2V4HA

Nemo cc2-lz domain - 1d5 darpin complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
98
structure length
98
Chain Sequence
GLVPRGSHMASMQLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords NF-KAPPA-B ESSENTIAL MODULATOR
publication title Darpin-Assisted Crystallography of the Cc2-Lz Domain of Nemo Reveals a Coupling between Dimerization and Ubiquitin-Binding.
pubmed doi rcsb
source organism Mus musculus
total genus 40
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.990 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Nemo cc2-lz domain - 1d5 darpin complex 2v4hA00
2V4HA 3FX0A 2ZVNB 3JSVC 4OWFA 4BWNA 2ZVOB 3F89A
chains in the Genus database with same CATH superfamily
4PD4E 3CCEP 3C8VA 5AVSB 2FFDA 2N9BA 1GL2D 1J2JB 1NU1D 3VTPC 1PFIA 3L35A 4N6JA 4DCKA 1R5LA 3IR9A 2GM4A 4GODA 5AW0B 2IZ1A 1MUUA 3PHLA 3N4XA 1P84D 3AEBC 3G3ZA 2W6AA 4K35A 4H44B 4YPCA 5GTIH 3GW6A 1P84I 2W6JH 1N7SB 3CMEP 1VQ9P 3H1KD 2H89C 1FZCC 1SQQD 2QRXA 2HFED 1U7MA 4ZKPA 2XKMA 3CWBG 3FXDA 4RO0A 3CX5H 2MKVA 3HD7C 1BSHA 1RE3C 3HD7A 2HPCA 1KYOD 1RE3A 1NTKG 1VQLP 2ZXXA 5AW7B 5GTIE 2JDIH 4GKGA 4H0LD 1KYOI 1SQPD 2KZJA 3E7KA 1OX3A 3E1RA 1KFMA 1RH5B 3H32B 4I1LA 2N9YB 5E79H 3CX5E 5AVQB 1D7MA 4L73A 3QWOC 3L70G 2M3EA 3VYIA 1R5SA 1FS0E 4U3FG 2QG4A 1LT9C 2FYUJ 2ZT9D 1N8RQ 1LT9A 2K37A 5KAFE 2WMMA 5B5EH 1L4AB 3D6YA 2POHA 3G9RA 1LTAC 2P2UA 2K1AA 3MP7B 3EFGA 1SQBG 2O3JA 1XTCC 3CC7P 1HVVA 3M0DC 1W5CE 2E74B 1DIPA 3NFQA 5E79E 2FY8A 1L2PA 2IBZD 1KB9E 2B9BA 1J1EB 2QSIA 1FZBA 1SS1A 1VQOP 4H44C 1BGYG 1BCCJ 5APSA 2IBZI 5B5EE 4GT1A 1N7SC 2M8RA 1SQVK 1SP4A 3A0HH 1N7SA 4OGQB 3V2QA 3BCCD 1FZEA 3W68A 3L72E 3L75G 2WSCJ 1N2DC 1VQ8P 1LTSC 5CCGC 5CMZA 1MKMA 3AEFC 1X8YA 1NTZE 4M3LA 3V2NA 1GL2B 3RL0D 3AE6C 3S1KA 3RBZA 1S2EA 5APQA 2FXOA 4HKZH 3ITKA 1GW3A 1G1JA 2QIWA 1DD3A 3SWYA 4UB6E 1IC2A 3KDPB 1Q2NA 2ZVNB 5EFWB 1E79H 4L75A 2IYPA 1JCCA 3TGUD 1FU1A 4I6MC 3SFDC 1EDKA 1JMMA 3H32A 2ZAEB 1NYHA 1GK4A 2A06E 1BGYE 1AJYA 3KYQA 4OH8B 1HUCA 4WWIA 4W7YA 1Z56A 1SQXG 1ZR4A 3H1JE 1YHQP 1Y47A 1L4AC 1QLED 1KFNA 1NAFA 3L75E 1IJDB 1JY3P 1L0NG 2JWAA 1QL1A 2E74C 2Q3EA 3SWKA 1NH4A 3GG2A 2JKVA 2E5YA 4N78E 2W8ZA 1J1EC 3AE2C 1OXZA 3L73D 4TLFA 1A02J 5KJ7A 1CI6B 1NWQA 1EXJA 4C7RA 2WSEH 2ZFCA 1FZGA 2ZT9B 4OGQC 1AA0A 4I2LC 4WVZA 4RESB 5DJTB 1M90Q 3MTUE 2Q5UA 2M5AB 3P8MC 4YXDC 5CJ0A 1FC2C 1GL2C 3A5TA 1U7JA 3BASA 3H1KG 5KKZB 1L0LG 3CCVP 2KZIA 1PGPA 3H1IE 5TISH 3OAKA 3CX5I 3U59A 3AEAC 3L4FA 1NKNA 4AUWA 4EOTA 3D6ZA 4Z1MH 2PGDA 1USDA 2BEQD 3H1HE 5AW2B 3NXSA 2LXCB 2LKMA 2OTLP 1HJ0A 2OQQA 2O1KA 2JJLA 1ZN5A 2OYHA 1YTZT 1K05A 4AQRD 3CI9A 2WPSA 3ABVC 3SSUA 5TISE 3JCUH 4UB8H 2Q1KA 1KC8Q 3RL0B 1BDDA 4H13B 3A7OA 3L70J 1NTZJ 2CK3H 1BE3D 4U3FJ 1K9MQ 