5CCGA

Structure of the ca2+-bound synaptotagmin-1 snare complex (long unit cell form)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
63
structure length
63
Chain Sequence
b'GSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vesicle-associated membrane protein 2
publication title Architecture of the synaptotagmin-SNARE machinery for neuronal exocytosis.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis,exocytosis
total genus 28
structure length 63
sequence length 63
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5ccgA00
1JTHA 3VOPA 5KJ7A 2KOGA 4W7ZA 1KILC 2HG5D 3HD7C 5KJ7D 3RL0D 3B5ND 3RK3B 1URQD 3RK2B 2NPSB 3M0DC 2N1TB 3P8CE 1SFCA 5CCHC 1GL2A 1NHLA 4WY4D 1XTGB 3PP5A 1SFCD 1GL2D 1N7SD 3HD7A 5CCGC 2YMYA 3RK3C 2N1TC 1JTHB 2PP6A 4W80A 1L4AC 3RL0B 3B5NB 1URQB 2H8PD 4WY4B 1KILA 4N78E 1SFCB 3TSIA 2M8RA 1GL2B 1N7SB 3RK2C 1KILD 1L4AA 3HD7D 2NPSC 5CCHA 1HVVA 2WZ7A 5KJ7C 4LGDE 3RL0C 3B5NC 1URQC 3HD7B 4JF7A 3HTKB 4OH8B 5CCHD 4WY4C 5CCGA 2XDJA 1SFCC 1GL2C 1N7SC 2NPSA 5CCGD 2N1TA 2HFED 3B5NA 1URQA 3RK3D 3RK2D 3KYQA 2NPSD 2N1TD 4WY4A 1KILB 1L4AD 1N7SA 1T3JA 1L4AB 4W7YA
chains in the Genus database with same CATH superfamily
1JMBA 2GA1A 1VQ4P 2HR3A 2I1JA 3ABVC 3G4SP 1IFJA 3B5ND 1HF9A 1ZMEC 3L37A 5CCHC 1ZRTE 3WUUA 1SQBE 5AVTB 1KB9E 1LP1B 1R5LA 1T2KC 2KNCB 1YI2P 4IL6E 1YITP 2H7HA 5E79E 2FFDB 3FGAD 3FWLA 5AW2B 3CC4P 1LTJB 3RGUA 3GHGA 1EDKA 1JEKA 1FZFA 4WY4B 2WITA 1KV4A 4JQ0D 2QEXP 2IDBA 3C1LA 1KILD 2G3AA 3CL3D 3H32A 5AW7B 4LGDE 1M7LA 1S5LH 3EFGA 1JOCA 1GD2E 1ZN5A 2ZT9B 1JY2P 3G6EP 1KYOE 2Q3IA 3PLNA 5TJHA 1YTZI 4TT3H 5AVWB 4DZOA 3GHGB 1WRGA 1MUUA 1IK9A 1PP9D 5B66H 3L75G 2LXBA 1PV3A 1L0ND 1QGKB 3KXDA 4Y99C 3A3YB 3AE7C 4W7YA 4JYBA 1VDFA 3H32B 2A06E 3KPEA 3AEEC 2NRGA 1OW6A 5KJ7A 3H1JJ 2C9LY 2W6JH 2HG5D 3PTZA 1VF5B 1KFMA 1X8YA 2XKMA 2RMZA 2FYNB 3CCRP 2Y0CA 1ZV8A 2I1KA 1RE3C 1GMJA 2JDIH 3Q5SA 5CCGC 4HJGH 4XFJA 1KB9I 1S5LE 1NVOA 3AE1C 2HYNA 1P84H 2XNDH 4PV1D 4I7ZC 4D6TG 2IZ1A 3TGUD 2W83C 5AW9B 5KLIB 1M8OB 2FXOA 3SFEC 1NOHA 5B5EE 5B66E 1EXIA 4WWIA 2G8YA 4I1LA 1YQ4C 2P1JA 3RL0C 2BCCG 2IX7C 2OYIC 1RH5B 2R32A 1DIPA 2OTJP 4PJ0H 5KKZB 1NTZE 2KIKA 5DJUB 1URQA 4C46A 2P67A 1J1DB 5AVXB 4NPEA 4JBZA 2UWJE 2AXTH 2PFXA 4EOTA 1W5CE 3V5BA 1S72P 2WSCJ 5H2FH 1P84E 1X22A 3L70D 3HUSC 1X0TA 1RF1C 2O01J 5AVUB 2WQYC 1NTKJ 2Y0EA 1M1JC 1YQ3C 5CBOA 3TF5A 5AW5B 1NHLA 4HYTB 1N7SD 2IBZE 3M9QA 1JM0A 1NTKK 2YMYA 3HTKA 2JKVA 5GTHE 2KLVA 1ZRTD 1GW3A 1SQBD 1KB9D 3KZIE 1AVYA 3H1KJ 1GTWA 3CX5H 2E5TA 5DJTB 2YNYA 1LT1A 3AE9C 3V2QA 2ZXXA 4L75A 1NTZJ 2FBWC 1LWUA 5AW1B 2H88C 4H44B 3E1IA 1NO4A 2D2CC 2Z5IA 3HTKB 2CPSA 4GOEA 3LW5H 3A0BH 1G1IA 3K5BA 3H1JG 3B5NA 1MFZA 5AVSB 2N1TD 1KYOD 1NWQA 1JY3N 1LWUB 3W68A 2E74B 5APXA 1E5WA 3OAKA 4TLFA 2YXQB 1OVUA 1MV8A 2A06D 1AA0A 1GL2A 2OARA 4L73A 3M91A 4ZKUA 4WB4A 2YMKA 2GUVA 4I2LC 3M9BA 1BDCA 3D70A 5APYA 2IBZI 1FC2C 3TK1A 3W67A 3A0BE 3CCLP 2FKWB 4W80A 3Q5RA 2FY8A 2ZYGA 1IO4A 1KN7A 5CJ4A 2K3RA 3CWBE 1CZQA 1USDA 2R3SA 4RJTA 2O3JA 1GL2B 1DX7A 2QG4A 3HE4A 1WMKA 3L75E 5AVYB 2AEMA 2IYPA 1KTMA 5CCHD 4IOIH 2HLOA 1HTLC 2KXPB 1SFCC 1VQ9P 3JCUH 1T2KD 2NZ2A 2JWDA 2M0BA 3RK2D 1LTBC 2QJPC 1NTKG 1VQPP 3CXHE 1BE3J 1NTZD 5CBNA 1IC2A 4IFDK 3HE4B 1NH4A 3AE6C 3AE3C 3H1KG 3WU2H 3RK3B 1P84D 4D6TE 2OYHA 2OGUA 4JPZB 1WT6A 3HE5A 1SS1A 1N7LA 3VTPC 3USSA 3OW2O 3H6PA 5K5GB 3M0DA 1BSNA 1K73Q 1RE4A 5APUA 2IBZD 1VQKP 2BCCE 3L75J 3JCUE 1CI6A 4H13B 4N3YB 1BGYJ 2OYHB 3VYIA 3MP7B 1PIXA 1Q2NA 1LTJC 4HH2A 3HE5B 1HVVA 3OA7A 5AW3B 2BEZF 1GZLA 2ZAEB 3JSVC 2W8ZA 1PPJG 3AE4C 4WY4C 5CHXA 1DD4A 2MKVA 3WU2E 2NPSA 1KQFB 5CCGD 2R3CA 1KB9H 3CCUP 2OQQA 1JB0J 4RESB 2ZT9C 2YKPA 4D6TJ 5E79H 1N7SA 1T3JA 1SQQG 3CXHI 1JNMA 3GHGC 3WUVA 3TDKA 3AEDC 4BWNA 3Q2YA 3Q3DA 3I55P 2J5UA 4GOFA 3MZWB 3CCJP 1AQ5A 1HJBA 3SWKA 4W7ZA 1Y47A 4M3LA 3KHUA 3RL0D 5L8RJ 2NPSB 1OVVA 2BCCJ 2FXMA 3C9IA 4YPCA 3V2RA 2WPQA 2CPBA 1YJ9P 3D6YA 1A02J 2K88A 1VF5C 1KYOH 2PGDA 1S4XA 2Y0DA 2FYNC 1JCDA 2AEFA 