3A0BH

Crystal structure of br-substituted photosystem ii complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
64
structure length
64
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein
publication title Location of chloride and its possible functions in oxygen-evolving photosystem II revealed by X-ray crystallography
pubmed doi rcsb
total genus 10
structure length 64
sequence length 64
chains with identical sequence h
ec nomenclature
pdb deposition date 2009-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 3a0bH01
5B5EH 1S5LH 2AXTH 5B66H 4UB8H 3A0BH 5KAIH 3A0HH 3KZIH 4UB6H 3WU2H 3JCUH 5KAFH 4PJ0H 5E79H 5GTHH 5TISH 4IL6H 5H2FH 5GTIH
chains in the Genus database with same CATH superfamily
3TNUB 1CI6B 2OYOA 1GL2A 2YXQB 1PGOA 1YJWP 2FXOA 2O01H 1KQSO 3TNUA 2AEMA 1AJYA 3TGUJ 2YMKA 2Q9IA 1RF1C 1K04A 2WSFJ 1T2KC 4I1LA 1OW7A 3PP5A 1NU1K 1MKMA 1N86A 4GODA 3CXHH 4PD4D 4RO0A 1DX7A 2OGUA 2Z4EA 3QH9A 1OW8A 3KZIH 1VQMP 2QG4A 3WUTA 5E79H 1BCCE 3MZWB 2K9YA 1NKZB 1KN7A 1LTJC 4H0LD 1EDKA 1U57A 3LIDA 2LXBA 1DEEG 3L73E 2FYUK 4ASWA 3Q5SA 3V5BA 2B87B 2QM7A 2O01N 1IFDA 3P8CD 3L71J 1E79H 1N73B 1BE3E 2K1AA 1GU4A 3AE7C 3Q5PA 5CCGA 1JO5A 3TSIA 3CCJP 1K73Q 2ZYAA 2QJYB 3JCUE 3MP7B 4LC1A 1IFIA 2E5TA 3H1JD 3BCCG 2QJPC 3HE5B 5TISH 2NPSC 3G6EP 5APTA 2ITAA 2OYIA 2H89C 5AW9B 2FKWB 1GU5A 4WY4B 2W90A 5CJ4A 2XNXA 3HE5A 1VQ9P 4EI2A 1LTSC 2PP6A 4PV1D 3HE4A 3CI9A 3N7NA 4WY4A 2B89A 3RK3E 1NTKJ 3L71G 3LW5H 2VRSA 4R4LA 4NPFX 2QSIA 1FZEA 1SQPD 3AEGC 3CWBD 1QVFO 2WZ7A 2LR2A 1KYOD 1OWAA 1J1DB 1SS1A 3A0HH 2AXCA 1JY2P 3RK3B 3EWKA 1E5WA 2JWAA 3A5TA 3H32B 1L0LJ 2P10A 2OTKE 1WT6A 3H1ID 1VF5B 3H32A 2O1JA 1NU1E 2YKQA 1RE4C 3L72D 3OW2O 3FX0A 4EIJA 1U7JA 2HODB 1R5LA 2LKMA 1SQXK 1L4AB 1FZGA 2IPPA 3L75D 1OVUA 3GW6A 5CCHC 2W6BA 2HODA 2M3EA 1L4AA 3CCUP 3VMYA 2PAJA 1SQVD 1K8AQ 3IFMA 1AA0A 1KC8Q 4KHXA 2Y9ZA 4IFDK 1L0LG 4D6TD 4PD4I 2WSEH 1JEKA 3CX5H 2W6JH 1BE3J 1SQQK 1G2CB 1IK9A 1N7SA 2Z5IA 1WMKA 5AVTB 1VQLP 1NKNA 1EQ7A 2QRXA 2HPCB 3AEAC 2Y0CA 1GTWA 3GHGC 2KUBA 1YTZI 1X22A 2ZT9B 1NTMK 3I56P 3H1KJ 2HPCA 2POHA 1LP1B 4U3FE 3EFGA 3AE6C 2CK3H 5AVRB 3MUDA 3V2NA 2GM4A 1VQPP 2QJKC 1DD4A 3PH0A 5KLVG 5TJHA 3V2RA 2GUVA 1A02J 1FDOA 1RE3A 1HUCA 1BSHA 3V2PA 5APVA 1BE3G 2JJLA 2P1JA 2XNDH 5AW8B 2D2CB 5B5EE 3RL0C 2Y9YA 2JDIH 3II6A 1KILE 2JP3A 3H1KG 2WPQA 1EZVG 3H1HJ 3HD7C 3WMM0 3B5NB 1FE6A 1PGPA 2HYNA 5APUA 1SFCC 3CCLP 1NU1J 2WSSH 3B5NA 1FS0E 4GKGA 2QJPB 1NTZD 2OYHC 2RN0A 4EOTA 2DW3A 4TLFA 3F89A 1GL2C 1IFPA 2KK7A 3R2PA 2KNCB 3V4QA 2KSJA 2V7QJ 1M8OB 1L0ND 3L70J 2QEXP 3VTPC 2FYUJ 2KNCA 1G1JA 3CCEP 3IF4A 3NFQA 2E43A 3H1HG 3B4SA 2MKVA 2Q6QA 4IL6X 1JCCA 3CCRP 3CCMP 1VQOP 1JUNA 3M0AA 5AW5B 2IBZE 2K9JB 4JQ0D 2JO1A 2C0WA 3SSUA 2B9BA 1S2EA 3VN0A 2K9JA 4YXDC 3G3ZA 5H2FE 