5CCGA

Structure of the ca2+-bound synaptotagmin-1 snare complex (long unit cell form)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
63
structure length
63
Chain Sequence
b'GSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vesicle-associated membrane protein 2
molecule tags Endocytosis,exocytosis
source organism Rattus norvegicus
publication title Architecture of the synaptotagmin-SNARE machinery for neuronal exocytosis.
pubmed doi rcsb
total genus 28
structure length 63
sequence length 63
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5ccgA00
1GL2B 3HTKB 3KYQA 1SFCB 2NPSD 4N78E 3RK2D 1L4AD 1N7SB 1NHLA 3B5NA 5CCGC 2N1TB 3HD7A 1SFCA 4OH8B 1URQD 5CCGA 4JF7A 2H8PD 3RK2B 3RK3B 2YMYA 1URQC 2NPSA 3M0DC 4LGDE 5CCHC 1HVVA 5CCGD 3HD7B 2N1TC 3RK3D 4WY4B 3RL0B 1SFCC 3P8CE 3RK2C 2HFED 2NPSB 1N7SC 1KILC 4W80A 1KILA 1L4AB 3RL0D 4WY4D 3B5NC 2XDJA 3HD7C 4WY4A 2N1TA 2M8RA 1SFCD 2KOGA 3RK3C 1L4AC 5KJ7A 1XTGB 1L4AA 5KJ7C 3VOPA 2NPSC 2WZ7A 1JTHB 1T3JA 1URQB 3B5ND 1GL2C 2HG5D 3PP5A 1N7SD 1KILD 1GL2D 5KJ7D 1N7SA 2N1TD 4W7YA 1URQA 1KILB 5CCHD 1JTHA 1GL2A 3TSIA 3B5NB 2PP6A 4WY4C 3RL0C 4W7ZA 5CCHA 3HD7D
chains in the Genus database with same CATH superfamily
2CPBA 1M1JC 2V7QJ 1S2EA 2ZT9D 1EC5A 3A0HH 3L75D 3RK3E 2BCCE 2J5UA 2QEXP 3AE2C 3RBZA 4DT0A 1M56D 3L70G 1SFCB 3QWOC 2WSSH 1JOCA 4ASWA 1Q7YQ 1KQFB 2E74C 1T6AA 2BEZF 1SQQE 1U7MA 2JR8A 2QM7A 1P84E 3BCCG 3M0AA 4O9BA 4PD4D 2V7QH 1X79B 3RK2D 1NTME 3KPEA 5APXA 2QJYB 1SQPK 5GTIH 2GUSA 1NAYA 1YQ4C 2K88A 3A0BH 4PD4E 1FS0E 5GTHH 2OTJP 5APSA 1Q90D 3B5NA 3IN6A 4L76A 5AVTB 1LWUB 3SWFA 1UIXA 2CK3H 2KUBA 1SFCA 1YYCA 4JPZB 1BE3E 5AVZB 3U59A 3USSA 1URQD 5BVZA 5APYA 1K9MQ 2OYHA 2ZXXA 1R5SA 3VMAA 2FYNB 3L75G 2FXMA 2KSJA 4H44C 3TSIA 4AQRD 2QE7H 4BRYA 1AVYA 1JCCA 4H0LD 3RK3B 1OVVA 3CMAP 1NU1G 1URQC 2NPSA 1HJBA 1FDMA 1RH5B 3V2QA 5APQA 1PP9G 1YIJP 1LWUA 2A45G 3SFEC 4YXWH 4D6TJ 5AVSB 3VP9A 2AXCA 1SQXE 1FJKA 1WRGA 3JSVC 5AVWB 4D6TG 3L72D 1LP1B 3ITKA 4UB8E 3V6IA 2HODB 1SQPE 3LW5H 3CLQA 5AVVB 3H1JD 1NAFA 1RQVA 2IBZD 2J58A 2I8DA 1KMIZ 3FGAD 2E76D 3P8CE 2B87A 1NTZK 2FYNC 2R5DA 3L75J 3L71G 4H13D 2O1JA 2ZYGA 1OMIA 3N7NA 2HFED 3E1RA 1VF5D 2NPSB 1N7SC 3H1IG 3II6A 3WU2E 1S4XA 4I7ZC 1T2KD 1NTKJ 2H89C 1FZEA 2AEJA 4N3YB 1QL1A 3OW2O 1FOSE 1FE6A 1QL2A 3RL0D 4WY4D 1G1JA 1T3UA 3D6ZA 2WVRA 3L74D 2P67A 2MJZA 4U3FJ 1LTAC 4ASVA 1JMBA 1YJNP 2M8RA 3CCVP 3KZIE 2WPSA 2XZRA 1S72P 1L4AC 2QM8A 5KJ7A 3RL0g 1IK7A 2XU6A 4JYCA 1DEEG 1X0TA 1M1JA 1FC2C 1GK6A 2E75C 1NYHA 2FYUE 2O01H 2Q6QA 3AE1C 3MUDC 4GDOA 1PPJG 3H1HE 3L74E 4Y99C 3WUUA 2V4HA 3I56P 1JTHB 1KB9H 1N73C 1ZP0C 1USDA 1T3JA 3A0HE 2KK7A 3P32A 1IC2A 3B5ND 3CWBG 1LTIC 1SQBK 2P2UA 1VQOP 2GUVA 4K35A 5KAIE 1PL5A 5AVQB 1JY2O 2ZVOB 3D70A 1NJIQ 1SQBG 2N9BA 1Y8AA 2ZT9C 1LTJC 1NTMD 3AE9C 3L72J 3PP5A 3T97A 3TK1A 5B5EE 3KZIH 3O8ZA 3CCMP 1A02F 1N7SD 1KYOH 1NTZD 3AEEC 3CC4P 1IJDB 3P8CD 1CI6A 1IO4A 2KZIA 4I7ZB 1WT6A 1RY3A 4C46A 3A5TA 2OYHC 1Q82Q 2N1TD 2D2CC 3AE6C 1SQQK 1SQVE 2Y0DA 4TLFA 3W68A 3CMEP 1S3JA 3CXHI 2W83C 3EFGA 1PFIA 1SQPJ 2FKWB 3HTKA 4IL6E 4RKUJ 1NKNA 1NU1J 1ZOYC 5KLVD 4R4MA 5CCHD 1KQSO 3P7KA 3ZDMA 3CC7P 1GMJA 1GL2A 2D2CB 2KLUA 1PIXA 2B89A 2YIUB 2YNYA 1YTZT 3EFFK 4HYTB 4KT0J 2KNCA 3TGUG 4RESB 4MN4C 4K3AA 1HBWA 4Y28J 3B5NB 4WBAA 1NWQA 2PP6A 1EDIA 3A7OA 3TYYA 3PH0A 4R4LA 1ZN5A 4C7NB 3G4SP 1AFOA 1VQ4P 2MKVA 4IFFA 1MFTA 1U57A 1GW3A 1FJPA 1NTZG 4PV1B 4WVZA 3VTPC 3VMXA 1GL2B 2FBWC 3HTKB 3KYQA 1YJ9P 3L4FA 3F89A 3H1KJ 1ZR4A 5TISH 3CD6P 3P8MC 1G2CB 2OYOA 3OAKA 4LC1A 1EDLA 2YIUC 1P84D 1N86A 3GMAA 3H1LE 1FZCC 2PAJA 2I1JA 5APVA 3G3ZA 2LXCB 1S1CX 4NPEA 3LIEA 4GKGA 2JWDA 5APUA 1VQKP 1KB9D 3H1JG 4C7NA 2WSFH 5KLVK 4L75A 1NHLA 3PJSK 1BE3G 4H44D 5AW5B 2O01J 1HTLC 2FY8A 2N1TB 1L0NK 1DEBA 3FXDA 5KLVG 3HD7A 1KYOD 2RN0A 3CXHE 1E5WA 1NTKE 1L0LG 5AVXB 2R3SA 1DD4A 3H25A 1IFPA 3H1KG 2H8PD 3L74G 3HUSC 4I1LA 4L74A 1TU3F 5KAFE 3RK2B 2P10A 3KQGA 2C0XA 5APTA 2KSEA 1PP9E 1BGYJ 2WPVB 1K73Q 1FU1A 3F5HA 