5CCGA

Structure of the ca2+-bound synaptotagmin-1 snare complex (long unit cell form)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
63
structure length
63
Chain Sequence
GSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis,exocytosis
molecule keywords Vesicle-associated membrane protein 2
publication title Architecture of the synaptotagmin-SNARE machinery for neuronal exocytosis.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 28
structure length 63
sequence length 63
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5ccgA00
3P8CE 5CCHC 1NHLA 1T3JA 3VOPA 4WY4A 1JTHB 4WY4D 2WZ7A 1KILC 3RK2D 1KILB 5CCGC 2N1TA 4WY4C 3RL0C 3RL0B 3RK2C 2N1TD 3PP5A 4N78E 1L4AA 4W7ZA 1N7SA 1L4AD 3HD7A 2KOGA 1N7SD 3HD7D 2M8RA 1L4AC 3HTKB 3HD7C 3M0DC 3B5NA 3B5ND 2XDJA 3RK3D 1XTGB 3KYQA 4WY4B 1URQA 3RK2B 1URQD 2N1TC 2N1TB 1SFCA 1SFCD 1L4AB 1N7SC 2YMYA 3HD7B 1URQB 1GL2A 1GL2D 4W80A 2HG5D 1GL2C 2NPSA 3B5NC 2NPSD 3B5NB 3RK3C 3RK3B 2H8PD 4LGDE 4W7YA 3TSIA 1URQC 1JTHA 1KILA 4JF7A 5CCGA 1SFCC 1N7SB 1KILD 1SFCB 5CCGD 3RL0D 1HVVA 4OH8B 1GL2B 2HFED 5KJ7A 5KJ7D 5CCHA 5KJ7C 5CCHD 2NPSC 2NPSB 2PP6A
chains in the Genus database with same CATH superfamily
2KNCB 3IFMA 4HJGH 1Y47A 2WZ7A 1JY2O 2DW3A 2NRGA 4PD4D 1BE3J 2YO2A 4Y28J 1KV4A 4YXDC 1AA0A 1LWUB 3H32A 3L71G 2WVRA 4XA4A 3CCEP 4JBZA 2GUSA 2AXTE 4EDFA 4BWNA 1FZAA 3N4XA 3H1KJ 1QVGO 1X0TA 3A0BH 3FWLA 2IZ1A 4CPGA 1PPJG 1LTTC 2M0BA 1U7JA 1J1EB 1GW3A 4W7YA 5M1BA 1URQC 2R5BA 3P8CD 4D6TJ 3V4WA 3V5BA 1SFCC 1JO5A 1LT1A 1BCCJ 3L74D 2KK7A 3AE5C 1P84H 1VF5D 2SPZA 2BCCE 5B66E 2D2CD 1QL2A 1P84I 4GT1A 1NYHA 2Z5IA 2YKQA 4IFFA 1NU1K 4IOIH 3AECC 1BDDA 5E79H 1MV8A 2BASA 2B88A 2BCCJ 3AE7C 2C9LY 2E42A 3EWKA 1FZGA 4UB8H 3HUSA 2FFDA 1NTKJ 2YO3A 1SQQD 3RK3D 3T97A 1SQVE 3CCSP 1KB9E 3AE1C 2L5GB 2YMKA 1EZVD 3BATA 1VQKP 3II6A 3H1HJ 1LTBC 1T3UA 2I1JA 2M3BA 4EI2A 1KQFB 3USSA 1CI6A 4O9BA 2FYZA 2KLVA 2W27A 1SQVJ 1OVUA 1X8YA 1GL2C 1L0LE 3H1JJ 1ZR4A 1X22A 3CWBD 3S4RA 3MZWB 2WSEH 2KNCA 2K9JB 5B5EE 3L75J 3JSVC 3IN6A 1S9KE 1NH4A 2IYOA 1K73Q 1KILD 1FZFA 3RL0D 3P32A 1HVVA 1LTGC 2E75C 4OH8B 5GTHE 4DCKA 3KZIE 4EYYQ 1EDLA 3CCRP 1LWUA 5GTIE 1UIIA 1S4XA 1VQ9P 2Y0DA 2QJYC 3L72D 3M0DA 3L70D 1AQ5A 1YBKA 3CCLP 1JCCA 4H0LD 4KHXA 2Q3EA 3Q1MA 1AVYA 3AEEC 4DJGA 1RF1B 4RJTA 1WRGA 1VQ7P 4IL6X 1VF5B 3HTKB 3MD0A 3HD7C 1M56D 2D2CB 4I6MC 1YJ9P 3TGUE 1XTGB 3BASA 2ZYAA 5H2FH 2KSEA 3TDKA 2LR2A 1NU1G 2IDBA 1W5CE 3L73J 3PLNA 3CC4P 3M06A 5KLVJ 3TGUJ 1GL2D 3G9RA 3GMAA 1IFIA 3CWBG 3HUSC 1FC2C 1NTZD 5B66H 3RK3B 3V4QA 1S3JA 3RL0g 3EQ2A 1H88A 2P67A 1GDTA 1KN7A 3S1KA 3H1IE 3R4YA 2JWAA 1ZP0C 1GK6A 2E76C 1YYCA 1PP9G 2ZXEB 4IFDK 1SQPD 2ZYGA 4C7RA 2P1JA 3CD6P 5KJ7A 1DH3A 4ASWA 5CJ0A 3L72G 2WSSH 1SQXE 3L70G 1URQB 1P84D 2PP6A 2E5TA 1VQ4P 1OW8A 3G71P 1NU1E 3RGUA 2WMMA 2FYUJ 4R4LA 5DJUB 1BSNA 1KB9H 2Y0CA 1KILB 4EIJA 1UIXA 3RL0B 1KB9I 3RK2C 1U7MA 1ZRTE 1PGPA 1SQXJ 5EFWB 3HD7D 2H88C 1KD1Q 2ZAEB 3ITKA 2XNDH 3M0DC 1LP1B 5AVXB 1BGYG 3B5ND 1PP9E 2K9JA 4H0LB 1WMKA 3GW6A 4U3FE 5B5EH 4IL6E 2HLOA 3CX5D 3G3ZA 3U59A 1VDFA 5AW5B 1MZ9A 2JP3A 1X79B 5GTHH 2Z4EA 3KZIH 1A02F 3E1IA 2POHA 4U3FJ 4HYTB 1ZMEC 5GTIH 2R5DA 1J1EC 3E7KA 1G1JA 3B71A 2E43A 2E76D 3N7NA 5APWA 3VMYA 1WT6A 1RF1A 4PJ0E 3H32B 1XTCC 5KLIC 1GL2B 1QL1A 3V2NA 2K88A 2O01J 3HTKA 1S5LE 1KQSO 2QVAA 2JJLA 1HJ0A 1YQ3C 4WBAA 3GLMA 5CCHC 3A3YB 2XV5A 3AEFC 3RK2D 5BU8B 3V6IA 1BDCA 1VL2A 1D7MA 2IBZE 4W7ZA 1SQBE 2KOGA 1DEEG 1L4AC 2WSFJ 1L0NJ 1JY3N 2Y9YA 3FGAD 5TISE 3PJSK 3VP8A 3AE6C 1QEXA 2UWJE 2WPQA 1SQBJ 2HYNA 2B87B 1NTKK 3OJAB 1OMIA 2WT7B 2O01N 3Q5RA 3IR9A 3HD7B 2QJPB 1FZBA 5APSA 2WTYA 2QM8A 1VQ8P 3B5NB 2J59M 1RHZB 3UIAA 1JUNA 5E79E 3L4FA 1SQVK 3NXSA 4UB6E 2A45H 2LKMA 1KILA 3O8ZA 4GDOA 3AEAC 1A02J 2A45I 3LIEA 1VQOP 2RH0A 1J2JB 1H0TB 2RKLA 3MP7B 4UB8E 5AW7B 2RN0A 1FOSE 1DIPA 3V2PA 4C7NA 5CCHD 5AW6B 3T97B 5KAFE 3H1KG 3OA7A 1LP1A 4AYCA 2JR8A 2KLUA 5L8RJ 3V2RA 2E76B 2Y9ZA 3U1AA 2H43A 4IL6H 3MIWA 4QMAA 2B89A 1LTIC 3M9BA 1KB9D 