1KB9E 4JF7A 1Q2NA 4U3FJ 3L70G 3C9IA 3VOPA 3S9OA 4QMAA 1FAVA 2FYUG 4TT3H 1SQBK 1W2EA 5APWA 3KHUA 2R32A 3CX5I 3C1LA 5AVWB 2ZAEB 5CCGC 1RE4A 2W27A 3RK2B 3AE2C 1AQ5A 3W67A 3P8MC 1CW5A 2OYIC 3IAOA 3CD6P 1VPCA 1T3JA 3AE1C 4PJ0H 1URQB 4WY4C 1Z56A 3BCCD 1SP4A 1YITP 2AEFA 1JM0A 3RL0g 1URQA 3HUSB 3L74E 1PPJG 2FYNB 2M5AB 3HUSA 1HH0A 2M5AA 4IL6H 5KJ7A 3H1LJ 1JY3P 2R44A 4L73A 3M9BA 3ZDMA 1J1EB 2QJKB 3HD7D 1JOCA 3L71D 3RK3C 1H8AA 1FZCB 3L35A 4I2LC 4C46A 1S5LX 3B71A 1SQQJ 1IFJA 1HVVA 2L91A 2R5DA 1FZCA 1BGYJ 1GD2E 1VF5C 1AFOA 3W68A 1MUUA 2M3BA 2I1KA 1LTTC 3D6YA 1SQXG 1KQLA 5AW1B 3C8VA 4Y99B 2FY8A 1NTMJ 1HJBA 1L4AC 3H1LG 2A06E 1KFMA 3GG2A 3JC22 1SFCB 4H44D 1IC2A 1M1KQ 4N78D 3R4YA 5GTHE 4N6JA 1NJIQ 2KS1A 3MTUE 3NXSA 1N7SC 4CPGA 1JMBA 1SQQG 3AEBC 2KZIA 2RMZA 3E1IA 1P84D 1X79B 1BGYG 1L0LD 3CCSP 2XZRA 1NTMG 2ZT9C 2BCCE 1NGMB 3NMDA 3MUDC 4HJGH 3Q5RA 1JY2O 3M9QA 5CCGD 2E75D 5L8RJ 2FXMA 1RE3C 3L74J 1VQ5P 5CJ0A 4IFMA 4L75A 1LT1A 2N1TB 2KLVA 2E74C 4OH8B 4YXWH 3CXHD 5APSA 1HGVA 3IN6A 2N1TA 1CZQA 5KLVD 1D7MA 3WU2E 2D2CC 1VQKP 1W2BO 3JCUH 4PD4E 1BE3D 3Q1MA 4WY4D 3TGUG 1S5LE 3MIWA 1J2JB 3H6PA 3B5NC 1KFNA 3AE3C 3L4FA 3PRJA 1H89A 2OYIB 3H1KD 1HJ0A 1EZVD 1XTCC 2BEZF 1PP9J 1SQVK 3MGNA 2ZXEB 3VP8A 2Q1KA 2WSCH 3HE4B 3P8CE 2YIUB 1HBWA 2Y0EA 4YPCA 3D70A 4GOFA 2Z5HA 1SQBJ 4RJTA 3FXDA 2HFED 5BU5A 1T3UA 3H1JE 1RH5B 2E42A 5KLIB 2IZ1A 3BVHA 2HG5D 1T8ZA 2P67A 4WB4A 3USSA 1GDTA 5AVZB 2XKMA 3H1HD 1USDA 1PP9G 3E7KA 1LTAC 2H7HA 1DIPA 1USEA 3H25A 1EXJA 1LNQA 3AEEC 2BCCJ 1SQPE 3SWYA 2I8DA 3CWBE 1SQBG 2V7QH 1KYOE 3M06A 1P84I 4PV1B 1NTKG 4L76A 1RHZB 2A45H 4OWFA 3L70D 3RK2C 4HH2A 3U1AA 1BCCJ 2WPRA 1JY3N 2FYUD 4OVNF 2K37A 4OGQC 1JMMA 1CSBA 3WUVA 3H1IE 2ZT9D 1MFTA 4GIFA 3L73J 4Z1MH 1DD3A 3L72E 4WBAA 3RBZA 1ZRTD 4GDOA 1T2KD 1N7SB 1NTZK 1M90Q 1Q7YQ 1HF9A 1AV1A 2I1JA 3L75E 1URQC 2HLOA 3CXHI 3CX5D 4IOIH 4JYCA 2ZYGA 1PV3A 3BATA 3KDPB 1L0NK 3S4RA 3HUSC 1SQVE 2O3JA 3M9HA 2FYNC 1KQFB 2KSEA 5KJ7C 2P7JA 4BRYA 4AYCA 3U1CA 4UB8E 1VQNP 3KPEA 1BCCG 4D6TE 1FDMA 3AE5C 1PGQA 1HTLC 1PPJD 1LTIC 3L73G 1J1EC 2QM8A 3U59A 2Q3EA 5B5EH 3B5ND 2E74B 1RF0A 2WSCJ 3CC7P 3M0DA 2V4HA 3AEFC 1EZVI 1FZCC 2KYVA 2E76C 1YBKA 5GTIE 3TYYA 5KKZB 2NPSD 4DOJA 1NWQA 2QVAA 1XTGB 4ZNCA 1AVYA 5EFWB 2J5UA 1M7LA 4Y99C 4JYBA 5AW4B 2BASA 3RGUA 1OZHA 5K5GB 3CWBJ 1SQXD 1JB0J 2IFMA 4BWNA 3AECC 2OQQA 3CPWO 1KD1Q 1EXIA 2O1KA 4KT0J 3H1LD 2QA4P 1KILB 2QIWA 5DJUB 5AW7B 4W7ZA 5KAFH 1KILA 1OXZA 3H1IJ 1IFMA 1X9VA 5AVUB 3CC4P 1EDIA 2NZ2A 3GMAA 3SFDC 1SQQD 1NTZE 1JY3O 4DCKA 1BGYD 1W5CE 1GZLA 5KAFE 4ZMDA 4BXLA 1OFCX 1Q90D 1FC2C 4XE5B 1N7LA 5H2FH 1S72P 1NU1G 1KB9H 1L0NE 1NTMD 3RK2D 3E1RA 1TU3F 2FYZA 2FXPA 1SQVJ 5CCHD 2KOGA 3ITKA 2N1TC 1OVVA 4ZKPA 4B86A 1LWUA 4D6TJ 4K3AA 2J58A 1ZR2A 1LTBC 1MFZA 2GA1A 1ZP0C 5BU8B 5APYA 