2ZYAA

Dimeric 6-phosphogluconate dehydrogenase complexed with 6-phosphogluconate
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
465
structure length
465
Chain Sequence
SKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDACAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-phosphogluconate dehydrogenase, decarboxylating
publication title Conformational changes associated with cofactor/substrate binding of 6-phosphogluconate dehydrogenase from Escherichia coli and Klebsiella pneumoniae: Implications for enzyme mechanism
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 176
structure length 465
sequence length 465
chains with identical sequence B
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2zyaA02
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 2zyaA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zyaA01
4PZDA 1IYZA 3INTA 1WPQA 3VHRA 3OH8A 4BMSA 3A06A 4XQ9A 2NADA 1BW9B 3DONA 2C0CA 1PU2A 4B7CA 3K5PA 1UP4A 4PVCA 4TKMA 1P1HA 2IZ0A 1Z74A 4QO8A 4K28A 4R9RA 1HSOA 2DBZA 1R4NA 3ZNOA 3ZU3A 2X7HA 4F46A 4XIYA 1I01A 1GR0A 3WOHA 4DC0A 2WSBA 2P9EA 4QQRA 2BFMA 3DFZA 5A5EA 1HE5A 2AEJA 1PR9A 4DPMA 1E7MA 4XZ3A 3GUCA 5EN4A 3W6UA 1H9BA 3VAZA 3GN2A 1M6WA 3GAZA 1LDGA 3U4DA 4CM5A 1IZ9A 1HXHA 3JD2A 2JD1A 4I5FA 1VJTA 1N1EA 2O23A 4FB5A 2VTDA 3WYEA 2ILTA 3RKUA 2VYNA 4E12A 1IE3A 1GQ2A 4EJ6A 2GCGA 3GN1A 2EGHA 1DRUA 5A1TA 5A02A 1XR3A 4R1SA 3WG9A 1V3TA 2GGSA 1LDNA 2JD2A 3ADOA 1X1EA 3K8ZA 3A1NA 2QQ5A 3RUHA 1LQUA 2B36A 2NU8A 3RROA 3DAPA 2GZ1A 4ZQGA 4IDBA 4NFHA 4FD3A 3W8DA 3A28A 3WJAA 4IZIA 4A2CA 4XWYA 2ZB7A 4YJDA 1DDOA 1V8BA 2NU7A 3SBOA 3P7MA 5BNIA 3DTTA 3QV1A 2R00A 3NX4A 1WW8A 3KTDA 5T8KC 4R1NA 1UDAA 2AMFA 4NU6A 5DULA 1LUAA 3TZ6A 2O3RA 4WOKA 4U0KA 3ROQA 1YB5A 3ONFA 3OEYA 4U8GA 3JQ8A 2O3SA 4G5HA 4CLDA 2VUSA 3PHGA 4L8VA 4M54A 5TJHA 4EYEA 1M76A 1T2EA 2B83A 2H63A 3LT0A 1DB3A 5JS6A 5L40A 3NT4A 4H7PA 5KVVA 2OFPA 2JAPA 4AJ2A 1SNYA 4DQUA 4YJFA 2CDAA 1BSVA 2O3TA 1PR3A 4GPD1 4NU5A 3PVZA 1HWYA 1NQTA 1Q0HA 2RAFA 3RCBA 2X23A 3OFSA 2CVZA 4RQUA 5JNLA 4J3FA 1Z82A 1KEPA 2PKRA 1A7AA 1KY5A 1WLYA 2HU2A 1PSDA 4XR9A 4D79A 4D3FA 1LA2A 3MTGA 5DCWA 4DLAA 1ZSVA 3RAJA 1EMDA 1D4FA 1T24A 4W9NA 3RUEA 3MJTA 1MFPA 2XXBA 5KVCA 3VPFA 2P91A 3IC5A 2NVBA 4ND4A 4L4SA 4J16A 4CL3A 4WK6A 2NUAA 4BKOA 1HDGO 2PKQP 1ID1A 3VDQA 1HDYA 1E1LA 3GPIA 4FOSA 1HYEA 1QORA 1R0SA 4JK3A 3UOGA 5MGBA 3E03A 2EIHA 4IZHA 2Q3EA 3OJEA 3CE6A 3HG7A 4IDDA 1B8VA 2GO1A 2XAAA 4K6CA 1SOVA 1D1SA 4OQYA 3WR5A 4BO3A 3JYNA 1GADO 2Q1TA 3AM3A 5DBIA 3PWKA 3EZYA 1GUZA 1NASA 3H3FA 2Y67A 3TZKA 1F14A 4JROA 1QKIA 2HLPA 4KWHA 2FOIA 1VSUA 5T57A 4ZHSA 5A9SB 1R16A 3BMQA 4RVGA 1I2BA 1YKFA 3Q1LA 5CFZA 3GNSA 4FJ0A 4AJIA 2EHDA 1JAYA 3ANLA 1XWFA 4B3HA 5ADHA 2O3UA 5DF1A 3WQSB 3TFOA 1XCBA 3ADPA 3G1TA 5ER9A 4JBIA 3EMKA 1G0OA 2HK9A 3H5AA 1K3TA 1T1RA 1UXJA 5JAZA 2ZK7A 4RF3A 3LC2O 2AXQA 2G5CA 2OORA 3EAGA 3KYDB 3RIHA 5ICMA 1EE9A 5F3RA 2IZZA 1ZJZA 4BO9A 1SOWA 1ISHA 3D3EA 1E7QA 1PJQA 3TNLA 2FSVA 1EEHA 1V6AA 2E48A 2PY6A 1A72A 2PA3A 3BMQB 4WLOA 4ZRMA 4FFNA 3VDRA 4E5NA 2YZ7A 4WUVA 2FR0A 2JFFA 2R6JA 2VZ8A 4CM4A 1ISJA 3PJDA 1EFLA 3M2PA 4INAA 3L9WA 1OC4A 4MVJH 5B1YA 3LF2A 3NJ4A 5CAEA 4CV0A 1FXSA 1LTHR 3JTMA 5IFLA 1WAMA 3UICA 1A5ZA 4CLOB 4QT0A 4FFOA 4FGSA 5L95A 3FSRA 3P19A 5KCZA 1NR7A 3FN4A 4HNGA 4EW6A 2PGDA 3RBXA 4URFA 4E0BA 2BFAA 3GFGA 5F1KA 3GLQA 1PWXA 1GAEO 1K5HA 2WYUA 3C1TA 5COBA 3K73O 3UXYA 5JFOA 3G1UA 3HUDA 2YUTA 4OH1A 4JNKA 2QYSA 3ANMA 4GWGA 1GL3A 3V2UA 1YBMA 1ZIDA 2JHFA 1LSOA 2X9VA 3DOOA 2I67A 2JFGA 4Z0PA 3WIDA 3DTYA 1QLHA 1MV8A 1XQ1A 1KYQA 5KJFA 5JLAA 4XD2A 3PLRA 2Y0EA 3C24A 4KQXA 3HZZA 3PHJA 1DPGA 1B8PA 3H9GA 2V65A 5F1PA 4E2YA 1FJHA 1JWAB 3AWDA 3D3WB 3VPHA 2GPTA 2YFQA 1A9YA 3BIOA 1JTVA 1NP3A 2PD4A 4BNTA 2ZJ0A 3E5MA 2ZTMA 4GX5A 3E1KA 3DB2A 3NV9A 4BNKA 1HLDA 1F17A 3GG9A 4P4NA 3OBBA 3TSCA 4WCFA 3QVTA 2NV6A 4FSHA 1C1XB 1C0KA 8LDHA 2QYTA 3E48A 1PGPA 2P68A 3AOEC 3LT4A 2DTDA 5TC4A 1QLJA 2W8ZA 3H9QA 1PWZA 2E4AA 3GVCA 3GHHA 2EW2A 4PLCA 3OJ0A 3BTUA 3PI7A 1I24A 