2WSSH 3I5CA 4W7ZA 1NU1K 3Q5PA 2AXTE 5DJUB 1FE6A 1N7SD 4HB1A 1RE4C 1IK9A 4NPDA 3GMAA 3FXEA 1YYCA 3CMAP 4PJ0E 1NO4A 5CBOA 1S9KD 1RE4A 2QM7A 4DT0A 3JCUE 3T97B 3P8CE 1PIXA 2H7HA 3RK2B 1RY3A 3MGNA 2IBZG 2ZT9C 1EDIA 1BGYJ 1SQQK 3G6EP 2P10A 2MJZA 3H1JJ 3L74D 2WVRA 2K9JB 3II6A 3BATA 1ZMEC 3TNUA 3B5NB 1KQSO 5KKZC 1X9VA 3L75J 1FDIA 4ASWA 3JSVC 3V2RA 3HE5B 3AE1C 1BSNA 2H88C 3Q5SA 2WQYC 2J5UA 1PP9G 3QH9A 1SQPK 2YKOA 1RF0A 1J1DB 1H0TB 4R4LA 1EC5A 3AEEC 1LJ2A 5B66E 3VMAA 1ZRTE 3EWKA 2WSCH 3TK1A 1FBMA 1CW5A 3FWNA 1FZFA 3TGUG 2K88A 4PD4H 2KLVA 3RL0C 2YMYA 3MHVA 1SFCB 2PRRA 4H13C 2JP3A 3Q5RA 1OVVA 1BCCE 5KLVE 1SQXJ 5KJ7D 2FYUK 4GOFA 3M9QA 3H1IJ 3VMXA 3Q2YA 3KPEA 2KUBA 5M1BA 1KILE 1Q7YQ 1MFTA 3B4SA 2A45G 1OMIA 1L0NJ 4OGQD 3M0AA 3CCQP 2E76D 3CXHH 5APUA 3K5BA 1OW6A 3H1HJ 4KT0J 5APWA 1LNQA 1EDLA 1KZUB 3RK2C 2VRSA 3T97A 3HUSA 1W2EA 1UIIA 2ZYGA 1CSBA 3L71G 3L73G 3R4YA 2IDBA 2XV5A 1LTGC 1HGZA 3CC4P 3WU2E 3B5NC 1RF1A 2K9JA 1S1CX 3B5NA 3RGUA 3VP8A 2OTKE 1YQ3C 1JY3O 3CXHE 2JWDA 2RMZA 2ITAA 5APVA 3CC2P 3LIDA 3HE5A 3H1KJ 1QGKB 1HWTC 1YJWP 4ASVA 1L0LJ 4BRYB 3SFEC 1PPJD 2W6BA 3HE4B 2NPSA 2ZYAA 1J1DC 3U1AA 2YMKA 1SQVG 4OVNF 1NTME 3WUTA 4I7ZB 1H0TA 3CCRP 1JY3N 1HBWA 1U57A 2GUVA 5KAFH 2WSFJ 2WT7B 1ZOYC 4GDOA 1SFCC 3P8CD 2O01J 2KSJA 3V4QA 2KSEA 2QJYB 4BXLA 1SFCA 4HJGH 2KIKA 1KQGB 2RKLA 4YXWH 4GOEA 2WPRA 5BU5A 2E42A 2BCCG 2LXBA 4WB4A 1BE3G 2C0XA 1KB9H 4U7JA 1JNMA 1ZW0A 5KLIB 2YXQB 1FOSF 2KXPB 1UIXA 1SVFA 2L5GB 2KI7B 2LR2A 1OZHA 2IX7C 3WMM0 2FYUD 3CWBE 1T8ZA 1EZVG 1FJPA 1YQ4C 2OGUA 1YJNP 1URQB 4IL6H 3D71A 2KNCA 1DD4A 1NTKE 5L8RJ 4ZNCA 1GTWA 1FDOA 4WY4B 1M8OB 1G2CA 2W90A 5KLVJ 4UB6H 2IPPA 3CCMP 1IFMA 3L74G 2QE7H 3AEDC 2D2CB 2E76B 4K3AA 4W80A 4BRYA 3AE8C 1S4XA 4DOJA 3L70E 3H1LG 3HE4A 1IFPA 4U3FE 4IL6E 3A0BE 4I7ZC 2Q7CA 2Q9IA 4H13D 1N7LA 1T3JA 1PP9J 2FXMA 2FXPA 3CL3D 1VQ6P 1GDTA 1YI2P 1SQBE 3Q3DA 4PD4D 2WT7A 1N86A 1TU3F 1JY2P 4PV1D 4AYCA 3KQGA 1AVYA 2KS1A 5AW3B 2QJYC 4Y99B 3UIAA 1EZVE 1VQNP 3S9OA 2GA1A 1GK6A 4D6TG 4PD4I 1FDMA 3A2AA 2UWJE 2B88A 2OYHB 2WPQA 1FAVA 3RK2D 1NTZK 2E5TA 4HYTB 1AV1A 4IL6X 1JOCA 3WUVA 5KLIC 4IFDK 2KLUA 4IFFA 3Q1MA 3MIWA 2XNDH 3AEGC 1NTMJ 2P67A 3CCJP 3B5ND 2AEJA 2E75D 3CXHI 2CPSA 1S5LH 2PFXA 3H1LE 1KMIZ 1EXIA 2E43A 1URQC 3PLNA 5AW9B 4LC1A 1NJIQ 1URQA 1KV4A 2P58A 5KJ7C 1NU1G 4WY4C 3L71J 2NPSD 3L36A 4WY4A 1GZLA 2D2CC 2E76C 1OWAA 2N1TD 2K3RA 2OYOA 1JO5A 1VQ4P 1JEKA 1H89A 1S5LE 1Y9BA 3TNUB 3CX5D 4WBAA 1PZQA 4IOIH 1SFCD 4TT3H 1YJ9P 2QJKB 1JCDA 1SQXE 1SQQG 3CWBJ 1PPJG 1SQVJ 1K04A 4EIJA 3V6IA 1ZV8A 1L0NE 2Y0EA 2C9LY 3M91A 3M06A 1R8EA 3FWLA 4Y99C 5GTHE 2WTYA 5CJ4A 2Z5IA 1NTKJ 1PL5A 2AXTH 1GU5A 2OYHC 3IN6A 5AVWB 1S5LX 2SPZA 1NU1E 2RN0A 3EQ2A 1SQPG 2OARA 1IFJA 1KB9D 4PJ0H 1FZAA 3AE5C 5AW1B 