1KB9E 2OYIA 3CX5E 1J1EB 1ZW0A 1S5LX 3M06A 1FOSF 3M0DC 1EXJA 1UIIA 1VPCA 1Y47A 1ZRTE 1MKMA 1ZLLA 1K05A 1L0NE 1HUCA 1OW6A 1IFJA 5CCHC 5AW0B 3HD7B 3AE7C 1ZXGA 1G1IA 1IFMA 4H0LB 4WY4B 3EQ2A 2YO2A 4GOFA 1CW5A 3JC22 1J2JB 1RE4A 3GW6A 3WUVA 1M7LA 2O3JA 2G8YA 2W6AA 1RF1C 1SQBD 2IDBA 1RE4C 1BDCA 2CPSA 2OTLP 2BASA 1YI2P 3CWBD 3L72E 3U1AA 4EI2A 1KN7A 4H0LC 3L73E 1OZHA 3HE4A 3O6QA 1E79H 4H13C 1N8RQ 3AE5C 1BE3J 4WB4A 2B9BA 1Z56A 4GOEA 1FZCA 1PGOA 2FYUJ 1IZNB 2K9YA 3PRJA 3B5NC 1LT1A 1OX3A 4WY4A 4IFMA 2KS1B 4PJ0H 2IX7C 2WWWA 1SFCD 3AEDC 3BASA 4U3FD 5B66H 3C8VA 3MUDA 1HGVA 1LTTC 4AUWA 3HUSA 2B88A 3BCCE 2C9LY 3HE4B 4HB1A 5C39A 3G6EP 2E76C 5EFWB 1BGYD 2NPSC 2WZ7A 2Z5HA 1Y9BA 2ZYAA 5BU8B 1SP4A 5CJ4A 5KLIC 2AXTE 5E79E 1HH0A 2YXRB 4GIFA 3BATA 2WITA 4PV1C 2K3RA 2A45I 3SFDC 1BSNA 3H32B 3Q5SA 1GL2C 1T2KC 2QJPB 1VQ5P 1J1DB 2K9JA 3MGNA 1FZAA 3V4WA 5AVYB 3CX5D 4DJGA 3CCSP 3I55P 3S4RA 3CCJP 3U1CA 1KILD 1AQ5A 3M9QA 2OQQA 4HJGH 1NTZJ 1R8EA 1CSBA 2R32A 3AEBC 1USEA 2WMMA 4OGQB 2RH0A 1RE3C 1ZV8A 2QJPC 5CHXA 3I5CA 3HE5B 1FDOA 3MP7B 1KYOE 5CBOA 1KTMA 1W2EA 1M90Q 2WSEJ 3V5BA 1AVOA 3TGUE 3M0DA 1CZQA 1JY2N 1LTSC 1YITP 3WMM0 5B66E 3W67A 5H2FH 3FWLA 2LKMA 2RMZA 2DW3A 3PTZA 4Y99B 4WY4C 4YPCA 4EYYQ 4W7ZA 5KAFH 1OFCX 1PP9J 1HJ0A 5AW1B 2W6JH 4JBZA 3AE3C 4CPGA 2J59M 5AW8B 3NXSA 3CXHH 4IOIH 4XE5B 3PHLA 4DCKA 4JYBA 1GDTA 3TDKA 2YXQB 1PV3A 3GG2A 3L72G 3BCCD 5AW2B 1VQLP 1YHQP 2E75D 1DD3A 1PGJA 3HRNA 4PD4H 1EDJA 2OYIC 2NPSD 2LR2A 3FWNA 1AJYA 3KHUA 3Q5PA 4U3FG 1ZMEC 1X9VA 3M91A 2IFMA 5L8RJ 5KKZB 1Q86Q 4UB6H 2B87B 1QVGO 1N7SB 5H2FE 2WSCJ 5KLVE 1CI6B 2E5YA 1KORA 2OTKE 1L0LD 1PGPA 1YBKA 2JJLA 2W8ZA 3FX0A 1NTKG 2M3BA 3L73D 1LT9A 1PGQA 4OWFA 4A7PA 2WT7A 3CWBE 1HGZA 1VQ7P 1AV1A 2Z5IA 4OH8B 3H6PA 3L37A 1BE3D 2FXOA 1SQBE 3CX5H 4JF7A 2QJYC 5CCGA 1H88A 3BVHA 2OGUA 2XNXA 1IK9A 2WQYC 3GLMA 3O6QB 4I6MC 3L36A 1JNMA 1DH3A 1DX7A 2FFDC 1IFNA 2FYUK 2P7JA 1T8ZA 2WT7B 1GD2E 2KYVA 2W27A 3V2NA 1NGMB 5TJHA 2JDIH 1QVFO 2K1AA 3E1IA 1HVVA 1BCCJ 2IZ1A 3JCUH 2W90A 3QH9A 3CL3D 5CCGD 3TGUD 3L75E 3RK3D 3H1HD 1NH4A 3RL0B 3A2AA 1OW7A 3V4QA 2FYUD 1X8YA 3AE4C 3N4XA 1NU1E 2FXPA 2AXTH 3AEAC 3CXHD 2M3EA 3MTUE 1BCCE 1G2CA 3SWKA 1RE3A 2YKOA 1KILC 3CWBJ 1M1KQ 1SQVK 1H8AA 3LW5J 4D6TE 1JUNA 5B5EH 1S9KE 2QVAA 4W80A 1KILA 1L4AB 1EZVE 1NU1K 2KI7B 3IF4A 4BXLA 1JO5A 3EWKA 1JY3P 2KXPB 4PV1D 3V2RA 2ZVNB 2XDJA 4DZOA 3HD7C 3H1LD 3Q1MA 1VDFA 1N7LA 1GW4A 1SQQJ 2A06E 2N1TA 4YTPC 5AW6B 1LTGC 1JEKA 2IFNA 1SQXK 3RK3C 3L70J 5CMZA 1KD1Q 3H1HJ 1SQQG 3AE8C 2M5AB 2Y0EA 2O1KA 3OJAB 1L4AA 1OW8A 3IAOA 3C1LA 2KIKA 5KJ7C 3H1JE 2A06D 2E42A 2D2CD 1PZQA 2P58A 3UIAA 2NZ2A 2Q7CA 2Q5UA 3GF3A 1AA0A 2WSCH 2FYZA 2OARA 1U7JA 1SQXD 1URQB 4U3FE 3A0BE 4U7JA 2ZFCA 4ZMDA 1L0LE 1Q2NA 1GU5A 4N6JA 2L91A 3CCRP 3CI9A 2HG5D 2Y9YA 3FXEA 3V2PA 3Q2YA 3B4SA 3AEFC 1ZR2A 3NMDA 1BCCD 1P84I 2VRSA 1VQ8P 2QJKC 4C7RA 1H89A 1NU1D 1PPJE 1EQ7A 1GL2D 2ZAEB 5KJ7D 1H0TA 2KB7P 1FBMA 2QIWA 3MD0A 1S5LE 1KILE 1L0NJ 1SQVD 2LXBA 3AECC 3LIDA 4W7YA 4DOJA 1OWAA 3Q3DA 1GK4A 2H7HA 4QMAA 1KFNA 2QG4A 2XKMA 1Q81Q 1URQA 1WMKA 3GHGA 4JQ0D 1M8OB 1K04A 1NOHA 1NTZE 4UB6E 1FZFA 1YJWP 3M9HA 2A45H 2FFDB 1OIPA 2IBZG 3WUTA 4EOTA 1L0ND 1SQVJ 3R4YA 4NPDA 4BWNA 1D7MA 1BGYE 2K37A 2KS1A 1M1JB 1OVUA 1MUUA 2AEFA 3L71E 4EIJA 2GM4A 3VYIA 1LT9B 4GODA 3H1IE 5CBNA 3A3YB 1BDDA 1LP1A 2C9NY 1NO4A 4IL6X 4OGQC 3K5BA 3SWYA 3HD7D 1PP9D 2E74B 1XTCC 3Q5RA 1VF5C 5DJTB 1W2BO 2YMKA 2I1KA 3WU2H 1DIPA 2E76B 4OVNF 1QGKB 3VMYA 1KZUB 1QEXA 3BCCJ 3GHGC 1JM0A 2IYPA 2O01N 2QSIA 3TNUA 1LJ2A 1KFMA 4RJTA 3OA7A 1RF1A 1N73A 2BCCG 3MZWB 1VF5B 1KYOI 1JY3N 1SVFA 3H1KE 4HKZH 1NVOA 3L70E 4M3LA 1P84H 4N78E 1JY2P 2IBZI 2RKLA 5AW3B 2HYNA 2Z4EA 2R5BA 1L4AD 2A06G 2FYUG 5KTBA 4YXDC 1LTJA 4B86A 3VMZA 2PGDA 2POHA 4PJ0E 2WSEH 2IYOA 2UWJE 2IPPA 3L73J 3PLNA 5CCGC 1FZCB 4OGQD 1GZLA 2BCCJ 4L73A 2G3AA 3CCLP 1VQ9P 2WPQA 5AW4B 3S9OA 4IL6H 2Y0CA 3TNUB 3VN0A 2KLVA 3AEGC 1RF1B 1ZRTD 2YKQA 1N73B 2KNCB 1OVRA 2ITAA 5K5GB 2E43A 3D6YA 3G71P 3CC2P 1LWUC 3JCUE 