3C8VA 3G4SP 2J58A 1L4AD 1YITP 1YJWP 1PGOA 1HJBA 1JCDA 1BE3E 3H6PA 3M91A 1VF5C 5APUA 1G2CB 1QLED 4D6TG 1QGKB 2D2CC 3M9QA 1HBWA 1BCCG 1L0LD 3AE3C 3SWFA 2ITAA 2Q5UA 1LT9C 1M57D 3RK2B 2ZVOB 3CMEP 3QH9A 1S9KD 3PTZA 2AEJA 1JY3P 3H1KE 1GL2A 4PJ0H 4H13D 5AW3B 1FDIA 2R32A 1S5LH 2Q9IA 3RK3C 2BCCG 1OXZA 5KLVK 2OYOA 1FDMA 2WSFH 2IX7C 4JF7A 2BEZF 4D6TE 1NTKG 1GU4A 2KS1B 3SWYA 3VMZA 1MFTA 2FXPA 1OVRA 3VMXA 1VPCA 2XZRA 5APQA 3D71A 4RKUJ 1BCCE 2IBZI 1NTMK 3CC7P 3CCMP 4OWFA 5H2FE 3H1HG 2ZFCA 2OTKE 1VQLP 1YIJP 5TISH 2QE7H 3BCCJ 1DD4A 3SSUA 4I7ZC 1SQVG 1KILC 2B87A 3TGUD 5AVQB 3RL0C 2YIUB 2N1TD 5AW4B 5KLIB 2WT7A 3H1JG 1OX3A 1FZEA 1MUUA 2I8DA 2FYUK 2PRRA 1M7LA 3HD7A 1LJ2A 1N7SD 3L75G 1FS0E 1M1JA 3A2AA 1SVFA 3I55P 1L0LG 1SQXK 3B5NA 3AE9C 3A0HE 4H0LC 1NTKE 5CBOA 3NFQA 4UB6H 2C9NY 3H1ID 1H0TA 2YXRB 2FXMA 1L4AB 3IF4A 3F89A 3H1HE 5AW2B 5BVZA 1OWAA 2RMZA 2K1AA 4ZNCA 1VQMP 4JQ0D 3HE4B 1ZR2A 5KAFH 3H1JE 1SQXD 1NKNA 2XKMA 1KFMA 1NU1D 4I1LA 3L75E 1PZQA 4GKGA 1ZXGA 2OARA 4Y99B 2CK3H 4N3YB 1FU1A 2QG4A 1FJKA 1IK7A 1ZRTD 5DJTB 1CW5A 1G2CA 2KB7P 3SFDC 4PV1D 2PFXA 3L73G 1NHLA 5AW0B 4TT3H 3TGUG 1R5LA 1PP9D 2PAJA 3S9OA 1YTZT 2O1KA 3VYIA 4OGQC 3A5TA 1HF9A 5AVTB 3VN0A 2A06G 3KXDA 1NAYA 2XDJA 3SWKA 1Q82Q 2KUBA 2O1JA 2IFMA 3CL3D 1L0NK 4GODA 2AEMA 3H1IG 2N1TB 3Q2YA 4H44D 2C0XA 5AVUB 2WSCJ 2KS1A 1SQBK 2KZIA 2QJPC 2FYUG 3L73E 3SFEC 1ZOYC 4W80A 1M1JC 5KLVE 1R5SA 1KQLA 1BGYD 3B5NC 1LT9B 1HH0A 1SQXG 2IZ0A 3TSIA 2A45G 3JCUE 3M9HA 1SS1A 1NTME 2A06E 4RO0A 2Z5HA 4ZMDA 1S1CX 3WMM0 1PGQA 2IBZD 4JPZB 3TF5A 5CCHA 1FZCB 3OAKA 3VMAA 2LXCB 3PHLA 1N86A 5APXA 1NTMJ 3L74J 3A0HH 1HGVA 3MGNA 1CZQA 1JTHB 2V7QJ 4NPDA 4U3FG 1KYOE 1Q7YQ 2FYUE 4A7PA 1T8ZA 4N78E 1N73B 1L4AA 1OZHA 2ZT9D 4BXLA 4OGQD 1N7LA 3CCVP 2E74D 3L37A 1GZLA 3M0AA 1VQPP 4PV1B 3HE4A 1EDKA 2OTJP 4DOJA 3VP9A 4I7ZB 3NTNA 2W6JH 1NKZB 1BSHA 4LLHA 1Z56A 1HTLC 3QWOC 2P10A 5AVRB 2GM4A 1SP4A 2OYHB 1SQQJ 2MKVA 4C7NB 1EQ7A 1FAVA 1KZUB 3BVHA 4L76A 3LW5J 2FYNB 4AQRD 2WPSA 2OTLP 1OVVA 1JNMA 3AE2C 3W67A 1S2EA 1ZLLA 4H44B 4HKZH 2OQQA 2JO1A 3BRTB 4YXWH 2G8YA 3CWBJ 2IBZG 1SQBG 1HGZA 2E5YA 2CPSA 2JKVA 4NPEA 4XE5B 1BE3D 1IFPA 3FWNA 3H1LE 1N8RQ 1ZV8A 2G3AA 3FXDA 1IFDA 3R2PA 1T3JA 3VOPA 2KZJA 1NO4A 2H89C 2N1TA 1JEKA 1YJNP 2YIUC 5KTBA 3L72J 1AJYA 3H1LJ 1N7SA 3L70J 1KFNA 2IFNA 2KSJA 3H1KD 1L0NE 1LT9A 5AVVB 2NZ2A 2KP8A 1M90Q 1KTMA 4WB4A 1PV3A 2OYIB 2WWWA 3JCUH 4JYBA 4K35A 2P2UA 3P8MC 1H89A 2ZT9B 3WU2E 2IYPA 4OGQB 1EXJA 2IPPA 4D6TD 1W2BO 2GA1A 2K3RA 3CI9A 3TNUB 1FZCA 2WQYC 3A7OA 3E1RA 1K04A 1BCCD 3CXHE 2NPSD 1NOHA 4DT0A 2H7HA 1JTHA 2YKOA 1G1IA 4XFJA 5APYA 1KYOH 1RQVA 2FXOA 1NTZJ 1N73A 5AVZB 1KYOI 4Y99C 4H13C 1M1JB 2HFED 4YPCA 1TU3F 1BE3G 3MUDC 1YI2P 5AVYB 2BCCD 2W90A 1SQPJ 1RE3A 3Q5SA 3TK1A 1VQ6P 3F5HA 4WVZA 1GD2E 3PH0A 1IC2A 4WY4C 1NTKD 3LW5H 2P7JA 1IO4A 2OYHA 3I56P 2FBWC 2M8RA 1JY3O 1NJIQ 2N9BA 4HH2A 3H1HD 4ZKUA 1K8AQ 3TYYA 3KPEA 3CCUP 4M3LA 1NGMB 1SQVD 2FY8A 1OW6A 3CX5E 2N1TC 2XU6A 3H1JD 4ZKPA 1LGHB 4BRYA 3D6ZA 1IFMA 1N7SC 3L75D 1H8AA 3EFGA 4JYCA 2K9YA 3WUTA 3GF3A 1Q81Q 1T2KC 1OW7A 5BU5A 2JWDA 2O01H 3G6EP 2OGUA 4U7JA 4I2LC 5CCGD 3CLQA 3HE5A 3P7KA 2W8ZA 3C9IA 2L91A 3L36A 2WSEJ 3IAOA 1JB0J 4AUWA 1S72P 1FZCC 5CHXA 1IFNA 2B9BA 1EDIA 2NPSB 1NVOA 2QIWA 4WY4D 3BCCE 2OYIA 1N73C 1IFJA 3WU2H 5APTA 1PIXA 3JC22 3KHUA 2R3CA 1LTJB 5CBNA 4PV1C 3TNUA 1GU5A 3L73D 3CCJP 1LTAC 3CXHH 1LTSC 1RE3C 2W6BA 5KLVD 3WUUA 1JY2P 3CXHI 1EXIA 3I5CA 1MFZA 2OYHC 3BRVB 1USDA 1RY3A 2KXPB 1T2KD 3L71E 1NTMD 2A06D 1J1DB 1SQQK 2FYNC 3ABVC 1RE4A 2YXQB 3CCQP 1DX7A 3LIDA 4H44C 3L71J 4OVNF 1IJDB 1PPJE 2LXBA 2O3JA 1KYOD 5KKZC 2FYUD 1DEBA 1Q2NA 2Y0EA 4N78D 3CC2P 3KDPB 3HRNA 5AW8B 3PRJA 2AEFA 1YQ4C 4ASVA 1MKMA 1CSBA 3CX5H 4H13B 4HB1A 3GHGB 2N9YB 1AV1A 3CX5I 5K5GB 2CPBA 2WPRA 1RQUA 4EOTA 5CJ4A 3OW2O 3MTUE 1KQGB 5KLVG 2HODB 1PGJA 1AFOA 4PD4E 4WY4B 1ZW0A 4U3FD 3AEDC 1URQD 3MHVA 2JDIH 2OYIC 1NWQA 1SFCD 2ZT9C 5APVA 2FKWB 5CMZA 2E74C 4C46A 1Y9BA 3CPWO 1L0LJ 1NTMG 3L74G 4IFMA 1PFIA 2NPSA 