2A45G 1FZBA 1PFIA 1URQD 2JEEA 3V2QA 1NAYA 2WWWA 4IFFA 1FDIA 2IFNA 1RQVA 3CCVP 5AW2B 1RY3A 4OGQB 1NH4A 1ZXGA 1JTHB 3PTZA 5B66E 1KZUB 1JY2N 2IYPA 3TGUD 2JWDA 3BRTB 1PGJA 1SQVG 4C7NB 1JTHA 2XDJA 4U7JA 3I5CA 1ZW0A 4H13B 2Q5UA 4Y28J 1OIPA 4C7NA 4U3FG 2YIUC 3V4WA 2P2UA 3EQ2A 4H0LC 1FBMA 2RH0A 1PZQA 2WTYA 1HWTC 1Q82Q 2YXRB 4LGDE 4EDFA 3B8EB 5KLIC 1H0TA 4RKUJ 5CMZA 3ABVC 3RL0D 2R3SA 1YHQP 3L36A 2KP8A 3BCCE 2G3AA 2WQYC 3A0BE 5KAIE 2WMMA 2KLUA 1Y47A 1G1IA 1NHLA 1NTZJ 1FOSF 2Q3IA 1SFCD 1S1CX 2E76B 1KORA 1KQGB 1PP9D 1NOHA 1GL2D 1L0NJ 2NRGA 5KLVK 5CBOA 4PV1C 3L71E 1NVOA 2XU6A 4K35A 1K9MQ 5GTHH 1SQBD 1X8YA 2KS1B 3EFFK 3I55P 2ZFCA 2FFDB 1NTKD 2QE7H 1PL5A 2IBZI 1IK7A 2K88A 1OX3A 5AW3B 1QGKB 5AVQB 1S9KE 1NTZG 2FFDA 3SWFA 2ZXXA 3VP9A 1YYCA 2M0BA 1ZR4A 1H88A 2IDBA 2IBZG 1WRGA 1LT9B 2R3CA 3V6IA 2C9NY 1N8RQ 1UIXA 4NPDA 1AQTA 1LT9A 2YKOA 2Y0DA 4O9BA 1IFNA 1U7MA 2FBWC 1P84E 1SQPK 4UB6E 1ZV8A 1RF0C 1CI6A 3M0DC 1R8EA 1KTMA 4H44B 1BCCD 3WU2H 1L0LE 4EYYQ 2E5YA 4HB1A 4PD4H 2P58A 3L73D 1S5LH 2UWJE 4DJGA 1SVFA 2AXTH 5APXA 2ZVNB 1OVRA 5KKZC 3KQGA 2WT7B 3A2AA 3BCCJ 3AE8C 5AVXB 1YJ9P 2WT7A 2RKLA 2AXTE 3LIEA 3CXHE 3MHVA 3KZIE 3FWNA 4HKZH 5E79E 1DEBA 3FXEA 5KLVE 1ZMEC 1L2PA 3L74G 1DH3A 2E75B 5CBNA 2WPSA 3FWLA 2MJZA 4XFJA 1QX8A 1KILC 5BVZA 2B87A 3AEDC 4GOEA 1N2DC 1N73A 3P32A 1KV4A 3RK3D 4H0LB 3OAKA 2M8RA 3RBXA 3P7KA 3H1KE 4C7RA 1EZVE 4DZOA 3HRNA 1RQUA 1VF5D 1S4XA 4A7PA 1VL2A 3VMAA 1FJPA 5TISE 4I7ZC 1VQ7P 2PGDA 3FGAD 1L4AD 3CCQP 1FOSE 1LWUC 3O6QB 4L74A 1KYOH 3CC2P 4M3LA 4WWIA 3JSVC 1NU1D 3O6QA 2A06G 1K05A 4KJMA 1EC5A 2PFXA 1N7SD 2C0XA 2WPVB 5AVVB 3H1HE 1M1JB 3TF5A 1KMIZ 4ASVA 3A0HE 5KTBA 1M1JA 2O01J 1JCDA 1FJKA 3M91A 2IX7C 5AVYB 1YI2P 1Y9BA 2YNYA 2YMYA 4DT0A 4H13C 2BCCG 1FZAA 3L70E 3MD0A 3T97B 4UB8H 2R5BA 3GLMA 2FYUE 2OTJP 1YQ4C 1GW4A 2E74D 4BRYB 2KI7B 1GK4A 3T97A 2W8ZA 5KLVJ 1X0TA 1MV8A 3N4XA 4U3FD 2G8YA 1ZRTE 4JPZB 3GF3A 3SWKA 2D2CD 1YIJP 1M57D 2CPSA 2HR3A 1G2CA 1GW3A 2Q7CA 3IR9A 3CX5E 5GTIH 3OJAB 1VQ8P 4N3YB 1QVGO 3PJSK 4JBZA 3G9RA 3H1JJ 1RF1B 2C9LY 1QL2A 3L37A 2KZJA 5DJTB 1RF1A 1LP1A 2KB7P 1QLED 1KILD 1PPJE 3AE4C 1HGZA 2JKVA 3CLQA 1M56D 2H8PD 5AW0B 1LTJB 2OARA 1ZLLA 3KYQA 3HTKB 2YO3A 1Q81Q 1FZFA 2W83C 2ZVOB 1ZOYC 1LGHB 3SFEC 1Y8AA 1LTJA 3OA7A 3HTKA 1SQPJ 1FU1A 2FFDC 3LW5J 1EDLA 3H1JG 2KXPB 1LJ2A 1QL1A 3G71P 1OW6A 4I6MC 3S1KA 5C39A 2GUSA 1SLQA 3D71A 2OTLP 3O8ZA 1KYOI 2NPSB 1SQXE 1LT9C 3L72J 2AEJA 3AE9C 3VMXA 2LXCB 3H1LE 4AQRD 2NPSA 2YO2A 5AVSB 3A7OA 2IBZD 3A3YB 1VDFA 1MZ9A 3PHLA 1VQ6P 1SQPG 3L75J 3CWBG 4I7ZB 2IYOA 2A45I 1LWUB 3CMEP 4WVZA 1QEXA 4H44C 4R4MA 4OGQD 1KB9D 1PIXA 1LTGC 1SQQE 1BGYE 1OMIA 1JNMA 3H1IG 1YQ3C 4H13D 2ZYDA 2WSEJ 4YTPC 1EDJA 5B66H 3L72G 1NTME 1BSNA 1IO4A 2YKPA 1Q86Q 2J59M 1GMJA 3L75G 4W80A 1T6AA 5KJ7D 1UIIA 1NTKK 3TDKA 3CL3D 1VQ4P 2E75C 2N9BA 4MN4C 1N73C 4XA4A 4D6TG 2WSFH 3L74D 2H88C 2QJYC 5CCHA 3QWOC 1R5SA 4W7YA 2KIKA 3VYIA 2E76D 3TGUE 1H0TB 3A0BH 1L0LK 5KAIH 3D6ZA 3NTNA 1NAFA 3VMZA 1NYHA 1S3JA 3BASA 3F5HA 3CMAP 2WVRA 3GHGB 1AVOA 4PJ0E 2W6AA 1SQXJ 1GK6A 4ZKUA 3BRVB 3GHGA 1A02F 4HYTB 3Q3DA 1J1DC 4LLHA 1NO4A 3G4SP 2B88A 3GF7A 4IL6E 5APQA 1M1JC 2WITA 4GT1A 3WUUA 2A06D 2BEQD 2PRRA 1IJDB 2JR8A 4RESB 2K3RA 3Q2YA 3PLNA 2ZJSE 3RL0B 1PP9E 1S9KD 4AUWA 5AW6B 5M1BA 4NPEA 2SPZA 3HD7B 3K5BA 2N9YB 1IZNB 2CPBA 2IZ0A 3HD7A 1KB9I 2H43A 1ZN5A 1SQBE 3TK1A 1YJNP 1BDCA 3KXDA 2XV5A 1YTZT 2N1TD 2OYHB 1L0NG 3UIAA 2L5GB 1NTKE 1P84H 1SFCA 4UB6H 1GL2B 2BCCD 4N78E 1BDDA 2OYHA 5CHXA
chains in the Genus database with same CATH topology
5B5EH 1S5LH 2AXTH 5B66H 4UB8H 3A0BH 5KAIH 3A0HH 3KZIH 4UB6H 3WU2H 3JCUH 5KAFH 4PJ0H 5E79H 5GTHH 5TISH 4IL6H 5H2FH 5GTIH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B5E H;  1S5L H;  2AXT H;  5B66 H;  4UB8 H;  3A0B H;  5KAI H;  3A0H H;  3KZI H;  4UB6 H;  3WU2 H;  3JCU H;  5KAF H;  4PJ0 H;  5E79 H;  5GTH H;  5TIS H;  4IL6 H;  5H2F H;  5GTI H; 
#chains in the Genus database with same CATH topology
 3TNU B;  1CI6 B;  2OYO A;  1GL2 A;  2YXQ B;  1PGO A;  1YJW P;  2FXO A;  2O01 H;  1KQS O;  3TNU A;  2AEM A;  1AJY A;  3TGU J;  2YMK A;  2Q9I A;  1RF1 C;  1K04 A;  2WSF J;  1T2K C;  4I1L A;  1OW7 A;  3PP5 A;  1NU1 K;  1MKM A;  1N86 A;  4GOD A;  3CXH H;  4PD4 D;  4RO0 A;  1DX7 A;  2OGU A;  2Z4E A;  3QH9 A;  1OW8 A;  3KZI H;  1VQM P;  2QG4 A;  3WUT A;  5E79 H;  1BCC E;  3MZW B;  2K9Y A;  1NKZ B;  1KN7 A;  1LTJ C;  4H0L D;  1EDK A;  1U57 A;  3LID A;  2LXB A;  1DEE G;  3L73 E;  2FYU K;  4ASW A;  3Q5S A;  3V5B A;  2B87 B;  2QM7 A;  2O01 N;  1IFD A;  3P8C D;  3L71 J;  1E79 H;  1N73 B;  1BE3 E;  2K1A A;  1GU4 A;  3AE7 C;  3Q5P A;  5CCG A;  1JO5 A;  3TSI A;  3CCJ P;  1K73 Q;  2ZYA A;  2QJY B;  3JCU E;  3MP7 B;  4LC1 A;  1IFI A;  2E5T A;  3H1J D;  3BCC G;  2QJP C;  3HE5 B;  5TIS H;  2NPS C;  3G6E P;  5APT A;  2ITA A;  2OYI A;  2H89 C;  5AW9 B;  2FKW B;  1GU5 A;  4WY4 B;  2W90 A;  5CJ4 A;  2XNX A;  3HE5 A;  1VQ9 P;  4EI2 A;  1LTS C;  2PP6 A;  4PV1 D;  3HE4 A;  3CI9 A;  3N7N A;  4WY4 A;  2B89 A;  3RK3 E;  1NTK J;  3L71 G;  3LW5 H;  2VRS A;  4R4L A;  4NPF X;  2QSI A;  1FZE A;  1SQP D;  3AEG C;  3CWB D;  1QVF O;  2WZ7 A;  2LR2 A;  1KYO D;  1OWA A;  1J1D B;  1SS1 A;  3A0H H;  2AXC A;  1JY2 P;  3RK3 B;  3EWK A;  1E5W A;  2JWA A;  3A5T A;  3H32 B;  1L0L J;  2P10 A;  2OTK E;  1WT6 A;  3H1I D;  1VF5 B;  3H32 A;  2O1J A;  1NU1 E;  2YKQ A;  1RE4 C;  3L72 D;  3OW2 O;  3FX0 A;  4EIJ A;  1U7J A;  2HOD B;  1R5L A;  2LKM A;  1SQX K;  1L4A B;  1FZG A;  2IPP A;  3L75 D;  1OVU A;  3GW6 A;  5CCH C;  2W6B A;  2HOD A;  2M3E A;  1L4A