5CCGA

Structure of the ca2+-bound synaptotagmin-1 snare complex (long unit cell form)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
63
structure length
63
Chain Sequence
GSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of the synaptotagmin-SNARE machinery for neuronal exocytosis.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis,exocytosis
molecule keywords Vesicle-associated membrane protein 2
total genus 28
structure length 63
sequence length 63
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5ccgA00
1KILC 3VOPA 4WY4A 5CCHD 3HD7B 3B5NB 2NPSD 1N7SB 3RK3C 2N1TC 2KOGA 5KJ7C 1L4AB 3PP5A 1JTHA 3B5NA 2PP6A 2WZ7A 2HG5D 3KYQA 1NHLA 3RK2C 1URQB 4WY4B 5CCGD 5KJ7A 1T3JA 1XTGB 3HD7C 3P8CE 2XDJA 3B5ND 2N1TB 1N7SD 1L4AC 1GL2A 2YMYA 4W80A 4W7YA 3RK3D 2HFED 1SFCC 3RL0D 1URQC 4N78E 3RL0B 1GL2D 3TSIA 1N7SA 4LGDE 4WY4D 1URQA 2NPSC 3HTKB 5KJ7D 2N1TD 1L4AD 1SFCB 3HD7A 5CCGA 2M8RA 3M0DC 3RK2D 1GL2B 1JTHB 1HVVA 3RL0C 5CCGC 1KILD 5CCHC 2NPSA 1KILB 4W7ZA 5CCHA 3HD7D 2NPSB 1KILA 3B5NC 4JF7A 1N7SC 3RK3B 2H8PD 1L4AA 1URQD 1SFCD 3RK2B 2N1TA 1GL2C 4OH8B 4WY4C 1SFCA
chains in the Genus database with same CATH superfamily
1ZN5A 4R4LA 1KFMA 3MZWB 4UB8H 1KYOH 2W83C 1QL2A 3L70G 3PTZA 3H1JJ 4C7RA 3AEFC 1BGYJ 2P67A 3G3ZA 4JPZB 5KAIH 1E79H 1BE3E 1NU1J 1VDFA 2KYVA 2ZJSE 4IFMA 1E5WA 2RH0A 4L73A 5CMZA 3WUVA 2G3AA 2W27A 1VF5D 2W6BA 3BRTB 3PP5A 1BGYG 1PIXA 2WTYA 5DJTB 1N7LA 1N2DC 1RHZB 1YQ3C 3MGNA 1LGHB 3M9QA 2AXTH 1BCCD 4YPCA 1NJIQ 1SQPJ 1HJ0A 3LW5J 3USSA 3V6IA 3AEBC 2K3RA 3HE4A 3KYQA 2Y0DA 1NVOA 3GG2A 2MKVA 5AVVB 5AW9B 3RK3E 1KMIZ 2IBZI 2GM4A 2IZ0A 3Q3DA 2GUSA 1OX3A 2D2CC 1NAYA 2Y9YA 3L73E 4PV1B 1G2CB 2R3SA 3K5BA 5CCGD 1LTIC 1L0LG 4H13B 3G6EP 3CCUP 1JNMA 1L0LK 2O1KA 4H0LC 1T3JA 3P8CD 1GU4A 2CPBA 1SS1A 2YKQA 1KQLA 4LLHA 3CCEP 3F89A 2A06D 3CWBE 1L0LJ 3TGUJ 1L0NK 2Q9IA 1OW7A 3VP9A 1N73C 3B5ND 5GTIE 1IJDB 1LP1B 4CPGA 1GL2A 1NWQA 1KTMA 1W2EA 1T3UA 3NMDA 5KLIB 1OXZA 3AEDC 1G1IA 1SFCC 4I7ZB 2Z5IA 5APWA 1R5LA 4GODA 3MUDC 4LC1A 1USDA 1PV3A 2O3JA 5AW2B 2K1AA 4EDFA 2M5AA 4N3YB 3W67A 2FYUD 5CHXA 4IOIH 3H1HJ 3O6QB 2K9JB 4PV1C 2WITA 2WVRA 1N7SA 4TLFA 3TSIA 1S1CX 2KZJA 2L5GB 1KZUB 1NU1K 4BXLA 4RESB 2L91A 1QGKB 3H1HG 2IBZE 3ITKA 4NPEA 2YXRB 2GA1A 2W90A 4WWIA 3ZDMA 1ZRTE 2IFNA 3U59A 2E5TA 4ASWA 3HTKB 3WU2H 2QVAA 1ZP0C 1KILE 4KT0J 1IFJA 5AVWB 1GK4A 5KLIC 2N9YB 2PFXA 4H44B 1FZCC 2LR2A 4BRYA 1L4AD 1J1DB 1KYOE 1P84D 3H25A 1NTMG 3H1KG 4JYCA 1BDDA 1T2KD 3BCCE 1ZV8A 2NRGA 3O6QA 1LT9B 4Y99B 3BATA 2WSEH 3RK2D 5KLVG 1JTHB 1AQTA 4I2LC 1X0TA 3RL0C 1KORA 2K9YA 1NTMJ 3H1KJ 1BSHA 3OA7A 3V4WA 4PD4D 3QWOC 1NKZB 3MHVA 4EI2A 1SQVK 1NTZG 1PPJG 1RH5B 2IYPA 3CC7P 1IK7A 1FZEA 1KILB 2M3EA 2WPRA 1SQQE 4WBAA 3TGUE 1GTWA 3CMEP 2NPSB 3CPWO 1PZQA 1WRGA 1DH3A 1CSBA 1S5LE 1YJWP 1BE3J 1N7SC 1NU1E 2OARA 2P1JA 3RK2B 3S4RA 3I55P 1TU3F 2XU6A 3L72D 1SQPG 1XTCC 3KPEA 4BRYB 2OYHA 3CC2P 3L73J 2M5AB 1JUNA 3H32A 1NTZD 1PPJD 1M1JC 1UIIA 2SPZA 3FX0A 3L71E 2XNXA 3MUDA 1SQPD 4Y28J 5L8RJ 2W8ZA 1RF0A 1ZW0A 1LTSC 3U1CA 3OW2O 2FFDA 4HJGH 1URQD 1SFCD 2BCCG 1FJKA 5BU8B 1FOSF 2N1TA 2R32A 3EFFK 1GL2C 1KB9H 2KSJA 2FYUJ 2J5UA 2KSEA 3VMYA 2E43A 3BASA 1BE3D 1DEBA 5KKZB 2G8YA 1MFTA 1S72P 5CJ0A 4YXDC 1SFCA 2H7HA 1BDCA 3L4FA 3IFMA 3VOPA 1BGYE 4DCKA 4IL6E 1IZNB 2WSSH 2E75B 2UWJE 1H89A 2A06G 1GD2E 3CC4P 5KLVK 2I8DA 1SQQK 2KZIA 1N7SB 1P84H 3GW6A 1RF1B 1SQXG 3M0AA 1LTJC 5KJ7C 1HH0A 1LJ2A 3VYIA 1T6AA 2E74B 1JTHA 1L0LD 2QJYB 2FYZA 2VRSA 2Y0CA 3AE5C 2KNCB 3L75G 4O9BA 1K9MQ 1DEEG 1SQBK 1OVVA 3HRNA 3EWKA 5AVQB 1JY3P 2WZ7A 1K73Q 1ZOYC 2YIUB 3C8VA 1CI6A 2LXBA 4PV1D 3CCVP 1NTKD 1EXJA 1IFDA 1T2KC 2P10A 1GDTA 1WMKA 2I1KA 1SP4A 1EDLA 3A0BE 1QLED 1YHQP 5APXA 4GDOA 1VPCA 5KAIE 5AW7B 3D71A 1MUUA 3L74G 1AFOA 2IBZD 2Q7CA 3CXHE 1SQXJ 3AEEC 2P58A 2QJKC 1FE6A 3AE7C 3HD7C 3RL0g 1NTKG 1HTLC 3H1JG 2ZFCA 3MTUE 3WU2E 3NXSA 1S9KE 4I6MC 2N1TB 1N7SD 2HR3A 3L74J 3N4XA 4K35A 1RF0C 4U3FE 3TF5A 2ZVOB 1NU1G 2YMYA 4W80A 3V2NA 1IFNA 1VF5B 