1RQUA 2YMYA 1KC8Q 1EZVD 4I2LC 3L70D 1OXZA 1LNQA 1JCDA 1KQGB 2HLOA 4N78D 1S9KD 3RGUA 2KP8A 4D6TD 4LGDE 2ZJSE 1QX8A 1W5CE 1KQLA 1SS1A 2M5AA 5GTHE 2ZYDA 1KV4A 3TGUJ 3B71A 2N1TC 1LT9C 3H32A 2KZJA 3KXDA 1GTWA 1SFCC 1X22A 2YO3A 3CPWO 3G9RA 1VL2A 1SQXJ 2XNDH 2ZT9B 3ABVC 3BRVB 1SLQA 4XFJA 1SQPG 3RK2C 3VP8A 4ZKPA 1VQ6P 1L0LK 2N9YB 2K9JB 3H1ID 4HH2A 4ZNCA 4IFDK 3B8EB 1M57D 4BRYB 4GT1A 5KAIH 1L0NG 3GF7A 3S1KA 4Z1MH 2XV5A 3L71D 2C0WA 2AEMA 2OYHB 2JWAA 2W6BA 1MV8A 1EXIA 3HE5A 3D71A 4PD4I 1LGHB 2R44A 3H1JJ 3TF5A 1L2PA 2Y9ZA 1J1DC 1NTMG 1SQQD 3L74J 3BRTB 2Q3EA 3H1LJ 2KOGA 3L35A 1GU4A 4KHXA 4EDFA 2QJKB 1JMMA 2HPCA 2JP3A 4RO0A 2HODA 1IFDA 1H0TB 1XTGB 2BCCD 2Q1KA 3H1LG 3CCQP 1J1EC 1FZGA 4XA4A 1NTMJ 4KJMA 5AVRB 3KDPB 2R3CA 3VOPA 1PPJD 2E74D 2HR3A 3CX5I 2FFDA 1BSHA 1IFIA 3GHGB 5CJ0A 3NFQA 5AW7B 2WTYA 2E5TA 1RF0A 1FDIA 4H13B 5TISE 4AYCA 1YQ3C 3H1HG 1VQNP 1MZ9A 1JY3O 1RF0C 1MFZA 1HF9A 5APWA 1NTKK 3RBXA 5KKZC 3IFMA 2HPCB 2PRRA 4UB8H 2H88C 2IZ0A 1SQXG 2JKVA 5AW9B 5BU5A 1EZVI 3M9BA 4TT3H 1FZBA 4ZKUA 2BEQD 3E7KA 5AVUB 2Q9IA 1S5LH 3IR9A 2JEEA 1VQPP 1K8AQ 1N2DC 1N7SA 2SPZA 3R2PA 2QRXA 3C9IA 3H1IJ 1LTBC 3NTNA 3MHVA 2WSFJ 2JO1A 1QLED 2IBZE 1HWTC 3L71J 5KLIB 2YKPA 5M1BA 1SQVG 1SQPD 1KILB 1YTZI 2PFXA 2Q3IA 2QA4P 1JTHA 1BGYG 1A02J 3CCUP 2OYIB 4WWIA 1JB0J 2WPRA 3SSUA 1EDKA 1AQTA 4NPFX 2GA1A 1LTJB 2M0BA 1KB9I 2P1JA 3H1KD 3HUSB 1SQBJ 2E75B 4H44B 1BCCG 5E79H 1R5LA 1L0LJ 2H43A 2ZXEB 3T97B 5GTIE 2L5GB 1FAVA 2NRGA 1NKZB 1RHZB 3RL0C 1NTKD 3L73G 4LLHA 3CCEP 5DJUB 5CCHA 5KLVJ 1EZVG 1VQMP 1NTMK 3MIWA
chains in the Genus database with same CATH topology
2CPBA 1M1JC 1HWTC 1SFCB 1JOCA 2QM7A 3M0AA 4O9BA 1X79B 3RK2D 3KPEA 5APXA 1SQPK 2GUSA 5APSA 3B5NA 5AVTB 3SWFA 1LWUB 3U59A 5AVZB 1SFCA 1YYCA 1URQD 5BVZA 5APYA 2OYHA 4AQRD 2FXMA 2KSJA 1JCCA 3RK3B 1URQC 1FDMA 2NPSA 3V2QA 5APQA 1LWUA 2A45G 5AVSB 3VP9A 1FJKA 1WRGA 5AVWB 2HODB 3LW5H 3CLQA 5AVVB 1NAFA 2J58A 3P8CE 2R5DA 1NTZK 2O1JA 3N7NA 2HFED 2NPSB 1N7SC 3II6A 1T2KD 1FOSE 1FZEA 4N3YB 1QL1A 1QL2A 3RL0D 4WY4D 1G1JA 1T3UA 2P67A 2MJZA 1LTAC 2M8RA 2WPSA 2XZRA 1L4AC 2QM8A 5KJ7A 2XU6A 4JYCA 1M1JA 1GK6A 2O01H 4Y99C 1JTHB 1N73C 1T3JA 3P32A 1IC2A 3B5ND 1LTIC 1SQBK 2P2UA 2GUVA 5AVQB 1JY2O 2N9BA 3TK1A 1LTJC 3PP5A 3T97A 1A02F 3O8ZA 1N7SD 1IJDB 3P8CD 1CI6A 1IO4A 1WT6A 1RY3A 4C46A 3A5TA 2OYHC 2N1TD 1SQQK 3EFGA 1PFIA 2FKWB 3HTKA 1NKNA 5CCHD 3P7KA 1GL2A 2YNYA 3TSIA 4HYTB 1YTZT 1HBWA 4RESB 3B5NB 4WBAA 1NWQA 2PP6A 3A7OA 3TYYA 1ZN5A 4C7NB 1AFOA 4IFFA 1GW3A 1FJPA 3VTPC 3VMXA 1GL2B 3HTKB 3KYQA 3L4FA 1ZR4A 3P8MC 1G2CB 3OAKA 4LC1A 1N86A 1FZCC 2PAJA 2I1JA 5APVA 3G3ZA 3LIEA 4GKGA 5APUA 4C7NA 2WSFH 5KLVK 1NHLA 5AW5B 1HTLC 2N1TB 1L0NK 1DEBA 3HD7A 1E5WA 5AVXB 2H43A 4I1LA 2H8PD 3RK2B 3HUSC 3KQGA 5APTA 2C0XA 1FU1A 2OYIA 1J1EB 3M06A 1FOSF 3M0DC 1VPCA 1ZLLA 1HUCA 5CCHC 1IFJA 5AW0B 3HD7B 1G1IA 1IFMA 4WY4B 3EQ2A 2YO2A 1CW5A 1J2JB 1RE4A 1M7LA 2W6AA 1RF1C 1RE4C 2CPSA 2BASA 3U1AA 3HE4A 4WB4A 1Z56A 1FZCA 3B5NC 4WY4A 4IFMA 2IX7C 2WWWA 1SFCD 3BASA 3MUDA 1HGVA 1LTTC 4AUWA 3HUSA 2C9LY 3HE4B 2NPSC 2WZ7A 2Z5HA 5BU8B 1SP4A 5CJ4A 1HH0A 4GIFA 3BATA 2WITA 1T2KC 2A45I 3H32B 1GL2C 1J1DB 3MGNA 1FZAA 3V4WA 5AVYB 3U1CA 1KILD 3M9QA 1CSBA 2R32A 1RE3C 1ZV8A 5CHXA 3I5CA 3HE5B 1W2EA 3V5BA 3M0DA 1CZQA 1JY2N 1LTSC 3WMM0 4Y99B 2LKMA 4WY4C 4W7ZA 5AW1B 1AQ5A 2J59M 5AW8B 3NXSA 4XE5B 4JYBA 1GDTA 5AW2B 3HRNA 2OYIC 2NPSD 1X9VA 3M91A 2IFMA 1N7SB 1CI6B 2JJLA 2M3BA 1LT9A 2WT7A 1HGZA 2Z5IA 4OH8B 3H6PA 3L37A 4JF7A 5CCGA 1H88A 3BVHA 2XNXA 1IK9A 4I6MC 3L36A 1JNMA 1DH3A 1DX7A 2FFDC 1IFNA 2FYUK 2P7JA 1T8ZA 2WT7B 1GD2E 2KYVA 2W27A 3V2NA 3E1IA 1HVVA 5CCGD 3CL3D 3RK3D 1NH4A 3RL0B 3A2AA 3V4QA 1X8YA 3N4XA 3MTUE 1G2CA 1RE3A 2YKOA 1KILC 1H8AA 1SQVK 1JUNA 1S9KE 4W80A 1KILA 1L4AB 1NU1K 1JO5A 1JY3P 3V2RA 4DZOA 2XDJA 3HD7C 1VDFA 1N7LA 1GW4A 2N1TA 5AW6B 1LTGC 3RK3C 2IFNA 1SQXK 5CMZA 2O1KA 3OJAB 1L4AA 5KJ7C 2E42A 3UIAA 2Q7CA 2Q5UA 2WSCH 2FYZA 2OARA 1URQB 1GU5A 2ZFCA 4N6JA 3CI9A 2HG5D 3V2PA 1ZR2A 3NMDA 