3FX0A 1NAFA 4LGDE 3H25A 4L73A 1OFCX 1K05A 3H1LD 4LC1A 2QRXA 1KORA 2Q6QA 1N7SB 1VQNP 2AXTH 1EC5A 1AQTA 5C39A 3D70A 2KYVA 1LTJA 1W2EA 2M3EA 1NTZK 2QJKB 3C1LA 3RBXA 3P8CE 1SQQG 1RE4C 1YTZI 1L0ND 2KIKA 4YTPC 3L74E 1EZVG 3KQGA 3PP5A 5KAIE 1SQPK 1LNQA 1SQBD 1GTWA 3AE8C 2WPVB 4L74A 3EFFK 1U57A 2YKPA 2FFDC 1EDJA 2VRSA 3O6QB 3KYQA 1IK9A 2Q7CA 3CXHD 1K9MQ 4K3AA 4NPFX 2Q3IA 2MJZA 2ZYDA 2M5AB 1KC8Q 1S5LX 3GF7A 2E75D 1GW4A 1HUCA 1OIPA 1SQQE 3L35A 4KT0J 3RK3E 3U1CA 3H1IJ 1EZVE 2K37A 3H1LG 2QEXP 5AW1B 4N6JA 3B4SA 5CCGA 1SFCB 3GHGA 1R8EA 3AE4C 3MUDA 3CWBE 2HPCB 2Q1KA 1NU1J 3ZDMA 2GUVA 2NPSC 1LWUC 4MN4C 1RF0A 4DZOA 1T6AA 2PGDA 2HODA 1L0NG 1KILE 2J5UA 4WY4A 1ZN5A 4BRYB 1Y8AA 2BEQD 4PD4H 4WWIA 4Z1MH 1E5WA 4PD4I 5KKZB 4TLFA 1IZNB 1USEA 4KJMA 1N2DC 3L72E 2WSCH 1LTJC 3L70E 1PP9J 1NTZG 1VQ5P 5TJHA 3HE5B 3K5BA 2ZXXA 1PL5A 1RH5B 2YMYA 1SQPG 3GG2A 3FXEA 2R3SA 1M8OB 4R4MA 1L2PA 1FOSF 1J1DC 1BGYE 4GOEA 2W83C 1E79H 1YHQP 2W6AA 5AW9B 1JMBA 2E74B 3A0BE 2E75B 2V7QH 1BGYJ 5KAIH 2I1KA 1GK4A 3BCCD 1FDOA 1NTZE 2JEEA 2AXCA 2QJYB 5KJ7C 5AVWB 1FE6A 3W68A 1KMIZ 1JOCA 3O6QA 2KI7B 1SQPE 5CCGC 1DD3A 3RBZA 1FBMA 2P58A 3GHGC 1QVFO 1Q90D 2M5AA 4B86A 2C0WA 1P84E 2HR3A 2R44A 3Q3DA 4RESB 1JMMA 2V4HA 1RF0C 3L71D 4GIFA 2WITA 1URQA 2QSIA 1JY2N 1EZVI 3AEBC 1SFCA 1M1KQ 2QM7A 1FJPA 2YNYA 3NMDA 1PPJD 3WUVA 2HG5D 2HPCA 1HWTC 3HUSB 3D6YA 2FFDB 2XNXA 2QA4P 2H8PD 1L0LK 3B8EB 2ZJSE 4L75A 3AEGC 3CMAP 3BCCG 1GMJA 1X9VA 1JM0A 1CI6B 4GOFA 3Q5PA 5AVSB 5KJ7D 1AVOA 3VTPC 1RF1C 2ZVNB 1SLQA 3V2QA 1QX8A 2QJKC 1Q86Q
chains in the Genus database with same CATH topology
5CCHC 3A3YB 5AW8B 1N86A 5APXA 2XV5A 3IFMA 3MGNA 1HGVA 1CZQA 1JTHB 2WZ7A 3RK2D 5BU8B 1CSBA 1JY2O 3GHGB 2YO2A 1T8ZA 4N78E 1N73B 1L4AA 4W7ZA 2KOGA 1N7LA 2CPBA 3L37A 2WPRA 1L4AC 1LWUB 1GZLA 4EOTA 5CJ4A 1JY3N 3H32A 3M0AA 3HE4A 3MTUE 3VP8A 4XA4A 4DOJA 2HODB 2GUSA 3VP9A 1AFOA 2WPQA 3NTNA 1NKZB 4WY4B 1FZAA 4LLHA 2HYNA 1Z56A 1URQD 1HTLC 3N4XA 2OYIC 1NWQA 5AVRB 1NTKK 3OJAB 2GM4A 2WT7B 1SFCD 1SP4A 5APVA 2OYHB 2FKWB 3IR9A 4C7NB 5CMZA 3HD7B 4C46A 1LTTC 1FZBA 5APSA 2WTYA 1EQ7A 1FAVA 2QM8A 1KZUB 3BVHA 4IFMA 1PFIA 2NPSA 1J1EB 1NAFA 3B5NB 1GW3A 2J59M 4AQRD 4LGDE 3UIAA 2WPSA 1JUNA 4W7YA 3L4FA 1JNMA 1SQVK 1URQC 3NXSA 2A45H 2R5BA 4LC1A 2LKMA 3P8CD 3V4WA 1ZLLA 1KILA 3O8ZA 3V5BA 1SFCC 1A02J 1N7SB 2A45I 3LIEA 1JO5A 1J2JB 3BRTB 5AW7B 1FOSE 3V2PA 1HGZA 2CPSA 2KYVA 4C7NA 1LTJA 1W2EA 5CCHD 1NTZK 4XE5B 5AW6B 1QL2A 4GT1A 3OA7A 3P8CE 1ZV8A 4AYCA 1IFDA 2Z5IA 3R2PA 1RE4C 1T3JA 2YKQA 1YTZI 3VOPA 3V2RA 4IFFA 1NO4A 3U1AA 2H43A 1NU1K 3MIWA 2N1TA 5KTBA 1LTIC 3M9BA 1MV8A 3KQGA 3PP5A 2BASA 1SQPK 2J58A 2C9LY 1N7SA 1L4AD 1GTWA 1JCDA 1HJBA 2E42A 3H6PA 3M91A 1KFNA 2IFNA 2KSJA 5APUA 1G2CB 1FZGA 3M9QA 3HUSA 2FFDA 1HBWA 2YO3A 1LT9A 5AVVB 2KP8A 2YKPA 2FFDC 3RK3D 3T97A 2VRSA 3SWFA 3KYQA 2Q5UA 1LT9C 1IK9A 2Q7CA 3RK2B 2L5GB 4WB4A 3BATA 2Q3IA 3II6A 2WWWA 2OYIB 2MJZA 1LTBC 4JYBA 1T3UA 2I1JA 2M3BA 2P2UA 1S9KD 3P8MC 1H89A 1JY3P 1GW4A 1CI6A 2IPPA 2FYZA 4O9BA 1GL2A 1HUCA 2KLVA 2W27A 5AW3B 3L35A 1X8YA 1GL2C 3CI9A 3TNUB 2R32A 1FZCA 2Q9IA 3A7OA 3U1CA 1ZR4A 2NPSD 3RK3C 1NOHA 2WSEH 1OXZA 5KLVK 5AW1B 4N6JA 1FDMA 2H7HA 2WSFH 2IX7C 1S9KE 1JTHA 1NH4A 2YKOA 1G1IA 4JF7A 5CCGA 1KILD 1SFCB 5APYA 1FZFA 3GHGA 3RL0D 3P32A 1HVVA 1LTGC 1GU4A 4OH8B 3SWYA 1N73A 5AVZB 3VMZA 4Y99C 3VMXA 1M1JB 2HFED 1VPCA 3MUDA 2XZRA 5APQA 1LWUA 1NTMK 2HPCB 2GUVA 2NPSC 1LWUC 5AVYB 2ZFCA 1RF0A 4DZOA 3M0DA 2HODA 1AQ5A 1RE3A 3TK1A 1JCCA 4WY4A 1ZN5A 4KHXA 1GD2E 1KILC 1E5WA 5AVQB 1IC2A 4WY4C 3RL0C 3LW5H 2N1TD 5AW4B 2WT7A 2P7JA 1IO4A 2OYHA 1FZEA 1RF1B 1MUUA 2FYUK 1M7LA 3HD7A 1N2DC 1N7SD 1WRGA 2M8RA 1JY3O 2WSCH 1LTJC 3HTKB 3MD0A 3HD7C 2N9BA 4HH2A 4ZKUA 1M1JA 3A2AA 1SVFA 3TYYA 1SQXK 3B5NA 4I6MC 3KPEA 1XTGB 3BASA 4M3LA 3NFQA 3HE5B 2N1TC 2XU6A 4ZKPA 1LGHB 2C9NY 1IFMA 2FXMA 1L4AB 1N7SC 2YMYA 3M06A 5AW2B 1H8AA 5BVZA 3EFGA 1OWAA 4JYCA 1GL2D 1FOSF 1J1DC 1IFIA 3HUSC 1T2KC 3HE4B 5BU5A 1ZR2A 2O01H 3RK3B 3V4QA 3EQ2A 1H88A 2P67A 