2ZAEB 1JB0J 3SWKA 1G1JA 1Q81Q 1FZCB 1EZVE 3JSVC 2QEXP 1YJ9P 3Q1MA 2POHA 5E79E 1N73A 1FC2C 2ZVNB 1SQPK 5AVRB 1RE3C 3JCUE 1SQBJ 2P2UA 4Y99C 1SQVE 1PL5A 1LTJA 1URQC 4GKGA 3T97A 5APQA 2OYHB 1ZXGA 3CX5D 2AEFA 1FZGA 2BCCJ 3U1AA 1KB9D 2D2CB 3H1IG 4K3AA 2Q6QA 3H1HD 2QM7A 1FZBA 1NU1D 4DOJA 4DZOA 2ZXEB 3N7NA 3TK1A 2FXMA 1VQLP 3VMZA 4IFDK 1JM0A 3CXHD 4KHXA 3KZIE 1SQQD 1AQ5A 1X8YA 2WPQA 4Z1MH 4UB8E 3AEAC 2BCCD 3A5TA 1GK6A 2WSCJ 3A0BH 3H1LD 1FZCA 2P7JA 1S2EA 2N1TD 1SQBD 3G9RA 3AE8C 1LT1A 2B87B 1M7LA 2C0WA 4EYYQ 2M0BA 1SQVD 1QVFO 3M0DC 2BEZF 1SQQG 3V2QA 1GL2B 3I5CA 4NPFX 2AEJA 1HVVA 2FFDC 5C39A 5M1BA 1AVYA 5CCGC 3CL3D 1KILD 3Q5SA 3H1LE 1R5SA 1SLQA 2IZ1A 2KIKA 2WQYC 1N73B 2A45I 2H89C 4BWNA 3G71P 2IYOA 5EFWB 2LXCB 2Q5UA 1OWAA 3FXDA 5E79H 4AUWA 3JC22 1W5CE 2QSIA 4W7ZA 4H13D 2LKMA 3FXEA 4XE5B 1IFMA 5B5EH 4N6JA 1OVRA 3TYYA 1EDIA 2OTKE 3L36A 1EXIA 3RK3B 1RF1C 2R5BA 3L35A 1U7MA 2FYUK 1LTJB 3M0DA 1NTMK 1NKNA 1DD3A 1LTTC 1NH4A 3AE9C 1NTKE 2KLVA 2WSCH 3C9IA 3KXDA 4N78D 4RO0A 3SWYA 4H44C 1NO4A 4IL6X 3VTPC 2QIWA 3CCSP 1CW5A 1JCDA 2OGUA 2O01H 1KQGB 4D6TG 1IFIA 1A02J 1S3JA 2YXQB 4PJ0E 2Q3IA 2HODB 5B66H 2BEQD 1VQKP 3D6YA 3KHUA 1BCCE 1OIPA 1OW8A 1KB9I 2A06E 2JWAA 3CWBD 3CLQA 3L72E 3L70D 4L76A 4OVNF 1HWTC 1JY3N 1EDJA 1KYOI 1FBMA 2WT7A 1NTZK 1EC5A 1YYCA 2WSEJ 1RE3A 2H88C 2YNYA 2C0XA 4L75A 2N9BA 4WY4A 2XKMA 4OGQD 3JCUH 2B87A 2KI7B 5AW8B 1HJBA 4EOTA 5APVA 4TT3H 4XA4A 2NPSD 3L74D 1RE4A 3EFGA 3PHLA 1PP9E 1ZR2A 3BCCD 2C9LY 1FDMA 1QEXA 5CBNA 2RKLA 3B5NA 3I56P 1RY3A 1SQBG 2XNDH 2XV5A 2KP8A 2QM8A 2FYUE 2QE7H 3L75D 4EIJA 3R2PA 3L73G 1EZVD 4PD4H 2DW3A 2E76C 1L0LE 2HG5D 3AE2C 2ZT9C 1NHLA 2M3BA 3RK2C 3BVHA 5AW4B 2FXPA 2Y0EA 2YKOA 1NTKK 1PP9J 1URQB 5APSA 2B88A 1S4XA 2W6AA 3V2PA 3L71J 1VQ8P 3BCCJ 1SVFA 2MJZA 3H1JE 4WY4B 3SFEC 3BRVB 1AVOA 1OVUA 1SQXK 1YTZT 2WWWA 1RF1A 4ASVA 1HGZA 5APYA 1Q86Q 2O01J 3SFDC 1OFCX 3P8CE 4RJTA 3CCMP 3CCQP 1ZR4A 3C1LA 1H8AA 2IFMA 1SQVG 3W68A 1Y9BA 3QH9A 3RK3D 4UB6E 2E74D 2FYNB 1PGOA 3LW5H 2HFED 3RBZA 2ZYDA 3P7KA 4H44D 4IFFA 4KJMA 3WUUA 5BU5A 2WT7B 4HH2A 2ZT9B 1IC2A 2R5DA 3L71G 3M91A 3PRJA 1FOSE 1YJNP 2IBZG 4D6TJ 4D6TE 3RL0B 3M06A 4L74A 2AEMA 1LTAC 4U3FD 1L0NJ 4GT1A 3CXHH 1LTBC 4H13C 1T8ZA 4HYTB 2K9JA 3CXHI 1BCCJ 5AVSB 2HODA 1IO4A 1J1EB 1URQA 2J59M 2JKVA 4PD4E 1KC8Q 3KZIH 1QVGO 2WPSA 1L0ND 5AVUB 3P32A 5KJ7D 3TNUA 3LIDA 3IN6A 2OTLP 1RQVA 4D6TD 1Q2NA 1NTKJ 1PGJA 1USEA 1GZLA 3H1HE 3HTKA 3II6A 4AQRD 1VQPP 1VF5C 2OYIA 3CCLP 2OYOA 2PAJA 2I1JA 3ABVC 1LWUA 1LNQA 1SQXD 3L75E 5AVYB 1X9VA 4OWFA 5TISE 4AYCA 3B71A 1U7JA 1NTZE 1PPJE 3MP7B 5CCGA 1VQ4P 2IDBA 2ZT9D 3S9OA 2KK7A 4YTPC 1KD1Q 1RQUA 5K5GB 2E5YA 2QG4A 1VQ7P 2V7QH 3V2RA 3H1LJ 5TJHA 4DJGA 1M1KQ 3A0HE 4PJ0H 3CCJP 1YQ4C 1PGQA 2NPSA 5AW3B 2WPVB 3BCCG 5B66E 2QA4P 1ZMEC 1Q7YQ 1J1EC 2W6JH 1FZAA 3E1RA 5CCHA 4QMAA 3HD7D 5DJUB 1JEKA 3GMAA 2HPCA 3PJSK 3AE6C 3SWFA 1WT6A 5KTBA 2KS1B 2AXCA 1LWUB 3Q5RA 2Q1KA 2QJYC 3TGUG 5AVXB 2E76D 3NTNA 5APTA 5B5EE 1DIPA 2BASA 4U3FG 3VP8A 1KQSO 3L72G 1L4AA 2K88A 3WUTA 3D70A 3HE5B 3P8MC 3KQGA 2E76B 1KN7A 2YIUC 3AECC 1UIXA 1FAVA 1M8OB 2YKPA 5AVZB 1SQPE 2V4HA 1FU1A 3GF3A 3CX5H 3IAOA 1M57D 3NFQA 4U3FJ 5KLVD 2C9NY 4OH8B 3D6ZA 2FFDB 1NAFA 1L2PA 2JWDA 1IK9A 1U57A 4H0LD 3V5BA 1VQ9P 2A45G 4GOFA 3VMXA 4WY4C 4C46A 1S9KD 1Y8AA 2J58A 2RN0A 2JP3A 1EQ7A 1D7MA 3H1IE 4ZMDA 2BCCE 2KLUA 4PD4I 1VQNP 1KILC 1MFZA 1FDIA 5CCHD 1SQVJ 2CK3H 2GUVA 3FGAD 4IL6H 1OMIA 1VQOP 1IFPA 3PLNA 1K8AQ 2QJKB 3HD7B 3B5NB 3OAKA 1NTMD 3H1KD 3MD0A 2IX7C 4R4MA 5AVTB 3RK3C 1MKMA 2FBWC 2N1TC 2KOGA 2ZYGA 3FWNA 3L73D 3Q5PA 1L4AB 1H0TA 3L72J 1YIJP 2KUBA 2JO1A 3EQ2A 3L70E 3HUSA 4DT0A 1M1JB 3M9BA 1KB9E 2K37A 4I1LA 1YITP 1NGMB 1LP1A 2PP6A 1A02F 1DD4A 5KLVE 1FS0E 1RE4C 1SQXE 3R4YA 3A3YB 3RBXA 1VQMP 1JOCA 2OYHC 2R44A 1YI2P 5AW6B 2WSFH 2OQQA 3FWLA 3L71D 3AE1C 1GW4A 1PP9D 1J2JB 3CX5I 5AW1B 1JMBA 1JMMA 3V4QA 4ZNCA 2E42A 3IF4A 5KJ7A 4ZKPA 1S5LH 1ZRTD 2A45H 4YXWH 3TGUD 3H1LG 1W2BO 3H1IJ 3A2AA 1P84I 1KFNA 4JBZA 4HKZH 2QJPB 