2PFGA 4PFJA 3DZBA 1CYDA 2EKPA 1UR5A 3SLKA 4D41A 5T64A 2ZTLA 3X2EA 4MKRA 4BNUA 4B3JA 3L77A 1CWUA 2AE2A 1U7HA 3FBTA 4E30A 3ZHBA 4CR8A 4B4VA 5IZCA 5G4LA 3AUAA 4IY1A 3U49A 3WXBA 1HF3A 4CLXA 3JQDA 2PH5A 1V3VA 2AQIA 4EJMA 4PRLA 1WZEA 2Q4EA 1NVGA 2X9NA 2DBQA 2B4TO 2DFDA 3WNQA 2BKAA 4NJMA 4BKUA 4BNHA 5JYEA 2FWMX 5U9CA 1OAAA 1OI7A 2O4CA 1KC3A 4JJIA 4OKIA 5KIAA 5JW6A 3JD3A 4L4XA 5JMPA 2OZPA 3R3JA 3WTCA 4QSMA 3INRA 4Q3DA 3WS7A 4J0FA 2VHZA 3GVIA 1ISMA 5AQ1A 5I8WA 1ZNQO 2DTEA 1F0YA 2JKVA 1LLDA 3AY7A 1ZSNA 1PZFA 3DBLA 3EVNA 1ORRA 1DHTA 1PS0A 1ZK4A 2HK7A 2Y1GA 2QRJA 4UUOA 4AVYA 5CEFA 5HTOA 3FWNA 4NJMB 1B3BA 3BZUA 4GX1A 3P2OA 3V2HA 4IM7A 5HS4A 1R15A 2C7VA 4GKVA 3JD0A 5DZSA 3L4SO 4GX2A 2DLDA 3F4BA 3I9NA 1FDTA 3HN2A 5G4KB 5G2OA 4R1UA 1U3UA 3ETGA 1P1RA 2BD0A 3ZWOA 4DXHA 2C5AA 1Q1NA 2EERA 5ER6A 4ROSA 4XB1A 2VN8A 2X8LA 3NUGA 4ITUA 5J23A 2YQ4A 5B4VA 1AE1A 4PCVA 2O7SA 5CPFA 1KBZA 5JMWA 1YRLA 1CRWG 5ENVA 3KZVA 3KB6A 1WVGA 3WQQA 1TLTA 2Y1DA 1ZW1A 4DTIA 1NQAO 1ADGA 1OOEA 2GDZA 5TJ9A 4LCEA 2P5UA 3QRWA 4IDCA 1DO8A 4GSKA 1C0LA 3HJAA 5TIIA 1B14A 1IZ0A 1HDOA 1X14A 5BSGA 3I5MA 2TMDA 5KJ6A 5CHEA 1BDMA 4EGFA 2X58A 3OIGA 1P44A 4CR7A 4RGBA 1BXGB 1GEGA 3O26A 3JD1A 4D0RA 4PLGA 1NAIA 1JKJA 2DU8A 3OQBA 3ZWBA 4XQGA 4J4TA 3AM4A 4PLTA 1HZZA 2NTVA 4BNJA 3QQPA 1W8DA 3C7DB 1HZJA 3D5TA 4NFSA 1MLDA 3M1AA 4JN6B 1KC1A 4PG6A 2R00C 2ZCUA 4IS3A 1WMAA 1BGVA 1E3WB 4J6FA 4MVJA 1ZK0A 4ZJUA 4DIBA 1DEHA 1JQBA 4LMRA 5JCJA 1TT5B 3O8QB 3ZH2A 3WFJA 1OMOA 3HSKA 4LMPA 2Y66A 1QYCA 5IJZA 4AG3A 4I1IA 1FMCA 3E9MA 1QMGA 2BLLA 2Y99A 2DFVA 4CM7A 3AU9A 1GZ4A 1AA0A 3KSUA 3NT2A 1NFQA 2P4HX 1UAYA 5T6BA 5GMOA 2YDXA 1BRMA 2FPGA 4NK5A 3S2GA 5LDHA 3WLFA 3ZV6A 3VZQA 2RH4A 1IPEA 1NVMB 3LVFO 1BVUA 1LU9A 4U6QA 1PQUA 1PTJA 4CM9A 5GZ1A 5K6AA 2V6FA 5KOIA 2IYPA 3GT0A 1MG0A 3K9QO 2EG9A 3TN7A 3IP3A 4AJ1A 3F9IA 1YDEA 1Q7CA 2AA3A 4Y67A 4AJOA 8ADHA 3W1VA 4YEDA 1IHXA 2O7QA 2W98A 4RDHA 1KETA 3B1FA 1HEUA 2D5AA 4XX0A 1E1NA 1GPDG 2Y68A 4W9NC 3BHJA 3EK2A 3PHHA 4EZBA 4FN4A 3D4OA 3I6QA 4CPDA 2EXXA 2O3QA 4QUKA 3N58A 4R4JA 3ZNQA 1DSSG 3F3SA 4IMRA 1MXFA 4D7AA 1I2CA 6LDHA 1PJ4A 3TQHA 4PLVA 3IKVA 3FPCA 1H94A 3PWSA 3U4CA 4EEZA 1HYGA 2VCYA 4M8SA 1R4MB 3WB9A 4YJGB 5L53A 4D45A 2AE1A 3GR6A 1PGJA 4JCOA 3GRPA 1HDXA 4ALNA 4OQZA 4IJVA 1GYPA 4KOAA 1M2WA 4O5OA 3I52A 4Q39A 4TRNA 3IIEA 4IDEA 3VTFA 3ZNPA 3HADA 1ARZA 2EWMA 4MPDA 3DAGA 4LW8A 4A10A 3IJPA 4AJ4A 4W7IA 4W82A 1AUPA 1I3NA 2I3AA 4IGEA 4XGKA 4IDAA 4BNVA 1UDBA 1JKFA 2GUGA 5L4NA 3GG2A 5TT0A 2X0RA 5EPOA 2B4RO 3CZRA 1CQJA 2DTXA 2C07A 2X9GA 1M67A 2G0TA 3PJGA 3JQ7A 2PGJA 1ZJYA 3AUUA 1CERA 2BHLA 4B3IA 4YAJA 4YAKA 2HDHA 1QXSA 2OUIA 3RJ9A 5I7SA 2B37A 5TQVA 2HRBA 4IIVA 2C82A 2PH3A 2CMDA 3NYWA 4AJHA 5AXCA 4RLSA 2BFPA 1O9BA 2XF8A 2WD7A 1O89A 4K1LA 2HJSA 2XOXA 1PGOA 4Q3EA 4TMFA 4WLUA 1I36A 4WLFA 3ZNNA 4PG7A 4U5QA 4ZVVA 1IHYA 1AXGA 4C7JA 4DUPA 1HDCA 1C3VA 1B7GO 2ZIZA 3WIEA 1U9JA 5LDGA 1LC0A 3JQGA 1Q7GA 3OETA 4JBGA 4NHEA 4WE3A 5CG1A 5KVSA 4OM8A 3V1UA 3FR8A 4FCCA 3HFSA 4B4OA 1N5DA 1ZUD1 4AFNA 5JBIA 5ES3A 3MTJA 1NM5A 2YY7A 1SB8A 4FFLA 3ETDA 3MOIA 4XDZA 1OC2A 1HDRA 3V5NA 1Y8QA 3HN7A 1SO8A 1NPYA 1CEQA 5I9NA 5FI3A 2HMVA 3M2TA 4L75A 3VH1A 2BELA 3LC7O 1X7GA 3ZI0A 5TRTA 3VPXA 3ZWWA 3W8FA 5A3VA 2BGKA 2EV9A 5DOVA 4ALLA 4F45A 5DN9A 3WLEA 4CQMB 5B4UA 3H6KA 4I5GA 1XA0A 2Y1EA 5F1OA 1NTOA 2Y93A 4AJLA 4DBVO 3KXDA 3MZ0A 4ZD6A 1UXHA 1ONPA 2E82A 3H65A 4B7UA 4EUEA 1EK5A 1ZEMA 5JC8A 1Q0QA 4W99A 4DL9A 4XDYA 3K96A 3EUWA 3DHNA 3IOYA 4DA9A 5BQFA 4XEHA 2NU6A 4O6VA 3C7CB 3T7EA 4E6PA 4CM1A 4JLWA 4BNXA 4IQ0A 2GSDA 1E0DA 5A03A 3NTRA 3ZV4A 2WE7A 3H9EO 4YAIA 1P1JA 3BMCA 4OGWA 3KSDO 4MP8A 1DAOA 1A4IA 2WJPA 3RUFA 3IAHA 4RF5A 4I9HA 1D8AA 1SEPA 4L73A 5I9LA 1DFHA 3DZGA 3OP4A 2ZATA 3WQRA 1H2HA 2O3JA 1UJMA 2I66A 4WJZA 4DREA 2Q1UA 2HMSA 1EBFA 1P45A 4MVJP 3HNPA 3VZPA 1H6AA 1YOVA 3HE3A 1T2FA 1YL6A 1E5QA 1H5QA 4MKXA 4ID9A 4XJSA 3JD4A 4Y9DA 4UULA 3T7CA 2O2YA 2POQX 4BO8A 1U3VA 1Z7EA 3JQEA 1DFIA 1UXIA 1DOHA 1KY4A 3GNTA 3VPSA 1ZCJA 3AOGA 1PZGA 3BMNA 3NT5A 1YJ8A 3GA0A 3PLNA 1VL8A 