC 1NU1K 2YKPA 2YO2A 2N1TC 3MP7B 1VL2A 4L73A 5KAIE 2OGUA 4L74A 1NVOA 3A0HE 1SQQG 3KDPB 1RHZB 2O3JA 1SQPJ 1N8RQ 5KLVJ
chains in the Genus database with same CATH topology
2QM7A 1FOSF 1SLQA 5CMZA 1FOSE 1RF0A 2HODB 3L4FA 1N73A 1LT9C 4WY4A 1JNMA 3V2QA 4W7ZA 2OYIA 1LTSC 1EQ7A 1URQB 4EOTA 2C9NY 1L0NK 1JY3O 5KJ7C 3HD7C 2FFDC 4IFDK 1SQVK 1A02J 3L36A 1JY3P 2WSFH 3U1CA 1FZGA 1LTJB 1FAVA 3IR9A 2N1TD 4C7NA 3P8CE 3VYIA 1LWUB 4LLHA 2C0WA 1RF0C 3M0DC 2C9LY 3NXSA 3H6PA 1LTTC 1IFIA 3VP8A 1ZLLA 1MV8A 4XA4A 3O8ZA 3MUDA 2WSCH 4IFMA 1VPCA 2HYNA 4IFFA 3VMXA 1M7LA 1GW4A 5KJ7D 2WPQA 4N6JA 1JY2P 1NKNA 1N7SD 3G3ZA 3L37A 2POHA 2KSJA 2P1JA 1HGZA 3B5ND 1H8AA 4I1LA 3A5TA 5CJ0A 5AW8B 2KP8A 4HYTB 4M3LA 3RK3D 2E42A 1LWUC 2R5DA 5CCHA 1HGVA 1NH4A 2P2UA 3HTKB 1Z56A 1NTKK 2N1TA 2XZRA 5APYA 3CL3D 2H43A 1SFCA 5APXA 4WBAA 1OXZA 2YKOA 3TSIA 1L0LK 5CCGD 3VN0A 4EIJA 1G2CB 4GIFA 3GHGB 4DZOA 5APQA 2O1KA 2W6BA 4O9BA 1GK4A 1MFZA 1NTZK 2KLVA 5AW9B 1URQD 5AW6B 1WT6A 4HH2A 1N7SB 1IFMA 1LT9A 1XTCC 2KOGA 1LTBC 3B5NB 1T2KD 1AFOA 2WT7B 4JYBA 2P67A 3BVHA 1J2JB 3RK3B 1A02F 3M91A 1JUNA 3RL0D 2A45I 5KJ7A 3SWFA 3HD7A 2FFDA 1KILB 2IX7C 2A45H 3NFQA 4DOJA 1N7SA 3B5NA 2LKMA 2R3CA 2WT7A 1FJPA 1J1DC 1SQBK 3MTUE 1FU1A 3PP5A 3N7NA 1KQLA 2NPSB 1JY2N 1XTGB 3KYQA 3M0DA 4B86A 1YYCA 1J1EC 3R2PA 3BRTB 5AVRB 3VOPA 2ZFCA 5APSA 1NHLA 1JCDA 2FYUK 5CCGA 4JYCA 3TNUB 1VDFA 2L5GB 1PFIA 2O1JA 2HODA 2WPSA 2WWWA 1N7SC 1LTAC 1X79B 3B5NC 5APTA 3V2RA 3RL0B 1HBWA 3V5BA 1IFDA 1URQA 3BATA 2WITA 3RK3C 1FZAA 1MUUA 2IPPA 1JO5A 3L35A 5BVZA 5APVA 3V2PA 2J58A 5AVYB 1KFMA 3V4QA 2ZXEB 1LTJA 2O01H 2HLOA 3CI9A 5CCGC 3II6A 1KZUB 3TK1A 2OYHB 2R32A 1LWUA 3IFMA 2YMYA 3M9BA 3MIWA 3H32B 2KYVA 1IO4A 1FDMA 1T8ZA 3OAKA 1GU4A 1ZR2A 3U1AA 5AW3B 4W7YA 3LIDA 1YTZI 3VP9A 1URQC 3WMM0 1GDTA 2OYHA 3EQ2A 1M1JB 1FZCB 2JJLA 3M0AA 3SWYA 2W6AA 1JY2O 3LW5H 4RESB 1HTLC 3B8EB 1T2KC 1FBMA 1CW5A 2XU6A 1KFNA 3HUSB 3RL0C 1SQQK 3CLQA 3VTPC 1LTJC 1CZQA 3VMZA 3BRVB 1FZCA 1CSBA 1L4AD 2M3BA 2GM4A 3A7OA 1KILD 1DH3A 5AVUB 1X9VA 2VRSA 1QL2A 5APWA 1FZBA 1RF1B 1LGHB 1YTZT 3M9HA 5AVSB 3UIAA 2OYHC 3BASA 2NPSD 3HTKA 1RE4A 2HFED 1E5WA 3HE4B 5AVZB 1NKZB 1MZ9A 1GW3A 1M1JC 1FZCC 1G2CA 3MGNA 5KTBA 3GHGA 4LGDE 4WY4D 2H7HA 5AW5B 3HE4A 1JTHB 1L4AB 3HUSC 4OH8B 2XKMA 2WPRA 4C7RA 1H88A 2J59M 4GT1A 2GUSA 1IC2A 3M06A 4AUWA 1RE4C 4ZKUA 1N2DC 1S9KE 2H8PD 2I1KA 5CJ4A 5AVTB 1KILA 1RF1C 1CI6B 2KB7P 1GK6A 2Q3IA 3GHGC 2CPBA 2Z5IA 2Q7CA 2M8RA 1HUCA 2Z4EA 4GKGA 4JF7A 2FKWB 1DX7A 4WB4A 2NPSA 4N78D 1N73B 4WY4B 5APUA 2OYIB 4AQRD 5AVVB 1OWAA 1GL2D 2QM8A 2YO3A 3TNUA 4LC1A 2IFNA 1L4AC 3I5CA 2A45G 3MD0A 5BU5A 1NWQA 1KILC 3V4WA 1SQXK 2YKQA 3VMYA 2HPCB 4C7NB 1RE3C 1HWTC 1FZFA 1HH0A 3LIEA 5AW7B 2E43A 2NPSC 5CCHD 1SP4A 2FYZA 1GU5A 4I2LC 2R5BA 1GZLA 1SVFA 2HPCA 1IFNA 