3GHGA 3H6PA 1ZLLA 1XTGB 2E75C 1KQFB 2Y9ZA 1H0TB 3HE5A 4GOEA 3RGUA 3AEGC 2AXTE 1HF9A 1FDOA 2XDJA 3O8ZA 1YBKA 3E7KA 4GIFA 4OGQC 3VN0A 1VQ6P 1Q90D 3M9HA 1L4AC 5AW5B 1M56D 4M3LA 4W7YA 3GF7A 1MZ9A 3A7OA 3F5HA 3AE3C 2KXPB 3B8EB 5CBOA 1CZQA 5GTHE 1J1DC 5GTHH 2PGDA 2OTJP 3RL0D 2O1JA 2RMZA 1QX8A 1LT9C 2KS1A 1M90Q 1GW3A 2YO2A 1L0NG 3GHGC 1VL2A 1EDKA 4N78E 1GMJA 1N86A 3AE4C 3HUSB 1FZFA 1GL2D 1M1JA 4C7NA 4JYBA 3T97B 4WB4A 3G4SP 4LGDE 3WMM0 2YMKA 1BCCG 5BVZA 1PFIA 1AA0A 5KAFH 1SQQJ 4WY4D 5H2FH 2IPPA 1BGYD 2CPSA 1JY2P 2HLOA 2NZ2A 4H0LB 2FXOA 3H1JD 2R3CA 1BE3G 2PRRA 2QJPC 2WMMA 4WVZA 3CMAP 2V7QJ 2NPSC 3MIWA 4MN4C 3Q2YA 2JEEA 1FJPA 1JO5A 3IR9A 2O01N 3PH0A 4OGQB 1HBWA 1KV4A 5CJ4A 1K05A 1DX7A 1LWUC 1MV8A 2B9BA 3SSUA 4ZKUA 3LIEA 2H43A 2OYIB 2FYNC 3OJAB 1PP9G 2ITAA 1GU5A 1OW6A 1SFCB 3HD7A 1SQBE 4I7ZC 3TNUB 2FYUG 2KB7P 2M8RA 2FKWB 5KAFE 2FY8A 1JCCA 3CI9A 1QL1A 1YTZI 1AV1A 2D2CD 2JR8A 2WSFJ 1OZHA 1K04A 3GHGB 1JY2N 2Q3EA 1PGPA 2HYNA 3HUSC 4JQ0D 1LT9A 5GTIH 5KKZC 5KLVJ 1Z56A 3L74E 5APUA 5CCHC 1NTME 3H1KE 2ZYAA 2YO3A 1HUCA 3CWBG 3H1ID 2HPCB 1HGVA 2JJLA 2Z4EA 1EZVI 2KNCA 3E1IA 3VMAA 2ZXXA 3KDPB 1Q82Q 1NTZJ 1NYHA 4A7PA 1LTGC 1JY3O 4C7NB 1KILA 3A0HH 2E75D 3B5NC 1G2CA 1X22A 1Y47A 3HE4B 3L75J 4JF7A 4U7JA 4UB6H 3TDKA 1VQ5P 3CCRP 1N8RQ 2Z5HA 1EZVG 2E74C 2H8PD 4RKUJ 1R8EA 3CX5E 3GLMA 2OYIC 3CD6P 1X79B 2XZRA 4XFJA 3B4SA 1KYOD 1JY2O 1P84E 3UIAA 1BSNA 5TISH 2JDIH 2QRXA 3H32B 1S5LX 1H88A 1AJYA 4NPDA 3L37A 5H2FE 4HB1A 3S1KA 2B89A 1CI6B 3L70J 3CWBJ 5AW0B 1L0NE 1NOHA 4B86A
chains in the Genus database with same CATH topology
1ZN5A 1KFMA 1QL2A 4C7RA 2P67A 3G3ZA 1VDFA 2KYVA 4IFMA 1E5WA 5CMZA 2W27A 2W6BA 3BRTB 3PP5A 2WTYA 1N7LA 1N2DC 3MGNA 1LGHB 3M9QA 5AVVB 3HE4A 3KYQA 2GM4A 2GUSA 1G2CB 5CCGD 1LTIC 1JNMA 1L0LK 2O1KA 1T3JA 3P8CD 2CPBA 2YKQA 4LLHA 1KQLA 1L0NK 2Q9IA 3VP9A 1N73C 3B5ND 1IJDB 1GL2A 1W2EA 1T3UA 3NMDA 1OXZA 1G1IA 1SFCC 5APWA 2Z5IA 4LC1A 5AW2B 4N3YB 5CHXA 3TSIA 2WITA 1N7SA 2L5GB 1KZUB 1NU1K 4RESB 2IFNA 3U59A 3HTKB 1IFJA 5AVWB 1GK4A 1FZCC 1L4AD 1J1DB 4JYCA 1T2KD 1ZV8A 4Y99B 1LT9B 3BATA 2WSEH 3RK2D 1JTHB 4I2LC 3RL0C 3OA7A 3V4WA 1NKZB 1SQVK 1KILB 1FZEA 2WPRA 4WBAA 1GTWA 2NPSB 1DH3A 1WRGA 1CSBA 1FDMA 1N7SC 2OARA 2P1JA 2XU6A 2OYHA 1XTCC 3KPEA 1JUNA 3H32A 1M1JC 3MUDA 2XNXA 3U1CA 1RF0A 1LTSC 2FFDA 1URQD 1SFCD 1FJKA 5BU8B 1FOSF 2N1TA 2R32A 1GL2C 2KSJA 3VMYA 2E43A 3BASA 1DEBA 5CJ0A 1SFCA 2H7HA 3L4FA 3IFMA 3VOPA 1H89A 1GD2E 5KLVK 1SQQK 1N7SB 1RF1B 3M0AA 1LTJC 5KJ7C 1HH0A 3VYIA 1JTHA 2FYZA 2VRSA 4O9BA 3HRNA 1SQBK 5AVQB 1JY3P 2WZ7A 1CI6A 1GDTA 1IFDA 1T2KC 2I1KA 1SP4A 5APXA 1VPCA 5AW7B 1MUUA 1AFOA 2Q7CA 3HD7C 1HTLC 3MTUE 2ZFCA 1S9KE 1GU4A 3NXSA 4I6MC 2N1TB 1N7SD 3N4XA 1RF0C 2YMYA 4W80A 3V2NA 1IFNA 1FZCB 1G1JA 2POHA 1N73A 1SQPK 5AVRB 1RE3C 3VTPC 2P2UA 4Y99C 3T97A 2OYHB 1LTJA 1URQC 4GKGA 5APQA 1FZGA 3U1AA 2QM7A 1FZBA 4DOJA 4DZOA 2ZXEB 3N7NA 3TK1A 2FXMA 3VMZA 4IFDK 4KHXA 1AQ5A 1X8YA 2WPQA 1FZCA 3A5TA 1GK6A 2P7JA 2N1TD 1M7LA 2C0WA 3M0DC 3V2QA 1GL2B 3I5CA 1HVVA 2FFDC 5CCGC 3CL3D 1KILD 1SLQA 1N73B 2A45I 2Q5UA 1OWAA 4AUWA 4W7ZA 2LKMA 4XE5B 1IFMA 4N6JA 3TYYA 3L36A 3RK3B 1RF1C 2R5BA 3L35A 2FYUK 3M0DA 1LTJB 1NTMK 1NKNA 1NH4A 1LTTC 3C9IA 5AW9B 2KLVA 2WSCH 4N78D 3SWYA 1NO4A 1CW5A 1JCDA 2O01H 1IFIA 1A02J 2Q3IA 2HODB 1HWTC 3CLQA 1JY3N 1FBMA 2WT7A 1NTZK 1YYCA 1RE3A 2YNYA 2C0XA 2N9BA 4WY4A 2XKMA 5AW8B 1HJBA 4EOTA 5APVA 4XA4A 2NPSD 1RE4A 3EFGA 1ZR2A 2C9LY 3B5NA 1NWQA 1RY3A 2XV5A 2KP8A 2QM8A 4EIJA 3R2PA 2HG5D 1NHLA 2M3BA 3RK2C 3BVHA 5AW4B 2YKOA 5APSA 3V2PA 1NTKK 1URQB 3WMM0 2W6AA 1SVFA 2MJZA 4WY4B 3BRVB 1SQXK 1YTZT 2WWWA 1RF1A 1HGZA 5APYA 3P8CE 1ZR4A 1H8AA 2IFMA 3RK3D 3LW5H 2HFED 3P7KA 4IFFA 5BU5A 2WT7B 4HH2A 3M91A 1IC2A 2R5DA 1FOSE 3RL0B 3M06A 1LTAC 4GT1A 1LTBC 1T8ZA 4HYTB 5AVSB 2HODA 1IO4A 1J1EB 1URQA 2J59M 2WPSA 5AVUB 3P32A 5KJ7D 3TNUA 3LIDA 3II6A 3HTKA 1GZLA 4AQRD 2PAJA 2I1JA 5AVYB 1LWUA 4AYCA 1X9VA 5CCGA 3V2RA 5AW3B 2NPSA 1J1EC 1FZAA 5CCHA 3HD7D 2HPCA 3SWFA 1WT6A 5KTBA 