1GDTA 4I2LC 1NKNA 2W6AA 1KFMA 2XKMA 5AW9B 4I1LA 1GK6A 5CCGD 1YYCA 3CLQA 2ZXEB 3HE5A 4IFDK 3P7KA 4GKGA 2OARA 2I1KA 1GK4A 4Y99B 4C7RA 2P1JA 4N3YB 1FU1A 5KJ7A 1DH3A 1FJKA 2JEEA 3C9IA 5CJ0A 3L36A 1CW5A 1G2CA 2KB7P 4AUWA 5KJ7C 1FZCC 5CHXA 5AVWB 1IFNA 2NPSB 1URQB 2PP6A 1JOCA 1NHLA 5AW0B 4WY4D 1KILB 4EIJA 5CCGC 2OYIA 1FBMA 2PAJA 3RK2C 3GHGC 3RL0B 1N73C 4B86A 1IFJA 2C0WA 1YTZT 5APTA 3HD7D 2O1KA 3VYIA 3A5TA 2R3CA 1LTJB 5AVTB 3TNUA 1GU5A 3VN0A 4RESB 1JMMA 1RF0C 3M0DC 1LTAC 4GIFA 3B5ND 2XDJA 5AVXB 1LTSC 1RE3C 2W6BA 2WITA 2O1JA 2IFMA 1JY2P 1L0NK 3CL3D 1URQA 1JY2N 2HLOA 2N1TB 1SFCA 3G3ZA 3U59A 2C0XA 1VDFA 3I5CA 5AVUB 1MFZA 5AW5B 2OYHC 2QM7A 1SQBK 3BRVB 1FJPA 1MZ9A 2YNYA 1X79B 2Z4EA 1RY3A 1A02F 1T2KD 3NMDA 3E1IA 4W80A 2POHA 4HYTB 2HG5D 1M1JC 2HPCA 1HWTC 1J1DB 3HUSB 2FFDB 2XNXA 2R5DA 1J1EC 1SQQK 1KQLA 1G1JA 3B5NC 1LT9B 2H8PD 1L0LK 1HH0A 3B8EB 1RE4A 3TSIA 1DX7A 2A45G 2E43A 3LIDA 3N7NA 3M9HA 5APWA 3VMYA 1IJDB 1WT6A 1X9VA 1RF1A 3H32B 1CI6B 1XTCC 2Z5HA 1DEBA 1GL2B 1QL1A 3V2NA 3WMM0 5AVSB 5KJ7D 3VTPC 1RF1C 4N78D 3HTKA 1SLQA 5CCHA 2JJLA 1FZCB 3V2QA 3KDPB 4WBAA 3OAKA 3HRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P8C E;  5CCH C;  1NHL A;  1T3J A;  3VOP A;  4WY4 A;  1JTH B;  4WY4 D;  2WZ7 A;  1KIL C;  3RK2 D;  1KIL B;  5CCG C;  2N1T A;  4WY4 C;  3RL0 C;  3RL0 B;  3RK2 C;  2N1T D;  3PP5 A;  4N78 E;  1L4A A;  4W7Z A;  1N7S A;  1L4A D;  3HD7 A;  2KOG A;  1N7S D;  3HD7 D;  2M8R A;  1L4A C;  3HTK B;  3HD7 C;  3M0D C;  3B5N A;  3B5N D;  2XDJ A;  3RK3 D;  1XTG B;  3KYQ A;  4WY4 B;  1URQ A;  3RK2 B;  1URQ D;  2N1T C;  2N1T B;  1SFC A;  1SFC D;  1L4A B;  1N7S C;  2YMY A;  3HD7 B;  1URQ B;  1GL2 A;  1GL2 D;  4W80 A;  2HG5 D;  1GL2 C;  2NPS A;  3B5N C;  2NPS D;  3B5N B;  3RK3 C;  3RK3 B;  2H8P D;  4LGD E;  4W7Y A;  3TSI A;  1URQ C;  1JTH A;  1KIL A;  4JF7 A;  5CCG A;  1SFC C;  1N7S B;  1KIL D;  1SFC B;  5CCG D;  3RL0 D;  1HVV A;  4OH8 B;  1GL2 B;  2HFE D;  5KJ7 A;  5KJ7 D;  5CCH A;  5KJ7 C;  5CCH D;  2NPS C;  2NPS B;  2PP6 A; 
#chains in the Genus database with same CATH topology
 2KNC B;  3IFM A;  4HJG H;  1Y47 A;  2WZ7 A;  1JY2 O;  2DW3 A;  2NRG A;  4PD4 D;  1BE3 J;  2YO2 A;  4Y28 J;  1KV4 A;  4YXD C;  1AA0 A;  1LWU B;  3H32 A;  3L71 G;  2WVR A;  4XA4 A;  3CCE P;  4JBZ A;  2GUS A;  2AXT E;  4EDF A;  4BWN A;  1FZA A;  3N4X A;  3H1K J;  1QVG O;  1X0T A;  3A0B H;  3FWL A;  2IZ1 A;  4CPG A;  1PPJ G;  1LTT C;  2M0B A;  1U7J A;  1J1E B;  1GW3 A;  4W7Y A;  5M1B A;  1URQ C;  2R5B A;  3P8C D;  4D6T J;  3V4W A;  3V5B A;  1SFC C;  1JO5 A;  1LT1 A;  1BCC J;  3L74 D;  2KK7 A;  3AE5 C;  1P84 H;  1VF5 D;  2SPZ A;  2BCC E;  5B66 E;  2D2C D;  1QL2 A;  1P84 I;  4GT1 A;  1NYH A;  2Z5I A;  2YKQ A;  4IFF A;  1NU1 K;  4IOI H;  3AEC C;  1BDD A;  5E79 H;  1MV8 A;  2BAS A;  2B88 A;  2BCC J;  3AE7 C;  2C9L Y;  2E42 A;  3EWK A;  1FZG A;  4UB8 H;  3HUS A;  2FFD A;  1NTK J;  2YO3 A;  1SQQ D;  3RK3 D;  3T97 A;  1SQV E;  3CCS P;  1KB9 E;  3AE1 C;  2L5G B;  2YMK A;  1EZV D;  3BAT A;  1VQK P;  3II6 A;  3H1H J;  1LTB C;  1T3U A;  2I1J A;  2M3B A;  4EI2 A;  1KQF B;  3USS A;  1CI6 A;  4O9B A;  2FYZ A;  2KLV A;  2W27 A;  1SQV J;  1OVU A;  1X8Y A;  1GL2 C;  1L0L E;  3H1J J;  1ZR4 A;  1X22 A;  3CWB D;  3S4R A;  3MZW B;  2WSE H;  2KNC A;  2K9J B;  5B5E E;  3L75 J;  3JSV C;  3IN6 A;  1S9K E;  1NH4 A;  2IYO A;  1K73 Q;  1KIL D;  1FZF A;  3RL0 D;  3P32 A;  1HVV A;  1LTG C;  2E75 C;  4OH8 B;  5GTH E;  4DCK A;  3KZI E;  4EYY Q;  1EDL A;  3CCR P;  1LWU A;  5GTI E;  1UII A;  1S4X A;  1VQ9 P;  2Y0D A;  2QJY C;  3L72 D;  3M0D A;  3L70 D;  1AQ5 A;  1YBK A;  3CCL P;  1JCC A;  4H0L D;  4KHX A;  2Q3E A;  3Q1M A;  1AVY A;  3AEE C;  4DJG A;  1RF1 B;  4RJT A;  1WRG A;  1VQ7 P;  4IL6 X;  1VF5 B;  3HTK B;  3MD0 A;  3HD7 C;  1M56 D;  2D2C B;  4I6M C;  1YJ9 P;  3TGU E;  1XTG B;  3BAS A;  2ZYA A;  5H2F H;  2KSE A;  3TDK A;  2LR2 A;  1NU1 G;  2IDB A;  1W5C E;  3L73 J;  3PLN A;  3CC4 P;  3M06 