3T97A 3M0AA 4Z1MH 2YIUB 3BVHA 1NU1G 3TSIA 2OYOA 3H1JE 2B87A 3RK2C 1BE3G 3CWBD 5KJ7C 5KLIC 1FS0E 2ZJSE 3L75D 1Q7YQ 2Q1KA 5EFWB 2WSCH 1SQXG 2P2UA 1BCCG 3U1CA 2BEQD 3D71A 1TU3F 1NGMB 3B8EB 2MJZA 4GT1A 1NYHA 2O01H 1JUNA 1N2DC 2B87B 1X79B 4XA4A 4OGQC 5AW4B 1SQVJ 3CXHD 1W2BO 1NTMG 1M90Q 3CCQP 2GUSA 3AE5C 2KOGA 1JY2N 5B5EH 1Q90D 2D2CD 3FXDA 1SQVK 3S9OA 1HUCA 2DW3A 1BGYG 1QLED 4JYCA 4D6TD 1Y8AA 1AV1A 1KQLA 2QIWA 1L4AC 3I56P 2HODA 3H1LG 3CC7P 2L91A 4AQRD 3CD6P 2BCCD 4BRYA 2B88A 1K05A 1NTKE 1SQPJ 2FYUG 4GKGA 3L73G 1EQ7A 4CPGA 1SQPK 4H44C 1J1EC 3A0HE 3L71G 2N9YB 1S3JA 4B86A 3H1KE 2HODB 1KZUB 5GTHH 2M5AA 3V4QA 3RL0g 1JCCA 4BRYB 4KHXA 2AXCA 2A45I 3KZIH 2WSEH 3II6A 2KSJA 1T6AA 2O1KA 1MFTA 1SVFA 3HD7C 2O1JA 2FYZA 2E74C 3KQGA 3H1IJ 3P8CE 2RKLA 2LR2A 4U3FG 5BU8B 4MN4C 4QMAA 1SFCD 2M3EA 2M5AB 3L35A 1HH0A 1KD1Q 1S1CX 2IFNA 2BASA 1KQSO 1URQB 2POHA 3SWYA 2N9BA 1PPJE 4GDOA 1FBMA 2H8PD 4YXWH 1PGQA 3NFQA 2E76B 2R5DA 3MTUE 5KAFH 2E42A 1G2CA 1RHZB 1T8ZA 5APVA 1K9MQ 1OW8A 1ZW0A 2E75B 2SPZA 4AUWA 2K37A 4H0LB 5C39A 3H1JD 2KSEA 2Q7CA 1SQVG 1SQQE 1FDOA 1EZVI 1GL2C 2XV5A 2QJKB 2OYIA 4NPDA 2W27A 1KORA 1YYCA 1PGJA 3ZDMA 2IZ0A 2P7JA 3R4YA 1G2CB 3CLQA 5APTA 1EC5A 3A5TA 3N4XA 5KLVG 3V2PA 2WSFJ 3VP8A 2KYVA 1NKZB 2WWWA 3L74G 1W2EA 4WY4D 2OYIB 3TNUA 1M56D 4O9BA 3HUSA 3GLMA 3GG2A 5KAFE 3Q1MA 1EDIA 1DEBA 1NJIQ 1OFCX 1OXZA 1M1JA 3V2NA 2JWAA 2W6BA 1NU1E 3RK3C 4ASVA 1H8AA 1FZEA 1SQPG 1VQLP 1ZXGA 2A45G 3M9HA 1LTSC 5KAIE 1BE3E 1U57A 1J2JB 2KS1A 2Q3EA 2ZT9D 1N86A 3BCCJ 2K9JA 3SFDC 3B5NB 1XTCC 5GTIH 3CXHH 3MHVA 4GIFA 1SQQJ 5AVQB 1KILA 4WVZA 2PRRA 1SQXE 1A02F 3TNUB 1BCCE 1L0LJ 2Y9YA 2WZ7A 1Q81Q 3BASA 3RBXA 1SQQK 4JF7A 3EQ2A 1M1JB 2RH0A 4H13C 3EFFK 1NTKD 4IFMA 1VPCA 1L0LK 2KS1B 1OIPA 1NTME 2K9JB 2L5GB 1VF5D 3KYQA 3H1IG 3VMAA 4EDFA 2KK7A 2HPCA 3U1AA 1KILB 1N73A 1GDTA 3H1KD 1BGYE 1FZCC 1JTHA 5AVZB 1EDLA 2JO1A 1NU1J 1OW7A 5KJ7D 5GTIE 3G9RA 3CC2P 1K8AQ 1MZ9A 1EZVG 3HRNA 2QJYC 3LIDA 2D2CB 3A7OA 3JC22 3RBZA 1NU1K 2HPCB 3H1LE 1E79H 3VN0A 1D7MA 3P8CD 1N73B 3V6IA 1SQXJ 1BCCJ 1JTHB 1GK4A 2WSSH 1LT9C 1IFPA 3CMEP 2FYUE 1JY2O 4OGQD 1SQXK 4N78E 1RF0C 3L73E 3NMDA 2YKOA 1NTMJ 1LTAC 3L71E 5AVRB 5AVVB 1PPJD 2P58A 3LW5J 4PV1B 1GU4A 1AVOA 3RK3E 3G71P 1FDIA 1NTMK 5APSA 2QM7A 1Y9BA 4DJGA 2Z4EA 2FFDC 1PFIA 1QX8A 1RQVA 1SQQD 1X9VA 2QVAA 4UB8H 3F89A 1GW4A 2OTLP 1IFNA 1L4AD 2B89A 2J59M 4U3FE 4GODA 3PJSK 4RKUJ 3CCEP 4C7RA 3H1LJ 3FX0A 2Y9ZA 1CI6B 2YO2A 3BCCG 3MIWA 2QA4P 4ZNCA 3CPWO 3F5HA 1PGPA 1PP9J 2FYUJ 2Q9IA 1L0NJ 1OZHA 2KZIA 4H44D 2R5BA 3L73J 1L0LG 2IFMA 3B4SA 3L71J 4RO0A 2FYUK 3P8MC 1L0NK 2QE7H 1NU1D 2O01N 4Y28J 3MUDA 1SQVE 2XNXA 2YKQA 1BE3D 4UB8E 3AECC 1ZLLA 1N7SB 1PZQA 3AEAC 3HD7D 1S2EA 2E74D 1VQ7P 4LC1A 3PRJA 1M57D 3GMAA 1HBWA 1SQXD 2KP8A 3VP9A 1LTJA 1BCCD 4UB6H 4U3FJ 2J58A 4PD4E 2PAJA 3TGUJ 2N1TA 2FXPA 5KLVE 1S9KE 3PH0A 1ZR4A 4WY4A 1Z56A 4I6MC 1GK6A 2KLUA 1NTMD 3L74E 3NTNA 3GF7A 1FJPA 3L72G 3D6ZA 3H1HG 1U7JA 3CMAP 2XZRA 3C8VA 4IL6X 2JP3A 3E7KA 3VOPA 2W6AA 1FJKA 1K04A 5BU5A 2AEJA 1SQPE 2RN0A 3KDPB 1BGYD 3T97B 1H0TA 2N1TB 3QWOC 5KKZC 4KT0J 2V7QJ 1GL2D 2Q6QA 1Q86Q 2YXRB 5KTBA 3CCSP 1J1DC 3A0HH 4UB6E 3H1LD 1VQMP 1YTZT 3L70J 3CWBG 2YO3A 3BRVB 1H0TB 2K9YA 2KB7P 1FOSE 1JY3O 2FYUD 5KLVJ 4EI2A 5CCHA 1YHQP 4XE5B 3O6QA 1URQC 3H1IE 4N78D 3L73D 3FXEA 3L74J 3L71D 1SQBJ 5KLVK 2E76C 4U7JA 2ZVOB 3AEGC 3RK3D 4PD4I 2E75C 4H0LC 1SQBK 3S1KA 2WSFH 1EZVE 1PP9G 3SWFA 1OVRA 2QJKC 1IFDA 1L0NG 1AFOA 1FZAA 3O6QB 2QM8A 2K1AA 2ZYDA 3N7NA 1ZP0C 1S5LX 2LKMA 4AYCA 1PL5A 3P7KA 4R4MA 4U3FD 4YTPC 3RK2B 4H13D 3WUTA 1BSHA 4YXDC 1NAFA 3M06A 2C0XA 3E1RA 1IZNB 1HGZA 1YIJP 3PHLA 4LLHA 1AQTA 2WPVB 1LWUC 1KFNA 1SLQA 1OX3A 2E5YA 3H25A 3TGUG 3CCVP 4OGQB 2M8RA 1KYOI 1L4AA 3AE8C 2H43A 1SQVD 5AW0B 3B5NC 1AJYA 2WPRA 1RE3A 2ZYAA 1VL2A 5APWA 4Y99B 5CCGA 2KUBA 3BATA 3BRTB 3WMM0 3GW6A 1DD3A 2NPSD 1LTIC 4PD4D 1USEA 2Z5HA 2IYOA 1HGVA 3BCCE 1KC8Q 5KLVD 4EIJA 5KAIH 1S9KD 1L4AB 5TISH 3CCMP 4WBAA 3AEFC 1QVGO 1MKMA 3L74D 1L0LE 1KILC 4PJ0E 