1LWUB 5AVXB 3NTNA 5APTA 2BASA 3VP8A 1L4AA 3HE5B 3P8MC 3KQGA 3TNUB 5AVZB 1FAVA 3RK2B 2YKPA 1FU1A 2C9NY 3NFQA 4OH8B 2FFDB 1NAFA 1IK9A 3V5BA 2A45G 3VMXA 4C46A 4WY4C 1S9KD 2J58A 1EQ7A 1KILC 1MFZA 5CCHD 2GUVA 3HD7B 3OAKA 3B5NB 3MD0A 5AVTB 2IX7C 3RK3C 2N1TC 2KOGA 1L4AB 3EQ2A 3HUSA 1M1JB 3M9BA 4I1LA 2PP6A 1A02F 1RE4C 3A3YB 1JOCA 2OYHC 5AW6B 2WSFH 1GW4A 3V4QA 1J2JB 5AW1B 2E42A 1JMMA 5KJ7A 4ZKPA 2A45H 3A2AA 2OYIA 1KFNA 3GHGA 3H6PA 1ZLLA 1XTGB 3HE5A 2XDJA 3O8ZA 4GIFA 3VN0A 3M9HA 1L4AC 5AW5B 4M3LA 4W7YA 1MZ9A 3A7OA 3B8EB 1CZQA 1J1DC 3RL0D 2O1JA 1LT9C 1GW3A 2YO2A 3GHGC 4N78E 1FZFA 1N86A 3HUSB 1GL2D 1M1JA 4C7NA 4JYBA 4WB4A 1PFIA 4LGDE 5BVZA 4WY4D 2IPPA 2CPSA 2HLOA 1JY2P 2R3CA 2NPSC 3MIWA 2JEEA 1FJPA 1JO5A 3IR9A 1HBWA 5CJ4A 1DX7A 1LWUC 1MV8A 4ZKUA 2H43A 3LIEA 2OYIB 3OJAB 1GU5A 1SFCB 3HD7A 2KB7P 2M8RA 2FKWB 1JCCA 3CI9A 1QL1A 1YTZI 3GHGB 1JY2N 3HUSC 2HYNA 1LT9A 1Z56A 5APUA 5CCHC 2YO3A 1HUCA 2HPCB 1HGVA 2JJLA 2Z4EA 3E1IA 3KDPB 1LTGC 1JY3O 4C7NB 1KILA 3B5NC 4JF7A 1G2CA 3HE4B 2Z5HA 2H8PD 2OYIC 1X79B 2XZRA 1JY2O 3UIAA 3H32B 1H88A 3L37A 1CI6B 5AW0B 1NOHA 4B86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KIL C;  3VOP A;  4WY4 A;  5CCH D;  3HD7 B;  3B5N B;  2NPS D;  1N7S B;  3RK3 C;  2N1T C;  2KOG A;  5KJ7 C;  1L4A B;  3PP5 A;  1JTH A;  3B5N A;  2PP6 A;  2WZ7 A;  2HG5 D;  3KYQ A;  1NHL A;  3RK2 C;  1URQ B;  4WY4 B;  5CCG D;  5KJ7 A;  1T3J A;  1XTG B;  3HD7 C;  3P8C E;  2XDJ A;  3B5N D;  2N1T B;  1N7S D;  1L4A C;  1GL2 A;  2YMY A;  4W80 A;  4W7Y A;  3RK3 D;  2HFE D;  1SFC C;  3RL0 D;  1URQ C;  4N78 E;  3RL0 B;  1GL2 D;  3TSI A;  1N7S A;  4LGD E;  4WY4 D;  1URQ A;  2NPS C;  3HTK B;  5KJ7 D;  2N1T D;  1L4A D;  1SFC B;  3HD7 A;  5CCG A;  2M8R A;  3M0D C;  3RK2 D;  1GL2 B;  1JTH B;  1HVV A;  3RL0 C;  5CCG C;  1KIL D;  5CCH C;  2NPS A;  1KIL B;  4W7Z A;  5CCH A;  3HD7 D;  2NPS B;  1KIL A;  3B5N C;  4JF7 A;  1N7S C;  3RK3 B;  2H8P D;  1L4A A;  1URQ D;  1SFC D;  3RK2 B;  2N1T A;  1GL2 C;  4OH8 B;  4WY4 C;  1SFC A; 
#chains in the Genus database with same CATH topology
 1ZN5 A;  4R4L A;  1KFM A;  3MZW B;  4UB8 H;  1KYO H;  2W83 C;  1QL2 A;  3L70 G;  3PTZ A;  3H1J J;  4C7R A;  3AEF C;  1BGY J;  2P67 A;  3G3Z A;  4JPZ B;  5KAI H;  1E79 H;  1BE3 E;  1NU1 J;  1VDF A;  2KYV A;  2ZJS E;  4IFM A;  1E5W A;  2RH0 A;  4L73 A;  5CMZ A;  3WUV A;  2G3A A;  2W27 A;  1VF5 D;  2W6B A;  3BRT B;  3PP5 A;  1BGY G;  1PIX A;  2WTY A;  5DJT B;  1N7L A;  1N2D C;  1RHZ B;  1YQ3 C;  3MGN A;  1LGH B;  3M9Q A;  2AXT H;  1BCC D;  4YPC A;  1NJI Q;  1SQP J;  1HJ0 A;  3LW5 J;  3USS A;  3V6I A;  3AEB C;  2K3R A;  3HE4 A;  3KYQ A;  2Y0D A;  1NVO A;  3GG2 A;  2MKV A;  5AVV B;  5AW9 B;  3RK3 E;  1KMI Z;  2IBZ I;  2GM4 A;  2IZ0 A;  3Q3D A;  2GUS A;  1OX3 A;  2D2C C;  1NAY A;  2Y9Y A;  3L73 E;  4PV1 B;  1G2C B;  2R3S A;  3K5B A;  5CCG D;  1LTI C;  1L0L G;  4H13 B;  3G6E P;  3CCU P;  1JNM A;  1L0L K;  2O1K A;  4H0L C;  1T3J A;  3P8C D;  1GU4 A;  2CPB A;  1SS1 A;  2YKQ A;  1KQL A;  4LLH A;  3CCE P;  3F89 A;  2A06 D;  3CWB E;  1L0L J;  3TGU J;  1L0N K;  2Q9I A;  1OW7 A;  3VP9 A;  1N73 C;  3B5N D;  5GTI E;  1IJD B;  1LP1 B;  4CPG A;  1GL2 A;  1NWQ A;  1KTM A;  1W2E A;  1T3U A;  3NMD A;  5KLI B;  1OXZ A;  3AED C;  1G1I A;  1SFC C;  4I7Z B;  2Z5I A;  5APW A;  1R5L A;  4GOD A;  3MUD C;  4LC1 A;  1USD A;  1PV3 A;  2O3J A;  5AW2 B;  2K1A A;  4EDF A;  2M5A A;  4N3Y B;  3W67 A;  2FYU D;  5CHX A;  4IOI H;  3H1H J;  3O6Q B;  2K9J B;  4PV1 C;  2WIT A;  2WVR A;  1N7S A;  4TLF A;  3TSI A;  1S1C X;  2KZJ A;  2L5G B;  1KZU B;  1NU1 K;  4BXL A;  4RES B;  2L91 A;  1QGK B;  3H1H G;  2IBZ E;  3ITK A;  4NPE A;  2YXR B;  2GA1 A;  2W90 A;  4WWI A;  3ZDM A;  1ZRT E;  2IFN A;  3U59 A;  2E5T A;  4ASW A;  3HTK B;  3WU2 H;  2QVA A;  1ZP0 C;  1KIL E;  4KT0 J;  1IFJ A;  5AVW B;  1GK4 A;  5KLI C;  2N9Y B;  2PFX A;  4H44 B;  1FZC C;  2LR2 A;  4BRY A;  1L4A D;  1J1D B;  1KYO E;  1P84 D;  3H25 A;  1NTM