4S1VA 3ZWAA 2D59A 3D5QA 4H16A 4DQVA 4PGFA 3I4FA 1C1DA 4HWKA 4DYVA 1U5CA 1J0XO 1DBVO 1O0SA 1SB9A 4AJPA 4BQPA 1RM0A 4YR9A 3JQFA 3U4IA 1R4NB 3FF4A 1CJCA 1PJCA 3WGTA 4GLLA 1LXCA 2W90A 2DQ4A 4J43A 3HQ4O 3DR3A 3OECA 1KEUA 4XQCA 4BOYA 1MGOA 4C7KA 1E6WA 3ANNA 3TZQA 1PJ2A 1E7SA 3JQBA 3KRTA 1AVYA 5EINA 2VHWA 3V1YA 2NWQA 5FEUA 1N1GA 2HJRA 4IDFA 2R2GA 4PLPA 1IY8A 3H7AA 1SCUA 2ZTUA 1LC3A 1ULUA 5CPBA 5AOVA 4MIEA 4RO0A 5DDIP 4CMJA 4A0SA 2Q2WA 4HNHA 3F4LA 4RPGA 3DBVO 4GVXA 3KLMX 2NACA 4XYBA 4FBGA 1VL0A 3PRJA 4B4WA 1C14A 2D8AA 3U62A 4YAGA 3JQ9C 3MJVA 5FYDA 1DIHA 2G76A 3F5QA 1YQGA 3AW9A 1GPJA 1LX6A 2EW8A 1ZBQA 1XLTA 1T25A 1A4UA 3U0BA 1GCUA 4BO4A 5BSHA 1YONA 1KS9A 2X5OA 4KMSA 3KEQA 3TF5A 4FFPA 4MJLA 5DCYA 3ZW8A 1R0KA 4K9DA 3DBRA 4OOFA 3PHIA 3AI1A 4DPLA 3E8XA 2BGLA 3JQCA 1V0JA 4UEKA 2CDBA 1TT7A 2HO5A 4XR4A 4RVUA 2HQ1A 2A35A 4YAEA 3RC7A 1DC3A 1M6HA 3JQ8B 5IXSA 3I3OA 4R3NA 4TRRA 2X0IA 1U5AA 3F1LA 1LDBA 4E4YA 2JFHA 4JJFA 5BT9A 1SZJG 3TWOA 4EI2A 1E6EA 1NPTO 2BGMA 4HV4A 1U1IA 4YJFB 2NM0A 3DBRB 5JDIA 4Y8VA 2VYVA 1XELA 1PIWA 3N74A 4LCJA 2C7GA 1NYTA 1NFRA 3GDOA 3ZWMA 1U2DA 1S7CA 3V8BA 2B5VA 4OKNA 5DOZA 2VHXA 9LDBA 1VPDA 1X0XA 4CMIA 4HFNA 1NPDA 3L07A 4KQWA 4NR0A 4AJEA 4NFYA 4M55A 4XIJA 4K26A 1K89A 2J5KA 1G0NA 2DM6A 1K2WA 2E37A 2F00A 4D42A 1Y5MA 5CG2A 4TVOA 5JY1A 1XDWA 1BXKA 2O4UX 3M1LA 2WD8A 4WPGA 4EBFA 1LSSA 5C7LO 3LSYA 5CEEA 3ZWPA 1JVBA 3AFMA 5I7VA 1T1SA 1R37A 2VNAA 1I33A 1P77A 1WDLA 1NWCA 1KERA 5JY6A 4IJUA 3O38A 4W4TA 2AW5A 1W73A 4CV2A 1XQ6A 1QV7A 4CR6A 2Z5LA 3CH6A 1E7RA 3PPIA 4YVFA 4P4LA 4CMIB 1ZK1A 3RASA 3EHEA 4XYGA 3QJ5A 5L45A 4ND1A 3PXXA 2QZZA 3ZHYA 4RL6A 1RYDA 3BMOA 3BTSA 3E82A 3EYWA 1U3WA 4PVDA 5K6AC 3ROKA 4GBJA 1XU7A 1T2CA 1LLQA 5JDCA 1MC4A 1B8UA 3RUCA 5I7FA 2VNSA 3LQFA 1PS9A 1QP8A 2J3KA 4YPOA 2ZYAA 4WLVA 2P4QA 1P0CA 3LLSA 3QLJA 2AQKA 1JWBB 4I9NA 1RM5A 1VSVA 2ZB3A 2ZTVA 1HLPA 2PZLA 3KYCA 4GMFA 4BV8A 3DMTC 2G82A 4PG8A 4LN1A 3DWFA 1LQTA 3ASVA 3H4VA 1XG5A 3FNEA 4NDNE 5HBRA 4BNWA 1CQIA 3MWEB 4R9SA 2YYYA 3D4PA 3GNQA 5A04A 4RQTA 9LDTA 3L4BA 4FDAA 4CV1A 1AXEA 3AFNA 2Q45A 4FJ2A 4J7CA 1Z7BA 2FMUA 3B6ZA 4YRBA 3P5SA 1VLLA 4H3VA 1Y1PA 1K6IA 2IYOA 4L76A 3L9XA 4KDEA 2VOEA 3UCEA 4ZN6A 3EDMA 4DVJA 1A71A 4BB6A 1LLCA 2A4KA 2EKLA 4EJ0A 2QX7A 4MP3A 4CM4B 5JXWA 1HE3A 1JKIA 2FHSA 3RC2A 2C54A 3G0OA 1Y8RA 2GN6A 3C85A 3DZKA 4YQZA 2NVUA 3IKTA 2YV1A 1I30A 4YCAA 5AYVA 1E5LA 2GRAA 3B1KA 4FW8A 5ENDA 3ZHZA 1FDUA 4ZRNA 2Q4BA 3PJEA 1U7TA 3HDYA 4ALKA 1GV1A 1TEHA 1EFKA 2NSDA 3RBVA 3UH1A 5EMHA 4L4RA 2NU9A 1P1IA 1E7YA 1ISGA 3UW3A 4BNIA 3PDUA 2OOSA 2PKQO 3CIFA 3CTMA 1DC4A 4B8ZA 1V35A 4CMHA 2CNBA 2EJWA 1YVEI 3L6EA 4AJKA 1KVSA 1RKXA 3F1KA 3DAFA 4UUPA 2W2LD 1PL8A 3JYOA 1UXKA 3GFBA 1HDZA 1ML3A 3ZWNA 2I6TA 3OJOA 3H2SA 4RZIA 3CMCO 4M87A 2QIOA 3I9MA 2AQ8A 3ZV3A 3ONEA 4P4GA 1YQDA 4CQLA 5C7OO 2DBRA 2ZYDA 3WBFA 3ZU4A 3GOHA 4PLWA 4DIOA 4CMEA 3GQVA 4NPCA 4Q3NA 4RVSA 3PGJA 4BVAA 3WTBA 4F6LA 3CUKA 4LSWA 1EE2A 4J1QA 2GN8A 3PZBA 1X7HA 2HMTA 3R0IA 3I4CA 3UFXA 3RU7A 1SC6A 2X86A 2CF5A 2I76A 3DXFA 4M86A 1MXHA 1MP0A 4LVCA 4WCFB 5L7WA 1Y9EA 3AY6A 3VVBA 4BNZA 1I32A 4Z9YA 1DXYA 1E7WA 1LRLA 3FNHA 2FP4A 4NH4A 2DAPA 2OO5A 5TSDA 4EEXA 1E3LA 1GV0A 3H9JA 2BI8A 1BVRA 4ALIA 2SCUA 1HSZA 3MJ4A 2CF6A 1EUDA 2HKIA 3RBZA 1GUYA 5COAA 1E3IA 3WBBA 5I7EA 4R68A 3IDSA 3S2FA 1PX0A 2NTJA 5CDUA 3ZU2A 4CLHA 3PFWO 3VOSA 4WLNA 1EVIA 4FQ8A 4Z9XA 4OYRA 5AVOA 4L0QA 3GZ4A 4MP6A 2X6TA 5KWEA 4N5LA 3UCFA 1GZ3A 1YBAA 1RPNA 4JGBA 3BYZA 1A9ZA 4ND3A 4BB5A 2B4QA 1MX3A 1H0KA 3QWFA 4D3DA 4NQZA 4WCDA 1T4BA 5KVQA 2BI7A 5U4QA 3CKYA 4HFMA 4TRMA 3K30A 2ZQYA 2JHGA 3ZWCA 4BNGA 2P9GA 1GZ6A 4J49A 4ZA2A 3IS3A 4MIYA 4NIMA 4CLRA 3AU8A 1GDHA 2OP1A 3PQDA 3PK0A 3WICA 1NQ5A 4ZU3A 4IXWA 3A9WA 4TZKA 2ET6A 4MOWA 3RFXA 2JCYA 1ZVMA 3DBLB 3HDQA 3PYXA 5T8KA 4YJHA 1Y81A 1ZEJA 1B26A 2D4AA 1LBEA 4OHUA 4GLOA 1Q2XA 2UUPA 2VZ9A 4GX0A 4ZGWA 4XA8A 4WLEA 3GHYA 1DLJA 4XRRA 4FOOA 3BAZA 3EVTA 5G0VA 1UDCA 2O48X 3GUYA 5JO0A 5LC1A 3I23A 1LLUA 1WP4A 1XIVA 3ZCXA 1KVRA 2Q2VA 5EQFA 4BO6A 3OA0A 2HK8A 4D46A 2NQ8A 2XXJA 