2VRSA 4C7RA 1H89A 1EQ7A 1GL2D 5KJ7D 2KB7P 1FBMA 3MD0A 3LIDA 4W7YA 4DOJA 1OWAA 1GK4A 2H7HA 1KFNA 2XKMA 1URQA 3GHGA 1FZFA 1NOHA 2FFDB 3M9HA 2A45H 4EOTA 1M1JB 4EIJA 1MUUA 2GM4A 3VYIA 1LT9B 3A3YB 2C9NY 1NO4A 3SWYA 3HD7D 1XTCC 2I1KA 1KZUB 1HJBA 3GHGC 3TNUA 1RF1A 1KFMA 3OA7A 1N73A 1SVFA 1JY3N 4M3LA 4N78E 5AW3B 1JY2P 2Z4EA 2HYNA 2R5BA 1L4AD 5KTBA 1LTJA 4B86A 3VMZA 2POHA 2WSEH 5CCGC 2IPPA 1FZCB 1GZLA 2WPQA 5AW4B 3TNUB 3VN0A 1RF1B 2KLVA 1N73B 2YKQA 2E43A 1LWUC 2YMYA 4I2LC 4N78D 1OXZA 1JCDA 1S9KD 2HLOA 2KP8A 4LGDE 1KQLA 2N1TC 1LT9C 3H32A 1GTWA 1SFCC 2YO3A 3BRVB 1SLQA 3RK2C 3VP8A 4ZKPA 1L0LK 4IFDK 4HH2A 3B8EB 4GT1A 2XV5A 2C0WA 2OYHB 2W6BA 1MV8A 3HE5A 1LGHB 1J1DC 3BRTB 2KOGA 3L35A 1GU4A 4KHXA 2HPCA 1JMMA 2HODA 1IFDA 1XTGB 1FZGA 1J1EC 4XA4A 5AVRB 3KDPB 2R3CA 3VOPA 2FFDA 1IFIA 3GHGB 5CJ0A 3NFQA 5AW7B 2WTYA 1RF0A 4AYCA 1MZ9A 1JY3O 1RF0C 1MFZA 5APWA 1NTKK 3IFMA 2HPCB 5AW9B 5BU5A 3M9BA 1FZBA 4ZKUA 5AVUB 2Q9IA 3IR9A 2JEEA 1N2DC 1N7SA 3R2PA 3C9IA 1LTBC 3NTNA 2YKPA 1YTZI 1KILB 2Q3IA 1JTHA 1A02J 2OYIB 2WPRA 1LTJB 3HUSB 2P1JA 3VMYA 2ZXEB 2L5GB 1FAVA 1NKZB 3RL0C 4LLHA 5CCHA 1NTMK 3MIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GL2 B;  3HTK B;  3KYQ A;  1SFC B;  2NPS D;  4N78 E;  3RK2 D;  1L4A D;  1N7S B;  1NHL A;  3B5N A;  5CCG C;  2N1T B;  3HD7 A;  1SFC A;  4OH8 B;  1URQ D;  5CCG A;  4JF7 A;  2H8P D;  3RK2 B;  3RK3 B;  2YMY A;  1URQ C;  2NPS A;  3M0D C;  4LGD E;  5CCH C;  1HVV A;  5CCG D;  3HD7 B;  2N1T C;  3RK3 D;  4WY4 B;  3RL0 B;  1SFC C;  3P8C E;  3RK2 C;  2HFE D;  2NPS B;  1N7S C;  1KIL C;  4W80 A;  1KIL A;  1L4A B;  3RL0 D;  4WY4 D;  3B5N C;  2XDJ A;  3HD7 C;  4WY4 A;  2N1T A;  2M8R A;  1SFC D;  2KOG A;  3RK3 C;  1L4A C;  5KJ7 A;  1XTG B;  1L4A A;  5KJ7 C;  3VOP A;  2NPS C;  2WZ7 A;  1JTH B;  1T3J A;  1URQ B;  3B5N D;  1GL2 C;  2HG5 D;  3PP5 A;  1N7S D;  1KIL D;  1GL2 D;  5KJ7 D;  1N7S A;  2N1T D;  4W7Y A;  1URQ A;  1KIL B;  5CCH D;  1JTH A;  1GL2 A;  3TSI A;  3B5N B;  2PP6 A;  4WY4 C;  3RL0 C;  4W7Z A;  5CCH A;  3HD7 D; 
#chains in the Genus database with same CATH topology
 2CPB A;  1M1J C;  2V7Q J;  1S2E A;  2ZT9 D;  1EC5 A;  3A0H H;  3L75 D;  3RK3 E;  2BCC E;  2J5U A;  2QEX P;  3AE2 C;  3RBZ A;  4DT0 A;  1M56 D;  3L70 G;  1SFC B;  3QWO C;  2WSS H;  1JOC A;  4ASW A;  1Q7Y Q;  1KQF B;  2E74 C;  1T6A A;  2BEZ F;  1SQQ E;  1U7M A;  2JR8 A;  2QM7 A;  1P84 E;  3BCC G;  3M0A A;  4O9B A;  4PD4 D;  2V7Q H;  1X79 B;  3RK2 D;  1NTM E;  3KPE A;  5APX A;  2QJY B;  1SQP K;  5GTI H;  2GUS A;  1NAY A;  1YQ4 C;  2K88 A;  3A0B H;  4PD4 E;  1FS0 E;  5GTH H;  2OTJ P;  5APS A;  1Q90 D;  3B5N A;  3IN6 A;  4L76 A;  5AVT B;  1LWU B;  3SWF A;  1UIX A;  2CK3 H;  2KUB A;  1SFC A;  1YYC A;  4JPZ B;  1BE3 E;  5AVZ B;  3U59 A;  3USS A;  1URQ D;  5BVZ A;  5APY A;  1K9M Q;  2OYH A;  2ZXX A;  1R5S A;  3VMA A;  2FYN B;  3L75 G;  2FXM A;  2KSJ A;  4H44 C;  3TSI A;  4AQR D;  2QE7 H;  4BRY A;  1AVY A;  1JCC A;  4H0L D;  3RK3 B;  1OVV A;  3CMA P;  1NU1 G;  1URQ C;  2NPS A;  1HJB A;  1FDM A;  1RH5 B;  3V2Q A;  5APQ A;  1PP9 G;  1YIJ P;  1LWU A;  2A45 G;  3SFE C;  4YXW H;  4D6T J;  5AVS B;  3VP9 A;  2AXC A;  1SQX E;  1FJK A;  1WRG A;  3JSV C;  5AVW B;  4D6T G;  3L72 D;  1LP1 B;  3ITK A;  4UB8 E;  3V6I A;  2HOD B;  1SQP E;  3LW5 H;  3CLQ A;  5AVV B;  3H1J D;  1NAF A;  1RQV A;  2IBZ D;  2J58 A;  2I8D A;  1KMI Z;  3FGA D;  2E76 D;  3P8C E;  2B87 A;  1NTZ K;  2FYN C;  2R5D A;  3L75 J;  3L71 G;  4H13 D;  2O1J A;  2ZYG A;  1OMI A;  3N7N A;  2HFE D;  3E1R A;  1VF5 D;  2NPS B;  1N7S C;  3H1I G;  3II6 A;  3WU2 E;  1S4X A;  4I7Z C;  1T2K D;  1NTK J;  2H89 C;  1FZE A;  2AEJ A;  4N3Y B;  1QL1 A;  3OW2 O;  1FOS E;  1FE6 A;  1QL2 A;  3RL0 D;  4WY4 D;  1G1J A;  1T3U A;  3D6Z A;  2WVR A;  3L74 D;  2P67 A;  2MJZ A;  4U3F J;  1LTA C;  4ASV A;  1JMB A;  1YJN P;  2M8R A;  3CCV P;  3KZI E;  2WPS A;  2XZR A;  1S72 P;  1L4A C;  2QM8 A;  5KJ7 A;  3RL0 g;  1IK7 A;  2XU6 A;  4JYC