G;  3H1K G;  4JYC A;  1BDD A;  1T2K D;  3BCC E;  1ZV8 A;  2NRG A;  3O6Q A;  1LT9 B;  4Y99 B;  3BAT A;  2WSE H;  3RK2 D;  5KLV G;  1JTH B;  1AQT A;  4I2L C;  1X0T A;  3RL0 C;  1KOR A;  2K9Y A;  1NTM J;  3H1K J;  1BSH A;  3OA7 A;  3V4W A;  4PD4 D;  3QWO C;  1NKZ B;  3MHV A;  4EI2 A;  1SQV K;  1NTZ G;  1PPJ G;  1RH5 B;  2IYP A;  3CC7 P;  1IK7 A;  1FZE A;  1KIL B;  2M3E A;  2WPR A;  1SQQ E;  4WBA A;  3TGU E;  1GTW A;  3CME P;  2NPS B;  3CPW O;  1PZQ A;  1WRG A;  1DH3 A;  1CSB A;  1S5L E;  1YJW P;  1BE3 J;  1N7S C;  1NU1 E;  2OAR A;  2P1J A;  3RK2 B;  3S4R A;  3I55 P;  1TU3 F;  2XU6 A;  3L72 D;  1SQP G;  1XTC C;  3KPE A;  4BRY B;  2OYH A;  3CC2 P;  3L73 J;  2M5A B;  1JUN A;  3H32 A;  1NTZ D;  1PPJ D;  1M1J C;  1UII A;  2SPZ A;  3FX0 A;  3L71 E;  2XNX A;  3MUD A;  1SQP D;  4Y28 J;  5L8R J;  2W8Z A;  1RF0 A;  1ZW0 A;  1LTS C;  3U1C A;  3OW2 O;  2FFD A;  4HJG H;  1URQ D;  1SFC D;  2BCC G;  1FJK A;  5BU8 B;  1FOS F;  2N1T A;  2R32 A;  3EFF K;  1GL2 C;  1KB9 H;  2KSJ A;  2FYU J;  2J5U A;  2KSE A;  3VMY A;  2E43 A;  3BAS A;  1BE3 D;  1DEB A;  5KKZ B;  2G8Y A;  1MFT A;  1S72 P;  5CJ0 A;  4YXD C;  1SFC A;  2H7H A;  1BDC A;  3L4F A;  3IFM A;  3VOP A;  1BGY E;  4DCK A;  4IL6 E;  1IZN B;  2WSS H;  2E75 B;  2UWJ E;  1H89 A;  2A06 G;  1GD2 E;  3CC4 P;  5KLV K;  2I8D A;  1SQQ K;  2KZI A;  1N7S B;  1P84 H;  3GW6 A;  1RF1 B;  1SQX G;  3M0A A;  1LTJ C;  5KJ7 C;  1HH0 A;  1LJ2 A;  3VYI A;  1T6A A;  2E74 B;  1JTH A;  1L0L D;  2QJY B;  2FYZ A;  2VRS A;  2Y0C A;  3AE5 C;  2KNC B;  3L75 G;  4O9B A;  1K9M Q;  1DEE G;  1SQB K;  1OVV A;  3HRN A;  3EWK A;  5AVQ B;  1JY3 P;  2WZ7 A;  1K73 Q;  1ZOY C;  2YIU B;  3C8V A;  1CI6 A;  2LXB A;  4PV1 D;  3CCV P;  1NTK D;  1EXJ A;  1IFD A;  1T2K C;  2P10 A;  1GDT A;  1WMK A;  2I1K A;  1SP4 A;  1EDL A;  3A0B E;  1QLE D;  1YHQ P;  5APX A;  4GDO A;  1VPC A;  5KAI E;  5AW7 B;  3D71 A;  1MUU A;  3L74 G;  1AFO A;  2IBZ D;  2Q7C A;  3CXH E;  1SQX J;  3AEE C;  2P58 A;  2QJK C;  1FE6 A;  3AE7 C;  3HD7 C;  3RL0 g;  1NTK G;  1HTL C;  3H1J G;  2ZFC A;  3MTU E;  3WU2 E;  3NXS A;  1S9K E;  4I6M C;  2N1T B;  1N7S D;  2HR3 A;  3L74 J;  3N4X A;  4K35 A;  1RF0 C;  4U3F E;  3TF5 A;  2ZVO B;  1NU1 G;  2YMY A;  4W80 A;  3V2N A;  1IFN A;  1VF5 B;  2ZAE B;  1JB0 J;  3SWK A;  1G1J A;  1Q81 Q;  1FZC B;  1EZV E;  3JSV C;  2QEX P;  1YJ9 P;  3Q1M A;  2POH A;  5E79 E;  1N73 A;  1FC2 C;  2ZVN B;  1SQP K;  5AVR B;  1RE3 C;  3JCU E;  1SQB J;  2P2U A;  4Y99 C;  1SQV E;  1PL5 A;  1LTJ A;  1URQ C;  4GKG A;  3T97 A;  5APQ A;  2OYH B;  1ZXG A;  3CX5 D;  2AEF A;  1FZG A;  2BCC J;  3U1A A;  1KB9 D;  2D2C B;  3H1I G;  4K3A A;  2Q6Q A;  3H1H D;  2QM7 A;  1FZB A;  1NU1 D;  4DOJ A;  4DZO A;  2ZXE B;  3N7N A;  3TK1 A;  2FXM A;  1VQL P;  3VMZ A;  4IFD K;  1JM0 A;  3CXH D;  4KHX A;  3KZI E;  1SQQ D;  1AQ5 A;  1X8Y A;  2WPQ A;  4Z1M H;  4UB8 E;  3AEA C;  2BCC D;  3A5T A;  1GK6 A;  2WSC J;  3A0B H;  3H1L D;  1FZC A;  2P7J A;  1S2E A;  2N1T D;  1SQB D;  3G9R A;  3AE8 C;  1LT1 A;  2B87 B;  1M7L A;  2C0W A;  4EYY Q;  2M0B A;  1SQV D;  1QVF O;  3M0D C;  2BEZ F;  1SQQ G;  3V2Q A;  1GL2 B;  3I5C A;  4NPF X;  2AEJ A;  1HVV A;  2FFD C;  5C39 A;  5M1B A;  1AVY A;  5CCG C;  3CL3 D;  1KIL D;  3Q5S A;  3H1L E;  1R5S A;  1SLQ A;  2IZ1 A;  2KIK A;  2WQY C;  1N73 B;  2A45 I;  2H89 C;  4BWN A;  3G71 P;  2IYO A;  5EFW B;  2LXC B;  2Q5U A;  1OWA A;  3FXD A;  5E79 H;  4AUW A;  3JC2 2;  1W5C E;  2QSI A;  4W7Z A;  4H13 D;  2LKM A;  3FXE A;  4XE5 B;  1IFM A;  5B5E H;  4N6J A;  1OVR A;  3TYY A;  1EDI A;  2OTK E;  3L36 A;  1EXI A;  3RK3 B;  1RF1 C;  2R5B A;  3L35 A;  1U7M A;  2FYU K;  1LTJ B;  3M0D A;  1NTM K;  1NKN A;  1DD3 A;  1LTT C;  1NH4 A;  3AE9 C;  1NTK E;  2KLV A;  2WSC H;  3C9I A;  3KXD A;  4N78 D;  4RO0 A;  3SWY A;  4H44 C;  1NO4 A;  4IL6 X;  3VTP C;  2QIW A;  3CCS P;  1CW5 A;  1JCD A;  2OGU A;  2O01 H;  1KQG B;  4D6T G;  1IFI A;  1A02 J;  1S3J A;  2YXQ B;  4PJ0 