2Z5HA 3HRNA 1SFCD 3TYYA 1JMMA 3RK2B 1SQPK 2HG5D 4KHXA 3KPEA 3P7KA 2IFMA 5KLVK 3A2AA 4N78E 3OJAB 1N73C 3H32A 4WY4C 3NMDA 1GL2B 2OYIC 3U59A 3P8MC 3C9IA 4XE5B 1DEBA 1IJDB 1IFJA 1X8YA 1QL1A 2WSEH 1M1JA 1N86A 2P7JA 2WZ7A 1G1JA 1ZN5A 1GL2A 1RY3A 2Q9IA 1NOHA 2FXMA 3P32A 4I6MC 5AW0B 1JOCA 4W80A 5AW2B 1S9KD 3HUSA 3HD7D 3A3YB 2PAJA 1ZR4A 2XDJA 3KQGA 2OARA 1N7LA 2W27A 2N1TB 1LTIC 4Y99B 1SFCB 4AYCA 5AVQB 1FZEA 1ZV8A 2I1JA 3HE5B 1LTGC 5AW4B 1HJBA 2MJZA 1NO4A 2XV5A 3RK2C 1RF1A 1JCCA 1J1DB 1WRGA 1GD2E 2PP6A 2WTYA 1G1IA 1GL2C 1IK9A 5BU8B 1JY3N 1NTMK 1NAFA 5AVXB 3V2NA 3HE5A 2XNXA 4N3YB 5CHXA 3E1IA 1J1EB 1LT9B 4C46A 4ZKPA 2BASA 2C0XA 2Q5UA 5AVWB 3OA7A 1AQ5A 2N9BA 2YNYA 3HD7B 2FFDB 1JTHA 1H89A 1L4AA 5AW1B 3T97A 5CCHC 1NU1K 2YKPA 2YO2A 3N4XA 2N1TC 1FJKA 1T3UA 4Y99C 1SFCC 3EFGA 1GTWA 3P8CD 3M9QA 2GUVA 1W2EA 1RE3A 3KDPB 3NTNA 2CPSA 1HVVA 3RK2D 1CI6A 1T3JA 2JEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1J A;  1FZG A;  1N86 A;  1LWU C;  2FFD B;  1LTJ B;  2Q9I A;  1RF1 A;  1FZC A;  1M1J C;  2HPC A;  1FZC C;  1JY2 N;  3GHG A;  1LT9 A;  1RF0 A;  1RF1 C;  2HOD B;  1LWU B;  1FZA A;  2A45 G;  2H43 A;  1N73 A;  1LT9 C;  1JY3 N;  1M1J B;  3HUS A;  2OYH A;  1FZC B;  3GHG C;  1RF0 C;  3BVH A;  1T3U A;  2OYI A;  1FZB A;  2XNX A;  1JY2 O;  3H32 A;  3HUS C;  1RF1 B;  2A45 I;  1N73 C;  3E1I A;  2OYH C;  2HPC B;  1W2E A;  2Z4E A;  1RE3 A;  3GHG B;  1LT9 B;  2OYI C;  1JY2 P;  1LTJ A;  2FFD A;  2A45 H;  1JY3 O;  2HLO A;  1RE4 A;  2FFD C;  1RE3 C;  1N73 B;  3HUS B;  1FZF A;  2HOD A;  2OYH B;  1LTJ C;  1FZE A;  1LWU A;  2OYI B;  1JY3 P;  3H32 B;  1RE4 C; 
#chains in the Genus database with same CATH topology
 4YXD C;  3KHU A;  4NPE A;  1SLQ A;  1VQK P;  5CMZ A;  4NPF X;  1FOS E;  1BE3 G;  3Q5P A;  2HR3 A;  3SWK A;  4IL6 X;  1LT9 C;  4K35 A;  1KB9 I;  1LTS C;  1URQ B;  1BCC E;  3HD7 C;  2FFD C;  2ZYA A;  1DD3 A;  2Y9Y A;  1JEK A;  1NAY A;  1LTJ B;  2ZT9 C;  3IR9 A;  4OWF A;  4C7N A;  1S2E A;  1LWU B;  2Y0C A;  3RGU A;  2C0W A;  4K3A A;  2H88 C;  3L74 D;  2P58 A;  3NXS A;  1LTT C;  4H13 B;  2ZXX A;  4TT3 H;  1NTM J;  1ZLL A;  1MV8 A;  3TF5 A;  3O8Z A;  2WSC H;  4IFM A;  3GG2 A;  3CXH D;  4D6T J;  3AE7 C;  2WPQ A;  3B5N D;  3A5T A;  1GMJ A;  3RK3 D;  3QH9 A;  5C39 A;  3L70 D;  5TJH A;  1PIX A;  3H1H J;  2WSF J;  1S5L H;  1SFC A;  5APX A;  1OXZ A;  3TSI A;  1PGP A;  3SFD C;  4EIJ A;  1G2C B;  1U7J A;  2W6B A;  4O9B A;  1R5S A;  2G8Y A;  1NTZ K;  2KLV A;  1URQ D;  1WT6 A;  4HH2 A;  4UB6 E;  1IFM A;  5GTI E;  2KOG A;  1SQV J;  1EZV D;  1AFO A;  1U7M A;  5KJ7 A;  1EXI A;  2AXC A;  1P84 I;  3O6Q A;  1K73 Q;  1FJP A;  3MTU E;  3N7N A;  1S72 P;  2NPS B;  2W8Z A;  3M0D A;  4B86 A;  1YYC A;  4PV1 B;  3Q3D A;  1J1E C;  3BRT B;  3VOP A;  3L70 G;  