4ASWA 3B71A 3LIEA 3IR9A 2I8DA 1VQ8P 3IN6A 2WPSA 3L70G 4I7ZB 4DCKA 3L4FA 3AEBC 1OWAA 2JR8A 1KQGB 1ZOYC 1SQPD 2WT7A 3HD7A 1QVFO 1QEXA 2AXTE 2QSIA 1ZR2A 1J1EB 2C0WA 1JMMA 4HKZH 1H88A 1CW5A 3AE2C 1IFMA 5H2FE 4DT0A 1CSBA 2E43A 1NTZK 3MD0A 3RL0B 1SQBG 3SSUA 2KI7B 1N73C 1VQNP 1EDJA 1RF1A 2Q5UA 3IFMA 1JY3P 1VQOP 4DOJA 2C9NY 1FAVA 4K3AA 1RY3A 4R4LA 2WT7B 3HD7B 5TISE 1YJWP 5CMZA 2XDJA 3L72E 3H1HE 2VRSA 1LJ2A 1QL2A 3H1ID 1VQ5P 1LTGC 1GU5A 3CX5E 1P84I 1FDMA 3O8ZA 4PV1C 4A7PA 2CK3H 3HUSB 2M3BA 2WSEJ 1RF1B 1YBKA 5AW6B 3CI9A 3VMXA 4ZMDA 2ITAA 2OYHC 3FWNA 1UIXA 1R5SA 1EXJA 4KJMA 3G3ZA 1EZVD 5CJ0A 1IJDB 2IPPA 3VMYA 3IAOA 5BVZA 4L74A 4ZKPA 4C7NA 3M0DC 3QH9A 1Q82Q 1RE4C 3PP5A 4NPFX 2A06G 2R44A 2XU6A 4N6JA 3Q5PA 1T3UA 4OWFA 4EYYQ 1KILE 1FZGA 3L72J 4C7NB 3H1HJ 1NKNA 2NPSC 1HWTC 1M1KQ 4OVNF 4HB1A 3EWKA 1R8EA 4OH8B 1FZBA 1LNQA 1PP9E 2JJLA 3P32A 1L0NE 1N7SC 3NXSA 5AW8B 3MGNA 2HFED 3UIAA 4BXLA 1QL1A 1L2PA 3CX5I 1SP4A 1VQ6P 1G1JA 2QRXA 2WVRA 4IFFA 2YIUC 1IFIA 1FE6A 1UIIA 1NTZG 1OMIA 1PGOA 3CWBJ 3ITKA 2JEEA 3BCCD 2V7QH 3MUDC 2KZJA 1FU1A 3TYYA 2V4HA 1URQD 1LGHB 3OJAB 2ZFCA 1FZCA 1SFCA 1IK7A 1XTGB 3A2AA 1L0LD 2WTYA 2E76D 1BDDA 3TGUE 3IF4A 1JO5A 1DEEG 1KMIZ 5APQA 4PD4H 1U7MA 2N1TC 2E75D 2LXCB 4H0LD 1YJNP 2ZVNB 3GF3A 2PP6A 3I5CA 3U59A 4L76A 3VMZA 2IBZG 1LTTC 2ZXEB 1FZCB 1SFCB 2P10A 1LT9A 1FOSF 1H89A 4IL6H 1NAYA 2QJPB 2B9BA 3L36A 3R2PA 5M1BA 1RF0A 2QJYB 2WMMA 2A45H 2H89C 1N8RQ 3V4WA 1DH3A 4K35A 1LP1A 2W90A 1RQUA 3L72D 3H1HD 1HJ0A 2KNCA 2GM4A 3L70E 2OTKE 3CX5D 3S4RA 2FFDA 1LT9B
chains in the Genus database with same CATH topology
3HE4B 1AFOA 1FZAA 3A5TA 2QM8A 1NH4A 3N4XA 3N7NA 2LKMA 4AYCA 2I1JA 3P7KA 3V2PA 3VP8A 2KYVA 1IFJA 1NKZB 2WWWA 3B5ND 3RK3B 3RK2B 2OYHA 1W2EA 3L37A 5CCHC 4WY4D 2OYIB 1WT6A 3TNUA 3HE5A 5AVTB 4O9BA 3HUSA 1NAFA 1N7LA 3VTPC 3M06A 1DEBA 2C0XA 1T2KC 3H6PA 1OXZA 1M1JA 3V2NA 2W6BA 3M0DA 3RK3C 2H7HA 2FFDB 1HGZA 1H8AA 1FZEA 5AW2B 1RE4A 2A45G 1LTSC 1LTJB 3M9HA 4LLHA 1J2JB 5APUA 1LWUC 3GHGA 1KFNA 1SLQA 1N86A 3B5NB 1XTCC 1CI6A 4GIFA 4N3YB 1FZFA 4WY4B 2OYHB 2WITA 5AVQB 1KILA 3VYIA 1LTJC 2M8RA 4HH2A 1A02F 3TNUB 1KILD 1L4AA 3HE5B 2H43A 3CL3D 1HVVA 2WZ7A 3H32A 3OA7A 4LGDE 5AW0B 1M7LA 3B5NC 3BASA 5AW3B 5AW7B 1GZLA 1SQQK 3EFGA 4JF7A 1JOCA 2WPRA 3EQ2A 1M1JB 1RE3A 1GD2E 4WY4C 1ZN5A 5APWA 4Y99B 5CHXA 5CCGA 1JY2P 3BATA 4IFMA 2Q3IA 1VPCA 3BRTB 1L0LK 1YTZI 4DZOA 5AVWB 3GHGB 2NPSA 5CCGD 1WRGA 2R3CA 2L5GB 1MUUA 3WMM0 1IK9A 3KYQA 2NPSD 1LTIC 4RESB 2Z5HA 2HPCA 1HGVA 3U1AA 1KILB 4Y99C 2YKPA 1N7SA 1N73A 1T3JA 4EIJA 1S9KD 1JNMA 3GHGC 1L4AB 1GDTA 3A3YB 4W7YA 4JYBA 1VDFA 3H32B 1FZCC 4WBAA 1JTHA 3KPEA 5AVZB 5KJ7A 1AQ5A 1HJBA 2C9LY 4W7ZA 1KILC 4M3LA 2HG5D 5KJ7D 3LIEA 3IR9A 3RL0D 1KFMA 1X8YA 1MZ9A 3HRNA 2NPSB 2WPSA 3L4FA 3LIDA 3A7OA 2XKMA 2FXMA 1OWAA 3C9IA 1ZV8A 2I1KA 3V2RA 2WPQA 1NU1K 1RE3C 2CPBA 2HPCB 2WT7A 3HD7A 5CCGC 3VN0A 3P8CD 1A02J 1N73B 2HYNA 1ZR2A 1J1EB 2C0WA 1JMMA 1H88A 1CW5A 1JTHB 1GK4A 1IFMA 1JCDA 1CSBA 5AW9B 1LT9C 2E43A 1NTZK 3MD0A 3RL0B 1JY2O 3T97A 1NOHA 1N73C 1SQXK 3M0AA 1RF1A 4N78E 1RF0C 2Q5UA 3BVHA 3IFMA 3TSIA 3NMDA 1JY3P 2YKOA 1LTAC 4I1LA 3RK2C 5AVRB 4DOJA 5AVVB 2C9NY 2P1JA 5KJ7C 1FAVA 3RL0C 2IX7C 1RY3A 2WT7B 3HD7B 2OYIC 1GU4A 2R32A 5CMZA 1NTMK 2XDJA 5APSA 2QM7A 2VRSA 2Z4EA 1QL2A 2FFDC 1PFIA 1LTGC 2WSCH 1URQA 1GU5A 2P2UA 3U1CA 1FDMA 4C46A 3O8ZA 1X9VA 2P67A 1J1DB 5AVXB 3HUSB 1GW4A 2M3BA 3B8EB 1RF1B 2MJZA 4GT1A 2O01H 1IFNA 5AW6B 3CI9A 1L4AD 4EOTA 3VMXA 1JUNA 2J59M 1N2DC 3V5BA 1X79B 4XA4A 2OYHC 5AW4B 3G3ZA 2GUSA 5CJ0A 4C7RA 3HUSC 1IJDB 2IPPA 2KOGA 1RF1C 5AVUB 1JY2N 3VMYA 1CI6B 2YO2A 5BVZA 4ZKPA 1M1JC 4C7NA 1SQVK 3M0DC 5AW5B 3MIWA 1NHLA 1RE4C 1HUCA 4JYCA 3PP5A 2Q9IA 4HYTB 1N7SD 3M9QA 1NTKK 2YMYA 3HTKA 2R5BA 2KLVA 2XU6A 4N6JA 1T3UA 1GW3A 2IFMA 2FYUK 1GTWA 1KQLA 3P8MC 1L0NK 1L4AC 2YNYA 1FZGA 3MUDA 3V2QA 2XNXA 2HODA 2YKQA 4C7NB 4AQRD 1ZLLA 1LWUA 1N7SB 5AW1B 1NKNA 3HD7D 3E1IA 2NPSC 1HWTC 1NO4A 2Z5IA 4LC1A 3HTKB 2CPSA 4OH8B 1FZBA 1HBWA 2KP8A 3LW5H 