A;  5KLV J;  3TGU J;  1GL2 D;  3G9R A;  3GMA A;  1IFI A;  3CWB G;  3HUS C;  1FC2 C;  1NTZ D;  5B66 H;  3RK3 B;  3V4Q A;  1S3J A;  3RL0 g;  3EQ2 A;  1H88 A;  2P67 A;  1GDT A;  1KN7 A;  3S1K A;  3H1I E;  3R4Y A;  2JWA A;  1ZP0 C;  1GK6 A;  2E76 C;  1YYC A;  1PP9 G;  2ZXE B;  4IFD K;  1SQP D;  2ZYG A;  4C7R A;  2P1J A;  3CD6 P;  5KJ7 A;  1DH3 A;  4ASW A;  5CJ0 A;  3L72 G;  2WSS H;  1SQX E;  3L70 G;  1URQ B;  1P84 D;  2PP6 A;  2E5T A;  1VQ4 P;  1OW8 A;  3G71 P;  1NU1 E;  3RGU A;  2WMM A;  2FYU J;  4R4L A;  5DJU B;  1BSN A;  1KB9 H;  2Y0C A;  1KIL B;  4EIJ A;  1UIX A;  3RL0 B;  1KB9 I;  3RK2 C;  1U7M A;  1ZRT E;  1PGP A;  1SQX J;  5EFW B;  3HD7 D;  2H88 C;  1KD1 Q;  2ZAE B;  3ITK A;  2XND H;  3M0D C;  1LP1 B;  5AVX B;  1BGY G;  3B5N D;  1PP9 E;  2K9J A;  4H0L B;  1WMK A;  3GW6 A;  4U3F E;  5B5E H;  4IL6 E;  2HLO A;  3CX5 D;  3G3Z A;  3U59 A;  1VDF A;  5AW5 B;  1MZ9 A;  2JP3 A;  1X79 B;  5GTH H;  2Z4E A;  3KZI H;  1A02 F;  3E1I A;  2POH A;  4U3F J;  4HYT B;  1ZME C;  5GTI H;  2R5D A;  1J1E C;  3E7K A;  1G1J A;  3B71 A;  2E43 A;  2E76 D;  3N7N A;  5APW A;  3VMY A;  1WT6 A;  1RF1 A;  4PJ0 E;  3H32 B;  1XTC C;  5KLI C;  1GL2 B;  1QL1 A;  3V2N A;  2K88 A;  2O01 J;  3HTK A;  1S5L E;  1KQS O;  2QVA A;  2JJL A;  1HJ0 A;  1YQ3 C;  4WBA A;  3GLM A;  5CCH C;  3A3Y B;  2XV5 A;  3AEF C;  3RK2 D;  5BU8 B;  3V6I A;  1BDC A;  1VL2 A;  1D7M A;  2IBZ E;  4W7Z A;  1SQB E;  2KOG A;  1DEE G;  1L4A C;  2WSF J;  1L0N J;  1JY3 N;  2Y9Y A;  3FGA D;  5TIS E;  3PJS K;  3VP8 A;  3AE6 C;  1QEX A;  2UWJ E;  2WPQ A;  1SQB J;  2HYN A;  2B87 B;  1NTK K;  3OJA B;  1OMI A;  2WT7 B;  2O01 N;  3Q5R A;  3IR9 A;  3HD7 B;  2QJP B;  1FZB A;  5APS A;  2WTY A;  2QM8 A;  1VQ8 P;  3B5N B;  2J59 M;  1RHZ B;  3UIA A;  1JUN A;  5E79 E;  3L4F A;  1SQV K;  3NXS A;  4UB6 E;  2A45 H;  2LKM A;  1KIL A;  3O8Z A;  4GDO A;  3AEA C;  1A02 J;  2A45 I;  3LIE A;  1VQO P;  2RH0 A;  1J2J B;  1H0T B;  2RKL A;  3MP7 B;  4UB8 E;  5AW7 B;  2RN0 A;  1FOS E;  1DIP A;  3V2P A;  4C7N A;  5CCH D;  5AW6 B;  3T97 B;  5KAF E;  3H1K G;  3OA7 A;  1LP1 A;  4AYC A;  2JR8 A;  2KLU A;  5L8R J;  3V2R A;  2E76 B;  2Y9Z A;  3U1A A;  2H43 A;  4IL6 H;  3MIW A;  4QMA A;  2B89 A;  1LTI C;  3M9B A;  1KB9 D;  3C8V A;  3G4S P;  2J58 A;  1L4A D;  1YIT P;  1YJW P;  1PGO A;  1HJB A;  1JCD A;  1BE3 E;  3H6P A;  3M91 A;  1VF5 C;  5APU A;  1G2C B;  1QLE D;  4D6T G;  1QGK B;  2D2C C;  3M9Q A;  1HBW A;  1BCC G;  1L0L D;  3AE3 C;  3SWF A;  2ITA A;  2Q5U A;  1LT9 C;  1M57 D;  3RK2 B;  2ZVO B;  3CME P;  3QH9 A;  1S9K D;  3PTZ A;  2AEJ A;  1JY3 P;  3H1K E;  1GL2 A;  4PJ0 H;  4H13 D;  5AW3 B;  1FDI A;  2R32 A;  1S5L H;  2Q9I A;  3RK3 C;  2BCC G;  1OXZ A;  5KLV K;  2OYO A;  1FDM A;  2WSF H;  2IX7 C;  4JF7 A;  2BEZ F;  4D6T E;  1NTK G;  1GU4 A;  2KS1 B;  3SWY A;  3VMZ A;  1MFT A;  2FXP A;  1OVR A;  3VMX A;  1VPC A;  2XZR A;  5APQ A;  3D71 A;  4RKU J;  1BCC E;  2IBZ I;  1NTM K;  3CC7 P;  3CCM P;  4OWF A;  5H2F E;  3H1H G;  2ZFC A;  2OTK E;  1VQL P;  1YIJ P;  5TIS H;  2QE7 H;  3BCC J;  1DD4 A;  3SSU A;  4I7Z C;  1SQV G;  1KIL C;  2B87 A;  3TGU D;  5AVQ B;  3RL0 C;  2YIU B;  2N1T D;  5AW4 B;  5KLI B;  2WT7 A;  3H1J G;  1OX3 A;  1FZE A;  1MUU A;  2I8D A;  2FYU K;  2PRR A;  1M7L A;  3HD7 A;  1LJ2 A;  1N7S D;  3L75 G;  1FS0 E;  1M1J A;  3A2A A;  1SVF A;  3I55 P;  1L0L G;  1SQX K;  3B5N A;  3AE9 C;  3A0H E;  4H0L C;  1NTK E;  5CBO A;  3NFQ A;  4UB6 H;  2C9N Y;  3H1I D;  1H0T A;  2YXR B;  2FXM A;  1L4A B;  3IF4 A;  3F89 A;  3H1H E;  5AW2 B;  5BVZ A;  1OWA A;  2RMZ A;  2K1A A;  4ZNC A;  1VQM P;  4JQ0 D;  3HE4 B;  1ZR2 A;  5KAF H;  3H1J E;  1SQX D;  1NKN A;  2XKM A;  1KFM A;  1NU1 D;  4I1L A;  3L75 E;  1PZQ A;  4GKG A;  1ZXG A;  2OAR A;  4Y99 B;  2CK3 H;  4N3Y B;  1FU1 A;  2QG4 A;  1FJK A;  1IK7 A;  1ZRT D;  5DJT B;  1CW5 A;  1G2C A;  2KB7 P;  3SFD C;  4PV1 D;  2PFX A;  3L73 G;  1NHL A;  5AW0 B;  4TT3 H;  3TGU G;  1R5L A;  1PP9 