3A4VA 4CM8A 1D7OA 2A9FA 3FI9A 4JIGA 4RORA 1CIVA 1NAYA 1N9GA 3FTNA 4RLHA 3S8MA 5BSEA 1NNUA 1I0ZA 3TZCA 1PJSA 5KTKA 3P2YA 3JQBC 1KVQA 3UAGA 4IPTA 5BNTA 4RJTA 1MUUA 4RDIA 5A3JA 2DUUA 2D1YA 2NNLD 2NLOA 2D3TA 3Q9NA 4TVBA 4NBUA 4YT4A 1NHWA 3AUTA 1J6UA 4XCVA 4YDRA 1CDOA 2A94A 4IIUA 2CVQA 1TXGA 4N5MA 5EESA 2C29D 1SAYA 2YHIA 1ONOA 2FRDA 4JP3A 3VKUA 1LRKA 2Q50A 1YH3A 4DYDA 1HE4A 5KJCA 3SXPA 3PEFA 1W0CA 2VWPA 4CMGA 3NKLA 4OXYA 5L7YA 3GMDA 4BMNA 4HADA 1YE3A 2RHCA 1QYXA 5G0UA 4U6SA 3ZGYA 4AICA 3KSZO 3QVOA 4NBTA 4YT8A 1EUZA 3WGZA 3K6JA 2DKNA 1DAPA 1PS8A 3EZLA 3GVPA 1PJ3A 4G65A 4MVJF 4ALMA 1L7EA 1J5PA 2UUOA 1RJWA 1P1KA 2V7PA 2WYWA 1KEWA 1RYEA 2WYVA 3JYQA 2C20A 1P9LA 1UP7A 4MVJM 4LISA 3I1JA 4BNLA 4GVLA 4DQXA 3DOJA 1QSGA 2OHXA 3ZDFA 3KUXA 4IINA 4RPLA 5KKCA 1XU9A 1RM3A 4J2HA 1RM4A 3AK4A 1SMKA 3EW7A 3CINA 3UGKA 4P38A 2WEKA 3RC1A 2Z1MA 3OICA 5HS6A 2Y0DA 3LF1A 3TL2A 1NQOA 2PV7A 3BXXA 5FWNA 1H6CA 3TDKA 3QY9A 3H9UA 2I99A 4P22A 3HDHA 5C7IO 1N92A 1O8CA 4DMLA 1N2SA 3Q11A 2I9PA 3RU9A 3JQAA 3H2ZA 3E5RA 4WNCA 4MVJG 2CFCA 4Y6RA 1XSEA 4UVGA 3DBHA 2HUNA 3NDRA 1SBYA 4E3ZA 3LYLA 1O95A 3GPDG 2CZCA 1NR1A 5CP8A 4YWJA 3RVDA 3MOGA 3DC2A 2IZ1A 4OSOA 3WSVA 4FFMA 3DZIA 4FC7A 4UVHA 2PR2A 3GGOA 4J4HA 2VOJA 4E5YA 3D0OA 4RPKA 4B8WA 4PN3A 3L6DA 5I9MA 3LU1A 4PZCA 3DEYX 5JC1A 3JQAB 3GDFA 3HWRA 1ULSA 5G0WA 3EY4A 4IJKA 2WTBA 5B37A 3OJLA 4GKBA 4BO7A 3FD8A 3GGGA 5ILOA 4IDGA 3W4KA 5TT1A 3K31A 2IODA 3GC6A 2O50A 4N5NA 3KOUA 3ULKA 3IUSA 5MDHA 1OFGA 4IMPA 4Q3CA 1J49A 1YB4A 2OMEA 1VJ1A 4RF2A 5ITWA 4F3YA 2J3HA 4WGGA 4TKLA 2UYYA 3KO8A 4UREA 5L9AA 1LNQA 4Z3DA 4EITA 4BGIA 3WJ7A 3JV7A 1KIFA 3JQ7B 3L4BC 3O4RA 2VT2A 1AGNA 3NRCA 4XQEA 1RWBA 3FTPA 3AI2A 4YACA 4BNNA 4JJGA 4NZ9A 4BNFA 3RFTA 1JLLA 4O63O 1YGYA 2FR8A 3SX2A 1E1MA 3PIIA 4AJNA 4Z6KA 5HM8A 2WD7B 2RHRA 3QVWA 1LJ8A 4KP7A 2PZMA 4CUKA 2BH9A 4ESOA 1H93A 3PHLA 1IL0A 5FFFA 1DLIA 3RUDA 2WDZA 1H9AA 3GEDA 4UVEA 1CF2O 3WDSA 2EP5A 4PG5A 1GUFA 1YJQA 3W6ZA 2BRUA 2CUKA 4E2ZA 3JQGB 5CEJA 2G1UA 3AI3A 3BTOA 3L0DA 1PQPA 3CSDA 1DIGA 3SEFA 2J8ZA 4IXTA 4J9UE 1VM6A 4CQMD 4OXNA 1YB1A 1UZMA 1P33A 1ADBA 1GFSA 4IS2A 4E2WA 4LRTB 5C5IA 4R54A 2H6EA 1GY8A 3HB4X 2VHVA 4UUMA 1Y8QB 1P1FA 4IJWA 4U0JA 3KHUA 1D3AA 1OZAA 2X0NA 2VRCD 3DFUA 4WEOA 2Y0CA 4ND5A 3ZWYA 1EVYA 2E49A 4YBZA 4I9UA 1X15A 3FWZA 1EDOA 1LDMA 3VVCA 5BR7A 1KVUA 4OJNA 1I3MA 1PGQA 1ZXLA 2GASA 3OQ1A 3T4EA 2P5YA 3NTQA 3F6YA 1UP6A 3QWIA 5JAMA 3LLVA 5HA5A 2W4QA 7MDHA 1GD1O 1DC5A 3AJRA 3R1IA 1FDSA 1NBOA 4J2OA 5CDSA 4WCFC 1E3EA 1YS4A 1BW9A 4KTTE 4TRJA 4WASA 5DBFA 1VKNA 3NDIA 3I9LA 5CDYA 2Y05A 2Y1CA 4E13A 4DC1A 3AY3A 3WNVA 2X5KO 3U09A 4GAEA 4L74A 4Y6SA 4BUCA 1MB4A 5IAAA 2P2SA 3ZZNA 4BKPA 3QSGA 2IEBA 3BHIA 3PTZA 1HTBA 3BMCB 3DZFA 1T2AA 4J7UA 3MCVA 3IJRA 3PFFA 2WMDA 5IG2A 4GL4A 2GR9A 2VHYA 3DQPA 5IZCC 2C2YA 3E18A 5TF4A 2B5WA 2YFHA 3FR7A 5HRUA 4H15A 1SEVA 1B3RA 3OIDA 2GYYA 4ONEA 2Q99A 2XPCA 2QHXA 1YOVB 3QW2A 3OMLA 5TLSA 1PJBA 2X22A 5L7TA 1EQ2A 5C3MA 1BDBA 2JCXA 3NAQA 3ZU5A 4NBWA 3ITDA 2IXAA 3MEQA 2Q1SA 4TWRA 4FPXA 1WDMA 4HP8A 5LCXA 3ITKA 3PDJA 4CODB 1DHRA 1ADFA 5IDWA 1CETA 3C3XA 1U4SA 1OX3A 2IRWA 5B4TA 3ST7A 3TOZA 2FZWA 2GLXA 5JCXA 3BMNB 3HB5X 4QEDA 3FCOA 2AHRA 4J0EA 5IF3A 1K0UA 4LRSB 1C1DB 1XEAA 2AEMA 1DRVA 5EQDA 3OEWA 5F21A 3ON5A 1PJLA 3SC4A 4BGEA 4LSMA 3W8EA 3CEAA 1GQYA 2VYND 3C8MA 4ZQHA 2WM3A 2IEDA 3WMXA 1GCOA 3GAFA 2ZKLA 1PZHA 4YT2A 1DJNA 2GN9A 1R12A 2ZCVA 3RI3A 1W4ZA 4CMCA 3GDGA 5G0TA 5FI5A 3LC1O 4GH5A 1VJ0A 2FSSA 1VL6A 4BNYA 1E77A 1N7HA 2OBYA 2V6BA 2V6MA 4QFDA 3E9NA 2PD3A 3AM5A 1W6UA 1LSUA 4S3MA 3EGOA 2DT5A 4CUJA 1WWKA 1XHLA 2I65A 5L3ZA 4ALJA 3WWZA 1EVZA 5EJ2A 2DPGA 3ZV5A 1E3JA 5K0ZA 1GQQA 2YJZA 2ZJ1A 3OSUA 4BMVA 4LVUA 1IUKA 3R6DA 5DP1A 4YT5A 5DCUA 1YWGO 4OMUA 2DUWA 2D5CA 5CDTA 3UHAA 3K2BA 4WKGA 2B69A 5F5NA 4J4BA 5A9RA 1I10A 1FF9A 4XB2A 2FR1A 2TMGA 4J9VA 4JXKA 4WOJA 3VZRA 4PLFA 4KZPA 3H8VA 3DOCA 3TRIA 3OIFA 4J91A 4OXKA 5GZ3A 3X2FA 1F8GA 5T5QA 4JP2A 1IULA 3Q6IA 4G2NA 3WMWA 2EEZA 3NEPX 2Q2QA 2HCTA 1G6KA 3LT2A 5TNXA 5K9ZA 3WFIA 2QRLA 1EBUA 4ND2A 