A;  1DEE G;  1X0T A;  1M1J A;  1FC2 C;  1GK6 A;  2E75 C;  1NYH A;  2FYU E;  2O01 H;  2Q6Q A;  3AE1 C;  3MUD C;  4GDO A;  1PPJ G;  3H1H E;  3L74 E;  4Y99 C;  3WUU A;  2V4H A;  3I56 P;  1JTH B;  1KB9 H;  1N73 C;  1ZP0 C;  1USD A;  1T3J A;  3A0H E;  2KK7 A;  3P32 A;  1IC2 A;  3B5N D;  3CWB G;  1LTI C;  1SQB K;  2P2U A;  1VQO P;  2GUV A;  4K35 A;  5KAI E;  1PL5 A;  5AVQ B;  1JY2 O;  2ZVO B;  3D70 A;  1NJI Q;  1SQB G;  2N9B A;  1Y8A A;  2ZT9 C;  1LTJ C;  1NTM D;  3AE9 C;  3L72 J;  3PP5 A;  3T97 A;  3TK1 A;  5B5E E;  3KZI H;  3O8Z A;  3CCM P;  1A02 F;  1N7S D;  1KYO H;  1NTZ D;  3AEE C;  3CC4 P;  1IJD B;  3P8C D;  1CI6 A;  1IO4 A;  2KZI A;  4I7Z B;  1WT6 A;  1RY3 A;  4C46 A;  3A5T A;  2OYH C;  1Q82 Q;  2N1T D;  2D2C C;  3AE6 C;  1SQQ K;  1SQV E;  2Y0D A;  4TLF A;  3W68 A;  3CME P;  1S3J A;  3CXH I;  2W83 C;  3EFG A;  1PFI A;  1SQP J;  2FKW B;  3HTK A;  4IL6 E;  4RKU J;  1NKN A;  1NU1 J;  1ZOY C;  5KLV D;  4R4M A;  5CCH D;  1KQS O;  3P7K A;  3ZDM A;  3CC7 P;  1GMJ A;  1GL2 A;  2D2C B;  2KLU A;  1PIX A;  2B89 A;  2YIU B;  2YNY A;  1YTZ T;  3EFF K;  4HYT B;  4KT0 J;  2KNC A;  3TGU G;  4RES B;  4MN4 C;  4K3A A;  1HBW A;  4Y28 J;  3B5N B;  4WBA A;  1NWQ A;  2PP6 A;  1EDI A;  3A7O A;  3TYY A;  3PH0 A;  4R4L A;  1ZN5 A;  4C7N B;  3G4S P;  1AFO A;  1VQ4 P;  2MKV A;  4IFF A;  1MFT A;  1U57 A;  1GW3 A;  1FJP A;  1NTZ G;  4PV1 B;  4WVZ A;  3VTP C;  3VMX A;  1GL2 B;  2FBW C;  3HTK B;  3KYQ A;  1YJ9 P;  3L4F A;  3F89 A;  3H1K J;  1ZR4 A;  5TIS H;  3CD6 P;  3P8M C;  1G2C B;  2OYO A;  3OAK A;  4LC1 A;  1EDL A;  2YIU C;  1P84 D;  1N86 A;  3GMA A;  3H1L E;  1FZC C;  2PAJ A;  2I1J A;  5APV A;  3G3Z A;  2LXC B;  1S1C X;  4NPE A;  3LIE A;  4GKG A;  2JWD A;  5APU A;  1VQK P;  1KB9 D;  3H1J G;  4C7N A;  2WSF H;  5KLV K;  4L75 A;  1NHL A;  3PJS K;  1BE3 G;  4H44 D;  5AW5 B;  2O01 J;  1HTL C;  2FY8 A;  2N1T B;  1L0N K;  1DEB A;  3FXD A;  5KLV G;  3HD7 A;  1KYO D;  2RN0 A;  3CXH E;  1E5W A;  1NTK E;  1L0L G;  5AVX B;  2R3S A;  1DD4 A;  3H25 A;  1IFP A;  3H1K G;  2H8P D;  3L74 G;  3HUS C;  4I1L A;  4L74 A;  1TU3 F;  5KAF E;  3RK2 B;  2P10 A;  3KQG A;  2C0X A;  5APT A;  2KSE A;  1PP9 E;  1BGY J;  2WPV B;  1K73 Q;  1FU1 A;  3F5H A;  1KB9 E;  2OYI A;  3CX5 E;  1J1E B;  1ZW0 A;  1S5L X;  3M06 A;  1FOS F;  3M0D C;  1EXJ A;  1UII A;  1VPC A;  1Y47 A;  1ZRT E;  1MKM A;  1ZLL A;  1K05 A;  1L0N E;  1HUC A;  1OW6 A;  1IFJ A;  5CCH C;  5AW0 B;  3HD7 B;  3AE7 C;  1ZXG A;  1G1I A;  1IFM A;  4H0L B;  4WY4 B;  3EQ2 A;  2YO2 A;  4GOF A;  1CW5 A;  3JC2 2;  1J2J B;  1RE4 A;  3GW6 A;  3WUV A;  1M7L A;  2O3J A;  2G8Y A;  2W6A A;  1RF1 C;  1SQB D;  2IDB A;  1RE4 C;  1BDC A;  2CPS A;  2OTL P;  2BAS A;  1YI2 P;  3CWB D;  3L72 E;  3U1A A;  4EI2 A;  1KN7 A;  4H0L C;  3L73 E;  1OZH A;  3HE4 A;  3O6Q A;  1E79 H;  4H13 C;  1N8R Q;  3AE5 C;  1BE3 J;  4WB4 A;  2B9B A;  1Z56 A;  4GOE A;  1FZC A;  1PGO A;  2FYU J;  1IZN B;  2K9Y A;  3PRJ A;  3B5N C;  1LT1 A;  1OX3 A;  4WY4 A;  4IFM A;  2KS1 B;  4PJ0 H;  2IX7 C;  2WWW A;  1SFC D;  3AED C;  3BAS A;  4U3F D;  5B66 H;  3C8V A;  3MUD A;  1HGV A;  1LTT C;  4AUW A;  3HUS A;  2B88 A;  3BCC E;  2C9L Y;  3HE4 B;  4HB1 A;  5C39 A;  3G6E P;  2E76 C;  5EFW B;  1BGY D;  2NPS C;  2WZ7 A;  2Z5H A;  1Y9B A;  2ZYA A;  5BU8 B;  1SP4 A;  5CJ4 A;  5KLI C;  2AXT E;  5E79 E;  1HH0 A;  2YXR B;  4GIF A;  3BAT A;  2WIT A;  4PV1 C;  2K3R A;  2A45 I;  3SFD C;  1BSN A;  3H32 B;  3Q5S A;  1GL2 C;  1T2K C;  2QJP B;  1VQ5 P;  1J1D B;  2K9J A;  3MGN A;  1FZA A;  3V4W A;  5AVY B;  3CX5 D;  4DJG A;  3CCS P;  3I55 P;  3S4R A;  3CCJ P;  3U1C A;  1KIL D;  1AQ5 A;  3M9Q A;  2OQQ A;  4HJG H;  1NTZ J;  1R8E A;  1CSB A;  2R32 A;  3AEB C;  1USE A;  2WMM A;  4OGQ B;  2RH0 A;  1RE3 C;  1ZV8 A;  2QJP C;  5CHX A;  3I5C A;  3HE5 B;  1FDO A;  3MP7 B;  1KYO E;  5CBO A;  1KTM A;  1W2E A;  1M90 Q;  2WSE J;  3V5B A;  1AVO A;  3TGU E;  3M0D A;  1CZQ A;  1JY2 N;  1LTS C;  1YIT P;  