2ZFC A;  1JCD A;  2FYU K;  2J5U A;  3TNU B;  1EDL A;  1DIP A;  2HOD A;  2WWW A;  2B87 B;  3L72 G;  3B5N C;  5APT A;  1SQX D;  3RK3 C;  3G6E P;  1KYO E;  4U3F G;  2IPP A;  3AE1 C;  1BGY J;  1NU1 E;  2O01 H;  1NTZ G;  3KZI H;  3TK1 A;  1WMK A;  2YMY A;  3MIW A;  3H32 B;  3OAK A;  1ZR2 A;  4EYY Q;  2B89 A;  1S1C X;  4QMA A;  1YTZ I;  1URQ C;  3TGU E;  2OYH A;  2JJL A;  3SWY A;  1OW6 A;  2W6A A;  2G3A A;  3LW5 H;  3B8E B;  3CWB J;  1FBM A;  1CW5 A;  3JSV C;  2XU6 A;  1KFN A;  3F5H A;  3HUS B;  4H0L B;  3CLQ A;  1LTJ C;  2OTJ P;  3AE3 C;  2K9J A;  2R3S A;  3A7O A;  3AE8 C;  2QSI A;  1DH3 A;  2ZYD A;  3CX5 H;  1X9V A;  2JKV A;  1QL2 A;  5APW A;  4YTP C;  1L0N G;  1RF1 B;  1NGM B;  2FXO A;  5CBN A;  2NPS D;  3H1K G;  3HTK A;  4KJM A;  1L0L D;  1MZ9 A;  5TIS E;  2IYO A;  3ITK A;  1FZC C;  5KTB A;  4LGD E;  2H7H A;  3HE4 A;  4D6T D;  1ZRT E;  2KXP B;  2Q1K A;  3A0H H;  2K9Y A;  2KS1 B;  1H88 A;  2GUS A;  1U57 A;  1IK7 A;  3H1H D;  2Q3I A;  3H1L G;  3GW6 A;  2Z5I A;  2Q7C A;  3SSU A;  3D6Y A;  4N78 D;  3E7K A;  3EFF K;  1ZP0 C;  1OWA A;  2A06 E;  1VF5 B;  3AEC C;  2YO3 A;  1NTZ E;  4LC1 A;  2IFN A;  1L0L G;  1SQQ J;  1SQV D;  3AEA C;  2IBZ G;  2GA1 A;  3V4W A;  2YKQ A;  2HPC B;  1Q82 Q;  1HWT C;  1FZF A;  1BE3 J;  2E43 A;  2NPS C;  2BCC D;  2FYZ A;  3WUV A;  2R5B A;  1IFN A;  3CCS P;  1SFC D;  2R44 A;  4ZMD A;  2HG5 D;  3P7K A;  1K9M Q;  3L71 E;  3NMD A;  1GL2 B;  1FC2 C;  2E75 B;  3S9O A;  3CX5 D;  2NRG A;  2FYU E;  1SQB G;  3FWN A;  3AEB C;  2KLU A;  2O01 N;  1M1J A;  1ZN5 A;  1R5L A;  1NOH A;  4I6M C;  1KMI Z;  2KZI A;  1BGY D;  1N7L A;  2W27 A;  2N1T B;  3BCC E;  3D6Z A;  1VQ8 P;  2FY8 A;  5KKZ B;  3I56 P;  4UB6 H;  1WRG A;  2PP6 A;  5GTI H;  2FBW C;  2E5Y A;  5BU8 B;  4N3Y B;  3IF4 A;  1LT9 B;  4C46 A;  4ZKP A;  2JWD A;  3G4S P;  5AVW B;  3HD7 B;  1YI2 P;  2FFD B;  1JTH A;  1L4A A;  3PLN A;  3T97 A;  3GF3 A;  2PFX A;  3N4X A;  1VQ5 P;  2ZT9 B;  1FJK A;  1T3U A;  1OVV A;  1SFC C;  4JPZ B;  1GTW A;  3M9Q A;  3NTN A;  3QWO C;  2CPS A;  1CI6 A;  1NAF A;  2QM7 A;  1FOS F;  3I55 P;  3L4F A;  1KYO H;  4WY4 A;  1ZXG A;  3V2Q A;  4W7Z A;  2OYI A;  2QIW A;  3JCU H;  3H1J G;  5KJ7 C;  3L36 A;  1JY3 P;  3U1C A;  1ZME C;  1Y47 A;  2N1T D;  3L70 J;  4IOI H;  3VYI A;  1YHQ P;  1BCC G;  2ZAE B;  1RF0 C;  3M0D C;  1KB9 E;  5E79 E;  1AVY A;  3L72 J;  1IFI A;  1LP1 B;  4U3F J;  2W90 A;  4BWN A;  3MUD A;  4TLF A;  3AED C;  4H44 D;  1SQQ D;  2WPV B;  2RKL A;  1KC8 Q;  3CD6 P;  3G3Z A;  1N7S D;  4I1L A;  2L91 A;  5CJ0 A;  1BE3 D;  5AW8 B;  3D71 A;  4HYT B;  4M3L A;  5TIS H;  1Z56 A;  1NTK K;  4IL6 E;  2LR2 A;  5APY A;  4Z1M H;  1NJI Q;  3AEG C;  3CL3 D;  4WVZ A;  4WBA A;  1RQV A;  1UII A;  3GHG B;  4R4M A;  2O1K A;  2MKV