3PP8A 1PJTA 3WGGA 3QWAA 4A03A 2PK3A 1B2LA 4EUFA 5L4SA 4M89A 2ZYGA 1UAGA 3OA2A 4CMAA 1YQXA 3FNGA 3WGHA 4XYLA 3SLGA 4D3SA 4J1NA 2CY0A 4BNMA 4IQGA 1BG6A 1WXDA 3WGQA 4B79A 4BS9A 3ZWXA 4CLEA 2VYVD 3PYMA 4YQYA 5A9SA 2CVOA 3RJ5A 2YV3A 4GI2A 3UN1A 2H9IA 3LZ6A 5EL0A 4CL8A 2J5RA 4QFCA 2AG8A 4FC6A 1ENOA 4PIVA 3JQ6A 3KVOA 1P31A 3QVSA 2GZ3A 2Z95A 4DLLA 5AXDA 3KBOA 5BSFA 1V9LA 4RPJA 5DT9A 1VI2A 1NWHA 1KEVA 4OL9A 1FDVA 3PJFA 2YDYA 4PG4A 4A7PA 4MDHA 2W2KA 3KYDA 5IXYA 1NX6A 3Q2IA 4RVDA 4CM6A 1I3LA 2PTGA 4CV3A 4NNJA 3A14A 1MG5A 3D4NA 3IL2A 4HXYA 1X1TA 3F5SA 5GY7A 2X0JA 4NMHA 4J1SA 4PRKA 3ORFA 1JVSA 4TZTA 4O59O 1JAXA 1B0AA 1LRJA 2FPIA 3IMFA 4L9RA 4QXMA 1PL6A 2CDCA 3G49A 4MKZA 4R5MA 2ZB4A 3CZMA 4HBGA 1QRRA 1U28A 1X13A 1V3UA 2NVWA 1PQWA 3BMOB 1NFFA 3SC6A 4GWKA 2W2KB 3CTVA 5H82A 3U3XA 1WMBA 1Y6JA 4J1TA 4XYMA 3VH3A 4Q9NA 3WSWA 4CLOA 1O94A 1Q0LA 5KJEA 5ICSA 3GEMA 3PZRA 3GMSA 2FZEA 1TVEA 2B35A 2HMUA 2VT3A 1NHGA 2Q49A 3FBGA 5AXAA 1DIAA 2EGGA 2VTEA 3KYCB 3W4IA 4UVDA 1HRDA 3SVTA 1ENZA 3S2EA 4NBVA 5ILGA 3HDJA 3ETEA 4DRYA 2X5JO 5THKA 2Q1WA 2A92A 1ONNA 1X7DA 1MA0A 1GU7A 2QRKA 3QVXA 2CSUA 2QZ9A 1HYHA 4K6FA 4NBRA 1U8FO 3OHSX 1HL3A 3BHMA 4N7RA 4BGUA 4IBOA 4E5PA 4MVJE 5AXBA 3QWBA 4YYZA 5CDGA 3QE3A 3DO5A 1IOLA 3S1LA 3H5RA 2ZQZA 4Q3AA 1B15A 3D3WA 4BO1A 4I8XA 2P9CA 1BTOA 3R3SA 1E6UA 4IGFA 4IUYA 4RZHA 3KM0A 1Y8RB 4DGSA 2AEFA 5F5LA 2UVDA 2NVUB 3H3JA 3TL3A 5IZ4A 1ZH8A 2W2LA 4R1TA 5L4LA 4MIOA 1YXMA 2NQTA 3NDJA 2PLAA 3WYCA 3E6AA 3SJUA 3TFQA 3UKOA 4YA6A 4BO5A 1XYGA 4CMKA 4DMMA 4RV9A 4B4UA 5EIOA 1M75A 1NXQA 3U4HA 1BWSA 4XYEA 4BKQA 1C1XA 1T4DA 1ZFNA 2BFOA 2EKQA 5BNFA 1HKUA 2PD6A 1E92A 4CMBA 3BTVA 5A9TA 4E5KA 4A73A 5JPIA 3RUIA 1K6JA 2YHUA 3DZHA 4BL5A 4RCVA 1IPFA 2QG4A 1I5RA 3F47A 5G0SA 1N7GA 3QWHA 4GQAA 1JW9B 2JL1A 3VTZA 4E31A 1E1KA 1VKOA 1Y9AA 2AG5A 3DHEA 1ISIA 3WGYA 3C1AA 4ZQEA 3UF0A 1K6XA 3MJCA 2PZKA 1DC6A 4BKRA 3C1OA 2GN4A 1D1TA 4OO3A 4CQLB 3ENKA 3NJ8A 4MINA 3RFVA 5ITVA 1YL7A 4MVJI 4FIZA 1Z75A 3FNFA 3TJRA 1GYQA 1KVTA 3JYLA 3U5TA 1J4AA 3SJ7A 3OM9A 1UZLA 4D43A 3WWYA 4E32A 1ZSYA 2VWQA 5GZ6A 1UXGA 1QYDA 1ZMTA 3TPCA 3PGXA 1HT0A 3WGOA 3GZNA 4ILKA 3AUSA 4CUZA 3B70A 3ZN2A 2O2SA 1P0FA 3STHA 1BHSA 2E6UX 3D64A 3TOXA 3PQFA 1YDWA 1ISFA 1H2BA 1JU9A 2HAEA 4QO7A 1C0IA 1P3DA 1VRWA 4OAQA 4XGIA 3RUAA 4PLZA 2PGLA 4DBZA 3UUWA 4II2A 4YTEA 2ZB8A 2J6IA 1PGNA 4CM3A 1OBFO 1ZXBA 5G4KA 3F46A 1G1AA 3GZNB 3NGLA 4YRAA 1SPXA 2GERA 3JCZA 3NTOA 2FN7A 2FPPA 1LDEA 1S6YA 3ONDA 4M49A 4UEJA 5EERA 4FJ1A 4BIIA 3V1TC 4I08A 4P8RA 4R69A 4XKJA 4KDFA 4B7XA 4Q3BA 2HRZA 3ZW9A 1KOLA 5DNAA 2DBVO 3GH3A 3PQEA 4E33A 4JBHA 3FHLA 4NG5A 2Y1FA 5I8ZA 4TSKA 3S55A 3U9LA 3DL2A 4BO0A 3JQ9A 4HY3A 4Z0TA 4EDFA 4BQRA 2G17A 3T4XA 4HFJA 5T67A 4DIFA 4Z3KA 4TQGA 3JQFC 2WE8A 3D7LA 1ENPA 1GEEA 2CD9A 4J7XA 4CLRB 3ABIA 1Z45A 4KUEA 2FY8A 3CMMA 3UCXA 3OJFA 3QHAA 1NAHA 1U2GA 1BXGA 4BO2A 2VUUA 4RVHA 4YJHB 2OBNA 4C4OA 3FPLA 5FF9A 1L1FA 1YL5A 2H5LA 4O0LA 3CPSA 4NI5A 3RQSA 2RH8A 1QYWA 2VWHA 3ZWVA 5B12A 2RIRA 2X4GA 1AHHA 4A27A 5DBGA 3RC9A 4JX8A 1UH5A 1WNTA 1VC2A 3KV3O 5H81A 5HWSA 1E3WA 3D1LA 1EDZA 2VQ3A 1EQUA 3H5NA 3VKVA 3G3EA 3KEOA 5TGDA 3I6IA 1TT5A 3O8QA 4XJTA 1DJQA 1ZO8A 2AQHA 3B1JA 2V6GA 1WZIA 2PWZA 1I3KA 4A26A 1P74A 2JD0A 4CM8B 5JAQA 3MWDB 3I9JA 4YB8A 4N18A 1X0VA 1ENYA 1N9GB 5A06A 5JE8A 4DLBA 2EP7A 2B0JA 3VPGA 3VC7A 2IXBA 1I8TA 2J5QA 3WX0A 5KNLA 4FFRA 4YRDA 1EVJA 4AJJA 5A05A 4R51A 5C37A 2IDZA 1JN0A 4UVIA 4KUGA 5IDYA 2C2XA 3COSA 4Y98A 4MVJD 4HFRA 3RSHA 1BXZA 3V2GA 5JCJD 4CJXA 2YHIB 3K2EA 1HETA 2GNAA 3WGIA 3IUPA 4E21A 4R01A 3QA9A 3GGPA 1YBVA 1LEHA 1T26A 5THQA 5JAIA 1ZK3A 1UZNA 5JYDA 4GGOA 1YO6A 3C7AA 4UAGA 2F1KA 3QP9A 1H6BA 3HHPA 5IN4A 3Q9UA 3O9ZA 2UV8A 3ZHXA 5JDIC 4IQ8A 3HFGA 1PZEA 1ZKMA 2JJYA 2BMAA 2OP0A 1ZZEA 4BGVA 2LDXA 3G79A 3DZJA 4R3WA 3N7UA 3Q3CA 3RD5A 1IB6A 2OXIA 3JSAA 3S2IA 1BMDA 4ZICA 1B16A 1F8FA 3DMYA 3MJSA 1Q7BA 4CM9D 1R4MA 4YJGA 1N8KA 2YQ5A 2PNFA 1DIBA 1L7DA 5H83A 1EZ4A 1QYVA 3DMTA 4U7WA 1EK6A 5IDXA 4QX6A 4II3A 3DHYA 4I5DA 4W7HA 5A4DA 4HKTA 4PLYA 3GF4A 1ZMOA 2LDBA 