A;  3CCU P;  3VMY A;  2PAJ A;  1SQV D;  1K8A Q;  3IFM A;  1AA0 A;  1KC8 Q;  4KHX A;  2Y9Z A;  4IFD K;  1L0L G;  4D6T D;  4PD4 I;  2WSE H;  1JEK A;  3CX5 H;  2W6J H;  1BE3 J;  1SQQ K;  1G2C B;  1IK9 A;  1N7S A;  2Z5I A;  1WMK A;  5AVT B;  1VQL P;  1NKN A;  1EQ7 A;  2QRX A;  2HPC B;  3AEA C;  2Y0C A;  1GTW A;  3GHG C;  2KUB A;  1YTZ I;  1X22 A;  2ZT9 B;  1NTM K;  3I56 P;  3H1K J;  2HPC A;  2POH A;  1LP1 B;  4U3F E;  3EFG A;  3AE6 C;  2CK3 H;  5AVR B;  3MUD A;  3V2N A;  2GM4 A;  1VQP P;  2QJK C;  1DD4 A;  3PH0 A;  5KLV G;  5TJH A;  3V2R A;  2GUV A;  1A02 J;  1FDO A;  1RE3 A;  1HUC A;  1BSH A;  3V2P A;  5APV A;  1BE3 G;  2JJL A;  2P1J A;  2XND H;  5AW8 B;  2D2C B;  5B5E E;  3RL0 C;  2Y9Y A;  2JDI H;  3II6 A;  1KIL E;  2JP3 A;  3H1K G;  2WPQ A;  1EZV G;  3H1H J;  3HD7 C;  3WMM 0;  3B5N B;  1FE6 A;  1PGP A;  2HYN A;  5APU A;  1SFC C;  3CCL P;  1NU1 J;  2WSS H;  3B5N A;  1FS0 E;  4GKG A;  2QJP B;  1NTZ D;  2OYH C;  2RN0 A;  4EOT A;  2DW3 A;  4TLF A;  3F89 A;  1GL2 C;  1IFP A;  2KK7 A;  3R2P A;  2KNC B;  3V4Q A;  2KSJ A;  2V7Q J;  1M8O B;  1L0N D;  3L70 J;  2QEX P;  3VTP C;  2FYU J;  2KNC A;  1G1J A;  3CCE P;  3IF4 A;  3NFQ A;  2E43 A;  3H1H G;  3B4S A;  2MKV A;  2Q6Q A;  4IL6 X;  1JCC A;  3CCR P;  3CCM P;  1VQO P;  1JUN A;  3M0A A;  5AW5 B;  2IBZ E;  2K9J B;  4JQ0 D;  2JO1 A;  2C0W A;  3SSU A;  2B9B A;  1S2E A;  3VN0 A;  2K9J A;  4YXD C;  3G3Z A;  5H2F E;  1KB9 E;  4JF7 A;  1Q2N A;  4U3F J;  3L70 G;  3C9I A;  3VOP A;  3S9O A;  4QMA A;  1FAV A;  2FYU G;  4TT3 H;  1SQB K;  1W2E A;  5APW A;  3KHU A;  2R32 A;  3CX5 I;  3C1L A;  5AVW B;  2ZAE B;  5CCG C;  1RE4 A;  2W27 A;  3RK2 B;  3AE2 C;  1AQ5 A;  3W67 A;  3P8M C;  1CW5 A;  2OYI C;  3IAO A;  3CD6 P;  1VPC A;  1T3J A;  3AE1 C;  4PJ0 H;  1URQ B;  4WY4 C;  1Z56 A;  3BCC D;  1SP4 A;  1YIT P;  2AEF A;  1JM0 A;  3RL0 g;  1URQ A;  3HUS B;  3L74 E;  1PPJ G;  2FYN B;  2M5A B;  3HUS A;  1HH0 A;  2M5A A;  4IL6 H;  5KJ7 A;  3H1L J;  1JY3 P;  2R44 A;  4L73 A;  3M9B A;  3ZDM A;  1J1E B;  2QJK B;  3HD7 D;  1JOC A;  3L71 D;  3RK3 C;  1H8A A;  1FZC B;  3L35 A;  4I2L C;  4C46 A;  1S5L X;  3B71 A;  1SQQ J;  1IFJ A;  1HVV A;  2L91 A;  2R5D A;  1FZC A;  1BGY J;  1GD2 E;  1VF5 C;  1AFO A;  3W68 A;  1MUU A;  2M3B A;  2I1K A;  1LTT C;  3D6Y A;  1SQX G;  1KQL A;  5AW1 B;  3C8V A;  4Y99 B;  2FY8 A;  1NTM J;  1HJB A;  1L4A C;  3H1L G;  2A06 E;  1KFM A;  3GG2 A;  3JC2 2;  1SFC B;  4H44 D;  1IC2 A;  1M1K Q;  4N78 D;  3R4Y A;  5GTH E;  4N6J A;  1NJI Q;  2KS1 A;  3MTU E;  3NXS A;  1N7S C;  4CPG A;  1JMB A;  1SQQ G;  3AEB C;  2KZI A;  2RMZ A;  3E1I A;  1P84 D;  1X79 B;  1BGY G;  1L0L D;  3CCS P;  2XZR A;  1NTM G;  2ZT9 C;  2BCC E;  1NGM B;  3NMD A;  3MUD C;  4HJG H;  3Q5R A;  1JY2 O;  3M9Q