A;  3L75 G;  1MFZ A;  5AW9 B;  1BSN A;  5AW6 B;  1ZW0 A;  1L0N J;  3B5N B;  3K5B A;  1T2K D;  1OVR A;  4JYB A;  3H1K J;  2P67 A;  3BVH A;  1J2J B;  1X22 A;  1Q2N A;  2WSC J;  3RK3 B;  1A02 F;  3M91 A;  1KYO D;  5KKZ C;  1KIL B;  2IX7 C;  1YBK A;  2A45 H;  4DOJ A;  1KV4 A;  2LKM A;  2R3C A;  3H1J E;  3PP5 A;  5AVR B;  2K37 A;  5APS A;  1NHL A;  5CCG A;  2BEQ D;  4H44 C;  5K5G B;  3PHL A;  3WU2 E;  3KXD A;  1NTK G;  1N7S C;  1X79 B;  1IFD A;  3H1L J;  1JB0 J;  2WIT A;  1PPJ E;  1MUU A;  1JO5 A;  3L35 A;  5BVZ A;  5APV A;  2B87 A;  5AVY B;  3V6I A;  1KN7 A;  2Y0D A;  3CI9 A;  1FE6 A;  1L0L J;  2LXC B;  1IO4 A;  1FDM A;  1NU1 G;  5AW3 B;  3LID A;  1GDT A;  2QRX A;  4GOE A;  1FZC B;  3USS A;  3M0A A;  1JY2 O;  1HTL C;  1T2K C;  2RN0 A;  4WWI A;  3W67 A;  3VMZ A;  3BRV B;  1CSB A;  1L4A D;  3TGU G;  1PGO A;  2OYO A;  3ABV C;  1KIL D;  2QEX P;  3CX5 I;  3L75 E;  5AVU B;  1FZB A;  1SQB J;  4NPD A;  2KI7 B;  3M9H A;  3UIA A;  5B66 H;  3L72 D;  2KNC A;  1VQ6 P;  1E5W A;  5AVZ B;  2O01 J;  4U3F D;  1GW3 A;  2FYN C;  1M1J C;  1S4X A;  3MGN A;  1M1K Q;  4WY4 D;  1VQP P;  3CC2 P;  1NTZ D;  1AJY A;  1K05 A;  2J59 M;  2M5A A;  3LW5 J;  1IC2 A;  1Q7Y Q;  2Y0E A;  4AUW A;  1RE4 C;  2BCC J;  1S9K E;  5CJ4 A;  1KTM A;  5AVT B;  1NTK E;  3GHG C;  2CPB A;  1HUC A;  2Z4E A;  1EXJ A;  4JF7 A;  1Y8A A;  5APU A;  1EDI A;  1L0N D;  1L4A C;  3I5C A;  2A45 G;  1PP9 E;  3CPW O;  1KIL C;  3H1K D;  5E79 H;  1SQX K;  3CCL P;  4CPG A;  1NYH A;  2A06 G;  4C7N B;  1PL5 A;  4MN4 C;  3GLM A;  1GU5 A;  2HPC A;  1EDK A;  1JMM A;  2WSS H;  1KD1 Q;  1Y9B A;  1SQP K;  1OW8 A;  4KHX A;  2IFM A;  5KLV K;  3A2A A;  1YIJ P;  2W83 C;  4WY4 C;  3FGA D;  5DJU B;  3CCM P;  2OYI C;  3R4Y A;  3C9I A;  4XE5 B;  1DEB A;  1X8Y A;  2WSE H;  5GTH E;  4ASV A;  1BCC J;  2WZ7 A;  1GL2 A;  3L71 G;  4Y28 J;  1PGQ A;  4IL6 H;  3H1L D;  3P32 A;  3MHV A;  3C1L A;  1JOC A;  2FYU G;  3GF7 A;  4OGQ D;  1JM0 A;  3A3Y B;  4I7Z C;  1ZR4 A;  2OAR A;  1SFC B;  3C8V A;  1FZE A;  2OTK E;  1HJB A;  4PD4 E;  1NO4 A;  2XV5 A;  3RK2 C;  4UB8 E;  2IBZ D;  3MUD C;  1G1I A;  3BCC G;  2YMK A;  1NTM K;  5CHX A;  3E1I A;  5KAI H;  1QLE D;  2M0B A;  4DT0 A;  2DW3 A;  2C0X A;  2SPZ A;  3CXH E;  4YPC A;  1AQ5 A;  2K3R A;  1SQP G;  2Q6Q A;  5KLV G;  1VQ7 P;  1H0T B;  3F89 A;  1HF9 A;  1K04 A;  3CCE P;  4ASW A;  1SQB D;  3L73 G;  3RK3 E;  1W2E A;  4U7J A;  3Q2Y A;  3CCV P;  3WU2 H;  1T3J A;  2JEE A;  3A0B E;  3RBX A;  1OX3 A;  1KYO I;  2IZ0 A;  2HOD B;  1N73 A;  3PTZ A;  1EQ7 A;  4OGQ C;  3Q5S A;  1OW7 A;  2AXT E;  1SQV K;  1KQS O;  3CME P;  1A02 J;  1AVO A;  2I8D A;  1EZV E;  3VMA A;  1LNQ A;  1FAV A;  1S3J A;  3P8C E;  4LLH A;  2V7Q J;  1NTK J;  2C9L Y;  3Q5R A;  1VQO P;  1K8A Q;  1PGJ A;  5KLI C;  2HYN A;  1LP1 A;  4IFF A;  1BDD A;  1M7L A;  2K9J B;  5KJ7 D;  4BRY A;  4ZNC A;  3H1I G;  1JY2 P;  3CCQ P;  1NU1 J;  1SQX E;  2POH A;  2P1J A;  1YJN P;  1H8A A;  2E42 A;  2KK7 A;  2P2U A;  3HTK B;  1ZOY C;  2XZR A;  3CCJ P;  3H1J D;  4OVN F;  1SQP E;  3VN0 A;  5KLV E;  2W6J H;  3TGU J;  2UWJ E;  4DZO A;  3PRJ A;  4H44 B;  1LJ2 A;  3L73 E;  1BCC D;  2V7Q H;  1N7S B;  4EDF A;  2E74 D;  2WT7 B;  2B9B A;  3RL0 D;  2A45 I;  3B5N A;  5B5E E;  2KUB A;  1KQL A;  1JY2 N;  2JO1 A;  4HB1 A;  1M56 D;  3RL0 g;  1NTM E;  4JYC A;  1VDF A;  2O1J A;  2Y9Z A;  3SFE C;  1LTA C;  2XND H;  4D6T E;  1HBW A;  5H2F E;  1URQ A;  5EFW B;  3CMA P;  1S5L X;  3V2P A;  2J58 A;  1KFM A;  3L75 D;  2ZXE B;  1LTJ A;  1DD4 A;  2AEJ A;  5DJT B;  1LWU A;  1PPJ G;  3H1H E;  3IFM A;  5GTH H;  1YQ4 C;  1T8Z A;  3H1I E;  3U1A A;  4W7Y A;  2FYN B;  3EQ2 A;  1M1J B;  1NTZ J;  2YXQ B;  2E74 C;  2LXB A;  3RL0 C;  1SQQ K;  1CZQ A;  4L75 A;  1FZC A;  1SQV E;  4PD4 H;  2M3B A;  4UB8 H;  3WUU A;  1DEE G;  1OFC X;  4BXL A;  1LGH B;  1YTZ T;  2OYH C;  1NTK D;  1W2B O;  2HFE D;  4RJT A;  3L71 J;  3CXH H;  2FYU J;  1G2C A;  3FX0 A;  3CX5 E;  3CC4 P;  5AW5 B;  2QA4 P;  1SS1 A;  1JTH B;  1L4A B;  1QVG O;  1YQ3 C;  3T97 B;  1USD A;  4OH8 B;  2N9Y B;  4C7R A;  1NU1 D;  2IBZ I;  2E76 D;  4GT1 A;  3AE4 C;  3M06 A;  1PZQ A;  2AEM A;  3Q1M A;  3BCC J;  1N2D C;  2KSE A;  1BGY E;  1X0T A;  2WMM A;  1QX8 A;  1QEX A;  1CI6 B;  2JR8 A;  1GK6 A;  1M8O B;  1JMB A;  2QJK C;  4GKG A;  3E1R A;  2FKW B;  1DX7 A;  4WB4 A;  3CCU P;  3TGU D;  2NPS A;  1MKM A;  2AXT H;  4WY4 B;  1VQ4 P;  1P84 E;  1HJ0 A;  2OYI B;  4AQR D;  2YXR B;  5CBO A;  2QJY C;  3CCR P;  3TNU A;  2YIU C;  3L73 J;  3CWB E;  3MD0 A;  5BU5 A;  1NWQ A;  3VMY A;  2NZ2 A;  4I7Z B;  2ITA A;  1PP9 G;  4DJG A;  4I2L C;  1QVF O;  3HRN A;  3TYY A;  4PD4 D;  3RK2 B;  2D2C B;  1OIP A;  3FXE A;  1N73 C;  3H32 A;  3U59 A;  3P8M C;  1IFP A;  1ZRT D;  1QL1 A;  1G1J A;  2E76 C;  2Q9I A;  3G71 P;  4PJ0 E;  2H89 C;  2IYP A;  4W80 A;  3H25 A;  1W5C E;  3HUS A;  5KAF E;  1LTI C;  3AE2 C;  4AYC A;  5AVQ B;  3AEF C;  3HE5 B;  1LTG C;  2KZJ A;  2PRR A;  5AW4 B;  2MJZ A;  1PV3 A;  1RF1 A;  1J1D B;  4GDO A;  2QE7 H;  4A7P A;  1BSH A;  3H1I J;  2A06 D;  5AVX B;  3GMA A;  3V2N A;  1EC5 A;  2XNX A;  1EDJ A;  2BAS A;  3FXD A;  3L74 G;  2Q5U A;  3B4S A;  5B5E H;  3OA7 A;  4OGQ B;  1SQQ E;  2N9B A;  1H89 A;  3AE6 C;  5AW1 B;  1VQ9 P;  3RBZ A;  2WSE J;  2KS1 A;  1FDI A;  1FDO A;  4Y99 C;  3EFG A;  3P8C D;  1BE3 E;  2GUV A;  2KIK A;  1RE3 A;  3PH0 A;  3W68 A;  1HVV A;  1H0T A;  3RK2 D;  2D2C D;  3MZW B;  3L71 D;  5M1B A;  4HJG H;  3JC2 2;  2Q3E A;  2FYU D;  5H2F H;  4H13 D;  1RF0 A;  1OMI A;  1JNM A;  1OVU A;  1BDC A;  5KLI