3ICPA 1NVTA 1PEDA 3GEGA 4F6CA 5COQA 4RF4A 4NJOA 3JYPA 3GVHA 1XKQA 4J90A 3RWBA 1C0PA 1TA4A 6ADHA 3UVEA 3RKRA 1XGKA 3IQDB 2X1HA 4R41A 4I5EA 5KJ1A 4G81A 4KWIA 4PLHA 1Y7TA 4AL4A 2PZJA 1FDWA 1QV6A 2BF7A 1H6DA 1R66A 2IE0A 3OQ6A 3JQAD 3WYBA 2D0IA 3I83A 2JCVA 4GSLA 4ZQFA 3DBHB 5JDCC 4MO2A 1Z6ZA 4OSPA 4R16A 1AN9A 3I9KA 4N54A 4UUNA 1TB4A 2WWRA 1EUCA 2JAHA 3EC7A 4XGNA 1MFZA 7ADHA 1DRWA 3KYBA 2RBEA 2VRBA 4GGPA 3ICCA 3TZHA 3Q0EA 4WECA 2GD1O 3KETA 4A5OA 3K92A 1DFGA 2UDPA 4E5MA 4FGWA 3BA1A 3ROMA 2NTNA 3G17A 2GF2A 4FR5A 2Z1NA 2OL4A 2D2IA 1ZK2A 3KLPX 1F06A 4XRGA 4LK3A 2HSDA 4QTZA 1U4OA 4PZEA 3GY0A 2OGUA 1JA9A 4O1MA 1O5IA 4FS3A 4BHTA 1LSJA 2EF1A 4YXFA 4QECA 3LDHA 4HUJA 5A5FA 1UUFA 4WNIA 1O6ZA 3I9OA 3QIVA 3GVXA 1PL7A 1U8XX 3CXRA 5DP2A 2I3GA 1R6DA 4OIMA 1AHIA 4Z0HO 2J3JA 3M6IA 2Y1OA 1Z73A 4KTVE 1LDYA 2VUTA 3MJEA 3AOEA 1R0LA 3PWZA 4M1QA 3W4JA 5KKAA 4CQMA 2GZ2A 2C5EA 5IN5A 5L51A 3ROPA 2Q46A 5JSFA 1T2DA 3VZSA 2C59A 1A27A 2VRCA 4NK4A 2I5PO 3LT1A 4TROA 3VH4A 4D44A 2YV2A 4D0SA 2RCYA 2HMWA 1MC5A 2J3IA 5JO9A 4BV9A 1M66A 3LK7A 4ZQBA 5TX7A 4DWVA 4OOEA 1TI7A 4RPHA 2VZ0A 2H1SA 3Q2KA 1FK8A 3GK3A 3IP1A 3PYLA 1HE2A 4Z9FA 3B20A 3ASUA 1QG6A 2UAGA 1A7KA 3PIDA 4JQCA 3INGA 2QW8A 3L6OO 1GYRA 4DPKA 1QR6A 1Y5RA 4UEOA 4KUHA 2DPHA 3GRKA 3OF2A 1E3SA 4HX5A 2DVMA 3FRJA 2VWGA 4Y6PA 1U3TA 2YW9A 1DIRA 2DC1A 1I2ZA 1WDKA 3E9QA 4GMGA 3VH2A 2EJVA 1F12A 4CMEC 1LI4A 3ENNA 4WEQA 5TS3A 1JDJA 4EUHA 4W6ZA 4LGVA 4E2XA 3O03A 4R5HA 1GTMA 3DDNA 5U1PA 1ADCA 3NGXA 4RVFA 1VE9A 4X54A 5IDQA
chains in the Genus database with same CATH superfamily
2JBHA 3THRA 1JJVA 5ERYA 3PDIA 2HA3A 1Z74A 1UPCA 1JIVA 1HBWA 1N2CE 3NHYA 4JJ8A 1KTVA 1LDGA 1IZ9A 4FKZA 3HK2A 3DKRA 3CF6R 4BX2A 1LDNA 4M1SA 2ZULA 4B31A 4P4SA 1LPBB 1LQUA 3KALA 3E22A 3L8EA 1OUMA 2RKBA 3HRNA 4HB3A 3O90A 2H0AA 1YI0A 3WDMA 2Q7XA 2ODAA 3H5VA 4L8VA 1U3FA 3LT0A 1FVHA 4L5AA 4PPNA 4JUBA 3BULA 1U9ZA 4I9GA 2RAFA 3GRFA 2KUBA 5I5GA 1Z82A 5DGDA 1DXQA 4RS4A 3C48A 4DLAA 4MUJA 4A6XA 1T24A 2X8JB 4F4JA 4XVHA 3RAFC 1HDGO 2PKQP 4F60A 3JR3A 2NO7A 3VDQA 1QORA 1EWRA 3EDRA 4F92B 1GG5A 3GFPA 3GA7A 3CWCA 1QH8B 1SOVA 2P0EA 3D5EA 2ONKA 1L6RA 1QKIA 5CT9A 2FWBA 3W7VA 3G9ZA 5ER9A 2OFWA 1YULA 1H3NA 4ODIA 3LX8A 3DE4X 4KGZA 5F3WB 1Z34A 3ILSA 3S68A 2WT4A 4RY2A 5FUXA 1T6YA 4BO9A 1JA0A 4JVOA 4OP2A 5DGIA 1T3JA 2FG6C 2FR0A 1QF9A 2A3NA 4FBMA 1ORWA 4MRNA 3PFBA 3UICA 5HG0A 4HWOA 4FX2A 3BXEA 5BWBA 2J3MA 3GFGA 2B2CA 1RRGA 3GARA 1B0ZA 1KAQA 3K73O 1KAEA 2IIVA 3D70A 3IB6A 3P2EA 4GPEA 2JHFA 3QPWA 4HB4A 3CMEP 3DTYA 1XQ1A 1JDZA 3L05A 3PS9A 4MGHA 2Q07A 2BHNA 3ECCA 4BLVA 2DKFA 1FJHA 3NV7A 2JGKA 1PW7A 1CZOA 5FWYB 1NC3A 4J6EA 4C0AC 4IFEA 2OBLA 3W05A 3AIIA 4QREA 1CUWA 5C34B 2YRFA 2LCFA 4QVKA 1L5MA 1PGPA 3LT4A 2W8ZA 1PWZA 5A4MS 2I6UA 4H7KA 4ZT7A 3RAPR 1J1IA 3EQ9A 2A5LA 1GTZA 1FNSA 5KI6A 1Q3TA 1U7HA 2JKZA 2RGBA 1L0ND 3IAS1 2XQGA 1IN5A 1P84E 4NXNB 2AGVA 5CM9C 3N0XA 3WA7A 1UDXA 1SG6A 2JW5A 3MD9A 2JJ2A 3R3JA 3KFVA 2Q4RA 1YASA 5JWRA 1TAQA 3AHHA 2Q3BA 4PV1B 1ORRA 3MOSA 1E2NA 4NJMB 1B3BA 1X1AA 1MJGA 1HF9A 3OX3A 1QE5A 3HN2A 3CX7A 5ER6A 1U0FA 1KWKA 2X8LA 2XCOA 1NN5A 1F9AA 4ZVPA 3ROEA 1U63A 3LYHA 4MNTA 3ED5A 1ZWKA 1RJ9B 4HATA 2WLSA 1ADGA 3EG9B 5DJ5A 1XVTA 1C0LA 1WHTA 1HDOA 1E6LA 3I5MA 1KI3A 4F3TA 1XAGA 4EGFA 1XJWA 1I4EB 4MGZR 2W6ID 4QOEA 4MPRA 3ZE0B 4V39A 2NTVA 4P82A 4BC0A 3C7DB 1MLDA 5CFRA 5ERGB 3USSA 5JS8A 5EP2A 1TT5B 5AKIA 5IH7A 1PV2A 5DLDA 4BWVA 3KSUA 3HKCA 2F8TA 1D03A 5LIRA 4P6VF 3GCXA 4CIBA 1IPEA 1JSCA 1VIVA 5KAIE 1LU9A 1PQUA 2YKQA 1XQYA 2V6FA 2OBBA 5ALQA 1YDEA 3TNDA 4NFLA 1LI7A 2C5SA 5C1IA 3AV3A 2P6UA 1DCMA 3RK2D 5KKZC 1SVNA 4J3NA 1EK2A 3QVVA 4MIKA 4BEVA 3A25A 4JCOA 3JU3A 2Z4RA 1E4EB 4IKPA 1N3BA 3Q10A 2PZGA 2ES4A 4AJ4A 3KT0A 4IGEA 1VI6A 3JWGA 1UDBA 3T95A 5TT0A 5EPOA 3D3QA 1DEXA 1RSZA 2IH5A 2YUIA 2W58A 5CCGA 4YAKA 1QXSA 1KILA 2OUIA 3CXHE 5TQVA 4LHSA 3B7WA 1PVVA 2A9VA 3H4IA 2VF2A 3H1KG 4DSAA 3L71D 4MA5A 1IIBA 3FE2A 5B55A 2KP8A 5AI5A 4DLZA 4AFNA 4XDZA 2Q41A 1JMKC 1XYVA 3E05A 1OWMA 1W2BO 5FI3A 3M2TA 4TQAA 3W8FA 3R41A 3QKUA 1PN3A 4EG6A 