A;  5CCG D;  2E75 D;  5L8R J;  2FXM A;  1RE3 C;  3L74 J;  1VQ5 P;  5CJ0 A;  4IFM A;  4L75 A;  1LT1 A;  2N1T B;  2KLV A;  2E74 C;  4OH8 B;  4YXW H;  3CXH D;  5APS A;  1HGV A;  3IN6 A;  2N1T A;  1CZQ A;  5KLV D;  1D7M A;  3WU2 E;  2D2C C;  1VQK P;  1W2B O;  3JCU H;  4PD4 E;  1BE3 D;  3Q1M A;  4WY4 D;  3TGU G;  1S5L E;  3MIW A;  1J2J B;  3H6P A;  3B5N C;  1KFN A;  3AE3 C;  3L4F A;  3PRJ A;  1H89 A;  2OYI B;  3H1K D;  1HJ0 A;  1EZV D;  1XTC C;  2BEZ F;  1PP9 J;  1SQV K;  3MGN A;  2ZXE B;  3VP8 A;  2Q1K A;  2WSC H;  3HE4 B;  3P8C E;  2YIU B;  1HBW A;  2Y0E A;  4YPC A;  3D70 A;  4GOF A;  2Z5H A;  1SQB J;  4RJT A;  3FXD A;  2HFE D;  5BU5 A;  1T3U A;  3H1J E;  1RH5 B;  2E42 A;  5KLI B;  2IZ1 A;  3BVH A;  2HG5 D;  1T8Z A;  2P67 A;  4WB4 A;  3USS A;  1GDT A;  5AVZ B;  2XKM A;  3H1H D;  1USD A;  1PP9 G;  3E7K A;  1LTA C;  2H7H A;  1DIP A;  1USE A;  3H25 A;  1EXJ A;  1LNQ A;  3AEE C;  2BCC J;  1SQP E;  3SWY A;  2I8D A;  3CWB E;  1SQB G;  2V7Q H;  1KYO E;  3M06 A;  1P84 I;  4PV1 B;  1NTK G;  4L76 A;  1RHZ B;  2A45 H;  4OWF A;  3L70 D;  3RK2 C;  4HH2 A;  3U1A A;  1BCC J;  2WPR A;  1JY3 N;  2FYU D;  4OVN F;  2K37 A;  4OGQ C;  1JMM A;  1CSB A;  3WUV A;  3H1I E;  2ZT9 D;  1MFT A;  4GIF A;  3L73 J;  4Z1M H;  1DD3 A;  3L72 E;  4WBA A;  3RBZ A;  1ZRT D;  4GDO A;  1T2K D;  1N7S B;  1NTZ K;  1M90 Q;  1Q7Y Q;  1HF9 A;  1AV1 A;  2I1J A;  3L75 E;  1URQ C;  2HLO A;  3CXH I;  3CX5 D;  4IOI H;  4JYC A;  2ZYG A;  1PV3 A;  3BAT A;  3KDP B;  1L0N K;  3S4R A;  3HUS C;  1SQV E;  2O3J A;  3M9H A;  2FYN C;  1KQF B;  2KSE A;  5KJ7 C;  2P7J A;  4BRY A;  4AYC A;  3U1C A;  4UB8 E;  1VQN P;  3KPE A;  1BCC G;  4D6T E;  1FDM A;  3AE5 C;  1PGQ A;  1HTL C;  1PPJ D;  1LTI C;  3L73 G;  1J1E C;  2QM8 A;  3U59 A;  2Q3E A;  5B5E H;  3B5N D;  2E74 B;  1RF0 A;  2WSC J;  3CC7 P;  3M0D A;  2V4H A;  3AEF C;  1EZV I;  1FZC C;  2KYV A;  2E76 C;  1YBK A;  5GTI E;  3TYY A;  5KKZ B;  2NPS D;  4DOJ A;  1NWQ A;  2QVA A;  1XTG B;  4ZNC A;  1AVY A;  5EFW B;  2J5U A;  1M7L A;  4Y99 C;  4JYB A;  5AW4 B;  2BAS A;  3RGU A;  1OZH A;  5K5G B;  3CWB J;  1SQX D;  1JB0 J;  2IFM A;  4BWN A;  3AEC C;  2OQQ A;  3CPW O;  1KD1 Q;  1EXI A;  2O1K A;  4KT0 J;  3H1L D;  2QA4 P;  1KIL B;  2QIW A;  5DJU B;  5AW7 B;  4W7Z A;  5KAF H;  1KIL A;  1OXZ A;  3H1I J;  1IFM A;  1X9V A;  5AVU B;  3CC4 P;  1EDI A;  2NZ2 A;  3GMA A;  3SFD C;  1SQQ D;  1NTZ E;  1JY3 O;  4DCK A;  1BGY D;  1W5C E;  1GZL A;  5KAF E;  4ZMD A;  4BXL A;  1OFC X;  1Q90 D;  1FC2 C;  4XE5 B;  1N7L A;  5H2F H;  1S72 P;  1NU1 G;  1KB9 H;  1L0N E;  1NTM D;  3RK2 D;  3E1R A;  1TU3 F;  2FYZ A;  2FXP A;  1SQV J;  5CCH D;  2KOG A;  3ITK A;  2N1T C;  1OVV A;  4ZKP A;  4B86 A;  1LWU A;  4D6T J;  4K3A A;  2J58 A;  1ZR2 A;  1LTB