3VP9A 1LTJA 4GKGA 2JJLA 2J58A 3P32A 1G1IA 2PAJA 1N7SC 3NXSA 5AW8B 1EQ7A 3MGNA 2N1TA 1SQPK 1J1EC 2HFED 3B5NA 3UIAA 1S9KE 1QL1A 1MFZA 5AVSB 2N1TD 4B86A 1ZR4A 2HODB 4WY4A 1KZUB 1Z56A 4I6MC 1GK6A 1SP4A 3V4QA 1JCCA 1NWQA 1JY3N 1G1JA 1LWUB 4KHXA 2A45I 3NTNA 4IFFA 1FJPA 3II6A 2WSEH 2KSJA 1IFIA 5APXA 2O1KA 2XZRA 2JEEA 3VOPA 2W6AA 1FJKA 1E5WA 1FU1A 1SVFA 5BU5A 3OAKA 3TYYA 3HD7C 2O1JA 2FYZA 3KDPB 1MV8A 1URQD 1LGHB 3OJAB 3KQGA 2N1TB 2ZFCA 3P8CE 1SFCA 1FZCA 1GL2A 5BU8B 1XTGB 3A2AA 2OARA 3M91A 2WTYA 1SFCD 1JO5A 1GL2D 4ZKUA 4WB4A 5KTBA 2GUVA 4I2LC 3L35A 1HH0A 3M9BA 1J1DC 5APQA 5APYA 2N1TC 3TK1A 2PP6A 2IFNA 2FKWB 4W80A 3I5CA 2BASA 1YTZT 1IO4A 1URQB 2POHA 3SWYA 5CJ4A 2N9BA 2YO3A 3U59A 1CZQA 3VMZA 3BRVB 1FBMA 2H8PD 1LTTC 2ZXEB 3NFQA 2KB7P 1SFCB 1FZCB 1GL2B 1FOSE 2R5DA 1JY3O 3MTUE 2E42A 1G2CA 1LT9A 1DX7A 5CCHA 3HE4A 1FOSF 1H89A 5AVYB 4XE5B 1T8ZA 1URQC 5APVA 4N78D 3L36A 4AUWA 5CCHD 2HLOA 3R2PA 1RF0A 1HTLC 2Q7CA 2A45H 5KLVK 1SFCC 1GL2C 1T2KD 2XV5A 3V4WA 1DH3A 3RK3D 3RK2D 2OYIA 1LTBC 2W27A 1YYCA 1SQBK 2WSFH 2GM4A 2P7JA 1IC2A 3SWFA 4IFDK 2FFDA 1G2CB 1LT9B 3CLQA 5APTA 1IFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JTH A;  3VOP A;  5KJ7 A;  2KOG A;  4W7Z A;  1KIL C;  2HG5 D;  3HD7 C;  5KJ7 D;  3RL0 D;  3B5N D;  3RK3 B;  1URQ D;  3RK2 B;  2NPS B;  3M0D C;  2N1T B;  3P8C E;  1SFC A;  5CCH C;  1GL2 A;  1NHL A;  4WY4 D;  1XTG B;  3PP5 A;  1SFC D;  1GL2 D;  1N7S D;  3HD7 A;  5CCG C;  2YMY A;  3RK3 C;  2N1T C;  1JTH B;  2PP6 A;  4W80 A;  1L4A C;  3RL0 B;  3B5N B;  1URQ B;  2H8P D;  4WY4 B;  1KIL A;  4N78 E;  1SFC B;  3TSI A;  2M8R A;  1GL2 B;  1N7S B;  3RK2 C;  1KIL D;  1L4A A;  3HD7 D;  2NPS C;  5CCH A;  1HVV A;  2WZ7 A;  5KJ7 C;  4LGD E;  3RL0 C;  3B5N C;  1URQ C;  3HD7 B;  4JF7 A;  3HTK B;  4OH8 B;  5CCH D;  4WY4 C;  5CCG A;  2XDJ A;  1SFC C;  1GL2 C;  1N7S C;  2NPS A;  5CCG D;  2N1T A;  2HFE D;  3B5N A;  1URQ A;  3RK3 D;  3RK2 D;  3KYQ A;  2NPS D;  2N1T D;  4WY4 A;  1KIL B;  1L4A D;  1N7S A;  1T3J A;  1L4A B;  4W7Y A; 
#chains in the Genus database with same CATH topology
 1JMB A;  2GA1 A;  1VQ4 P;  2HR3 A;  2I1J A;  3ABV C;  3G4S P;  1IFJ A;  3B5N D;  1HF9 A;  1ZME C;  3L37 A;  5CCH C;  1ZRT E;  3WUU A;  1SQB E;  5AVT B;  1KB9 E;  1LP1 B;  1R5L A;  1T2K C;  2KNC B;  1YI2 P;  4IL6 E;  1YIT P;  2H7H A;  5E79 E;  2FFD B;  3FGA D;  3FWL A;  5AW2 B;  3CC4 P;  1LTJ B;  3RGU A;  3GHG A;  1EDK A;  1JEK A;  1FZF A;  4WY4 B;  2WIT A;  1KV4 A;  4JQ0 D;  2QEX P;  2IDB A;  3C1L A;  1KIL D;  2G3A A;  3CL3 D;  3H32 A;  5AW7 B;  4LGD E;  1M7L A;  1S5L H;  3EFG A;  1JOC A;  1GD2 E;  1ZN5 A;  2ZT9 B;  1JY2 P;  3G6E P;  1KYO E;  2Q3I A;  3PLN A;  5TJH A;  1YTZ I;  4TT3 H;  5AVW B;  4DZO A;  3GHG B;  1WRG A;  1MUU A;  1IK9 A;  1PP9 D;  5B66 H;  3L75 G;  2LXB A;  1PV3 A;  1L0N D;  1QGK B;  3KXD A;  4Y99 C;  3A3Y B;  3AE7 C;  4W7Y A;  4JYB A;  1VDF A;  3H32 B;  2A06 E;  3KPE A;  3AEE C;  2NRG A;  1OW6 A;  5KJ7 A;  3H1J J;  2C9L Y;  2W6J H;  2HG5 D;  3PTZ A;  1VF5 B;  1KFM A;  1X8Y A;  2XKM A;  2RMZ A;  2FYN B;  3CCR P;  2Y0C A;  1ZV8 A;  2I1K A;  1RE3 C;  1GMJ A;  2JDI H;  3Q5S A;  5CCG C;  4HJG H;  4XFJ A;  1KB9 I;  1S5L E;  1NVO A;  3AE1 C;  2HYN A;  1P84 H;  2XND H;  4PV1 D;  4I7Z C;  4D6T G;  2IZ1 A;  3TGU D;  2W83 C;  5AW9 B;  5KLI B;  1M8O B;  2FXO A;  3SFE C;  1NOH A;  5B5E E;  5B66 E;  1EXI A;  4WWI A;  2G8Y A;  4I1L A;  1YQ4 C;  2P1J A;  3RL0 C;  2BCC G;  2IX7 C;  2OYI C;  1RH5 B;  2R32 A;  1DIP A;  2OTJ P;  4PJ0 H;  5KKZ B;  1NTZ E;  2KIK A;  5DJU B;  1URQ A;  4C46 A;  2P67 A;  1J1D B;  5AVX B;  4NPE A;  4JBZ A;  2UWJ E;  2AXT H;  2PFX A;  4EOT A;  1W5C E;  3V5B A;  1S72 P;  2WSC J;  5H2F H;  1P84 E;  1X22 A;  3L70 D;  3HUS C;  1X0T A;  1RF1 C;  2O01 J;  5AVU B;  2WQY C;  1NTK J;  2Y0E A;  1M1J C;  1YQ3 C;  5CBO A;  3TF5 A;  5AW5 B;  1NHL A;  4HYT B;  1N7S D;  2IBZ E;  3M9Q A;  1JM0 A;  1NTK K;  2YMY A;  3HTK A;  2JKV A;  5GTH E;  2KLV A;  