4HR7A 3ICWA 2GEBA 2J85A 5E2IA 1E79A 1UXHA 1EFPA 3HD7A 5BQFA 1UBOS 4CM1A 1OAKA 3RF6A 4OUDA 2LNDA 2ZATA 4JJZA 2W00A 1EBFA 2WJZB 2O2YA 1KSJA 4JJEA 4PPYA 1NQXA 5T4HA 1U5CA 1WD7A 4AJPA 4DDHA 3FF4A 1PJCA 2VDWB 1EIWA 2AK2A 2R3SA 3DR3A 2IH2A 5F52A 1PJ2A 3JQBA 2BEWA 5EA2A 1D8TA 1ULUA 3LNTA 3K0BA 4RA6A 3RADC 4IGIA 2ZYVX 2Q3HA 2RK6A 2BUCA 3W2HA 1FSSA 1VL0A 1JUDA 2REOA 4RM3A 3TGUE 2NU8B 4IGAA 3RK1A 4EGAA 5AK6A 5GTHE 3PF9A 3UK1A 4EL0A 5DV9A 4O4LF 2H7HA 3UWPA 1MIHA 5IXSA 4U5XA 1Y1SA 2F6RA 5JD6A 1JBEA 4LMBA 3TRJA 3I5XA 2X0IA 1U5AA 4FXOA 2ZIFA 4TX1A 4EI2A 1NPTO 3R23A 1N2GA 4YJFB 3DBRB 2WBLC 4A0FA 2I2CA 4Y8VA 1XELA 1PIWA 1YVDA 3QV2A 1Z9BA 1R5JA 4FX5A 2WWIA 1PL0A 1TCUA 9LDBA 1U11A 1NPDA 1J0BA 4NFYA 1Y5MA 4UCXA 4MPPA 2BW0A 4M7PA 3A2KA 3HBNA 2P0YA 4QQNA 3S1SA 2JLRA 1IC2A 3EY9A 1XRLA 4DM7A 3K0AA 5TISE 1M57D 4HZUB 3KB8A 1FMTA 4FMCF 1HE8B 1Z29A 2IL1A 1XU7A 4UJ5A 3SKXA 1P9OA 4J7AA 2IY9A 1RY3A 1VQPP 5GV7A 1P0CA 1MAVA 5DNDA 2KOGA 1CZUA 2XZPA 2ZTVA 4IRXA 4WK2B 3DWFA 2G63A 3I0ZA 4DJDC 3G59A 4IIXA 2FP3A 2ZAIA 4Q7EA 4KVZA 1M1NA 2X2EA 3BGSA 3E7FA 1IFPA 4IJ6A 1QC5B 4K3AA 4QIHA 2VJOA 3O8DA 5DH9A 2KS6A 1Y4UA 1Y6QA 5CIYA 3GT3A 5EEHA 2E1PA 1GNPA 4Q4LA 3RDPA 9GPBA 1A9PA 3M1YA 5BV0A 1HG1A 3N87A 1MC8A 4ENSA 4IYJA 4YONB 4CMHA 4I4CA 3F1KA 1Y8AA 3SDZA 4UUPA 1PL8A 3JYOA 4AJ9A 5EJ4A 4P5EA 4DG5A 1FSFA 3PCXA 4HDKB 5M34A 4G0NA 3IH5A 3WBFA 1XMIA 1I6MA 4TWBA 4BVAA 4LSWA 1ZGAA 3PZBA 2HMTA 4EFKA 3OLYA 4G8BA 5JOQA 2DAPA 2QT9A 2SCUA 3F4KA 1S2LA 3MJ4A 2P35A 1QU2A 3ZU2A 3RKSA 3HC7A 4DCMA 2QLJA 3JWIA 4XUEA 2ANCA 2Z6VA 2ZU0C 2PZBA 4REQB 4I4TF 1KP2A 1A9ZA 5EMKA 3I30X 2WDPA 1RBYA 3BC1A 2O57A 1W36B 4WCDA 3SHVA 1U7WA 4JZKA 4AIRA 3KDPA 3AESB 1BCCG 2JH8A 1K8XB 3PNOA 3QF7A 3OOSA 1NQ5A 3KPUA 1L5YA 1S2OA 3DBLB 5T8KA 4U7TB 1NHLA 4GLOA 4GNKA 2RGUA 4FXPA 3T34A 5AW8A 2KM1A 2I62A 2O48X 3NIFB 5LC1A 1CUXA 3DE7X 2IPXA 3NBAA 3EGDA 4CM8A 1UBFA 3L92A 1S3JA 3FM9A 4RKFA 4IPTA 1X39A 5K0TA 2VVTA 2D3TA 2GO7A 4EI7A 5I8PA 1ULZA 4H1UA 1MV5A 1NHWA 4MLZA 5AD1A 3IRUA 1PJZA 2A94A 1TXGA 1MB2A 2WY2D 5EESA 2C29D 1IWOA 1OWNA 1AK1A 4CMGA 4A82A 2JLYA 5K51A 1WV0A 5L7YA 1QAQA 1XXHA 2WT7B 3EPLA 3A9SA 2KLBA 1N6IA 1V8OA 4XUCA 6YASA 2DKNA 5KMGA 3IULA 5K3FB 3LQ1A 4H35A 4C6SA 3K6RA 5LQCA 1ZLXA 4P3PA 4D81A 3JALA 1KK0A 3KHSA 4M98A 1HTTA 3PQ7A 4RDXA 3P9YA 1LTTC 1CB0A 2VEOA 2AVNA 4B6OA 2ODEA 4C89A 2KK7A 1YZVA 1IBLB 1P0IA 4MVJG 4TTJA 3EASA 4L28A 4QJ4A 2ONZA 1I2MA 4H44B 5M04A 3UJ8A 1IBRA 2QNRA 3DC2A 4OSOA 3WSVA 3LV8A 3JXEA 2PUTA 3GQBB 1WDWB 1UBKS 2OCPA 3W2EA 1QGUA 4EENA 1NBEA 4MVWA 5A4KA 1PPJE 1H2FA 1ZJJA 5JJKA 1L5RA 3W4KA 3OTGA 3K31A 2IODA 3GC6A 3DZCA 2YINC 4JPZB 5MDHA 4M1TA 4HPXB 3IAM1 2Z3WA 4QVIA 3FW1A 2QAGA 4NICA 1G63A 3O4RA 3CISA 4GXRA 1QGED 4I1VA 1YHQP 4FLFA 4O63O 1DU4A 1XWIA 3QX8A 1HGVA 2G36A 2FMTA 2IWRA 2BDUA 3ET4A 1ELOA 1T4GA 1SU4A 2G1UA 4MMZB 2OWEA 4CQMD 5AHWA 1DKPA 2H6EA 2YXEA 4OBWA 4BDSA 2I1VB 2XI4A 4BQNA 3SS9X 4QDKA 2K37A 2GJ4A 3IPYA 2GD0A 2FYUK 1B73A 3PP5A 5BR7A 1MHTA 3BWMA 3O8BA 1UP6A 1BEUB 2XWPA 1EE1A 1VKNA 1X80A 1D6MA 1CNFA 1HJ0A 4X3OA 3M4YA 1G7RA 4GMXA 2GVZC 4KZKA 5GVSA 3LX5A 4ONEA 2HADA 4LOIA 4P7BA 4BPRA 3V7YA 4NYMR 5L7TA 5C3MA 1BDBA 2XMCA 3SZMA 4REMA 2YR0A 3MQFA 4QYMA 4YMUA 2FZWA 3BXOA 3PDWA 4J0EA 3C5WP 1DRVA 1OJ7A 4YJ2F 1OTXA 2QG9A 3AL2A 2VNKA 4HNSA 3W8EA 3CEAA 1JSRA 2C96A 1YI2P 1W4ZA 5G0TA 1VJ0A 2JZNA 4OYYA 3THXA 4LBWA 1OF1A 1SXHA 821PA 4KR7A 2DT5A 4CUJA 1HLFA 3HXLA 2IU0A 1V47A 3ER6A 5DP1A 1BCCE 2G25A 5CDTA 4B6PA 2V45A 3K2BA 1Q50A 2QVYX 4ZO6A 4KYVA 3MGCA 5T5QA 3Q1MA 1JYFA 4YECA 1C7EA 4BP1A 1NXOA 1IN8A 1KRWA 3QWAA 4LE0A 3C16C 3WMRA 1PFIA 4D3SA 3ORSA 2LWIA 3T41A 5DYNA 4IOJA 1E63A 4Q21A 3FUUA 4FI3F 1DXOA 2WFLB 1P31A 3ELYA 3SZOA 3OFJA 3SIWA 4A7PA 1D0SA 3L04A 3Q2IA 3C3WA 3N8NA 1MX1A 1PFGA 4GOKA 2ZITA 1UKYA 2WAXA 3RK3D 1JAXA 3RVBA 3QQ5A 2ZUFA 1Z56A 2C1EA 4FZ3A 2V8BA 2YJ6A 2ZLBA 3SC6A 5FWXA 1IOVA 2YZNA 2OLJA 3KWJA 3NHZA 2WU0A 3G0IA 1X7YA 2VT3A 4MCJA 4DRYA 4C0SA 2A78A 5K3OA 1QHHA 2ON6A 5IBQA 3WHLA 1SQQE 1HYHA 3OU6A 1U8FO 5BP7A 1HL3A 2RI6A 3ND7A 4EOTA 