D;  2PAJ A;  3S9O A;  1YTZ T;  2O1K A;  3VYI A;  4OGQ C;  3A5T A;  1HF9 A;  5AVT B;  3VN0 A;  2A06 G;  3KXD A;  1NAY A;  2XDJ A;  3SWK A;  1Q82 Q;  2KUB A;  2O1J A;  2IFM A;  3CL3 D;  1L0N K;  4GOD A;  2AEM A;  3H1I G;  2N1T B;  3Q2Y A;  4H44 D;  2C0X A;  5AVU B;  2WSC J;  2KS1 A;  1SQB K;  2KZI A;  2QJP C;  2FYU G;  3L73 E;  3SFE C;  1ZOY C;  4W80 A;  1M1J C;  5KLV E;  1R5S A;  1KQL A;  1BGY D;  3B5N C;  1LT9 B;  1HH0 A;  1SQX G;  2IZ0 A;  3TSI A;  2A45 G;  3JCU E;  3M9H A;  1SS1 A;  1NTM E;  2A06 E;  4RO0 A;  2Z5H A;  4ZMD A;  1S1C X;  3WMM 0;  1PGQ A;  2IBZ D;  4JPZ B;  3TF5 A;  5CCH A;  1FZC B;  3OAK A;  3VMA A;  2LXC B;  3PHL A;  1N86 A;  5APX A;  1NTM J;  3L74 J;  3A0H H;  1HGV A;  3MGN A;  1CZQ A;  1JTH B;  2V7Q J;  4NPD A;  4U3F G;  1KYO E;  1Q7Y Q;  2FYU E;  4A7P A;  1T8Z A;  4N78 E;  1N73 B;  1L4A A;  1OZH A;  2ZT9 D;  4BXL A;  4OGQ D;  1N7L A;  3CCV P;  2E74 D;  3L37 A;  1GZL A;  3M0A A;  1VQP P;  4PV1 B;  3HE4 A;  1EDK A;  2OTJ P;  4DOJ A;  3VP9 A;  4I7Z B;  3NTN A;  2W6J H;  1NKZ B;  1BSH A;  4LLH A;  1Z56 A;  1HTL C;  3QWO C;  2P10 A;  5AVR B;  2GM4 A;  1SP4 A;  2OYH B;  1SQQ J;  2MKV A;  4C7N B;  1EQ7 A;  1FAV A;  1KZU B;  3BVH A;  4L76 A;  3LW5 J;  2FYN B;  4AQR D;  2WPS A;  2OTL P;  1OVV A;  1JNM A;  3AE2 C;  3W67 A;  1S2E A;  1ZLL A;  4H44 B;  4HKZ H;  2OQQ A;  2JO1 A;  3BRT B;  4YXW H;  2G8Y A;  3CWB J;  2IBZ G;  1SQB G;  1HGZ A;  2E5Y A;  2CPS A;  2JKV A;  4NPE A;  4XE5 B;  1BE3 D;  1IFP A;  3FWN A;  3H1L E;  1N8R Q;  1ZV8 A;  2G3A A;  3FXD A;  1IFD A;  3R2P A;  1T3J A;  3VOP A;  2KZJ A;  1NO4 A;  2H89 C;  2N1T A;  1JEK A;  1YJN P;  2YIU C;  5KTB A;  3L72 J;  1AJY A;  3H1L J;  1N7S A;  3L70 J;  1KFN A;  2IFN A;  2KSJ A;  3H1K D;  1L0N E;  1LT9 A;  5AVV B;  2NZ2 A;  2KP8 A;  1M90 Q;  1KTM A;  4WB4 A;  1PV3 A;  2OYI B;  2WWW A;  3JCU H;  4JYB A;  4K35 A;  2P2U A;  3P8M C;  1H89 A;  2ZT9 B;  3WU2 E;  2IYP A;  4OGQ B;  1EXJ A;  2IPP A;  4D6T D;  1W2B O;  2GA1 A;  2K3R A;  3CI9 A;  3TNU B;  1FZC A;  2WQY C;  3A7O A;  3E1R A;  1K04 A;  1BCC D;  3CXH E;  2NPS D;  1NOH A;  4DT0 A;  2H7H A;  1JTH A;  2YKO A;  1G1I A;  4XFJ A;  5APY A;  1KYO H;  1RQV A;  2FXO A;  1NTZ J;  1N73 A;  5AVZ B;  1KYO I;  4Y99 C;  4H13 C;  1M1J B;  2HFE D;  4YPC A;  1TU3 F;  1BE3 G;  3MUD C;  1YI2 P;  5AVY B;  2BCC D;  2W90 A;  1SQP J;  1RE3 A;  3Q5S A;  3TK1 A;  1VQ6 P;  3F5H A;  4WVZ A;  1GD2 E;  3PH0 A;  1IC2 A;  4WY4 C;  1NTK D;  3LW5 H;  2P7J A;  1IO4 A;  2OYH A;  3I56 P;  2FBW C;  2M8R A;  1JY3 O;  1NJI Q;  2N9B A;  4HH2 A;  3H1H D;  4ZKU A;  1K8A Q;  3TYY A;  3KPE A;  3CCU P;  4M3L A;  1NGM B;  1SQV D;  2FY8 A;  1OW6 A;  3CX5 E;  2N1T C;  2XU6 A;  3H1J D;  4ZKP A;  1LGH B;  4BRY A;  3D6Z A;  1IFM A;  1N7S C;  3L75 D;  1H8A A;  3EFG A;  4JYC A;  2K9Y A;  3WUT A;  3GF3 A;  1Q81 Q;  1T2K C;  1OW7 A;  5BU5 A;  2JWD A;  2O01 H;  3G6E P;  2OGU A;  4U7J A;  4I2L C;  5CCG D;  3CLQ A;  3HE5 A;  3P7K A;  2W8Z A;  3C9I A;  2L91 A;  3L36 A;  2WSE J;  3IAO A;  1JB0 J;  4AUW A;  1S72 P;  1FZC C;  5CHX A;  1IFN A;  2B9B A;  1EDI A;  2NPS B;  1NVO A;  2QIW A;  4WY4 D;  3BCC E;  2OYI A;  1N73 C;  1IFJ A;  3WU2 H;  5APT A;  1PIX A;  3JC2 2;  3KHU A;  2R3C A;  1LTJ B;  5CBN A;  4PV1 C;  3TNU A;  1GU5 A;  3L73 D;  3CCJ P;  1LTA C;  3CXH H;  1LTS C;  1RE3 C;  2W6B A;  5KLV D;  3WUU A;  1JY2 P;  3CXH I;  1EXI A;  3I5C A;  1MFZ A;  2OYH C;  3BRV B;  1USD A;  1RY3 A;  2KXP B;  1T2K D;  3L71 E;  1NTM D;  2A06 D;  1J1D B;  1SQQ K;  2FYN C;  3ABV C;  1RE4 A;  2YXQ B;  3CCQ P;  1DX7 A;  3LID A;  4H44 C;  3L71 J;  4OVN F;  1IJD B;  1PPJ E;  2LXB A;  2O3J A;  1KYO D;  5KKZ C;  2FYU D;  1DEB A;  1Q2N A;  2Y0E A;  4N78 D;  3CC2 P;  3KDP B;  3HRN A;  5AW8 B;  3PRJ A;  2AEF A;  1YQ4 C;  4ASV A;  1MKM A;  1CSB A;  3CX5 H;  4H13 B;  4HB1 A;  3GHG B;  2N9Y B;  1AV1 A;  3CX5 I;  5K5G B;  2CPB A;  2WPR A;  1RQU A;  4EOT A;  5CJ4 A;  3OW2 O;  3MTU E;  1KQG