E;  2Q3I A;  2HOD B;  5B66 H;  2BEQ D;  1VQK P;  3D6Y A;  3KHU A;  1BCC E;  1OIP A;  1OW8 A;  1KB9 I;  2A06 E;  2JWA A;  3CWB D;  3CLQ A;  3L72 E;  3L70 D;  4L76 A;  4OVN F;  1HWT C;  1JY3 N;  1EDJ A;  1KYO I;  1FBM A;  2WT7 A;  1NTZ K;  1EC5 A;  1YYC A;  2WSE J;  1RE3 A;  2H88 C;  2YNY A;  2C0X A;  4L75 A;  2N9B A;  4WY4 A;  2XKM A;  4OGQ D;  3JCU H;  2B87 A;  2KI7 B;  5AW8 B;  1HJB A;  4EOT A;  5APV A;  4TT3 H;  4XA4 A;  2NPS D;  3L74 D;  1RE4 A;  3EFG A;  3PHL A;  1PP9 E;  1ZR2 A;  3BCC D;  2C9L Y;  1FDM A;  1QEX A;  5CBN A;  2RKL A;  3B5N A;  3I56 P;  1RY3 A;  1SQB G;  2XND H;  2XV5 A;  2KP8 A;  2QM8 A;  2FYU E;  2QE7 H;  3L75 D;  4EIJ A;  3R2P A;  3L73 G;  1EZV D;  4PD4 H;  2DW3 A;  2E76 C;  1L0L E;  2HG5 D;  3AE2 C;  2ZT9 C;  1NHL A;  2M3B A;  3RK2 C;  3BVH A;  5AW4 B;  2FXP A;  2Y0E A;  2YKO A;  1NTK K;  1PP9 J;  1URQ B;  5APS A;  2B88 A;  1S4X A;  2W6A A;  3V2P A;  3L71 J;  1VQ8 P;  3BCC J;  1SVF A;  2MJZ A;  3H1J E;  4WY4 B;  3SFE C;  3BRV B;  1AVO A;  1OVU A;  1SQX K;  1YTZ T;  2WWW A;  1RF1 A;  4ASV A;  1HGZ A;  5APY A;  1Q86 Q;  2O01 J;  3SFD C;  1OFC X;  3P8C E;  4RJT A;  3CCM P;  3CCQ P;  1ZR4 A;  3C1L A;  1H8A A;  2IFM A;  1SQV G;  3W68 A;  1Y9B A;  3QH9 A;  3RK3 D;  4UB6 E;  2E74 D;  2FYN B;  1PGO A;  3LW5 H;  2HFE D;  3RBZ A;  2ZYD A;  3P7K A;  4H44 D;  4IFF A;  4KJM A;  3WUU A;  5BU5 A;  2WT7 B;  4HH2 A;  2ZT9 B;  1IC2 A;  2R5D A;  3L71 G;  3M91 A;  3PRJ A;  1FOS E;  1YJN P;  2IBZ G;  4D6T J;  4D6T E;  3RL0 B;  3M06 A;  4L74 A;  2AEM A;  1LTA C;  4U3F D;  1L0N J;  4GT1 A;  3CXH H;  1LTB C;  4H13 C;  1T8Z A;  4HYT B;  2K9J A;  3CXH I;  1BCC J;  5AVS B;  2HOD A;  1IO4 A;  1J1E B;  1URQ A;  2J59 M;  2JKV A;  4PD4 E;  1KC8 Q;  3KZI H;  1QVG O;  2WPS A;  1L0N D;  5AVU B;  3P32 A;  5KJ7 D;  3TNU A;  3LID A;  3IN6 A;  2OTL P;  1RQV A;  4D6T D;  1Q2N A;  1NTK J;  1PGJ A;  1USE A;  1GZL A;  3H1H E;  3HTK A;  3II6 A;  4AQR D;  1VQP P;  1VF5 C;  2OYI A;  3CCL P;  2OYO A;  2PAJ A;  2I1J A;  3ABV C;  1LWU A;  1LNQ A;  1SQX D;  3L75 E;  5AVY B;  1X9V A;  4OWF A;  5TIS E;  4AYC A;  3B71 A;  1U7J A;  1NTZ E;  1PPJ E;  3MP7 B;  5CCG A;  1VQ4 P;  2IDB A;  2ZT9 D;  3S9O A;  2KK7 A;  4YTP C;  1KD1 Q;  1RQU A;  5K5G B;  2E5Y A;  2QG4 A;  1VQ7 P;  2V7Q H;  3V2R A;  3H1L J;  5TJH A;  4DJG A;  1M1K Q;  3A0H E;  4PJ0 H;  3CCJ P;  1YQ4 C;  1PGQ A;  2NPS A;  5AW3 B;  2WPV B;  3BCC G;  5B66 E;  2QA4 P;  1ZME C;  1Q7Y Q;  1J1E C;  2W6J H;  1FZA A;  3E1R A;  5CCH A;  4QMA A;  3HD7 D;  5DJU B;  1JEK A;  3GMA A;  2HPC A;  3PJS K;  3AE6 C;  3SWF A;  1WT6 A;  5KTB A;  2KS1 B;  2AXC A;  1LWU B;  3Q5R A;  2Q1K A;  2QJY C;  3TGU G;  5AVX B;  2E76 D;  3NTN A;  5APT A;  5B5E E;  1DIP A;  2BAS A;  4U3F G;  3VP8 A;  1KQS O;  3L72 G;  1L4A A;  2K88 A;  3WUT A;  3D70 A;  3HE5 B;  3P8M C;  3KQG A;  2E76 B;  1KN7 A;  2YIU C;  3AEC C;  1UIX A;  1FAV A;  1M8O B;  2YKP A;  5AVZ B;  1SQP E;  2V4H A;  1FU1 A;  3GF3 A;  3CX5 H;  3IAO A;  1M57 D;  3NFQ A;  4U3F J;  5KLV D;  2C9N Y;  4OH8 B;  3D6Z A;  2FFD B;  1NAF A;  1L2P A;  2JWD A;  1IK9 A;  1U57 A;  4H0L D;  3V5B A;  1VQ9 P;  2A45 G;  4GOF A;  3VMX A;  4WY4 C;  4C46 A;  1S9K D;  1Y8A A;  2J58 A;  2RN0 A;  2JP3 A;  1EQ7 A;  1D7M A;  3H1I E;  4ZMD A;  2BCC E;  2KLU A;  4PD4 I;  1VQN P;  1KIL C;  1MFZ A;  1FDI A;  5CCH D;  1SQV J;  2CK3 H;  2GUV A;  3FGA D;  4IL6 H;  1OMI A;  1VQO P;  1IFP A;  3PLN A;  1K8A Q;  2QJK B;  3HD7 B;  3B5N B;  3OAK A;  1NTM D;  3H1K D;  3MD0 A;  2IX7 C;  4R4M A;  5AVT B;  3RK3 C;  1MKM A;  2FBW C;  2N1T C;  2KOG A;  2ZYG A;  3FWN A;  3L73 D;  3Q5P A;  1L4A B;  1H0T A;  3L72 J;  1YIJ P;  2KUB A;  2JO1 A;  3EQ2 A;  3L70 E;  3HUS A;  4DT0 A;  1M1J B;  3M9B A;  1KB9 E;  2K37 A;  4I1L A;  1YIT P;  1NGM B;  1LP1 A;  2PP6 A;  1A02 F;  1DD4 A;  5KLV E;  1FS0 E;  1RE4 C;  1SQX E;  3R4Y A;  3A3Y B;  3RBX A;  1VQM P;  1JOC A;  2OYH C;  2R44 A;  1YI2 P;  5AW6 B;  2WSF H;  