2BCCJ 3IAOA 2OYIC 2NRGA 3M9HA 2ZJSE 3F89A 1ZP0C 1KB9I 2KYVA 4BWNA 2OYIA 2WSFH 4O9BA 3MZWB 2CPBA 3A3YB 1WRGA 3L72D 2FBWC 4PV1B 2YXRB 2O01H 2L91A 3H1KE 3L70D 1NTZD 1DEEG 1SQBJ 1QVFO 1L0LE 4U3FD 4R4MA 1QVGO 2FYUG 4ZKUA 1VDFA 2QEXP 1IK7A 2IYOA 3LW5H 1MV8A 2JO1A 1VF5D 3HUSB 1M56D 1LT1A 5CCHD 3CCSP 2BASA 1EQ7A 1VPCA 2I8DA 3PP5A 1X79B 1S3JA 1AQ5A 2H8PD 1RHZB 1YIJP 3O8ZA 1Q81Q 1RF1B 2Y9ZA 4KHXA 5B66H 1IZNB 2E75B 1T2KC 2QJKC 3BCCG 2IFNA 1E5WA 2A06D 1BGYD 2FYNB 3CPWO 2B87A 2XNXA 3H1LJ 3H1JD 1DH3A 4RJTA 4NPEA 3N7NA 1RF0C 3L75D 2NPSB 5H2FE 1CZQA 2R3SA 3IFMA 2J59M 4LLHA 1LWUB 4A7PA 2N1TB 2G8YA 4L74A 1Y8AA 4N78D 3AE7C 4D6TJ 3AECC 2IBZE 4JYCA 1M1JA 3P7KA 1JM0A 1URQD 1KILA 2KB7P 3V4WA 3V5BA 1PV3A 3EFFK 4WY4D 3HRNA 3TDKA 1AFOA 4PV1C 1GD2E 1GW4A 3WU2H 3BCCE 3PH0A 3KHUA 2Q6QA 2P1JA 1JY2O 2D2CD 4HH2A 1QX8A 3H1ID 1MFZA 3S4RA 3HUSC 3RK3E 1M57D 4JYBA 1PP9E 4QMAA 1L0ND 1NU1J 1NKZB 1OW8A 5AW6B 3GF3A 2A45H 2KNCB 2H43A 3H1HD 5KLVK 3OW2O 1RF1C 1NHLA 1YBKA 2J58A 2W27A 1G2CB 1IFDA 1VQKP 1PGJA 1QL2A 2E75C 1JY2N 3FGAD 4EYYQ 3TGUE 3CCLP 2FYNC 1X0TA 1DX7A 1MZ9A 1FJKA 1K8AQ 3CCUP 3OA7A 3D70A 1T6AA 2R44A 1SQQJ 2NPSC 1H8AA 2KOGA 1JMBA 1VF5B 2R32A 1OVUA 1LWUC 1VL2A 3MUDC 2N1TC 1L0LD 4GIFA 2V7QH 1LWUA 3MUDA 1YITP 2N1TA 1FZCA 1WT6A 1HF9A 2KS1B 1OVRA 3VMYA 2Y9YA 1SQPJ 1HJBA 4RKUJ 3L71E 3L73E 3M9BA 3KZIH 3AE4C 5AVZB 1OW7A 1IFIA 1G1IA 4L76A 3LW5J 1LTIC 3HTKB 3V2PA 1NTMK 2PAJA 3MD0A 5AVUB 1WMKA 3L72G 2BEZF 1S72P 1Q90D 1NTZG 4XFJA 3CLQA 1T2KD 1SQVE 3KZIE 3VOPA 3VN0A 3SWFA 4N3YB 3A0BH 3P32A 3WUUA 2YKQA 3ZDMA 2XZRA 4DJGA 1JTHB 1ZRTD 2QJPB 3M0DA 1Q82Q 3NMDA 5BVZA 3AE3C 2R3CA 2YO3A 2HR3A 3BCCJ 4JF7A 2W83C 4XE5B 2WWWA 1LTJB 5AVTB 1ZR2A 2WITA 1NOHA 2A06G 1BCCD 5KLVD 1AVOA 1VF5C 2BCCE 2Q3IA 1M1KQ 1NGMB 2AXCA 1BE3E 3H1JG 5CCHC 3FX0A 2YIUB 1KILD 5CCHA 3GF7A 4XA4A 3PTZA 1NTKK 5CCGA 3L37A 3RK3D 2Y0CA 1PP9D 1S9KE 3TGUJ 1ZLLA 1DEBA 3LIEA 3GLMA 2HLOA 5AVXB 3A0HE 1KD1Q 4IFMA 5CBNA 3HTKA 5AVVB 1SLQA 3RBXA 3L74E 2XU6A 3CXHD 3W67A 2OYIB 4C7NB 1KORA 1SQBK 2C9NY 4NPFX 1W2BO 3TSIA 4EDFA 2XDJA 1IFNA 5KTBA 3H1IG 2HODB 2Y0DA 3PJSK 2AEFA 2PP6A 4OWFA 1NTMD 1EDJA 1VQ7P 3I56P 1L4AA 2KK7A 4JBZA 1GMJA 3KXDA 5AW4B 1ZXGA 2QJPC 1JTHA 3L73J 3OJAB 2A45I 4H0LB 2NZ2A 2KP8A 3H1HG 5GTHH 2R5BA 3R2PA 5K5GB 5AW8B 1LTJC 3IF4A 4D6TE 3L71D 4JPZB 2V7QJ 1LTJA 3TYYA 3C1LA 1HTLC 2YIUC 1BDCA 3G4SP 3HD7D 1QEXA 2O1JA 2B87B 2DW3A 3TF5A 1P84H 3G71P 1OIPA 1A02F 2QVAA 1GL2A 1JB0J 3CWBD 1PGQA 2I1KA 1SQVD 3RL0g 2ZXEB 1AQTA 2K9YA 1T3UA 2WZ7A 1KQFB 3U1CA 1OFCX 3H6PA 4LGDE 1LP1B 2C0WA 3O6QB 1NTKD 3GHGB 3H25A 1LTTC 1M1JB 1SQXK 2IZ0A 1KILB 1P84E 2I1JA 3PRJA 1BE3J 2FYZA 1KYOH 1K73Q 5TJHA 1YTZI 2Z4EA 2OTJP 1L0NK 2RH0A 4C7NA 1VQ5P 3L72J 1LTBC 3VMZA 5KAIH 1H88A 1RQVA 