3WMM 0;  5B66 E;  3W67 A;  5H2F H;  3FWL A;  2LKM A;  2RMZ A;  2DW3 A;  3PTZ A;  4Y99 B;  4WY4 C;  4YPC A;  4EYY Q;  4W7Z A;  5KAF H;  1OFC X;  1PP9 J;  1HJ0 A;  5AW1 B;  2W6J H;  4JBZ A;  3AE3 C;  4CPG A;  2J59 M;  5AW8 B;  3NXS A;  3CXH H;  4IOI H;  4XE5 B;  3PHL A;  4DCK A;  4JYB A;  1GDT A;  3TDK A;  2YXQ B;  1PV3 A;  3GG2 A;  3L72 G;  3BCC D;  5AW2 B;  1VQL P;  1YHQ P;  2E75 D;  1DD3 A;  1PGJ A;  3HRN A;  4PD4 H;  1EDJ A;  2OYI C;  2NPS D;  2LR2 A;  3FWN A;  1AJY A;  3KHU A;  3Q5P A;  4U3F G;  1ZME C;  1X9V A;  3M91 A;  2IFM A;  5L8R J;  5KKZ B;  1Q86 Q;  4UB6 H;  2B87 B;  1QVG O;  1N7S B;  5H2F E;  2WSC J;  5KLV E;  1CI6 B;  2E5Y A;  1KOR A;  2OTK E;  1L0L D;  1PGP A;  1YBK A;  2JJL A;  2W8Z A;  3FX0 A;  1NTK G;  2M3B A;  3L73 D;  1LT9 A;  1PGQ A;  4OWF A;  4A7P A;  2WT7 A;  3CWB E;  1HGZ A;  1VQ7 P;  1AV1 A;  2Z5I A;  4OH8 B;  3H6P A;  3L37 A;  1BE3 D;  2FXO A;  1SQB E;  3CX5 H;  4JF7 A;  2QJY C;  5CCG A;  1H88 A;  3BVH A;  2OGU A;  2XNX A;  1IK9 A;  2WQY C;  3GLM A;  3O6Q B;  4I6M C;  3L36 A;  1JNM A;  1DH3 A;  1DX7 A;  2FFD C;  1IFN A;  2FYU K;  2P7J A;  1T8Z A;  2WT7 B;  1GD2 E;  2KYV A;  2W27 A;  3V2N A;  1NGM B;  5TJH A;  2JDI H;  1QVF O;  2K1A A;  3E1I A;  1HVV A;  1BCC J;  2IZ1 A;  3JCU H;  2W90 A;  3QH9 A;  3CL3 D;  5CCG D;  3TGU D;  3L75 E;  3RK3 D;  3H1H D;  1NH4 A;  3RL0 B;  3A2A A;  1OW7 A;  3V4Q A;  2FYU D;  1X8Y A;  3AE4 C;  3N4X A;  1NU1 E;  2FXP A;  2AXT H;  3AEA C;  3CXH D;  2M3E A;  3MTU E;  1BCC E;  1G2C A;  3SWK A;  1RE3 A;  2YKO A;  1KIL C;  3CWB J;  1M1K Q;  1SQV K;  1H8A A;  3LW5 J;  4D6T E;  1JUN A;  5B5E H;  1S9K E;  2QVA A;  4W80 A;  1KIL A;  1L4A B;  1EZV E;  1NU1 K;  2KI7 B;  3IF4 A;  4BXL A;  1JO5 A;  3EWK A;  1JY3 P;  2KXP B;  4PV1 D;  3V2R A;  2ZVN B;  2XDJ A;  4DZO A;  3HD7 C;  3H1L D;  3Q1M A;  1VDF A;  1N7L A;  1GW4 A;  1SQQ J;  2A06 E;  2N1T A;  4YTP C;  5AW6 B;  1LTG C;  1JEK A;  2IFN A;  1SQX K;  3RK3 C;  3L70 J;  5CMZ A;  1KD1 Q;  3H1H J;  1SQQ G;  3AE8 C;  2M5A B;  2Y0E A;  2O1K A;  3OJA B;  1L4A A;  1OW8 A;  3IAO A;  3C1L A;  2KIK A;  5KJ7 C;  3H1J E;  2A06 D;  2E42 A;  2D2C D;  1PZQ A;  2P58 A;  3UIA A;  2NZ2 A;  2Q7C A;  2Q5U A;  3GF3 A;  1AA0 A;  2WSC H;  2FYZ A;  2OAR A;  1U7J A;  1SQX D;  1URQ B;  4U3F E;  3A0B E;  4U7J A;  2ZFC A;  4ZMD A;  1L0L E;  1Q2N A;  1GU5 A;  4N6J A;  2L91 A;  3CCR P;  3CI9 A;  2HG5 D;  2Y9Y A;  3FXE A;  3V2P A;  3Q2Y A;  3B4S A;  3AEF C;  1ZR2 A;  3NMD A;  1BCC D;  1P84 I;  2VRS A;  1VQ8 P;  2QJK C;  4C7R A;  1H89 A;  1NU1 D;  1PPJ E;  1EQ7 A;  1GL2 D;  2ZAE B;  5KJ7 D;  1H0T A;  2KB7 P;  1FBM A;  2QIW A;  3MD0 A;  1S5L E;  1KIL E;  1L0N J;  1SQV D;  2LXB A;  3AEC C;  3LID A;  4W7Y A;  4DOJ A;  1OWA A;  3Q3D A;  1GK4 A;  2H7H A;  4QMA A;  1KFN A;  2QG4 A;  2XKM A;  1Q81 Q;  1URQ A;  1WMK A;  3GHG A;  4JQ0 D;  1M8O B;  1K04 A;  1NOH A;  1NTZ E;  4UB6 E;  1FZF A;  1YJW P;  3M9H A;  2A45 H;  2FFD B;  1OIP A;  2IBZ G;  3WUT A;  4EOT A;  1L0N D;  1SQV J;  3R4Y A;  4NPD A;  4BWN A;  1D7M A;  1BGY E;  2K37 A;  2KS1 A;  1M1J B;  1OVU A;  1MUU A;  2AEF A;  3L71 E;  4EIJ A;  2GM4 A;  3VYI A;  1LT9 B;  4GOD A;  3H1I E;  5CBN A;  3A3Y B;  1BDD A;  1LP1 A;  2C9N Y;  1NO4 A;  4IL6 X;  4OGQ C;  3K5B A;  3SWY A;  3HD7 D;  1PP9 D;  2E74 B;  1XTC C;  3Q5R A;  1VF5 C;  5DJT B;  1W2B O;  2YMK A;  2I1K A;  3WU2 H;  1DIP A;  2E76 B;  4OVN F;  1QGK B;  3VMY A;  1KZU B;  1QEX A;  3BCC J;  3GHG C;  1JM0 A;  2IYP A;  2O01 N;  2QSI A;  3TNU A;  1LJ2 A;  1KFM A;  4RJT A;  3OA7 A;  1RF1 A;  1N73 A;  2BCC G;  3MZW B;  1VF5 B;  1KYO I;  1JY3 N;  1SVF A;  3H1K E;  4HKZ H;  1NVO A;  3L70 E;  4M3L A;  1P84 H;  4N78 E;  1JY2 P;  2IBZ I;  2RKL A;  5AW3 B;  2HYN A;  2Z4E A;  2R5B A;  1L4A D;  2A06 G;  2FYU G;  5KTB A;  4YXD C;  1LTJ A;  4B86 A;  3VMZ A;  2PGD A;  2POH A;  4PJ0 E;  2WSE H;  2IYO A;  2UWJ E;  2IPP A;  3L73 J;  3PLN A;  5CCG C;  1FZC B;  4OGQ D;  1GZL A;  