2OQQ A;  3FWL A;  3L71 D;  3AE1 C;  1GW4 A;  1PP9 D;  1J2J B;  3CX5 I;  5AW1 B;  1JMB A;  1JMM A;  3V4Q A;  4ZNC A;  2E42 A;  3IF4 A;  5KJ7 A;  4ZKP A;  1S5L H;  1ZRT D;  2A45 H;  4YXW H;  3TGU D;  3H1L G;  1W2B O;  3H1I J;  3A2A A;  1P84 I;  1KFN A;  4JBZ A;  4HKZ H;  2QJP B;  3GHG A;  3H6P A;  1ZLL A;  1XTG B;  2E75 C;  1KQF B;  2Y9Z A;  1H0T B;  3HE5 A;  4GOE A;  3RGU A;  3AEG C;  2AXT E;  1HF9 A;  1FDO A;  2XDJ A;  3O8Z A;  1YBK A;  3E7K A;  4GIF A;  4OGQ C;  3VN0 A;  1VQ6 P;  1Q90 D;  3M9H A;  1L4A C;  5AW5 B;  1M56 D;  4M3L A;  4W7Y A;  3GF7 A;  1MZ9 A;  3A7O A;  3F5H A;  3AE3 C;  2KXP B;  3B8E B;  5CBO A;  1CZQ A;  5GTH E;  1J1D C;  5GTH H;  2PGD A;  2OTJ P;  3RL0 D;  2O1J A;  2RMZ A;  1QX8 A;  1LT9 C;  2KS1 A;  1M90 Q;  1GW3 A;  2YO2 A;  1L0N G;  3GHG C;  1VL2 A;  1EDK A;  4N78 E;  1GMJ A;  1N86 A;  3AE4 C;  3HUS B;  1FZF A;  1GL2 D;  1M1J A;  4C7N A;  4JYB A;  3T97 B;  4WB4 A;  3G4S P;  4LGD E;  3WMM 0;  2YMK A;  1BCC G;  5BVZ A;  1PFI A;  1AA0 A;  5KAF H;  1SQQ J;  4WY4 D;  5H2F H;  2IPP A;  1BGY D;  2CPS A;  1JY2 P;  2HLO A;  2NZ2 A;  4H0L B;  2FXO A;  3H1J D;  2R3C A;  1BE3 G;  2PRR A;  2QJP C;  2WMM A;  4WVZ A;  3CMA P;  2V7Q J;  2NPS C;  3MIW A;  4MN4 C;  3Q2Y A;  2JEE A;  1FJP A;  1JO5 A;  3IR9 A;  2O01 N;  3PH0 A;  4OGQ B;  1HBW A;  1KV4 A;  5CJ4 A;  1K05 A;  1DX7 A;  1LWU C;  1MV8 A;  2B9B A;  3SSU A;  4ZKU A;  3LIE A;  2H43 A;  2OYI B;  2FYN C;  3OJA B;  1PP9 G;  2ITA A;  1GU5 A;  1OW6 A;  1SFC B;  3HD7 A;  1SQB E;  4I7Z C;  3TNU B;  2FYU G;  2KB7 P;  2M8R A;  2FKW B;  5KAF E;  2FY8 A;  1JCC A;  3CI9 A;  1QL1 A;  1YTZ I;  1AV1 A;  2D2C D;  2JR8 A;  2WSF J;  1OZH A;  1K04 A;  3GHG B;  1JY2 N;  2Q3E A;  1PGP A;  2HYN A;  3HUS C;  4JQ0 D;  1LT9 A;  5GTI H;  5KKZ C;  5KLV J;  1Z56 A;  3L74 E;  5APU A;  5CCH C;  1NTM E;  3H1K E;  2ZYA A;  2YO3 A;  1HUC A;  3CWB G;  3H1I D;  2HPC B;  1HGV A;  2JJL A;  2Z4E A;  1EZV I;  2KNC A;  3E1I A;  3VMA A;  2ZXX A;  3KDP B;  1Q82 Q;  1NTZ J;  1NYH A;  4A7P A;  1LTG C;  1JY3 O;  4C7N B;  1KIL A;  3A0H H;  2E75 D;  3B5N C;  1G2C A;  1X22 A;  1Y47 A;  3HE4 B;  3L75 J;  4JF7 A;  4U7J A;  4UB6 H;  3TDK A;  1VQ5 P;  3CCR P;  1N8R Q;  2Z5H A;  1EZV G;  2E74 C;  2H8P D;  4RKU J;  1R8E A;  3CX5 E;  3GLM A;  2OYI C;  3CD6 P;  1X79 B;  2XZR A;  4XFJ A;  3B4S A;  1KYO D;  1JY2 O;  1P84 E;  3UIA A;  1BSN A;  5TIS H;  2JDI H;  2QRX A;  3H32 B;  1S5L X;  1H88 A;  1AJY A;  4NPD A;  3L37 A;  5H2F E;  4HB1 A;  3S1K A;  2B89 A;  1CI6 B;  3L70 J;  3CWB J;  5AW0 B;  1L0N E;  1NOH A;  4B86 A; 
#chains in the Genus database with same CATH homology
 1ZN5 A;  1KFM A;  1QL2 A;  4C7R A;  2P67 A;  3G3Z A;  1VDF A;  2KYV A;  4IFM A;  1E5W A;  5CMZ A;  2W27 A;  2W6B A;  3BRT B;  3PP5 A;  2WTY A;  1N7L A;  1N2D C;  3MGN A;  1LGH B;  3M9Q A;  5AVV B;  3HE4 A;  3KYQ A;  2GM4 A;  2GUS A;  1G2C B;  5CCG D;  1LTI C;  1JNM A;  1L0L K;  2O1K A;  1T3J A;  3P8C D;  2CPB A;  2YKQ A;  4LLH A;  1KQL A;  1L0N K;  2Q9I A;  3VP9 A;  1N73 C;  3B5N D;  1IJD B;  1GL2 A;  1W2E A;  1T3U A;  3NMD A;  1OXZ A;  1G1I A;  1SFC C;  5APW A;  2Z5I A;  4LC1 A;  5AW2 B;  4N3Y B;  5CHX A;  3TSI A;  2WIT A;  1N7S A;  2L5G B;  1KZU B;  1NU1 K;  4RES B;  2IFN A;  3U59 A;  3HTK B;  1IFJ A;  5AVW B;  1GK4 A;  1FZC C;  1L4A D;  1J1D B;  4JYC A;  1T2K D;  1ZV8 A;  4Y99 B;  1LT9 B;  3BAT A;  2WSE H;  3RK2 D;  1JTH B;  4I2L C;  3RL0 C;  3OA7 A;  3V4W A;  1NKZ B;  1SQV K;  1KIL B;  1FZE A;  2WPR A;  4WBA A;  1GTW A;  2NPS B;  1DH3 A;  1WRG A;  1CSB A;  1FDM A;  1N7S C;  2OAR A;  2P1J A;  2XU6 A;  2OYH A;  1XTC C;  3KPE A;  1JUN A;  3H32 A;  1M1J C;  3MUD A;  2XNX A;  3U1C A;  1RF0 A;  1LTS C;  2FFD A;  1URQ D;  1SFC D;  1FJK A;  5BU8 B;  1FOS F;  2N1T A;  2R32 A;  1GL2 C;  2KSJ A;  3VMY A;  2E43 A;  3BAS A;  1DEB A;  5CJ0 A;  1SFC A;  2H7H A;  3L4F A;  3IFM A;  3VOP A;  1H89 A;  1GD2 E;  5KLV K;  1SQQ K;  1N7S B;  1RF1 B;  3M0A A;  