2BCCD 2YO2A 1HH0A 3RK3B 2O01N 2YKPA 1SQQE 2M0BA 2HODA 5BU8B 1PPJE 1RQUA 3BRTB 1NVOA 2HG5D 1Q86Q 4H44D 4H0LC 1LGHB 3NTNA 5APXA 3JC22 4EI2A 1SQBD 1VQMP 1KYOE 3BRVB 1N73B 5H2FH 1EZVD 3B71A 2FFDB 1XTGB 5AW5B 5CCGD 4UB8E 5CHXA 1FOSE 3L74J 5KAIE 5AVRB 1SQPE 1CI6A 3CD6P 3C9IA 1EZVI 2QM8A 2JR8A 5AVYB 2ZYDA 3E1IA 4YTPC 1X22A 1L0LK 2GUSA 1USEA 1BCCG 2ZVOB 5APYA 5KLVG 1JUNA 2AEMA 2G3AA 2M5AA 5APTA 4ZMDA 2V4HA 1PGOA 1GU4A 1HGVA 3B8EB 3H1LD 2WPVB 2Z5HA 2FYUE 1FZCB 3GHGC 2P7JA 1M1JC 1LP1A 3O6QA 3GHGA 1KILC 3HD7B 1KN7A 2M3BA 1L4AD 2YNYA 3AE9C 2HPCB 4CPGA 4JQ0D 4KJMA 3BVHA 5C39A 4D6TD 4MN4C 4Y28J 4DZOA 2IFMA 1IO4A 2E74D 2FKWB 1NAYA 3RK3C 2HYNA 4B86A 1KQLA 3I55P 2R5DA 1M7LA 1SQXD 1KTMA 4C46A 1NTMG 2WSEJ 1VQPP 3F5HA 1LT9B 1N73C 2QA4P 3VP9A 3USSA 2JEEA 2FFDC 2B89A 1N73A
chains in the Genus database with same CATH topology
2V4HA 3FX0A 2ZVNB 3JSVC 4OWFA 4BWNA 2ZVOB 3F89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V4H A;  3FX0 A;  2ZVN B;  3JSV C;  4OWF A;  4BWN A;  2ZVO B;  3F89 A; 
#chains in the Genus database with same CATH topology
 4PD4 E;  3CCE P;  3C8V A;  5AVS B;  2FFD A;  2N9B A;  1GL2 D;  1J2J B;  1NU1 D;  3VTP C;  1PFI A;  3L35 A;  4N6J A;  4DCK A;  1R5L A;  3IR9 A;  2GM4 A;  4GOD A;  5AW0 B;  2IZ1 A;  1MUU A;  3PHL A;  3N4X A;  1P84 D;  3AEB C;  3G3Z A;  2W6A A;  4K35 A;  4H44 B;  4YPC A;  5GTI H;  3GW6 A;  1P84 I;  2W6J H;  1N7S B;  3CME P;  1VQ9 P;  3H1K D;  2H89 C;  1FZC C;  1SQQ D;  2QRX A;  2HFE D;  1U7M A;  4ZKP A;  2XKM A;  3CWB G;  3FXD A;  4RO0 A;  3CX5 H;  2MKV A;  3HD7 C;  1BSH A;  1RE3 C;  3HD7 A;  2HPC A;  1KYO D;  1RE3 A;  1NTK G;  1VQL P;  2ZXX A;  5AW7 B;  5GTI E;  2JDI H;  4GKG A;  4H0L D;  1KYO I;  1SQP D;  2KZJ A;  3E7K A;  1OX3 A;  3E1R A;  1KFM A;  1RH5 B;  3H32 B;  4I1L A;  2N9Y B;  5E79 H;  3CX5 E;  5AVQ B;  1D7M A;  4L73 A;  3QWO C;  3L70 G;  2M3E A;  3VYI A;  1R5S A;  1FS0 E;  4U3F G;  2QG4 A;  1LT9 C;  2FYU J;  2ZT9 D;  1N8R Q;  1LT9 A;  2K37 A;  5KAF E;  2WMM A;  5B5E H;  1L4A B;  3D6Y A;  2POH A;  3G9R A;  1LTA C;  2P2U A;  2K1A A;  3MP7 B;  3EFG A;  1SQB G;  2O3J A;  1XTC C;  3CC7 P;  1HVV A;  3M0D C;  1W5C E;  2E74 B;  1DIP A;  3NFQ A;  5E79 E;  2FY8 A;  1L2P A;  2IBZ D;  1KB9 E;  2B9B A;  1J1E B;  2QSI A;  1FZB A;  1SS1 A;  1VQO P;  4H44 C;  1BGY G;  1BCC J;  5APS A;  2IBZ I;  5B5E E;  4GT1 A;  1N7S C;  2M8R A;  1SQV K;  1SP4 A;  3A0H H;  1N7S A;  4OGQ B;  3V2Q A;  3BCC D;  1FZE A;  3W68 A;  3L72 E;  3L75 G;  2WSC J;  1N2D C;  1VQ8 P;  1LTS C;  5CCG C;  5CMZ A;  1MKM A;  3AEF C;  1X8Y A;  1NTZ E;  4M3L A;  3V2N A;  1GL2 B;  3RL0 D;  3AE6 C;  3S1K A;  3RBZ A;  1S2E A;  5APQ A;  2FXO A;  4HKZ H;  3ITK A;  1GW3 A;  1G1J A;  2QIW A;  