B;  1KB9 H;  2JDI H;  4EOT A;  2B88 A;  1L0N K;  2C9N Y;  2WQY C;  1JY3 O;  4IFD K;  1KQF B;  2WSF H;  2ZVO B;  1FZG A;  3BCC D;  3H1J J;  2QVA A;  3JCU E;  3S1K A;  2CK3 H;  4YXW H;  1Q86 Q;  1QGK B;  4JQ0 D;  1EZV G;  1AQT A;  3H6P A;  1SQP D;  1RQU A;  5KLV D;  3VP8 A;  4XA4 A;  1VQL P;  3L73 D;  1VPC A;  3VMX A;  1GW4 A;  4N6J A;  1NKN A;  3L37 A;  2KSJ A;  2WVR A;  1HGZ A;  2KP8 A;  1LWU C;  2R5D A;  5CCH A;  1HGV A;  1NH4 A;  2KNC B;  2D2C C;  2N1T A;  3L74 E;  2H43 A;  1SQX G;  2YKO A;  1VQM P;  1L0L K;  4H13 C;  5CCG D;  1T6A A;  4GIF A;  3S4R A;  1Q90 D;  5APQ A;  2K88 A;  1YJ9 P;  1GK4 A;  2QJP B;  1NTM D;  4PV1 D;  5L8R J;  3AE5 C;  1XTC C;  1LT9 A;  2M5A B;  3O6Q B;  1LTB C;  2OTL P;  1JUN A;  3L75 J;  3SWF A;  3HD7 A;  3AEE C;  2FFD A;  3NFQ A;  1N7S A;  1KIL E;  1KB9 D;  3L70 E;  1P84 H;  2WT7 A;  2ZVN B;  1J1D C;  1SQB K;  1M57 D;  1FU1 A;  4HKZ H;  1XTG B;  3KYQ A;  3L72 E;  3H1I D;  3R2P A;  3D70 A;  2L5G B;  4U3F E;  1PFI A;  1LT1 A;  2WPS A;  2E74 B;  3V2R A;  4XFJ A;  3RL0 B;  3V5B A;  3BAT A;  1NTM G;  4H0L D;  1FZA A;  2FXP A;  1USE A;  1L2P A;  2ZYG A;  3V4Q A;  4D6T G;  2HLO A;  5CCG C;  3II6 A;  1KZU B;  2OYH B;  2K1A A;  2R32 A;  3M9B A;  3AE9 C;  2KYV A;  2E5T A;  3IAO A;  2IZ1 A;  1GU4 A;  4PV1 C;  1R8E A;  4PJ0 H;  4GOF A;  3VP9 A;  3WMM 0;  3H1H G;  4RES B;  2JWA A;  5KAF H;  1PP9 J;  3B71 A;  2OQQ A;  1L0N E;  3VTP C;  4PD4 I;  2RMZ A;  1KQG B;  3H1K E;  2GM4 A;  1VQN P;  2AEF A;  2VRS A;  5AVS B;  1SQV G;  3BAS A;  2RH0 A;  3FWL A;  1RE4 A;  1TU3 F;  3CXH I;  2QJK B;  3HE4 B;  1MFT A;  1NKZ B;  1P84 D;  1S5L E;  3GHG A;  2BCC G;  2QJY B;  1AA0 A;  2YIU B;  4H0L C;  1VF5 D;  3HUS C;  2PGD A;  3CWB D;  5B66 E;  2M3E A;  1PPJ D;  2XKM A;  2WPR A;  3H1L E;  2P10 A;  4ZKU A;  2H8P D;  2I1K A;  2JP3 A;  1YIT P;  1KIL A;  1RF1 C;  2KB7 P;  3WUT A;  1KOR A;  4EI2 A;  3L74 J;  2M8R A;  1L0L E;  2QJP C;  1BGY G;  1YJW P;  1N73 B;  4RO0 A;  2IBZ E;  1EZV I;  5AVV B;  2V4H A;  1GL2 D;  2ZJS E;  2QM8 A;  2E75 D;  3CC7 P;  4RKU J;  2QG4 A;  2E76 B;  3G9R A;  1D7M A;  4R4L A;  3OW2 O;  1RE3 C;  1HH0 A;  3LIE A;  5AW7 B;  3CWB G;  5CCH D;  1SP4 A;  1GZL A;  1E79 H;  1SVF A;  2Z5H A;  1SQB E;  2BEZ F;  1RH5 B;  1Q81 Q;  3KPE A;  4N78 E;  3OJA B;  2IDB A;  3IN6 A;  1AV1 A;  3ZDM A;  3KZI E;  1VF5 C;  4L76 A;  1IJD B;  1IFJ A;  1N86 A;  4BRY B;  2P7J A;  4DCK A;  1RY3 A;  3TDK A;  2FXM A;  5AW0 B;  5AW2 B;  1S9K D;  3PJS K;  4GOD A;  3HD7 D;  1IZN B;  2PAJ A;  1UIX A;  2XDJ A;  3KQG A;  2BCC E;  4Y99 B;  4KT0 J;  2ZT9 D;  1ZV8 A;  2I1J A;  1JCC A;  1GD2 E;  2WTY A;  1GL2 C;  1IK9 A;  2E75 C;  1JY3 N;  3HE5 A;  1OZH A;  1J1E B;  1PP9 D;  3EWK A;  1M90 Q;  2YNY A;  1SQX J;  4JBZ A;  3A0B H;  1FS0 E;  5CCH C;  1NU1 K;  2YKP A;  2YO2 A;  2N1T C;  3MP7 B;  1VL2 A;  4L73 A;  5KAI E;  2OGU A;  4L74 A;  1NVO A;  3A0H E;  1SQQ G;  3KDP B;  1RHZ B;  2O3J A;  1SQP J;  1N8R Q;  5KLV J; 