2BCC J;  4L73 A;  2G3A A;  3CCL P;  1VQ9 P;  2WPQ A;  5AW4 B;  3S9O A;  4IL6 H;  2Y0C A;  3TNU B;  3VN0 A;  2KLV A;  3AEG C;  1RF1 B;  1ZRT D;  2YKQ A;  1N73 B;  2KNC B;  1OVR A;  2ITA A;  5K5G B;  2E43 A;  3D6Y A;  3G71 P;  3CC2 P;  1LWU C;  3JCU E;  1RQU A;  2YMY A;  1KC8 Q;  1EZV D;  4I2L C;  3L70 D;  1OXZ A;  1LNQ A;  1JCD A;  1KQG B;  2HLO A;  4N78 D;  1S9K D;  3RGU A;  2KP8 A;  4D6T D;  4LGD E;  2ZJS E;  1QX8 A;  1W5C E;  1KQL A;  1SS1 A;  2M5A A;  5GTH E;  2ZYD A;  1KV4 A;  3TGU J;  3B71 A;  2N1T C;  1LT9 C;  3H32 A;  2KZJ A;  3KXD A;  1GTW A;  1SFC C;  1X22 A;  2YO3 A;  3CPW O;  3G9R A;  1VL2 A;  1SQX J;  2XND H;  2ZT9 B;  3ABV C;  3BRV B;  1SLQ A;  4XFJ A;  1SQP G;  3RK2 C;  3VP8 A;  4ZKP A;  1VQ6 P;  1L0L K;  2N9Y B;  2K9J B;  3H1I D;  4HH2 A;  4ZNC A;  4IFD K;  3B8E B;  1M57 D;  4BRY B;  4GT1 A;  5KAI H;  1L0N G;  3GF7 A;  3S1K A;  4Z1M H;  2XV5 A;  3L71 D;  2C0W A;  2AEM A;  2OYH B;  2JWA A;  2W6B A;  1MV8 A;  1EXI A;  3HE5 A;  3D71 A;  4PD4 I;  1LGH B;  2R44 A;  3H1J J;  3TF5 A;  1L2P A;  2Y9Z A;  1J1D C;  1NTM G;  1SQQ D;  3L74 J;  3BRT B;  2Q3E A;  3H1L J;  2KOG A;  3L35 A;  1GU4 A;  4KHX A;  4EDF A;  2QJK B;  1JMM A;  2HPC A;  2JP3 A;  4RO0 A;  2HOD A;  1IFD A;  1H0T B;  1XTG B;  2BCC D;  2Q1K A;  3H1L G;  3CCQ P;  1J1E C;  1FZG A;  4XA4 A;  1NTM J;  4KJM A;  5AVR B;  3KDP B;  2R3C A;  3VOP A;  1PPJ D;  2E74 D;  2HR3 A;  3CX5 I;  2FFD A;  1BSH A;  1IFI A;  3GHG B;  5CJ0 A;  3NFQ A;  5AW7 B;  2WTY A;  2E5T A;  1RF0 A;  1FDI A;  4H13 B;  5TIS E;  4AYC A;  1YQ3 C;  3H1H G;  1VQN P;  1MZ9 A;  1JY3 O;  1RF0 C;  1MFZ A;  1HF9 A;  5APW A;  1NTK K;  3RBX A;  5KKZ C;  3IFM A;  2HPC B;  2PRR A;  4UB8 H;  2H88 C;  2IZ0 A;  1SQX G;  2JKV A;  5AW9 B;  5BU5 A;  1EZV I;  3M9B A;  4TT3 H;  1FZB A;  4ZKU A;  2BEQ D;  3E7K A;  5AVU B;  2Q9I A;  1S5L H;  3IR9 A;  2JEE A;  1VQP P;  1K8A Q;  1N2D C;  1N7S A;  2SPZ A;  3R2P A;  2QRX A;  3C9I A;  3H1I J;  1LTB C;  3NTN A;  3MHV A;  2WSF J;  2JO1 A;  1QLE D;  2IBZ E;  1HWT C;  3L71 J;  5KLI B;  2YKP A;  5M1B A;  1SQV G;  1SQP D;  1KIL B;  1YTZ I;  2PFX A;  2Q3I A;  2QA4 P;  1JTH A;  1BGY G;  1A02 J;  3CCU P;  2OYI B;  4WWI A;  1JB0 J;  2WPR A;  3SSU A;  1EDK A;  1AQT A;  4NPF X;  2GA1 A;  1LTJ B;  2M0B A;  1KB9 I;  2P1J A;  3H1K D;  3HUS B;  1SQB J;  2E75 B;  4H44 B;  1BCC G;  5E79 H;  1R5L A;  1L0L J;  2H43 A;  2ZXE B;  3T97 B;  5GTI E;  2L5G B;  1FAV A;  2NRG A;  1NKZ B;  1RHZ B;  3RL0 C;  1NTK D;  3L73 G;  4LLH A;  3CCE P;  5DJU B;  5CCH A;  5KLV J;  1EZV G;  1VQM P;  1NTM K;  3MIW A; 
#chains in the Genus database with same CATH homology
 2CPB A;  1M1J C;  1HWT C;  1SFC B;  1JOC A;  2QM7 A;  3M0A A;  4O9B A;  1X79 B;  3RK2 D;  3KPE A;  5APX A;  1SQP K;  2GUS A;  5APS A;  3B5N A;  5AVT B;  3SWF A;  1LWU B;  3U59 A;  5AVZ B;  1SFC A;  1YYC A;  1URQ D;  5BVZ A;  5APY A;  2OYH A;  4AQR D;  2FXM A;  2KSJ A;  1JCC A;  3RK3 B;  1URQ C;  1FDM A;  2NPS A;  3V2Q A;  5APQ A;  1LWU A;  2A45 G;  5AVS B;  3VP9 A;  1FJK A;  1WRG A;  5AVW B;  2HOD B;  3LW5 H;  3CLQ A;  5AVV B;  1NAF A;  2J58 A;  3P8C E;  2R5D A;  1NTZ K;  2O1J A;  3N7N A;  2HFE D;  2NPS B;  1N7S C;  3II6 A;  1T2K D;  1FOS E;  1FZE A;  4N3Y B;  1QL1 A;  1QL2 A;  3RL0 D;  4WY4 D;  1G1J A;  1T3U A;  2P67 A;  2MJZ A;  1LTA C;  2M8R A;  2WPS A;  2XZR A;  1L4A C;  2QM8 A;  5KJ7 A;  2XU6 A;  4JYC A;  1M1J A;  1GK6 A;  2O01 H;  4Y99 C;  1JTH B;  1N73 C;  1T3J A;  3P32 A;  1IC2 A;  3B5N D;  1LTI C;  1SQB K;  2P2U A;  2GUV A;  5AVQ B;  1JY2 O;  2N9B A;  3TK1 A;  1LTJ C;  3PP5 A;  3T97 A;  1A02 F;  3O8Z A;  1N7S D;  1IJD B;  3P8C D;  1CI6 A;  1IO4 A;  1WT6 A;  1RY3 A;  4C46 A;  3A5T A;  2OYH C;  2N1T D;  1SQQ K;  3EFG A;  1PFI A;  2FKW B;  3HTK A;  1NKN A;  5CCH D;  3P7K A;  1GL2 A;  2YNY A;  3TSI A;  4HYT B;  1YTZ T;  1HBW A;  4RES B;  3B5N B;  4WBA A;  1NWQ A;  2PP6 A;  3A7O A;  3TYY A;  1ZN5 A;  4C7N B;  1AFO A;  4IFF A;  1GW3 