B;  5KLV G;  2HOD B;  1PGJ A;  1AFO A;  4PD4 E;  4WY4 B;  1ZW0 A;  4U3F D;  3AED C;  1URQ D;  3MHV A;  2JDI H;  2OYI C;  1NWQ A;  1SFC D;  2ZT9 C;  5APV A;  2FKW B;  5CMZ A;  2E74 C;  4C46 A;  1Y9B A;  3CPW O;  1L0L J;  1NTM G;  3L74 G;  4IFM A;  1PFI A;  2NPS A;  3FX0 A;  1NAF A;  4LGD E;  3H25 A;  4L73 A;  1OFC X;  1K05 A;  3H1L D;  4LC1 A;  2QRX A;  1KOR A;  2Q6Q A;  1N7S B;  1VQN P;  2AXT H;  1EC5 A;  1AQT A;  5C39 A;  3D70 A;  2KYV A;  1LTJ A;  1W2E A;  2M3E A;  1NTZ K;  2QJK B;  3C1L A;  3RBX A;  3P8C E;  1SQQ G;  1RE4 C;  1YTZ I;  1L0N D;  2KIK A;  4YTP C;  3L74 E;  1EZV G;  3KQG A;  3PP5 A;  5KAI E;  1SQP K;  1LNQ A;  1SQB D;  1GTW A;  3AE8 C;  2WPV B;  4L74 A;  3EFF K;  1U57 A;  2YKP A;  2FFD C;  1EDJ A;  2VRS A;  3O6Q B;  3KYQ A;  1IK9 A;  2Q7C A;  3CXH D;  1K9M Q;  4K3A A;  4NPF X;  2Q3I A;  2MJZ A;  2ZYD A;  2M5A B;  1KC8 Q;  1S5L X;  3GF7 A;  2E75 D;  1GW4 A;  1HUC A;  1OIP A;  1SQQ E;  3L35 A;  4KT0 J;  3RK3 E;  3U1C A;  3H1I J;  1EZV E;  2K37 A;  3H1L G;  2QEX P;  5AW1 B;  4N6J A;  3B4S A;  5CCG A;  1SFC B;  3GHG A;  1R8E A;  3AE4 C;  3MUD A;  3CWB E;  2HPC B;  2Q1K A;  1NU1 J;  3ZDM A;  2GUV A;  2NPS C;  1LWU C;  4MN4 C;  1RF0 A;  4DZO A;  1T6A A;  2PGD A;  2HOD A;  1L0N G;  1KIL E;  2J5U A;  4WY4 A;  1ZN5 A;  4BRY B;  1Y8A A;  2BEQ D;  4PD4 H;  4WWI A;  4Z1M H;  1E5W A;  4PD4 I;  5KKZ B;  4TLF A;  1IZN B;  1USE A;  4KJM A;  1N2D C;  3L72 E;  2WSC H;  1LTJ C;  3L70 E;  1PP9 J;  1NTZ G;  1VQ5 P;  5TJH A;  3HE5 B;  3K5B A;  2ZXX A;  1PL5 A;  1RH5 B;  2YMY A;  1SQP G;  3GG2 A;  3FXE A;  2R3S A;  1M8O B;  4R4M A;  1L2P A;  1FOS F;  1J1D C;  1BGY E;  4GOE A;  2W83 C;  1E79 H;  1YHQ P;  2W6A A;  5AW9 B;  1JMB A;  2E74 B;  3A0B E;  2E75 B;  2V7Q H;  1BGY J;  5KAI H;  2I1K A;  1GK4 A;  3BCC D;  1FDO A;  1NTZ E;  2JEE A;  2AXC A;  2QJY B;  5KJ7 C;  5AVW B;  1FE6 A;  3W68 A;  1KMI Z;  1JOC A;  3O6Q A;  2KI7 B;  1SQP E;  5CCG C;  1DD3 A;  3RBZ A;  1FBM A;  2P58 A;  3GHG C;  1QVF O;  1Q90 D;  2M5A A;  4B86 A;  2C0W A;  1P84 E;  2HR3 A;  2R44 A;  3Q3D A;  4RES B;  1JMM A;  2V4H A;  1RF0 C;  3L71 D;  4GIF A;  2WIT A;  1URQ A;  2QSI A;  1JY2 N;  1EZV I;  3AEB C;  1SFC A;  1M1K Q;  2QM7 A;  1FJP A;  2YNY A;  3NMD A;  1PPJ D;  3WUV A;  2HG5 D;  2HPC A;  1HWT C;  3HUS B;  3D6Y A;  2FFD B;  2XNX A;  2QA4 P;  2H8P D;  1L0L K;  3B8E B;  2ZJS E;  4L75 A;  3AEG C;  3CMA P;  3BCC G;  1GMJ A;  1X9V A;  1JM0 A;  1CI6 B;  4GOF A;  3Q5P A;  5AVS B;  5KJ7 D;  1AVO A;  3VTP C;  1RF1 C;  2ZVN B;  1SLQ A;  3V2Q A;  1QX8 A;  2QJK C;  1Q86 Q; 
#chains in the Genus database with same CATH homology
 5CCH C;  3A3Y B;  5AW8 B;  1N86 A;  5APX A;  2XV5 A;  3IFM A;  3MGN A;  1HGV A;  1CZQ A;  1JTH B;  2WZ7 A;  3RK2 D;  5BU8 B;  1CSB A;  1JY2 O;  3GHG B;  2YO2 A;  1T8Z A;  4N78 E;  1N73 B;  1L4A A;  4W7Z A;  2KOG A;  1N7L A;  2CPB A;  3L37 A;  2WPR A;  1L4A C;  1LWU B;  1GZL A;  4EOT A;  5CJ4 A;  1JY3 N;  3H32 A;  3M0A A;  3HE4 A;  3MTU E;  3VP8 A;  4XA4 A;  4DOJ A;  2HOD B;  2GUS A;  3VP9 A;  1AFO A;  2WPQ A;  3NTN A;  1NKZ B;  4WY4 B;  1FZA A;  4LLH A;  2HYN A;  1Z56 A;  1URQ D;  1HTL C;  3N4X A;  2OYI C;  1NWQ A;  5AVR B;  1NTK K;  3OJA B;  2GM4 A;  2WT7 B;  1SFC D;  1SP4 A;  5APV A;  2OYH B;  2FKW B;  3IR9 A;  4C7N B;  5CMZ A;  3HD7 B;  4C46 A;  1LTT C;  1FZB A;  5APS A;  2WTY A;  1EQ7 A;  1FAV A;  2QM8 A;  1KZU B;  3BVH A;  4IFM A;  1PFI A;  2NPS A;  1J1E B;  1NAF A;  3B5N B;  1GW3 A;  2J59 M;  4AQR D;  4LGD E;  3UIA A;  2WPS A;  1JUN A;  4W7Y A;  3L4F A;  1JNM A;  1SQV K;  1URQ C;  3NXS A;  2A45 H;  2R5B A;  4LC1 A;  2LKM A;  3P8C D;  3V4W A;  1ZLL A;  1KIL A;  3O8Z A;  3V5B A;  1SFC C;  1A02 J;  1N7S B;  2A45 I;  3LIE A;  1JO5 A;  1J2J B;  3BRT B;  5AW7 B;  1FOS E;  3V2P A;  1HGZ A;  2CPS A;  2KYV A;  4C7N A;  1LTJ A;  1W2E A;  5CCH D;  1NTZ K;  4XE5 B;  5AW6 B;  1QL2 A;  4GT1 A;  3OA7 A;  3P8C E;  1ZV8 A;  4AYC A;  1IFD A;  2Z5I