1DD3 A;  3SWY A;  4UB6 E;  1IC2 A;  3KDP B;  1Q2N A;  2ZVN B;  5EFW B;  1E79 H;  4L75 A;  2IYP A;  1JCC A;  3TGU D;  1FU1 A;  4I6M C;  3SFD C;  1EDK A;  1JMM A;  3H32 A;  2ZAE B;  1NYH A;  1GK4 A;  2A06 E;  1BGY E;  1AJY A;  3KYQ A;  4OH8 B;  1HUC A;  4WWI A;  4W7Y A;  1Z56 A;  1SQX G;  1ZR4 A;  3H1J E;  1YHQ P;  1Y47 A;  1L4A C;  1QLE D;  1KFN A;  1NAF A;  3L75 E;  1IJD B;  1JY3 P;  1L0N G;  2JWA A;  1QL1 A;  2E74 C;  2Q3E A;  3SWK A;  1NH4 A;  3GG2 A;  2JKV A;  2E5Y A;  4N78 E;  2W8Z A;  1J1E C;  3AE2 C;  1OXZ A;  3L73 D;  4TLF A;  1A02 J;  5KJ7 A;  1CI6 B;  1NWQ A;  1EXJ A;  4C7R A;  2WSE H;  2ZFC A;  1FZG A;  2ZT9 B;  4OGQ C;  1AA0 A;  4I2L C;  4WVZ A;  4RES B;  5DJT B;  1M90 Q;  3MTU E;  2Q5U A;  2M5A B;  3P8M C;  4YXD C;  5CJ0 A;  1FC2 C;  1GL2 C;  3A5T A;  1U7J A;  3BAS A;  3H1K G;  5KKZ B;  1L0L G;  3CCV P;  2KZI A;  1PGP A;  3H1I E;  5TIS H;  3OAK A;  3CX5 I;  3U59 A;  3AEA C;  3L4F A;  1NKN A;  4AUW A;  4EOT A;  3D6Z A;  4Z1M H;  2PGD A;  1USD A;  2BEQ D;  3H1H E;  5AW2 B;  3NXS A;  2LXC B;  2LKM A;  2OTL P;  1HJ0 A;  2OQQ A;  2O1K A;  2JJL A;  1ZN5 A;  2OYH A;  1YTZ T;  1K05 A;  4AQR D;  3CI9 A;  2WPS A;  3ABV C;  3SSU A;  5TIS E;  3JCU H;  4UB8 H;  2Q1K A;  1KC8 Q;  3RL0 B;  1BDD A;  4H13 B;  3A7O A;  3L70 J;  1NTZ J;  2CK3 H;  1BE3 D;  4U3F J;  1K9M Q;  2WSS H;  3I5C A;  4W7Z A;  1NU1 K;  3Q5P A;  2AXT E;  5DJU B;  1FE6 A;  1N7S D;  4HB1 A;  1RE4 C;  1IK9 A;  4NPD A;  3GMA A;  3FXE A;  1YYC A;  3CMA P;  4PJ0 E;  1NO4 A;  5CBO A;  1S9K D;  1RE4 A;  2QM7 A;  4DT0 A;  3JCU E;  3T97 B;  3P8C E;  1PIX A;  2H7H A;  3RK2 B;  1RY3 A;  3MGN A;  2IBZ G;  2ZT9 C;  1EDI A;  1BGY J;  1SQQ K;  3G6E P;  2P10 A;  2MJZ A;  3H1J J;  3L74 D;  2WVR A;  2K9J B;  3II6 A;  3BAT A;  1ZME C;  3TNU A;  3B5N B;  1KQS O;  5KKZ C;  1X9V A;  3L75 J;  1FDI A;  4ASW A;  3JSV C;  3V2R A;  3HE5 B;  3AE1 C;  1BSN A;  2H88 C;  3Q5S A;  2WQY C;  2J5U A;  1PP9 G;  3QH9 A;  1SQP K;  2YKO A;  1RF0 A;  1J1D B;  1H0T B;  4R4L A;  1EC5 A;  3AEE C;  1LJ2 A;  5B66 E;  3VMA A;  1ZRT E;  3EWK A;  2WSC H;  3TK1 A;  1FBM A;  1CW5 A;  3FWN A;  1FZF A;  3TGU G;  2K88 A;  4PD4 H;  2KLV A;  3RL0 C;  2YMY A;  3MHV A;  1SFC B;  2PRR A;  4H13 C;  2JP3 A;  3Q5R A;  1OVV A;  1BCC E;  5KLV E;  1SQX J;  5KJ7 D;  2FYU K;  4GOF A;  3M9Q A;  3H1I J;  3VMX A;  3Q2Y A;  3KPE A;  2KUB A;  5M1B A;  1KIL E;  1Q7Y Q;  1MFT A;  3B4S A;  2A45 G;  1OMI A;  1L0N J;  4OGQ D;  3M0A A;  3CCQ P;  2E76 D;  3CXH H;  5APU A;  3K5B A;  1OW6 A;  3H1H J;  4KT0 J;  5APW A;  1LNQ A;  1EDL A;  1KZU B;  3RK2 C;  2VRS A;  3T97 A;  3HUS A;  1W2E A;  1UII A;  2ZYG A;  1CSB A;  3L71 G;  3L73 G;  3R4Y A;  2IDB A;  2XV5 A;  1LTG C;  1HGZ A;  