A;  1FJP A;  3VTP C;  3VMX A;  1GL2 B;  3HTK B;  3KYQ A;  3L4F A;  1ZR4 A;  3P8M C;  1G2C B;  3OAK A;  4LC1 A;  1N86 A;  1FZC C;  2PAJ A;  2I1J A;  5APV A;  3G3Z A;  3LIE A;  4GKG A;  5APU A;  4C7N A;  2WSF H;  5KLV K;  1NHL A;  5AW5 B;  1HTL C;  2N1T B;  1L0N K;  1DEB A;  3HD7 A;  1E5W A;  5AVX B;  2H43 A;  4I1L A;  2H8P D;  3RK2 B;  3HUS C;  3KQG A;  5APT A;  2C0X A;  1FU1 A;  2OYI A;  1J1E B;  3M06 A;  1FOS F;  3M0D C;  1VPC A;  1ZLL A;  1HUC A;  5CCH C;  1IFJ A;  5AW0 B;  3HD7 B;  1G1I A;  1IFM A;  4WY4 B;  3EQ2 A;  2YO2 A;  1CW5 A;  1J2J B;  1RE4 A;  1M7L A;  2W6A A;  1RF1 C;  1RE4 C;  2CPS A;  2BAS A;  3U1A A;  3HE4 A;  4WB4 A;  1Z56 A;  1FZC A;  3B5N C;  4WY4 A;  4IFM A;  2IX7 C;  2WWW A;  1SFC D;  3BAS A;  3MUD A;  1HGV A;  1LTT C;  4AUW A;  3HUS A;  2C9L Y;  3HE4 B;  2NPS C;  2WZ7 A;  2Z5H A;  5BU8 B;  1SP4 A;  5CJ4 A;  1HH0 A;  4GIF A;  3BAT A;  2WIT A;  1T2K C;  2A45 I;  3H32 B;  1GL2 C;  1J1D B;  3MGN A;  1FZA A;  3V4W A;  5AVY B;  3U1C A;  1KIL D;  3M9Q A;  1CSB A;  2R32 A;  1RE3 C;  1ZV8 A;  5CHX A;  3I5C A;  3HE5 B;  1W2E A;  3V5B A;  3M0D A;  1CZQ A;  1JY2 N;  1LTS C;  3WMM 0;  4Y99 B;  2LKM A;  4WY4 C;  4W7Z A;  5AW1 B;  1AQ5 A;  2J59 M;  5AW8 B;  3NXS A;  4XE5 B;  4JYB A;  1GDT A;  5AW2 B;  3HRN A;  2OYI C;  2NPS D;  1X9V A;  3M91 A;  2IFM A;  1N7S B;  1CI6 B;  2JJL A;  2M3B A;  1LT9 A;  2WT7 A;  1HGZ A;  2Z5I A;  4OH8 B;  3H6P A;  3L37 A;  4JF7 A;  5CCG A;  1H88 A;  3BVH A;  2XNX A;  1IK9 A;  4I6M C;  3L36 A;  1JNM A;  1DH3 A;  1DX7 A;  2FFD C;  1IFN A;  2FYU K;  2P7J A;  1T8Z A;  2WT7 B;  1GD2 E;  2KYV A;  2W27 A;  3V2N A;  3E1I A;  1HVV A;  5CCG D;  3CL3 D;  3RK3 D;  1NH4 A;  3RL0 B;  3A2A A;  3V4Q A;  1X8Y A;  3N4X A;  3MTU E;  1G2C A;  1RE3 A;  2YKO A;  1KIL C;  1H8A A;  1SQV K;  1JUN A;  1S9K E;  4W80 A;  1KIL A;  1L4A B;  1NU1 K;  1JO5 A;  1JY3 P;  3V2R A;  4DZO A;  2XDJ A;  3HD7 C;  1VDF A;  1N7L A;  1GW4 A;  2N1T A;  5AW6 B;  1LTG C;  3RK3 C;  2IFN A;  1SQX K;  5CMZ A;  2O1K A;  3OJA B;  1L4A A;  5KJ7 C;  2E42 A;  3UIA A;  2Q7C A;  2Q5U A;  2WSC H;  2FYZ A;  2OAR A;  1URQ B;  1GU5 A;  2ZFC A;  4N6J A;  3CI9 A;  2HG5 D;  3V2P A;  1ZR2 A;  3NMD A;  2VRS A;  4C7R A;  1H89 A;  1EQ7 A;  1GL2 D;  5KJ7 D;  2KB7 P;  1FBM A;  3MD0 A;  3LID A;  4W7Y A;  4DOJ A;  1OWA A;  1GK4 A;  2H7H A;  1KFN A;  2XKM A;  1URQ A;  3GHG A;  1FZF A;  1NOH A;  2FFD B;  3M9H A;  2A45 H;  4EOT A;  1M1J B;  4EIJ A;  1MUU A;  2GM4 A;  3VYI A;  1LT9 B;  3A3Y B;  2C9N Y;  1NO4 A;  3SWY A;  3HD7 D;  1XTC C;  2I1K A;  1KZU B;  1HJB A;  3GHG C;  3TNU A;  1RF1 A;  1KFM A;  3OA7 A;  1N73 A;  1SVF A;  1JY3 N;  4M3L A;  4N78 E;  5AW3 B;  1JY2 P;  2Z4E A;  2HYN A;  2R5B A;  1L4A D;  5KTB A;  1LTJ A;  4B86 A;  3VMZ A;  2POH A;  2WSE H;  5CCG C;  2IPP A;  1FZC B;  1GZL A;  2WPQ A;  5AW4 B;  3TNU B;  3VN0 A;  1RF1 B;  2KLV A;  1N73 B;  2YKQ A;  2E43 A;  1LWU C;  2YMY A;  4I2L C;  4N78 D;  1OXZ A;  1JCD A;  1S9K D;  2HLO A;  2KP8 A;  4LGD E;  1KQL A;  2N1T C;  1LT9 C;  3H32 A;  1GTW A;  1SFC C;  2YO3 A;  3BRV B;  1SLQ A;  3RK2 C;  3VP8 A;  4ZKP A;  1L0L K;  4IFD K;  4HH2 A;  3B8E B;  4GT1 A;  2XV5 A;  2C0W A;  2OYH B;  2W6B A;  1MV8 A;  3HE5 A;  1LGH B;  1J1D C;  3BRT B;  2KOG A;  3L35 A;  1GU4 A;  4KHX A;  2HPC A;  1JMM A;  2HOD A;  1IFD A;  1XTG B;  1FZG A;  1J1E C;  4XA4 A;  5AVR B;  3KDP B;  2R3C A;  3VOP A;  2FFD A;  1IFI A;  3GHG B;  5CJ0 A;  3NFQ A;  5AW7 B;  2WTY A;  1RF0 A;  4AYC A;  1MZ9 A;  1JY3 O;  1RF0 C;  1MFZ A;  5APW A;  1NTK K;  3IFM A;  2HPC B;  5AW9 B;  5BU5 A;  3M9B A;  1FZB A;  4ZKU A;  5AVU B;  2Q9I A;  3IR9 A;  2JEE A;  1N2D C;  1N7S A;  3R2P A;  3C9I A;  1LTB C;  3NTN A;  2YKP A;  1YTZ I;  1KIL B;  2Q3I A;  1JTH A;  1A02 J;  2OYI B;  2WPR A;  1LTJ B;  3HUS B;  2P1J A;  3VMY A;  2ZXE B;  2L5G B;  1FAV A;  1NKZ B;  3RL0 C;  4LLH A;  5CCH A;  1NTM K;  3MIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...