A;  3R2P A;  1RE4 C;  1T3J A;  2YKQ A;  1YTZ I;  3VOP A;  3V2R A;  4IFF A;  1NO4 A;  3U1A A;  2H43 A;  1NU1 K;  3MIW A;  2N1T A;  5KTB A;  1LTI C;  3M9B A;  1MV8 A;  3KQG A;  3PP5 A;  2BAS A;  1SQP K;  2J58 A;  2C9L Y;  1N7S A;  1L4A D;  1GTW A;  1JCD A;  1HJB A;  2E42 A;  3H6P A;  3M91 A;  1KFN A;  2IFN A;  2KSJ A;  5APU A;  1G2C B;  1FZG A;  3M9Q A;  3HUS A;  2FFD A;  1HBW A;  2YO3 A;  1LT9 A;  5AVV B;  2KP8 A;  2YKP A;  2FFD C;  3RK3 D;  3T97 A;  2VRS A;  3SWF A;  3KYQ A;  2Q5U A;  1LT9 C;  1IK9 A;  2Q7C A;  3RK2 B;  2L5G B;  4WB4 A;  3BAT A;  2Q3I A;  3II6 A;  2WWW A;  2OYI B;  2MJZ A;  1LTB C;  4JYB A;  1T3U A;  2I1J A;  2M3B A;  2P2U A;  1S9K D;  3P8M C;  1H89 A;  1JY3 P;  1GW4 A;  1CI6 A;  2IPP A;  2FYZ A;  4O9B A;  1GL2 A;  1HUC A;  2KLV A;  2W27 A;  5AW3 B;  3L35 A;  1X8Y A;  1GL2 C;  3CI9 A;  3TNU B;  2R32 A;  1FZC A;  2Q9I A;  3A7O A;  3U1C A;  1ZR4 A;  2NPS D;  3RK3 C;  1NOH A;  2WSE H;  1OXZ A;  5KLV K;  5AW1 B;  4N6J A;  1FDM A;  2H7H A;  2WSF H;  2IX7 C;  1S9K E;  1JTH A;  1NH4 A;  2YKO A;  1G1I A;  4JF7 A;  5CCG A;  1KIL D;  1SFC B;  5APY A;  1FZF A;  3GHG A;  3RL0 D;  3P32 A;  1HVV A;  1LTG C;  1GU4 A;  4OH8 B;  3SWY A;  1N73 A;  5AVZ B;  3VMZ A;  4Y99 C;  3VMX A;  1M1J B;  2HFE D;  1VPC A;  3MUD A;  2XZR A;  5APQ A;  1LWU A;  1NTM K;  2HPC B;  2GUV A;  2NPS C;  1LWU C;  5AVY B;  2ZFC A;  1RF0 A;  4DZO A;  3M0D A;  2HOD A;  1AQ5 A;  1RE3 A;  3TK1 A;  1JCC A;  4WY4 A;  1ZN5 A;  4KHX A;  1GD2 E;  1KIL C;  1E5W A;  5AVQ B;  1IC2 A;  4WY4 C;  3RL0 C;  3LW5 H;  2N1T D;  5AW4 B;  2WT7 A;  2P7J A;  1IO4 A;  2OYH A;  1FZE A;  1RF1 B;  1MUU A;  2FYU K;  1M7L A;  3HD7 A;  1N2D C;  1N7S D;  1WRG A;  2M8R A;  1JY3 O;  2WSC H;  1LTJ C;  3HTK B;  3MD0 A;  3HD7 C;  2N9B A;  4HH2 A;  4ZKU A;  1M1J A;  3A2A A;  1SVF A;  3TYY A;  1SQX K;  3B5N A;  4I6M C;  3KPE A;  1XTG B;  3BAS A;  4M3L A;  3NFQ A;  3HE5 B;  2N1T C;  2XU6 A;  4ZKP A;  1LGH B;  2C9N Y;  1IFM A;  2FXM A;  1L4A B;  1N7S C;  2YMY A;  3M06 A;  5AW2 B;  1H8A A;  5BVZ A;  3EFG A;  1OWA A;  4JYC A;  1GL2 D;  1FOS F;  1J1D C;  1IFI A;  3HUS C;  1T2K C;  3HE4 B;  5BU5 A;  1ZR2 A;  2O01 H;  3RK3 B;  3V4Q A;  3EQ2 A;  1H88 A;  2P67 A;  1GDT A;  4I2L C;  1NKN A;  2W6A A;  1KFM A;  2XKM A;  5AW9 B;  4I1L A;  1GK6 A;  5CCG D;  1YYC A;  3CLQ A;  2ZXE B;  3HE5 A;  4IFD K;  3P7K A;  4GKG A;  2OAR A;  2I1K A;  1GK4 A;  4Y99 B;  4C7R A;  2P1J A;  4N3Y B;  1FU1 A;  5KJ7 A;  1DH3 A;  1FJK A;  2JEE A;  3C9I A;  5CJ0 A;  3L36 A;  1CW5 A;  1G2C A;  2KB7 P;  4AUW A;  5KJ7 C;  1FZC C;  5CHX A;  5AVW B;  1IFN A;  2NPS B;  1URQ B;  2PP6 A;  1JOC A;  1NHL A;  5AW0 B;  4WY4 D;  1KIL B;  4EIJ A;  5CCG C;  2OYI A;  1FBM A;  2PAJ A;  3RK2 C;  3GHG C;  3RL0 B;  1N73 C;  4B86 A;  1IFJ A;  2C0W A;  1YTZ T;  5APT A;  3HD7 D;  2O1K A;  3VYI A;  3A5T A;  2R3C A;  1LTJ B;  5AVT B;  3TNU A;  1GU5 A;  3VN0 A;  4RES B;  1JMM A;  1RF0 C;  3M0D C;  1LTA C;  4GIF A;  3B5N D;  2XDJ A;  5AVX B;  1LTS C;  1RE3 C;  2W6B A;  2WIT A;  2O1J A;  2IFM A;  1JY2 P;  1L0N K;  3CL3 D;  1URQ A;  1JY2 N;  2HLO A;  2N1T B;  1SFC A;  3G3Z A;  3U59 A;  2C0X A;  1VDF A;  3I5C A;  5AVU B;  1MFZ A;  5AW5 B;  2OYH C;  2QM7 A;  1SQB K;  3BRV B;  1FJP A;  1MZ9 A;  2YNY A;  1X79 B;  2Z4E A;  1RY3 A;  1A02 F;  1T2K D;  3NMD A;  3E1I A;  4W80 A;  2POH A;  4HYT B;  2HG5 D;  1M1J C;  2HPC A;  1HWT C;  1J1D B;  3HUS B;  2FFD B;  2XNX A;  2R5D A;  1J1E C;  1SQQ K;  1KQL A;  1G1J A;  3B5N C;  1LT9 B;  2H8P D;  1L0L K;  1HH0 A;  3B8E B;  1RE4 A;  3TSI A;  1DX7 A;  2A45 G;  2E43 A;  3LID A;  3N7N A;  3M9H A;  5APW A;  3VMY A;  1IJD B;  1WT6 A;  1X9V A;  1RF1 A;  3H32 B;  1CI6 B;  1XTC C;  2Z5H A;  1DEB A;  1GL2 B;  1QL1 A;  3V2N A;  3WMM 0;  5AVS B;  5KJ7 D;  3VTP C;  1RF1 C;  4N78 D;  3HTK A;  1SLQ A;  5CCH A;  2JJL A;  1FZC B;  3V2Q A;  3KDP B;  4WBA A;  3OAK A;  3HRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...