1ZRT D;  1GW3 A;  1SQB D;  1KB9 D;  3KZI E;  1AVY A;  3H1K J;  1GTW A;  3CX5 H;  2E5T A;  5DJT B;  2YNY A;  1LT1 A;  3AE9 C;  3V2Q A;  2ZXX A;  4L75 A;  1NTZ J;  2FBW C;  1LWU A;  5AW1 B;  2H88 C;  4H44 B;  3E1I A;  1NO4 A;  2D2C C;  2Z5I A;  3HTK B;  2CPS A;  4GOE A;  3LW5 H;  3A0B H;  1G1I A;  3K5B A;  3H1J G;  3B5N A;  1MFZ A;  5AVS B;  2N1T D;  1KYO D;  1NWQ A;  1JY3 N;  1LWU B;  3W68 A;  2E74 B;  5APX A;  1E5W A;  3OAK A;  4TLF A;  2YXQ B;  1OVU A;  1MV8 A;  2A06 D;  1AA0 A;  1GL2 A;  2OAR A;  4L73 A;  3M91 A;  4ZKU A;  4WB4 A;  2YMK A;  2GUV A;  4I2L C;  3M9B A;  1BDC A;  3D70 A;  5APY A;  2IBZ I;  1FC2 C;  3TK1 A;  3W67 A;  3A0B E;  3CCL P;  2FKW B;  4W80 A;  3Q5R A;  2FY8 A;  2ZYG A;  1IO4 A;  1KN7 A;  5CJ4 A;  2K3R A;  3CWB E;  1CZQ A;  1USD A;  2R3S A;  4RJT A;  2O3J A;  1GL2 B;  1DX7 A;  2QG4 A;  3HE4 A;  1WMK A;  3L75 E;  5AVY B;  2AEM A;  2IYP A;  1KTM A;  5CCH D;  4IOI H;  2HLO A;  1HTL C;  2KXP B;  1SFC C;  1VQ9 P;  3JCU H;  1T2K D;  2NZ2 A;  2JWD A;  2M0B A;  3RK2 D;  1LTB C;  2QJP C;  1NTK G;  1VQP P;  3CXH E;  1BE3 J;  1NTZ D;  5CBN A;  1IC2 A;  4IFD K;  3HE4 B;  1NH4 A;  3AE6 C;  3AE3 C;  3H1K G;  3WU2 H;  3RK3 B;  1P84 D;  4D6T E;  2OYH A;  2OGU A;  4JPZ B;  1WT6 A;  3HE5 A;  1SS1 A;  1N7L A;  3VTP C;  3USS A;  3OW2 O;  3H6P A;  5K5G B;  3M0D A;  1BSN A;  1K73 Q;  1RE4 A;  5APU A;  2IBZ D;  1VQK P;  2BCC E;  3L75 J;  3JCU E;  1CI6 A;  4H13 B;  4N3Y B;  1BGY J;  2OYH B;  3VYI A;  3MP7 B;  1PIX A;  1Q2N A;  1LTJ C;  4HH2 A;  3HE5 B;  1HVV A;  3OA7 A;  5AW3 B;  2BEZ F;  1GZL A;  2ZAE B;  3JSV C;  2W8Z A;  1PPJ G;  3AE4 C;  4WY4 C;  5CHX A;  1DD4 A;  2MKV A;  3WU2 E;  2NPS A;  1KQF B;  5CCG D;  2R3C A;  1KB9 H;  3CCU P;  2OQQ A;  1JB0 J;  4RES B;  2ZT9 C;  2YKP A;  4D6T J;  5E79 H;  1N7S A;  1T3J A;  1SQQ G;  3CXH I;  1JNM A;  3GHG C;  3WUV A;  3TDK A;  3AED C;  4BWN A;  3Q2Y A;  3Q3D A;  3I55 P;  2J5U A;  4GOF A;  3MZW B;  3CCJ P;  1AQ5 A;  1HJB A;  3SWK A;  4W7Z A;  1Y47 A;  4M3L A;  3KHU A;  3RL0 D;  5L8R J;  2NPS B;  1OVV A;  2BCC J;  2FXM A;  3C9I A;  4YPC A;  3V2R A;  2WPQ A;  2CPB A;  1YJ9 P;  3D6Y A;  1A02 J;  2K88 A;  1VF5 C;  1KYO H;  2PGD A;  1S4X A;  2Y0D A;  2FYN C;  1JCD A;  2AEF A;  3T97 A;  3M0A A;  4Z1M H;  2YIU B;  3BVH A;  1NU1 G;  3TSI A;  2OYO A;  3H1J E;  2B87 A;  3RK2 C;  1BE3 G;  3CWB D;  5KJ7 C;  5KLI C;  1FS0 E;  2ZJS E;  3L75 D;  1Q7Y Q;  2Q1K A;  5EFW B;  2WSC H;  1SQX G;  2P2U A;  1BCC G;  3U1C A;  2BEQ D;  3D71 A;  1TU3 F;  1NGM B;  3B8E B;  2MJZ A;  4GT1 A;  1NYH A;  2O01 H;  1JUN A;  1N2D C;  2B87 B;  1X79 B;  4XA4 A;  4OGQ C;  5AW4 B;  1SQV J;  3CXH D;  1W2B O;  1NTM G;  1M90 Q;  3CCQ P;  2GUS A;  3AE5 C;  2KOG A;  1JY2 N;  5B5E H;  1Q90 D;  2D2C D;  3FXD A;  1SQV K;  3S9O A;  1HUC A;  2DW3 A;  1BGY G;  1QLE D;  4JYC A;  4D6T D;  1Y8A A;  1AV1 A;  1KQL A;  2QIW A;  1L4A C;  3I56 P;  2HOD A;  3H1L G;  3CC7 P;  2L91 A;  4AQR D;  3CD6 P;  2BCC D;  4BRY A;  2B88 A;  1K05 A;  1NTK E;  1SQP J;  2FYU G;  4GKG A;  3L73 G;  1EQ7 A;  4CPG A;  1SQP K;  4H44 C;  1J1E C;  3A0H E;  3L71 G;  2N9Y B;  1S3J A;  4B86 A;  3H1K E;  2HOD B;  1KZU B;  5GTH H;  2M5A A;  3V4Q A;  3RL0 g;  1JCC A;  4BRY B;  4KHX A;  2AXC A;  2A45 I;  3KZI H;  2WSE H;  3II6 A;  2KSJ A;  1T6A A;  2O1K A;  1MFT A;  1SVF A;  3HD7 C;  2O1J A;  2FYZ A;  2E74 C;  3KQG A;  3H1I J;  3P8C E;  2RKL A;  2LR2 A;  4U3F G;  5BU8 B;  4MN4 C;  4QMA A;  1SFC D;  2M3E A;  2M5A B;  3L35 A;  1HH0 A;  1KD1 Q;  1S1C X;  2IFN A;  2BAS A;  1KQS O;  1URQ B;  2POH A;  3SWY A;  2N9B A;  1PPJ E;  4GDO A;  1FBM A;  2H8P D;  4YXW H;  1PGQ A;  3NFQ A;  2E76 B;  2R5D A;  3MTU E;  5KAF H;  2E42 A;  1G2C A;  1RHZ B;  1T8Z A;  5APV A;  1K9M Q;  1OW8 A;  1ZW0 A;  2E75 B;  2SPZ A;  4AUW A;  2K37 A;  4H0L B;  5C39 A;  3H1J D;  2KSE A;  2Q7C A;  1SQV G;  1SQQ E;  1FDO A;  1EZV I;  1GL2 C;  2XV5 A;  2QJK B;  2OYI A;  4NPD A;  2W27 A;  1KOR A;  