3CC4 P;  3WU2 E;  3B5N C;  1RF1 A;  2K9J A;  1S1C X;  3B5N A;  3RGU A;  3VP8 A;  2OTK E;  1YQ3 C;  1JY3 O;  3CXH E;  2JWD A;  2RMZ A;  2ITA A;  5APV A;  3CC2 P;  3LID A;  3HE5 A;  3H1K J;  1QGK B;  1HWT C;  1YJW P;  4ASV A;  1L0L J;  4BRY B;  3SFE C;  1PPJ D;  2W6B A;  3HE4 B;  2NPS A;  2ZYA A;  1J1D C;  3U1A A;  2YMK A;  1SQV G;  4OVN F;  1NTM E;  3WUT A;  4I7Z B;  1H0T A;  3CCR P;  1JY3 N;  1HBW A;  1U57 A;  2GUV A;  5KAF H;  2WSF J;  2WT7 B;  1ZOY C;  4GDO A;  1SFC C;  3P8C D;  2O01 J;  2KSJ A;  3V4Q A;  2KSE A;  2QJY B;  4BXL A;  1SFC A;  4HJG H;  2KIK A;  1KQG B;  2RKL A;  4YXW H;  4GOE A;  2WPR A;  5BU5 A;  2E42 A;  2BCC G;  2LXB A;  4WB4 A;  1BE3 G;  2C0X A;  1KB9 H;  4U7J A;  1JNM A;  1ZW0 A;  5KLI B;  2YXQ B;  1FOS F;  2KXP B;  1UIX A;  1SVF A;  2L5G B;  2KI7 B;  2LR2 A;  1OZH A;  2IX7 C;  3WMM 0;  2FYU D;  3CWB E;  1T8Z A;  1EZV G;  1FJP A;  1YQ4 C;  2OGU A;  1YJN P;  1URQ B;  4IL6 H;  3D71 A;  2KNC A;  1DD4 A;  1NTK E;  5L8R J;  4ZNC A;  1GTW A;  1FDO A;  4WY4 B;  1M8O B;  1G2C A;  2W90 A;  5KLV J;  4UB6 H;  2IPP A;  3CCM P;  1IFM A;  3L74 G;  2QE7 H;  3AED C;  2D2C B;  2E76 B;  4K3A A;  4W80 A;  4BRY A;  3AE8 C;  1S4X A;  4DOJ A;  3L70 E;  3H1L G;  3HE4 A;  1IFP A;  4U3F E;  4IL6 E;  3A0B E;  4I7Z C;  2Q7C A;  2Q9I A;  4H13 D;  1N7L A;  1T3J A;  1PP9 J;  2FXM A;  2FXP A;  3CL3 D;  1VQ6 P;  1GDT A;  1YI2 P;  1SQB E;  3Q3D A;  4PD4 D;  2WT7 A;  1N86 A;  1TU3 F;  1JY2 P;  4PV1 D;  4AYC A;  3KQG A;  1AVY A;  2KS1 A;  5AW3 B;  2QJY C;  4Y99 B;  3UIA A;  1EZV E;  1VQN P;  3S9O A;  2GA1 A;  1GK6 A;  4D6T G;  4PD4 I;  1FDM A;  3A2A A;  2UWJ E;  2B88 A;  2OYH B;  2WPQ A;  1FAV A;  3RK2 D;  1NTZ K;  2E5T A;  4HYT B;  1AV1 A;  4IL6 X;  1JOC A;  3WUV A;  5KLI C;  4IFD K;  2KLU A;  4IFF A;  3Q1M A;  3MIW A;  2XND H;  3AEG C;  1NTM J;  2P67 A;  3CCJ P;  3B5N D;  2AEJ A;  2E75 D;  3CXH I;  2CPS A;  1S5L H;  2PFX A;  3H1L E;  1KMI Z;  1EXI A;  2E43 A;  1URQ C;  3PLN A;  5AW9 B;  4LC1 A;  1NJI Q;  1URQ A;  1KV4 A;  2P58 A;  5KJ7 C;  1NU1 G;  4WY4 C;  3L71 J;  2NPS D;  3L36 A;  4WY4 A;  1GZL A;  2D2C C;  2E76 C;  1OWA A;  2N1T D;  2K3R A;  2OYO A;  1JO5 A;  1VQ4 P;  1JEK A;  1H89 A;  1S5L E;  1Y9B A;  3TNU B;  3CX5 D;  4WBA A;  1PZQ A;  4IOI H;  1SFC D;  4TT3 H;  1YJ9 P;  2QJK B;  1JCD A;  1SQX E;  1SQQ G;  3CWB J;  1PPJ G;  1SQV J;  1K04 A;  4EIJ A;  3V6I A;  1ZV8 A;  1L0N E;  2Y0E A;  2C9L Y;  3M91 A;  3M06 A;  1R8E A;  3FWL A;  4Y99 C;  5GTH E;  2WTY A;  5CJ4 A;  2Z5I A;  1NTK J;  1PL5 A;  2AXT H;  1GU5 A;  2OYH C;  3IN6 A;  5AVW B;  1S5L X;  2SPZ A;  1NU1 E;  2RN0 A;  3EQ2 A;  1SQP G;  2OAR A;  1IFJ A;  1KB9 D;  4PJ0 H;  1FZA A;  3AE5 C;  5AW1 B;  2BCC J;  3IAO