#chains in the Genus database with same CATH homology
 2QM7 A;  1FOS F;  1SLQ A;  5CMZ A;  1FOS E;  1RF0 A;  2HOD B;  3L4F A;  1N73 A;  1LT9 C;  4WY4 A;  1JNM A;  3V2Q A;  4W7Z A;  2OYI A;  1LTS C;  1EQ7 A;  1URQ B;  4EOT A;  2C9N Y;  1L0N K;  1JY3 O;  5KJ7 C;  3HD7 C;  2FFD C;  4IFD K;  1SQV K;  1A02 J;  3L36 A;  1JY3 P;  2WSF H;  3U1C A;  1FZG A;  1LTJ B;  1FAV A;  3IR9 A;  2N1T D;  4C7N A;  3P8C E;  3VYI A;  1LWU B;  4LLH A;  2C0W A;  1RF0 C;  3M0D C;  2C9L Y;  3NXS A;  3H6P A;  1LTT C;  1IFI A;  3VP8 A;  1ZLL A;  1MV8 A;  4XA4 A;  3O8Z A;  3MUD A;  2WSC H;  4IFM A;  1VPC A;  2HYN A;  4IFF A;  3VMX A;  1M7L A;  1GW4 A;  5KJ7 D;  2WPQ A;  4N6J A;  1JY2 P;  1NKN A;  1N7S D;  3G3Z A;  3L37 A;  2POH A;  2KSJ A;  2P1J A;  1HGZ A;  3B5N D;  1H8A A;  4I1L A;  3A5T A;  5CJ0 A;  5AW8 B;  2KP8 A;  4HYT B;  4M3L A;  3RK3 D;  2E42 A;  1LWU C;  2R5D A;  5CCH A;  1HGV A;  1NH4 A;  2P2U A;  3HTK B;  1Z56 A;  1NTK K;  2N1T A;  2XZR A;  5APY A;  3CL3 D;  2H43 A;  1SFC A;  5APX A;  4WBA A;  1OXZ A;  2YKO A;  3TSI A;  1L0L K;  5CCG D;  3VN0 A;  4EIJ A;  1G2C B;  4GIF A;  3GHG B;  4DZO A;  5APQ A;  2O1K A;  2W6B A;  4O9B A;  1GK4 A;  1MFZ A;  1NTZ K;  2KLV A;  5AW9 B;  1URQ D;  5AW6 B;  1WT6 A;  4HH2 A;  1N7S B;  1IFM A;  1LT9 A;  1XTC C;  2KOG A;  1LTB C;  3B5N B;  1T2K D;  1AFO A;  2WT7 B;  4JYB A;  2P67 A;  3BVH A;  1J2J B;  3RK3 B;  1A02 F;  3M91 A;  1JUN A;  3RL0 D;  2A45 I;  5KJ7 A;  3SWF A;  3HD7 A;  2FFD A;  1KIL B;  2IX7 C;  2A45 H;  3NFQ A;  4DOJ A;  1N7S A;  3B5N A;  2LKM A;  2R3C A;  2WT7 A;  1FJP A;  1J1D C;  1SQB K;  3MTU E;  1FU1 A;  3PP5 A;  3N7N A;  1KQL A;  2NPS B;  1JY2 N;  1XTG B;  3KYQ A;  3M0D A;  4B86 A;  1YYC A;  1J1E C;  3R2P A;  3BRT B;  5AVR B;  3VOP A;  2ZFC A;  5APS A;  1NHL A;  1JCD A;  2FYU K;  5CCG A;  4JYC A;  3TNU B;  1VDF A;  2L5G B;  1PFI A;  2O1J A;  2HOD A;  2WPS A;  2WWW A;  1N7S C;  1LTA C;  1X79 B;  3B5N C;  5APT A;  3V2R A;  3RL0 B;  1HBW A;  3V5B A;  1IFD A;  1URQ A;  3BAT A;  2WIT A;  3RK3 C;  1FZA A;  1MUU A;  2IPP A;  1JO5 A;  3L35 A;  5BVZ A;  5APV A;  3V2P A;  2J58 A;  5AVY B;  1KFM A;  3V4Q A;  2ZXE B;  1LTJ A;  2O01 H;  2HLO A;  3CI9 A;  5CCG C;  3II6 A;  1KZU B;  3TK1 A;  2OYH B;  2R32 A;  1LWU A;  3IFM A;  2YMY A;  3M9B A;  3MIW A;  3H32 B;  2KYV A;  1IO4 A;  1FDM A;  1T8Z A;  3OAK A;  1GU4 A;  1ZR2 A;  3U1A A;  5AW3 B;  4W7Y A;  3LID A;  1YTZ I;  3VP9 A;  1URQ C;  3WMM 0;  1GDT A;  2OYH A;  3EQ2 A;  1M1J B;  1FZC B;  2JJL A;  3M0A A;  3SWY A;  2W6A A;  1JY2 O;  3LW5 