C;  1MFZ A;  2GA1 A;  1ZP0 C;  5BU8 B;  5APY A;  2A45 G;  1FZB A;  1PFI A;  1URQ D;  2JEE A;  3V2Q A;  1NAY A;  2WWW A;  4IFF A;  1FDI A;  2IFN A;  1RQV A;  3CCV P;  5AW2 B;  1RY3 A;  4OGQ B;  1NH4 A;  1ZXG A;  1JTH B;  3PTZ A;  5B66 E;  1KZU B;  1JY2 N;  2IYP A;  3TGU D;  2JWD A;  3BRT B;  1PGJ A;  1SQV G;  4C7N B;  1JTH A;  2XDJ A;  4U7J A;  3I5C A;  1ZW0 A;  4H13 B;  2Q5U A;  4Y28 J;  1OIP A;  4C7N A;  4U3F G;  2YIU C;  3V4W A;  2P2U A;  3EQ2 A;  4H0L C;  1FBM A;  2RH0 A;  1PZQ A;  2WTY A;  1HWT C;  1Q82 Q;  2YXR B;  4LGD E;  4EDF A;  3B8E B;  5KLI C;  1H0T A;  4RKU J;  5CMZ A;  3ABV C;  3RL0 D;  2R3S A;  1YHQ P;  3L36 A;  2KP8 A;  3BCC E;  2G3A A;  2WQY C;  3A0B E;  5KAI E;  2WMM A;  2KLU A;  1Y47 A;  1G1I A;  1NHL A;  1NTZ J;  1FOS F;  2Q3I A;  1SFC D;  1S1C X;  2E76 B;  1KOR A;  1KQG B;  1PP9 D;  1NOH A;  1GL2 D;  1L0N J;  2NRG A;  5KLV K;  5CBO A;  4PV1 C;  3L71 E;  1NVO A;  2XU6 A;  4K35 A;  1K9M Q;  5GTH H;  1SQB D;  1X8Y A;  2KS1 B;  3EFF K;  3I55 P;  2ZFC A;  2FFD B;  1NTK D;  2QE7 H;  1PL5 A;  2IBZ I;  1IK7 A;  2K88 A;  1OX3 A;  5AW3 B;  1QGK B;  5AVQ B;  1S9K E;  1NTZ G;  2FFD A;  3SWF A;  2ZXX A;  3VP9 A;  1YYC A;  2M0B A;  1ZR4 A;  1H88 A;  2IDB A;  2IBZ G;  1WRG A;  1LT9 B;  2R3C A;  3V6I A;  2C9N Y;  1N8R Q;  1UIX A;  4NPD A;  1AQT A;  1LT9 A;  2YKO A;  2Y0D A;  4O9B A;  1IFN A;  1U7M A;  2FBW C;  1P84 E;  1SQP K;  4UB6 E;  1ZV8 A;  1RF0 C;  1CI6 A;  3M0D C;  1R8E A;  1KTM A;  4H44 B;  1BCC D;  3WU2 H;  1L0L E;  4EYY Q;  2E5Y A;  4HB1 A;  4PD4 H;  2P58 A;  3L73 D;  1S5L H;  2UWJ E;  4DJG A;  1SVF A;  2AXT H;  5APX A;  2ZVN B;  1OVR A;  5KKZ C;  3KQG A;  2WT7 B;  3A2A A;  3BCC J;  3AE8 C;  5AVX B;  1YJ9 P;  2WT7 A;  2RKL A;  2AXT E;  3LIE A;  3CXH E;  3MHV A;  3KZI E;  3FWN A;  4HKZ H;  5E79 E;  1DEB A;  3FXE A;  5KLV E;  1ZME C;  1L2P A;  3L74 G;  1DH3 A;  2E75 B;  5CBN A;  2WPS A;  3FWL A;  2MJZ A;  4XFJ A;  1QX8 A;  1KIL C;  5BVZ A;  2B87 A;  3AED C;  4GOE A;  1N2D C;  1N73 A;  3P32 A;  1KV4 A;  3RK3 D;  4H0L B;  3OAK A;  2M8R A;  3RBX A;  3P7K A;  3H1K E;  4C7R A;  1EZV E;  4DZO A;  3HRN A;  1RQU A;  1VF5 D;  1S4X A;  4A7P A;  1VL2 A;  3VMA A;  1FJP A;  5TIS E;  4I7Z C;  1VQ7 P;  2PGD A;  3FGA D;  1L4A D;  3CCQ P;  1FOS E;  1LWU C;  3O6Q B;  4L74 A;  1KYO H;  3CC2 P;  4M3L A;  4WWI A;  3JSV C;  1NU1 D;  3O6Q A;  2A06 G;  1K05 A;  4KJM A;  1EC5 A;  2PFX A;  1N7S D;  2C0X A;  2WPV B;  5AVV B;  3H1H E;  1M1J B;  3TF5 A;  1KMI Z;  4ASV A;  3A0H E;  5KTB A;  1M1J A;  2O01 J;  1JCD A;  1FJK A;  3M91 A;  2IX7 C;  5AVY B;  1YI2 P;  1Y9B A;  2YNY A;  2YMY A;  4DT0 A;  4H13 C;  2BCC G;  1FZA A;  3L70 E;  3MD0 A;  3T97 B;  4UB8 H;  2R5B A;  3GLM A;  2FYU E;  2OTJ P;  1YQ4 C;  1GW4 A;  