1LTJ C;  5KJ7 C;  1HH0 A;  3VYI A;  1JTH A;  2FYZ A;  2VRS A;  4O9B A;  3HRN A;  1SQB K;  5AVQ B;  1JY3 P;  2WZ7 A;  1CI6 A;  1GDT A;  1IFD A;  1T2K C;  2I1K A;  1SP4 A;  5APX A;  1VPC A;  5AW7 B;  1MUU A;  1AFO A;  2Q7C A;  3HD7 C;  1HTL C;  3MTU E;  2ZFC A;  1S9K E;  1GU4 A;  3NXS A;  4I6M C;  2N1T B;  1N7S D;  3N4X A;  1RF0 C;  2YMY A;  4W80 A;  3V2N A;  1IFN A;  1FZC B;  1G1J A;  2POH A;  1N73 A;  1SQP K;  5AVR B;  1RE3 C;  3VTP C;  2P2U A;  4Y99 C;  3T97 A;  2OYH B;  1LTJ A;  1URQ C;  4GKG A;  5APQ A;  1FZG A;  3U1A A;  2QM7 A;  1FZB A;  4DOJ A;  4DZO A;  2ZXE B;  3N7N A;  3TK1 A;  2FXM A;  3VMZ A;  4IFD K;  4KHX A;  1AQ5 A;  1X8Y A;  2WPQ A;  1FZC A;  3A5T A;  1GK6 A;  2P7J A;  2N1T D;  1M7L A;  2C0W A;  3M0D C;  3V2Q A;  1GL2 B;  3I5C A;  1HVV A;  2FFD C;  5CCG C;  3CL3 D;  1KIL D;  1SLQ A;  1N73 B;  2A45 I;  2Q5U A;  1OWA A;  4AUW A;  4W7Z A;  2LKM A;  4XE5 B;  1IFM A;  4N6J A;  3TYY A;  3L36 A;  3RK3 B;  1RF1 C;  2R5B A;  3L35 A;  2FYU K;  3M0D A;  1LTJ B;  1NTM K;  1NKN A;  1NH4 A;  1LTT C;  3C9I A;  5AW9 B;  2KLV A;  2WSC H;  4N78 D;  3SWY A;  1NO4 A;  1CW5 A;  1JCD A;  2O01 H;  1IFI A;  1A02 J;  2Q3I A;  2HOD B;  1HWT C;  3CLQ A;  1JY3 N;  1FBM A;  2WT7 A;  1NTZ K;  1YYC A;  1RE3 A;  2YNY A;  2C0X A;  2N9B A;  4WY4 A;  2XKM A;  5AW8 B;  1HJB A;  4EOT A;  5APV A;  4XA4 A;  2NPS D;  1RE4 A;  3EFG A;  1ZR2 A;  2C9L Y;  3B5N A;  1NWQ A;  1RY3 A;  2XV5 A;  2KP8 A;  2QM8 A;  4EIJ A;  3R2P A;  2HG5 D;  1NHL A;  2M3B A;  3RK2 C;  3BVH A;  5AW4 B;  2YKO A;  5APS A;  3V2P A;  1NTK K;  1URQ B;  3WMM 0;  2W6A A;  1SVF A;  2MJZ A;  4WY4 B;  3BRV B;  1SQX K;  1YTZ T;  2WWW A;  1RF1 A;  1HGZ A;  5APY A;  3P8C E;  1ZR4 A;  1H8A A;  2IFM A;  3RK3 D;  3LW5 H;  2HFE D;  3P7K A;  4IFF A;  5BU5 A;  2WT7 B;  4HH2 A;  3M91 A;  1IC2 A;  2R5D A;  1FOS E;  3RL0 B;  3M06 A;  1LTA C;  4GT1 A;  1LTB C;  1T8Z A;  4HYT B;  5AVS B;  2HOD A;  1IO4 A;  1J1E B;  1URQ A;  2J59 M;  2WPS A;  5AVU B;  3P32 A;  5KJ7 D;  3TNU A;  3LID A;  3II6 A;  3HTK A;  1GZL A;  4AQR D;  2PAJ A;  2I1J A;  5AVY B;  1LWU A;  4AYC A;  1X9V A;  5CCG A;  3V2R A;  5AW3 B;  2NPS A;  1J1E C;  1FZA A;  5CCH A;  3HD7 D;  2HPC A;  3SWF A;  1WT6 A;  5KTB A;  1LWU B;  5AVX B;  3NTN A;  5APT A;  2BAS A;  3VP8 A;  1L4A A;  3HE5 B;  3P8M C;  3KQG A;  3TNU B;  5AVZ B;  1FAV A;  3RK2 B;  2YKP A;  1FU1 A;  2C9N Y;  3NFQ A;  4OH8 B;  2FFD B;  1NAF A;  1IK9 A;  3V5B A;  2A45 G;  3VMX A;  4C46 A;  4WY4 C;  1S9K D;  2J58 A;  1EQ7 A;  1KIL C;  1MFZ A;  5CCH D;  2GUV A;  3HD7 B;  3OAK A;  3B5N B;  3MD0 A;  5AVT B;  2IX7 C;  3RK3 C;  2N1T C;  2KOG A;  1L4A B;  3EQ2 A;  3HUS A;  1M1J B;  3M9B A;  4I1L A;  2PP6 A;  1A02 F;  1RE4 C;  3A3Y B;  1JOC A;  2OYH C;  5AW6 B;  2WSF H;  1GW4 A;  3V4Q A;  1J2J B;  5AW1 B;  2E42 A;  1JMM A;  5KJ7 A;  4ZKP A;  2A45 H;  3A2A A;  2OYI A;  1KFN A;  3GHG A;  3H6P A;  1ZLL A;  1XTG B;  3HE5 A;  2XDJ A;  3O8Z A;  4GIF A;  3VN0 A;  3M9H A;  1L4A C;  5AW5 B;  4M3L A;  4W7Y A;  1MZ9 A;  3A7O A;  3B8E B;  1CZQ A;  1J1D C;  3RL0 D;  2O1J A;  1LT9 C;  1GW3 A;  2YO2 A;  3GHG C;  4N78 E;  1FZF A;  1N86 A;  3HUS B;  1GL2 D;  1M1J A;  4C7N A;  4JYB A;  4WB4 A;  1PFI A;  4LGD E;  5BVZ A;  4WY4 D;  2IPP A;  2CPS A;  2HLO A;  1JY2 P;  2R3C A;  2NPS C;  3MIW A;  2JEE A;  1FJP A;  1JO5 A;  3IR9 A;  1HBW A;  5CJ4 A;  1DX7 A;  1LWU C;  1MV8 A;  4ZKU A;  2H43 A;  3LIE A;  2OYI B;  3OJA B;  1GU5 A;  1SFC B;  3HD7 A;  2KB7 P;  2M8R A;  2FKW B;  1JCC A;  3CI9 A;  1QL1 A;  1YTZ I;  3GHG B;  1JY2 N;  3HUS C;  2HYN A;  1LT9 A;  1Z56 A;  5APU A;  5CCH C;  2YO3 A;  1HUC A;  2HPC B;  1HGV A;  2JJL A;  2Z4E A;  3E1I A;  3KDP B;  1LTG C;  1JY3 O;  4C7N B;  1KIL A;  3B5N C;  4JF7 A;  1G2C A;  3HE4 B;  2Z5H A;  2H8P D;  2OYI C;  1X79 B;  2XZR A;  1JY2 O;  3UIA A;  3H32 B;  1H88 A;  3L37 A;  1CI6 B;  5AW0 B;  1NOH A;  4B86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...