H;  4RES B;  1HTL C;  3B8E B;  1T2K C;  1FBM A;  1CW5 A;  2XU6 A;  1KFN A;  3HUS B;  3RL0 C;  1SQQ K;  3CLQ A;  3VTP C;  1LTJ C;  1CZQ A;  3VMZ A;  3BRV B;  1FZC A;  1CSB A;  1L4A D;  2M3B A;  2GM4 A;  3A7O A;  1KIL D;  1DH3 A;  5AVU B;  1X9V A;  2VRS A;  1QL2 A;  5APW A;  1FZB A;  1RF1 B;  1LGH B;  1YTZ T;  3M9H A;  5AVS B;  3UIA A;  2OYH C;  3BAS A;  2NPS D;  3HTK A;  1RE4 A;  2HFE D;  1E5W A;  3HE4 B;  5AVZ B;  1NKZ B;  1MZ9 A;  1GW3 A;  1M1J C;  1FZC C;  1G2C A;  3MGN A;  5KTB A;  3GHG A;  4LGD E;  4WY4 D;  2H7H A;  5AW5 B;  3HE4 A;  1JTH B;  1L4A B;  3HUS C;  4OH8 B;  2XKM A;  2WPR A;  4C7R A;  1H88 A;  2J59 M;  4GT1 A;  2GUS A;  1IC2 A;  3M06 A;  4AUW A;  1RE4 C;  4ZKU A;  1N2D C;  1S9K E;  2H8P D;  2I1K A;  5CJ4 A;  5AVT B;  1KIL A;  1RF1 C;  1CI6 B;  2KB7 P;  1GK6 A;  2Q3I A;  3GHG C;  2CPB A;  2Z5I A;  2Q7C A;  2M8R A;  1HUC A;  2Z4E A;  4GKG A;  4JF7 A;  2FKW B;  1DX7 A;  4WB4 A;  2NPS A;  4N78 D;  1N73 B;  4WY4 B;  5APU A;  2OYI B;  4AQR D;  5AVV B;  1OWA A;  1GL2 D;  2QM8 A;  2YO3 A;  3TNU A;  4LC1 A;  2IFN A;  1L4A C;  3I5C A;  2A45 G;  3MD0 A;  5BU5 A;  1NWQ A;  1KIL C;  3V4W A;  1SQX K;  2YKQ A;  3VMY A;  2HPC B;  4C7N B;  1RE3 C;  1HWT C;  1FZF A;  1HH0 A;  3LIE A;  5AW7 B;  2E43 A;  2NPS C;  5CCH D;  1SP4 A;  2FYZ A;  1GU5 A;  4I2L C;  2R5B A;  1GZL A;  1SVF A;  2HPC A;  1IFN A;  2Z5H A;  3HRN A;  1SFC D;  3TYY A;  1JMM A;  3RK2 B;  1SQP K;  2HG5 D;  4KHX A;  3KPE A;  3P7K A;  2IFM A;  5KLV K;  3A2A A;  4N78 E;  3OJA B;  1N73 C;  3H32 A;  4WY4 C;  3NMD A;  1GL2 B;  2OYI C;  3U59 A;  3P8M C;  3C9I A;  4XE5 B;  1DEB A;  1IJD B;  1IFJ A;  1X8Y A;  1QL1 A;  2WSE H;  1M1J A;  1N86 A;  2P7J A;  2WZ7 A;  1G1J A;  1ZN5 A;  1GL2 A;  1RY3 A;  2Q9I A;  1NOH A;  2FXM A;  3P32 A;  4I6M C;  5AW0 B;  1JOC A;  4W80 A;  5AW2 B;  1S9K D;  3HUS A;  3HD7 D;  3A3Y B;  2PAJ A;  1ZR4 A;  2XDJ A;  3KQG A;  2OAR A;  1N7L A;  2W27 A;  2N1T B;  1LTI C;  4Y99 B;  1SFC B;  4AYC A;  5AVQ B;  1FZE A;  1ZV8 A;  2I1J A;  3HE5 B;  1LTG C;  5AW4 B;  1HJB A;  2MJZ A;  1NO4 A;  2XV5 A;  3RK2 C;  1RF1 A;  1JCC A;  1J1D B;  1WRG A;  1GD2 E;  2PP6 A;  2WTY A;  1G1I A;  1GL2 C;  1IK9 A;  5BU8 B;  1JY3 N;  1NTM K;  1NAF A;  5AVX B;  3V2N A;  3HE5 A;  2XNX A;  4N3Y B;  5CHX A;  3E1I A;  1J1E B;  1LT9 B;  4C46 A;  4ZKP A;  2BAS A;  2C0X A;  2Q5U A;  5AVW B;  3OA7 A;  1AQ5 A;  2N9B A;  2YNY A;  3HD7 B;  2FFD B;  1JTH A;  1H89 A;  1L4A A;  5AW1 B;  3T97 A;  5CCH C;  1NU1 K;  2YKP A;  2YO2 A;  3N4X A;  2N1T C;  1FJK A;  1T3U A;  4Y99 C;  1SFC C;  3EFG A;  1GTW A;  3P8C D;  3M9Q A;  2GUV A;  1W2E A;  1RE3 A;  3KDP B;  3NTN A;  2CPS A;  1HVV A;  3RK2 D;  1CI6 A;  1T3J A;  2JEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...