A;  2OYI C;  2NRG A;  3M9H A;  2ZJS E;  3F89 A;  1ZP0 C;  1KB9 I;  2KYV A;  4BWN A;  2OYI A;  2WSF H;  4O9B A;  3MZW B;  2CPB A;  3A3Y B;  1WRG A;  3L72 D;  2FBW C;  4PV1 B;  2YXR B;  2O01 H;  2L91 A;  3H1K E;  3L70 D;  1NTZ D;  1DEE G;  1SQB J;  1QVF O;  1L0L E;  4U3F D;  4R4M A;  1QVG O;  2FYU G;  4ZKU A;  1VDF A;  2QEX P;  1IK7 A;  2IYO A;  3LW5 H;  1MV8 A;  2JO1 A;  1VF5 D;  3HUS B;  1M56 D;  1LT1 A;  5CCH D;  3CCS P;  2BAS A;  1EQ7 A;  1VPC A;  2I8D A;  3PP5 A;  1X79 B;  1S3J A;  1AQ5 A;  2H8P D;  1RHZ B;  1YIJ P;  3O8Z A;  1Q81 Q;  1RF1 B;  2Y9Z A;  4KHX A;  5B66 H;  1IZN B;  2E75 B;  1T2K C;  2QJK C;  3BCC G;  2IFN A;  1E5W A;  2A06 D;  1BGY D;  2FYN B;  3CPW O;  2B87 A;  2XNX A;  3H1L J;  3H1J D;  1DH3 A;  4RJT A;  4NPE A;  3N7N A;  1RF0 C;  3L75 D;  2NPS B;  5H2F E;  1CZQ A;  2R3S A;  3IFM A;  2J59 M;  4LLH A;  1LWU B;  4A7P A;  2N1T B;  2G8Y A;  4L74 A;  1Y8A A;  4N78 D;  3AE7 C;  4D6T J;  3AEC C;  2IBZ E;  4JYC A;  1M1J A;  3P7K A;  1JM0 A;  1URQ D;  1KIL A;  2KB7 P;  3V4W A;  3V5B A;  1PV3 A;  3EFF K;  4WY4 D;  3HRN A;  3TDK A;  1AFO A;  4PV1 C;  1GD2 E;  1GW4 A;  3WU2 H;  3BCC E;  3PH0 A;  3KHU A;  2Q6Q A;  2P1J A;  1JY2 O;  2D2C D;  4HH2 A;  1QX8 A;  3H1I D;  1MFZ A;  3S4R A;  3HUS C;  3RK3 E;  1M57 D;  4JYB A;  1PP9 E;  4QMA A;  1L0N D;  1NU1 J;  1NKZ B;  1OW8 A;  5AW6 B;  3GF3 A;  2A45 H;  2KNC B;  2H43 A;  3H1H D;  5KLV K;  3OW2 O;  1RF1 C;  1NHL A;  1YBK A;  2J58 A;  2W27 A;  1G2C B;  1IFD A;  1VQK P;  1PGJ A;  1QL2 A;  2E75 C;  1JY2 N;  3FGA D;  4EYY Q;  3TGU E;  3CCL P;  2FYN C;  1X0T A;  1DX7 A;  1MZ9 A;  1FJK A;  1K8A Q;  3CCU P;  3OA7 A;  3D70 A;  1T6A A;  2R44 A;  1SQQ J;  2NPS C;  1H8A A;  2KOG A;  1JMB A;  1VF5 B;  2R32 A;  1OVU A;  1LWU C;  1VL2 A;  3MUD C;  2N1T C;  1L0L D;  4GIF A;  2V7Q H;  1LWU A;  3MUD A;  1YIT P;  2N1T A;  1FZC A;  1WT6 A;  1HF9 A;  2KS1 B;  1OVR A;  3VMY A;  2Y9Y A;  1SQP J;  1HJB A;  4RKU J;  3L71 E;  3L73 E;  3M9B A;  3KZI H;  3AE4 C;  5AVZ B;  1OW7 A;  1IFI A;  1G1I A;  4L76 A;  3LW5 J;  1LTI C;  3HTK B;  3V2P A;  1NTM K;  2PAJ A;  3MD0 A;  5AVU B;  1WMK A;  3L72 G;  2BEZ F;  1S72 P;  1Q90 D;  1NTZ G;  4XFJ A;  3CLQ A;  1T2K D;  1SQV E;  3KZI E;  3VOP A;  3VN0 A;  3SWF A;  4N3Y B;  3A0B H;  3P32 A;  3WUU A;  2YKQ A;  3ZDM A;  2XZR A;  4DJG A;  1JTH B;  1ZRT D;  2QJP B;  3M0D A;  1Q82 Q;  3NMD A;  5BVZ A;  3AE3 C;  2R3C A;  2YO3 A;  2HR3 A;  3BCC J;  4JF7 A;  2W83 C;  4XE5 B;  2WWW A;  1LTJ B;  5AVT B;  1ZR2 A;  2WIT A;  1NOH A;  2A06 G;  1BCC D;  5KLV D;  1AVO A;  1VF5 C;  2BCC E;  2Q3I A;  1M1K Q;  1NGM B;  2AXC A;  1BE3 E;  3H1J G;  5CCH C;  3FX0 A;  2YIU B;  1KIL D;  5CCH A;  3GF7 A;  4XA4 A;  3PTZ A;  