2E74 D;  4BRY B;  2KI7 B;  1GK4 A;  3T97 A;  2W8Z A;  5KLV J;  1X0T A;  1MV8 A;  3N4X A;  4U3F D;  2G8Y A;  1ZRT E;  4JPZ B;  3GF3 A;  3SWK A;  2D2C D;  1YIJ P;  1M57 D;  2CPS A;  2HR3 A;  1G2C A;  1GW3 A;  2Q7C A;  3IR9 A;  3CX5 E;  5GTI H;  3OJA B;  1VQ8 P;  4N3Y B;  1QVG O;  3PJS K;  4JBZ A;  3G9R A;  3H1J J;  1RF1 B;  2C9L Y;  1QL2 A;  3L37 A;  2KZJ A;  5DJT B;  1RF1 A;  1LP1 A;  2KB7 P;  1QLE D;  1KIL D;  1PPJ E;  3AE4 C;  1HGZ A;  2JKV A;  3CLQ A;  1M56 D;  2H8P D;  5AW0 B;  1LTJ B;  2OAR A;  1ZLL A;  3KYQ A;  3HTK B;  2YO3 A;  1Q81 Q;  1FZF A;  2W83 C;  2ZVO B;  1ZOY C;  1LGH B;  3SFE C;  1Y8A A;  1LTJ A;  3OA7 A;  3HTK A;  1SQP J;  1FU1 A;  2FFD C;  3LW5 J;  1EDL A;  3H1J G;  2KXP B;  1LJ2 A;  1QL1 A;  3G71 P;  1OW6 A;  4I6M C;  3S1K A;  5C39 A;  2GUS A;  1SLQ A;  3D71 A;  2OTL P;  3O8Z A;  1KYO I;  2NPS B;  1SQX E;  1LT9 C;  3L72 J;  2AEJ A;  3AE9 C;  3VMX A;  2LXC B;  3H1L E;  4AQR D;  2NPS A;  2YO2 A;  5AVS B;  3A7O A;  2IBZ D;  3A3Y B;  1VDF A;  1MZ9 A;  3PHL A;  1VQ6 P;  1SQP G;  3L75 J;  3CWB G;  4I7Z B;  2IYO A;  2A45 I;  1LWU B;  3CME P;  4WVZ A;  1QEX A;  4H44 C;  4R4M A;  4OGQ D;  1KB9 D;  1PIX A;  1LTG C;  1SQQ E;  1BGY E;  1OMI A;  1JNM A;  3H1I G;  1YQ3 C;  4H13 D;  2ZYD A;  2WSE J;  4YTP C;  1EDJ A;  5B66 H;  3L72 G;  1NTM E;  1BSN A;  1IO4 A;  2YKP A;  1Q86 Q;  2J59 M;  1GMJ A;  3L75 G;  4W80 A;  1T6A A;  5KJ7 D;  1UII A;  1NTK K;  3TDK A;  3CL3 D;  1VQ4 P;  2E75 C;  2N9B A;  4MN4 C;  1N73 C;  4XA4 A;  4D6T G;  2WSF H;  3L74 D;  2H88 C;  2QJY C;  5CCH A;  3QWO C;  1R5S A;  4W7Y A;  2KIK A;  3VYI A;  2E76 D;  3TGU E;  1H0T B;  3A0B H;  1L0L K;  5KAI H;  3D6Z A;  3NTN A;  1NAF A;  3VMZ A;  1NYH A;  1S3J A;  3BAS A;  3F5H A;  3CMA P;  2WVR A;  3GHG B;  1AVO A;  4PJ0 E;  2W6A A;  1SQX J;  1GK6 A;  4ZKU A;  3BRV B;  3GHG A;  1A02 F;  4HYT B;  3Q3D A;  1J1D C;  4LLH A;  1NO4 A;  3G4S P;  2B88 A;  3GF7 A;  4IL6 E;  5APQ A;  1M1J C;  2WIT A;  4GT1 A;  3WUU A;  2A06 D;  2BEQ D;  2PRR A;  1IJD B;  2JR8 A;  4RES B;  2K3R A;  3Q2Y A;  3PLN A;  2ZJS E;  3RL0 B;  1PP9 E;  1S9K D;  4AUW A;  5AW6 B;  5M1B A;  4NPE A;  2SPZ A;  3HD7 B;  3K5B A;  2N9Y B;  1IZN B;  2CPB A;  2IZ0 A;  3HD7 A;  1KB9 I;  2H43 A;  1ZN5 A;  1SQB E;  3TK1 A;  1YJN P;  1BDC A;  3KXD A;  2XV5 A;  1YTZ T;  2N1T D;  2OYH B;  1L0N G;  3UIA A;  2L5G B;  1NTK E;  1P84 H;  1SFC A;  4UB6 H;  1GL2 B;  2BCC D;  4N78 E;  1BDD A;  2OYH A;  5CHX A; 
#chains in the Genus database with same CATH homology
 5B5E H;  1S5L H;  2AXT H;  5B66 H;  4UB8 H;  3A0B H;  5KAI H;  3A0H H;  3KZI H;  4UB6 H;  3WU2 H;  3JCU H;  5KAF H;  4PJ0 H;  5E79 H;  5GTH H;  5TIS H;  4IL6 H;  5H2F H;  5GTI H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...