1YYC A;  1PGJ A;  3ZDM A;  2IZ0 A;  2P7J A;  3R4Y A;  1G2C B;  3CLQ A;  5APT A;  1EC5 A;  3A5T A;  3N4X A;  5KLV G;  3V2P A;  2WSF J;  3VP8 A;  2KYV A;  1NKZ B;  2WWW A;  3L74 G;  1W2E A;  4WY4 D;  2OYI B;  3TNU A;  1M56 D;  4O9B A;  3HUS A;  3GLM A;  3GG2 A;  5KAF E;  3Q1M A;  1EDI A;  1DEB A;  1NJI Q;  1OFC X;  1OXZ A;  1M1J A;  3V2N A;  2JWA A;  2W6B A;  1NU1 E;  3RK3 C;  4ASV A;  1H8A A;  1FZE A;  1SQP G;  1VQL P;  1ZXG A;  2A45 G;  3M9H A;  1LTS C;  5KAI E;  1BE3 E;  1U57 A;  1J2J B;  2KS1 A;  2Q3E A;  2ZT9 D;  1N86 A;  3BCC J;  2K9J A;  3SFD C;  3B5N B;  1XTC C;  5GTI H;  3CXH H;  3MHV A;  4GIF A;  1SQQ J;  5AVQ B;  1KIL A;  4WVZ A;  2PRR A;  1SQX E;  1A02 F;  3TNU B;  1BCC E;  1L0L J;  2Y9Y A;  2WZ7 A;  1Q81 Q;  3BAS A;  3RBX A;  1SQQ K;  4JF7 A;  3EQ2 A;  1M1J B;  2RH0 A;  4H13 C;  3EFF K;  1NTK D;  4IFM A;  1VPC A;  1L0L K;  2KS1 B;  1OIP A;  1NTM E;  2K9J B;  2L5G B;  1VF5 D;  3KYQ A;  3H1I G;  3VMA A;  4EDF A;  2KK7 A;  2HPC A;  3U1A A;  1KIL B;  1N73 A;  1GDT A;  3H1K D;  1BGY E;  1FZC C;  1JTH A;  5AVZ B;  1EDL A;  2JO1 A;  1NU1 J;  1OW7 A;  5KJ7 D;  5GTI E;  3G9R A;  3CC2 P;  1K8A Q;  1MZ9 A;  1EZV G;  3HRN A;  2QJY C;  3LID A;  2D2C B;  3A7O A;  3JC2 2;  3RBZ A;  1NU1 K;  2HPC B;  3H1L E;  1E79 H;  3VN0 A;  1D7M A;  3P8C D;  1N73 B;  3V6I A;  1SQX J;  1BCC J;  1JTH B;  1GK4 A;  2WSS H;  1LT9 C;  1IFP A;  3CME P;  2FYU E;  1JY2 O;  4OGQ D;  1SQX K;  4N78 E;  1RF0 C;  3L73 E;  3NMD A;  2YKO A;  1NTM J;  1LTA C;  3L71 E;  5AVR B;  5AVV B;  1PPJ D;  2P58 A;  3LW5 J;  4PV1 B;  1GU4 A;  1AVO A;  3RK3 E;  3G71 P;  1FDI A;  1NTM K;  5APS A;  2QM7 A;  1Y9B A;  4DJG A;  2Z4E A;  2FFD C;  1PFI A;  1QX8 A;  1RQV A;  1SQQ D;  1X9V A;  2QVA A;  4UB8 H;  3F89 A;  1GW4 A;  2OTL P;  1IFN A;  1L4A D;  2B89 A;  2J59 M;  4U3F E;  4GOD A;  3PJS K;  4RKU J;  3CCE P;  4C7R A;  3H1L J;  3FX0 A;  2Y9Z A;  1CI6 B;  2YO2 A;  3BCC G;  3MIW A;  2QA4 P;  4ZNC A;  3CPW O;  3F5H A;  1PGP A;  1PP9 J;  2FYU J;  2Q9I A;  1L0N J;  1OZH A;  2KZI A;  4H44 D;  2R5B A;  3L73 J;  1L0L G;  2IFM A;  3B4S A;  3L71 J;  4RO0 A;  2FYU K;  3P8M C;  1L0N K;  2QE7 H;  1NU1 D;  2O01 N;  4Y28 J;  3MUD A;  1SQV E;  2XNX A;  2YKQ A;  1BE3 D;  4UB8 E;  3AEC C;  1ZLL A;  1N7S B;  1PZQ A;  3AEA C;  3HD7 D;  1S2E A;  2E74 D;  1VQ7 P;  4LC1 A;  3PRJ A;  1M57 D;  3GMA A;  1HBW A;  1SQX D;  2KP8 A;  3VP9 A;  1LTJ A;  1BCC D;  4UB6 H;  4U3F J;  2J58 A;  4PD4 E;  2PAJ A;  3TGU J;  2N1T A;  2FXP A;  5KLV E;  1S9K E;  3PH0 A;  1ZR4 A;  4WY4 A;  1Z56 A;  4I6M C;  1GK6 A;  2KLU A;  1NTM D;  3L74 E;  3NTN A;  3GF7 A;  1FJP A;  3L72 G;  3D6Z A;  3H1H G;  1U7J A;  3CMA P;  2XZR A;  3C8V A;  4IL6 X;  2JP3 A;  3E7K A;  3VOP A;  2W6A A;  1FJK A;  1K04 A;  5BU5 A;  2AEJ A;  1SQP E;  2RN0 A;  3KDP B;  1BGY D;  3T97 B;  1H0T A;  2N1T B;  3QWO C;  5KKZ C;  4KT0 J;  2V7Q J;  1GL2 D;  2Q6Q A;  1Q86 Q;  2YXR B;  5KTB A;  3CCS P;  1J1D C;  3A0H H;  4UB6 E;  3H1L D;  1VQM P;  1YTZ T;  3L70 J;  3CWB G;  2YO3 A;  3BRV B;  1H0T B;  2K9Y A;  2KB7 P;  1FOS E;  1JY3 O;  2FYU D;  5KLV J;  4EI2 A;  5CCH A;  1YHQ P;  4XE5 B;  3O6Q A;  1URQ C;  3H1I E;  4N78 D;  3L73 D;  3FXE A;  3L74 J;  3L71 D;  1SQB J;  5KLV K;  2E76 C;  4U7J A;  2ZVO B;  3AEG C;  3RK3 D;  4PD4 I;  2E75 C;  4H0L C;  1SQB K;  3S1K A;  2WSF H;  1EZV E;  1PP9 G;  3SWF A;  1OVR A;  2QJK C;  1IFD A;  1L0N G;  1AFO A;  1FZA A;  3O6Q B;  2QM8 A;  2K1A A;  2ZYD A;  3N7N A;  1ZP0 C;  1S5L X;  2LKM A;  4AYC A;  1PL5 A;  3P7K A;  4R4M A;  4U3F D;  4YTP C;  3RK2 B;  4H13 D;  3WUT A;  1BSH A;  4YXD C;  1NAF A;  3M06 A;  2C0X A;  3E1R A;  1IZN B;  1HGZ A;  1YIJ P;  3PHL A;  4LLH A;  1AQT A;  2WPV B;  1LWU C;  1KFN A;  1SLQ A;  1OX3 A;  2E5Y A;  3H25 A;  3TGU G;  3CCV P;  4OGQ B;  2M8R A;  1KYO I;  1L4A A;  3AE8 C;  2H43 A;  1SQV D;  5AW0 B;  3B5N C;  1AJY A;  2WPR A;  1RE3 A;  2ZYA A;  1VL2 A;  5APW A;  4Y99 B;  5CCG A;  2KUB A;  