1NTK K;  5CCG A;  3L37 A;  3RK3 D;  2Y0C A;  1PP9 D;  1S9K E;  3TGU J;  1ZLL A;  1DEB A;  3LIE A;  3GLM A;  2HLO A;  5AVX B;  3A0H E;  1KD1 Q;  4IFM A;  5CBN A;  3HTK A;  5AVV B;  1SLQ A;  3RBX A;  3L74 E;  2XU6 A;  3CXH D;  3W67 A;  2OYI B;  4C7N B;  1KOR A;  1SQB K;  2C9N Y;  4NPF X;  1W2B O;  3TSI A;  4EDF A;  2XDJ A;  1IFN A;  5KTB A;  3H1I G;  2HOD B;  2Y0D A;  3PJS K;  2AEF A;  2PP6 A;  4OWF A;  1NTM D;  1EDJ A;  1VQ7 P;  3I56 P;  1L4A A;  2KK7 A;  4JBZ A;  1GMJ A;  3KXD A;  5AW4 B;  1ZXG A;  2QJP C;  1JTH A;  3L73 J;  3OJA B;  2A45 I;  4H0L B;  2NZ2 A;  2KP8 A;  3H1H G;  5GTH H;  2R5B A;  3R2P A;  5K5G B;  5AW8 B;  1LTJ C;  3IF4 A;  4D6T E;  3L71 D;  4JPZ B;  2V7Q J;  1LTJ A;  3TYY A;  3C1L A;  1HTL C;  2YIU C;  1BDC A;  3G4S P;  3HD7 D;  1QEX A;  2O1J A;  2B87 B;  2DW3 A;  3TF5 A;  1P84 H;  3G71 P;  1OIP A;  1A02 F;  2QVA A;  1GL2 A;  1JB0 J;  3CWB D;  1PGQ A;  2I1K A;  1SQV D;  3RL0 g;  2ZXE B;  1AQT A;  2K9Y A;  1T3U A;  2WZ7 A;  1KQF B;  3U1C A;  1OFC X;  3H6P A;  4LGD E;  1LP1 B;  2C0W A;  3O6Q B;  1NTK D;  3GHG B;  3H25 A;  1LTT C;  1M1J B;  1SQX K;  2IZ0 A;  1KIL B;  1P84 E;  2I1J A;  3PRJ A;  1BE3 J;  2FYZ A;  1KYO H;  1K73 Q;  5TJH A;  1YTZ I;  2Z4E A;  2OTJ P;  1L0N K;  2RH0 A;  4C7N A;  1VQ5 P;  3L72 J;  1LTB C;  3VMZ A;  5KAI H;  1H88 A;  1RQV A;  2BCC D;  2YO2 A;  1HH0 A;  3RK3 B;  2O01 N;  2YKP A;  1SQQ E;  2M0B A;  2HOD A;  5BU8 B;  1PPJ E;  1RQU A;  3BRT B;  1NVO A;  2HG5 D;  1Q86 Q;  4H44 D;  4H0L C;  1LGH B;  3NTN A;  5APX A;  3JC2 2;  4EI2 A;  1SQB D;  1VQM P;  1KYO E;  3BRV B;  1N73 B;  5H2F H;  1EZV D;  3B71 A;  2FFD B;  1XTG B;  5AW5 B;  5CCG D;  4UB8 E;  5CHX A;  1FOS E;  3L74 J;  5KAI E;  5AVR B;  1SQP E;  1CI6 A;  3CD6 P;  3C9I A;  1EZV I;  2QM8 A;  2JR8 A;  5AVY B;  2ZYD A;  3E1I A;  4YTP C;  1X22 A;  1L0L K;  2GUS A;  1USE A;  1BCC G;  2ZVO B;  5APY A;  5KLV G;  1JUN A;  2AEM A;  2G3A A;  2M5A A;  5APT A;  4ZMD A;  2V4H A;  1PGO A;  1GU4 A;  1HGV A;  3B8E B;  3H1L D;  2WPV B;  2Z5H A;  2FYU E;  1FZC B;  3GHG C;  2P7J A;  1M1J C;  1LP1 A;  3O6Q A;  3GHG A;  1KIL C;  3HD7 B;  1KN7 A;  2M3B A;  1L4A D;  2YNY A;  3AE9 C;  2HPC B;  4CPG A;  4JQ0 D;  4KJM A;  3BVH A;  5C39 A;  4D6T D;  4MN4 C;  4Y28 J;  4DZO A;  2IFM A;  1IO4 A;  2E74 D;  2FKW B;  1NAY A;  3RK3 C;  2HYN A;  4B86 A;  1KQL A;  3I55 P;  2R5D A;  1M7L A;  1SQX D;  1KTM A;  4C46 A;  1NTM G;  2WSE J;  1VQP P;  3F5H A;  1LT9 B;  1N73 C;  2QA4 P;  3VP9 A;  3USS A;  2JEE A;  2FFD C;  2B89 A;  1N73 A; 
#chains in the Genus database with same CATH homology
 2V4H A;  3FX0 A;  2ZVN B;  3JSV C;  4OWF A;  4BWN A;  2ZVO B;  3F89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...