3BAT A;  3BRT B;  3WMM 0;  3GW6 A;  1DD3 A;  2NPS D;  1LTI C;  4PD4 D;  1USE A;  2Z5H A;  2IYO A;  1HGV A;  3BCC E;  1KC8 Q;  5KLV D;  4EIJ A;  5KAI H;  1S9K D;  1L4A B;  5TIS H;  3CCM P;  4WBA A;  3AEF C;  1QVG O;  1MKM A;  3L74 D;  1L0L E;  1KIL C;  4PJ0 E;  4ASW A;  3B71 A;  3LIE A;  3IR9 A;  2I8D A;  1VQ8 P;  3IN6 A;  2WPS A;  3L70 G;  4I7Z B;  4DCK A;  3L4F A;  3AEB C;  1OWA A;  2JR8 A;  1KQG B;  1ZOY C;  1SQP D;  2WT7 A;  3HD7 A;  1QVF O;  1QEX A;  2AXT E;  2QSI A;  1ZR2 A;  1J1E B;  2C0W A;  1JMM A;  4HKZ H;  1H88 A;  1CW5 A;  3AE2 C;  1IFM A;  5H2F E;  4DT0 A;  1CSB A;  2E43 A;  1NTZ K;  3MD0 A;  3RL0 B;  1SQB G;  3SSU A;  2KI7 B;  1N73 C;  1VQN P;  1EDJ A;  1RF1 A;  2Q5U A;  3IFM A;  1JY3 P;  1VQO P;  4DOJ A;  2C9N Y;  1FAV A;  4K3A A;  1RY3 A;  4R4L A;  2WT7 B;  3HD7 B;  5TIS E;  1YJW P;  5CMZ A;  2XDJ A;  3L72 E;  3H1H E;  2VRS A;  1LJ2 A;  1QL2 A;  3H1I D;  1VQ5 P;  1LTG C;  1GU5 A;  3CX5 E;  1P84 I;  1FDM A;  3O8Z A;  4PV1 C;  4A7P A;  2CK3 H;  3HUS B;  2M3B A;  2WSE J;  1RF1 B;  1YBK A;  5AW6 B;  3CI9 A;  3VMX A;  4ZMD A;  2ITA A;  2OYH C;  3FWN A;  1UIX A;  1R5S A;  1EXJ A;  4KJM A;  3G3Z A;  1EZV D;  5CJ0 A;  1IJD B;  2IPP A;  3VMY A;  3IAO A;  5BVZ A;  4L74 A;  4ZKP A;  4C7N A;  3M0D C;  3QH9 A;  1Q82 Q;  1RE4 C;  3PP5 A;  4NPF X;  2A06 G;  2R44 A;  2XU6 A;  4N6J A;  3Q5P A;  1T3U A;  4OWF A;  4EYY Q;  1KIL E;  1FZG A;  3L72 J;  4C7N B;  3H1H J;  1NKN A;  2NPS C;  1HWT C;  1M1K Q;  4OVN F;  4HB1 A;  3EWK A;  1R8E A;  4OH8 B;  1FZB A;  1LNQ A;  1PP9 E;  2JJL A;  3P32 A;  1L0N E;  1N7S C;  3NXS A;  5AW8 B;  3MGN A;  2HFE D;  3UIA A;  4BXL A;  1QL1 A;  1L2P A;  3CX5 I;  1SP4 A;  1VQ6 P;  1G1J A;  2QRX A;  2WVR A;  4IFF A;  2YIU C;  1IFI A;  1FE6 A;  1UII A;  1NTZ G;  1OMI A;  1PGO A;  3CWB J;  3ITK A;  2JEE A;  3BCC D;  2V7Q H;  3MUD C;  2KZJ A;  1FU1 A;  3TYY A;  2V4H A;  1URQ D;  1LGH B;  3OJA B;  2ZFC A;  1FZC A;  1SFC A;  1IK7 A;  1XTG B;  3A2A A;  1L0L D;  2WTY A;  2E76 D;  1BDD A;  3TGU E;  3IF4 A;  1JO5 A;  1DEE G;  1KMI Z;  5APQ A;  4PD4 H;  1U7M A;  2N1T C;  2E75 D;  2LXC B;  4H0L D;  1YJN P;  2ZVN B;  3GF3 A;  2PP6 A;  3I5C A;  3U59 A;  4L76 A;  3VMZ A;  2IBZ G;  1LTT C;  2ZXE B;  1FZC B;  1SFC B;  2P10 A;  1LT9 A;  1FOS F;  1H89 A;  4IL6 H;  1NAY A;  2QJP B;  2B9B A;  3L36 A;  3R2P A;  5M1B A;  1RF0 A;  2QJY B;  2WMM A;  2A45 H;  2H89 C;  1N8R Q;  3V4W A;  1DH3 A;  4K35 A;  1LP1 A;  2W90 A;  1RQU A;  3L72 D;  3H1H D;  1HJ0 A;  2KNC A;  2GM4 A;  3L70 E;  2OTK E;  3CX5 D;  3S4R A;  2FFD A;  1LT9 B; 
#chains in the Genus database with same CATH homology
 3HE4 B;  1AFO A;  1FZA A;  3A5T A;  2QM8 A;  1NH4 A;  3N4X A;  3N7N A;  2LKM A;  4AYC A;  2I1J A;  3P7K A;  3V2P A;  3VP8 A;  2KYV A;  1IFJ A;  1NKZ B;  2WWW A;  3B5N D;  3RK3 B;  3RK2 B;  2OYH A;  1W2E A;  3L37 A;  5CCH C;  4WY4 D;  2OYI B;  1WT6 A;  3TNU A;  3HE5 A;  5AVT B;  4O9B A;  3HUS A;  1NAF A;  1N7L A;  3VTP C;  3M06 A;  1DEB A;  2C0X A;  1T2K C;  3H6P A;  1OXZ A;  1M1J A;  3V2N A;  2W6B A;  3M0D A;  3RK3 C;  2H7H A;  2FFD B;  1HGZ A;  1H8A A;  1FZE A;  5AW2 B;  1RE4 A;  2A45 G;  1LTS C;  1LTJ B;  3M9H A;  4LLH A;  1J2J B;  5APU A;  1LWU C;  3GHG A;  1KFN A;  1SLQ A;  1N86 A;  3B5N B;  1XTC C;  1CI6 A;  4GIF A;  4N3Y B;  1FZF A;  4WY4 B;  2OYH B;  2WIT A;  5AVQ B;  1KIL A;  3VYI A;  1LTJ C;  2M8R A;  4HH2 A;  1A02 F;  3TNU B;  1KIL D;  1L4A A;  3HE5 B;  2H43 A;  3CL3 D;  1HVV A;  2WZ7 A;  3H32 A;  3OA7 A;  4LGD E;  5AW0 B;  1M7L A;  3B5N C;  3BAS A;  5AW3 B;  5AW7 B;  1GZL A;  1SQQ K;  3EFG A;  4JF7 A;  1JOC A;  2WPR A;  3EQ2 A;  1M1J B;  1RE3 A;  1GD2 E;  4WY4 C;  1ZN5 A;  5APW A;  4Y99 B;  5CHX A;  5CCG A;  1JY2 P;  3BAT A;  4IFM A;  2Q3I A;  1VPC A;  3BRT B;  1L0L K;  1YTZ I;  4DZO A;  5AVW B;  3GHG B;  2NPS A;  5CCG D;  1WRG A;  2R3C A;  2L5G B;  1MUU A;  3WMM 0;  1IK9 A;  3KYQ A;  2NPS D;  1LTI C;  4RES B;  2Z5H A;  2HPC A;  1HGV A;  3U1A A;  1KIL B;  4Y99 C;  2YKP A;  1N7S A;  1N73 A;  1T3J A;  4EIJ A;  1S9K D;  1JNM A;  3GHG C;  1L4A B;  1GDT A;  3A3Y B;  4W7Y A;  4JYB A;  1VDF A;  3H32 B;  1FZC C;  4WBA A;  1JTH A;  3KPE A;  5AVZ B;  5KJ7 A;  1AQ5 A;  1HJB A;  2C9L Y;  4W7Z A;  1KIL C;  4M3L A;  2HG5 D;  5KJ7 D;  3LIE A;  3IR9 A;  3RL0 D;  1KFM A;  1X8Y A;  1MZ9 A;  3HRN A;  2NPS B;  2WPS A;  3L4F A;  3LID A;  3A7O A;  2XKM A;  2FXM A;  1OWA A;  3C9I A;  1ZV8 A;  2I1K A;  3V2R A;  2WPQ A;  1NU1 K;  1RE3 C;  2CPB A;  2HPC B;  2WT7 A;  3HD7 A;  5CCG C;  3VN0 A;  3P8C D;  1A02 J;  1N73 B;  2HYN A;  1ZR2 A;  1J1E B;  2C0W A;  1JMM A;  1H88 A;  1CW5 A;  1JTH B;  1GK4 A;  1IFM A;  1JCD A;  1CSB A;  5AW9 B;  1LT9 C;  2E43 A;  1NTZ K;  3MD0 A;  3RL0 B;  1JY2 O;  3T97 A;  1NOH A;  1N73 C;  1SQX K;  3M0A A;  1RF1 A;  4N78 E;  1RF0 C;  2Q5U A;  3BVH A;  3IFM A;  3TSI A;  3NMD A;  1JY3 P;  2YKO A;  1LTA C;  4I1L A;  3RK2 C;  5AVR B;  4DOJ A;  5AVV B;  2C9N Y;  2P1J A;  5KJ7 C;  1FAV A;  3RL0 C;  2IX7 C;  1RY3 A;  2WT7 B;  3HD7 B;  2OYI C;  1GU4 A;  2R32 A;  5CMZ A;  1NTM K;  2XDJ A;  5APS A;  2QM7 A;  2VRS A;  2Z4E A;  1QL2 A;  2FFD C;  1PFI A;  1LTG C;  2WSC H;  1URQ A;  1GU5 A;  2P2U A;  3U1C A;  1FDM A;  4C46 A;  3O8Z A;  1X9V A;  2P67 A;  1J1D B;  5AVX B;  3HUS B;  1GW4 A;  2M3B A;  3B8E B;  1RF1 B;  2MJZ A;  4GT1 A;  2O01 H;  1IFN A;  5AW6 B;  3CI9 A;  1L4A D;  4EOT A;  3VMX A;  1JUN A;  2J59 M;  1N2D C;  3V5B A;  1X79 B;  4XA4 A;  2OYH C;  5AW4 B;  3G3Z A;  2GUS A;  5CJ0 A;  4C7R A;  3HUS C;  1IJD B;  2IPP A;  2KOG A;  1RF1 C;  5AVU B;  1JY2 N;  3VMY A;  1CI6 B;  2YO2 A;  5BVZ A;  4ZKP A;  1M1J C;  4C7N A;  1SQV K;  3M0D C;  5AW5 B;  3MIW A;  1NHL A;  1RE4 C;  1HUC A;  4JYC A;  3PP5 A;  2Q9I A;  4HYT B;  1N7S D;  3M9Q A;  1NTK K;  2YMY A;  3HTK A;  2R5B A;  2KLV A;  2XU6 A;  4N6J A;  1T3U A;  1GW3 A;  2IFM A;  2FYU K;  1GTW A;  1KQL A;  3P8M C;  1L0N K;  1L4A C;  2YNY A;  1FZG A;  3MUD A;  3V2Q A;  2XNX A;  2HOD A;  2YKQ A;  4C7N B;  4AQR D;  1ZLL A;  1LWU A;  1N7S B;  5AW1 B;  1NKN A;  3HD7 D;  3E1I A;  2NPS C;  1HWT C;  1NO4 A;  2Z5I A;  4LC1 A;  3HTK B;  2CPS A;  4OH8 B;  1FZB A;  1HBW A;  2KP8 A;  3LW5 H;  3VP9 A;  1LTJ A;  4GKG A;  2JJL A;  2J58 A;  3P32 A;  1G1I A;  2PAJ A;  1N7S C;  3NXS A;  5AW8 B;  1EQ7 A;  3MGN A;  2N1T A;  1SQP K;  1J1E C;  2HFE D;  3B5N A;  3UIA A;  1S9K E;  1QL1 A;  1MFZ A;  5AVS B;  2N1T D;  4B86 A;  1ZR4 A;  2HOD B;  4WY4 A;  1KZU B;  1Z56 A;  4I6M C;  1GK6 A;  1SP4 A;  3V4Q A;  1JCC A;  1NWQ A;  1JY3 N;  1G1J A;  1LWU B;  4KHX A;  2A45 I;  3NTN A;  4IFF A;  1FJP A;  3II6 A;  2WSE H;  2KSJ A;  1IFI A;  5APX A;  2O1K A;  2XZR A;  2JEE A;  3VOP A;  2W6A A;  1FJK A;  1E5W A;  1FU1 A;  1SVF A;  5BU5 A;  3OAK A;  3TYY A;  3HD7 C;  2O1J A;  2FYZ A;  3KDP B;  1MV8 A;  1URQ D;  1LGH B;  3OJA B;  3KQG A;  2N1T B;  2ZFC A;  3P8C E;  1SFC A;  1FZC A;  1GL2 A;  5BU8 B;  1XTG B;  3A2A A;  2OAR A;  3M91 A;  2WTY A;  1SFC D;  1JO5 A;  1GL2 D;  4ZKU A;  4WB4 A;  5KTB A;  2GUV A;  4I2L C;  3L35 A;  1HH0 A;  3M9B A;  1J1D C;  5APQ A;  5APY A;  2N1T C;  3TK1 A;  2PP6 A;  2IFN A;  2FKW B;  4W80 A;  3I5C A;  2BAS A;  1YTZ T;  1IO4 A;  1URQ B;  2POH A;  3SWY A;  5CJ4 A;  2N9B A;  2YO3 A;  3U59 A;  1CZQ A;  3VMZ A;  3BRV B;  1FBM A;  2H8P D;  1LTT C;  2ZXE B;  3NFQ A;  2KB7 P;  1SFC B;  1FZC B;  1GL2 B;  1FOS E;  2R5D A;  1JY3 O;  3MTU E;  2E42 A;  1G2C A;  1LT9 A;  1DX7 A;  5CCH A;  3HE4 A;  1FOS F;  1H89 A;  5AVY B;  4XE5 B;  1T8Z A;  1URQ C;  5APV A;  4N78 D;  3L36 A;  4AUW A;  5CCH D;  2HLO A;  3R2P A;  1RF0 A;  1HTL C;  2Q7C A;  2A45 H;  5KLV K;  1SFC C;  1GL2 C;  1T2K D;  2XV5 A;  3V4W A;  1DH3 A;  3RK3 D;  3RK2 D;  2OYI A;  1LTB C;  2W27 A;  1YYC A;  1SQB K;  2WSF H;  2GM4 A;  2P7J A;  1IC2 A;  3SWF A;  4IFD K;  2FFD A;  1G2C B;  1LT9 B;  3CLQ A;  5APT A;  1IFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...