1K27A 3QU5A 5F2OA 4MVJE 3QWBA 3VNAA 4N7BA 2HODA 2Q5OA 2CXPA 3FHCB 3CKMA 4EEKA 3HJTA 1V5FA 4AXXA 1TU3A 4DG9A 1S3SA 3PXBA 4KH0A 3KKOA 4XYEA 3QSYA 1C1XA 1W34A 1KE2A 5PGMA 3TSOA 1RRMA 3DZHA 1Q83A 3AR8A 4PPFA 1N6RA 2OAP1 4BCDA 5K6RA 1Y9AA 2J9FB 2CNKA 3C1AA 2UUBB 2BUAA 1HX7A 3V1LA 3NJ8A 4JVLA 1YL7A 4FIZA 4YP5A 1J4AA 2C04A 4X24A 1SQXK 2OO7A 2XZDA 2G71A 4E32A 4E5SA 4PN7A 1G7SA 1UXGA 3UFXB 4NENA 4KYTA 4PICA 3H86A 2GPBA 4DR5B 1MCZA 3QBJA 1NVDA 3VZDA 4EJSC 2N1TC 2QRVA 1GGJA 3K70C 2GPNA 4TWIA 3D81A 3ZCQA 4RFSB 1OKKA 3CUTA 3VDNB 5EMLA 2VSYA 3A3PA 1R9JA 4PX3A 1S6YA 3I62A 2L5GB 2JDID 1Q7TA 1GL2D 4JBHA 2FSGA 2I8LA 1L4LA 2XODA 3LO5A 3ZGVA 3KCNA 5HE8A 1YF3A 5FP0A 4R0VA 3L8HA 4WBNF 1FDIA 4KLZA 1QTNA 4QODA 1NU8A 3SHTA 4PTLA 4MAMA 2H5LA 1G5HA 3TUJC 1XVIA 3RE1A 2RIRA 3FGPA 3VGPA 1JG4A 3JAKA 3T5BA 3DLTA 1I3KA 3KAJA 2DR2A 2WSMA 3B2NA 1V4BA 1DP4A 5JE8A 3IEMA 5J40A 2E21A 4WXPA 5DYTA 3L74J 3OVMA 3E5HA 1QRTA 4W1RA 2FYUD 1G20B 1TM1E 1KR5A 2RB5A 2GJKA 4IEFB 3QPAA 3VV2A 4JJAA 1EX6A 3Q9UA 3TM4A 4R3WA 5KZMB 4LDQA 3S2IA 4FI3C 3RYCB 1Q7BA 3VMAA 1R4MA 1C9NA 3WLSA 3PNMA 1L7DA 4RV4A 2JFOA 5H83A 4M8KA 3VKGA 2M0BA 3CR8A 2XTMA 4UB8E 3GHGB 2C58A 1Q95A 2KB7P 4YCLA 4RF4A 3C4QA 1GK6A 3ZHUA 3TSWA 4UTNA 2GNOA 1GN8A 4I5EA 5DXJA 1T9BA 5EKXA 4BX9A 4JYPA 5H5JA 2WNHA 1WA5A 2W27A 1PJAA 2V7XA 2H07A 3R6WA 5FTLA 3ZKWB 4TM8A 3PB3A 3HY6A 3OT1A 3TNFA 2XMBA 3FSGA 2D1RA 1W5SA 1CUGA 2JGNA 4HH0A 5H1YA 3L72J 4CTJA 3AHJA 5CCGD 1L4FA 2EF1A 3E58A 4YXFA 4ZU1X 4EB0A 5A6VA 1CE8B 3F90A 4AROA 3KKEA 1CUEA 1Z73A 2W93A 5KKAA 5AKGA 1NF9A 3DVAB 1IVNA 2R4QA 2ZS7A 1YIJP 1Z4PX 5JXGA 2DR3A 1BMTA 3R76A 1G2CB 3K0CA 2X8AA 1QR6A 4CEIB 2DVMA 1E79D 3FRJA 4Y6PA 3KXIA 4BFSA 2Y6VA 3V9PA 2ZUUA 2PR7A 4BE7B 4X3CA 5TS3A 3L84A 3O1IC 5J59A 3KEMA 2WQ6A 1PU2A 1UP4A 4MR7B 5BOSB 4CIAA 2P9BA 4CKXA 1OLXB 2BFMA 5CA1A 1PR9A 2X1VA 1TUIA 1RIIA 1E89A 3KZKA 2I9KA 2HR1A 1N1EA 3O6VA 3SXJA 4AF6A 5IJ9A 3B6JA 4HB0A 1VHLA 1Y6GA 3C3YA 2OTKE 4I55B 5PNTA 1BKYA 1V3TA 3PUYA 4XWAA 4UHJA 4UTOA 1ZOPA 1QVFO 4RMJA 4YJDA 1BCSA 5BNIA 3GNLA 4KAJA 4DR4B 1EJ2A 2O3RA 1KDVA 1YB5A 3U7EB 3OEYA 3U61B 3JCUE 2XEXA 3N6VA 3QLUA 2W2VA 4H7PA 1F20A 2OPHA 1JQJC 4CN9A 2R60A 2BGWA 4JEIA 1O7JA 3X1WA 1L0BA 1T2VA 4KKXB 2HCJB 2ZB2A 3ZDEA 3KAKA 2NYRA 3BFXA 2A5GA 2PH7A 3RIMA 1VXRA 1J7JA 3RAJA 1MFPA 1OT5A 3C3BA 5B6IA 3VAYA 1D5WA 3IC5A 3DP9A 5E1DA 2GPWA 4P3XA 4ZVSA 2GYWA 5E79E 2YMYA 3IGFA 1SQXD 2EIHA 3BJMA 2OG2A 2YO3A 1EHCA 4HT3B 1D9XA 1JLMA 4L50A 3Q6NA 4LJ9A 1ZIPA 2WSYB 4BVJA 1MOPA 1F14A 2PJUA 3L0BA 4URWR 4DW8A 4E09A 1L7XA 5KTNA 2RHDA 3RIHA 3RVQA 4JASB 1KY2A 4FLMA 3M4NA 1A72A 3T9FA 3Q9LA 5C4GB 4QLBA 3KDAA 1SJ9A 2JFFA 2R6JA 2V97A 4CM4A 4CTKA 2Z98A 2A0UA 3L9WA 1U9CA 2OZKA 5ELXA 3LUAA 2UVQA 5T41A 1OXUA 3AKYA 3WRYC 4PE5B 3M6WA 3PUZA 3W3ZB 3FSRA 3QY0A 4XPIB 1XT6A 1K5HA 3UXYA 1GA4A 1JXMA 2QGZA 4BB0A 4LV6A 4PD4E 2ZJOA 1Y9BA 3W3AA 5JLAA 3D2CA 5B5EH 3PHJA 3ZE1B 2JLWA 3H7IA 3C6KA 2Q1XA 2ZJ0A 2FK8A 1WETA 4GX5A 2QJPB 3ILYA 1P9WA 2P6NA 2KI5A 3QVTA 3W1WA 3LFHA 1TYBE 3OE5A 4MHTA 2ZI5A 1ML4A 3C4VA 3LBYA 1GZ7A 2R6DA 3LMKA 1M9NA 4PFJA 4TV8F 4LF9B 1CYDA 2OCAA 2V7UA 4F4HA 3X2EA 5IJXA 4B3JA 3OZTA 2YMPA 1EU1A 5TY0A 2PWBA 4B4VA 5IZCA 4CLXA 3U1VA 1ZONA 1IONA 1E9CA 4CFZA 3PENA 1PSWA 2V59A 5U9CA 1HA3A 1MO4A 4OKIA 4WFQA 4XB6B 1QS0B 4H1VA 4QSMA 4Q3DA 3WS7A 4MQUA 3A4LA 1XRJA 4BXLA 2P6OA 2JKVA 3IT1A 4RMGA 3ZDYB 3W5CA 4UUQA 1XMVA 5EJ5A 3RLFA 5FQOA 4DABA 5AI8A 1L0LE 3GLFA 3LPAA 5HQJA 4QOFA 1GZHB 3WL5A 3V7UA 3RHZA 1H8ED 2EERA 4ROSA 2FPXA 4KR2A 5FLKA 4DT1B 3NFQA 4GP9A 1RF0C 1R0RE 6REQA 2J9YB 2JGFA 1OOEA 4QDTA 3IBSA 2DLNA 4FYXA 2FEKA 5CVUA 1P44A 3W5UA 5E7IA 3NTNA 2BFDB 5LLDA 1NOJA 3BJIC 3KBBA 3S7ZA 1Z4MA 4HJRA 3MTIA 1DS6A 3HSKA 5IJZA 1SU6A 4PNHA 5BVGB 4MH0R 2C97A 5HJ5A 3EZFA 5BMVB 1NFQA 2P4HX 1X86B 4IWXA 2YDXA 2PMWB 4Z8XA 2D06A 4OAPA 1VKZA 1XF1A 2RFLA 2AA3A 2O7QA 2FW6A 4IEIA 1C8KA 2YYSA 3ZPXA 1Z2EA 4J16C 1DX6A 1UZAA 2AD5A 4EFDA 1C0EA 1URQC 3R0QA 1NTME 5FNVA 3PVCA 1AZWA 1HM5A 5KNBA 3FPBA 4BU1A 2J0UA 5IYZB 4ALNA 1J0DA 4GDOA 2JJLA 3ZJYA 1PDVA 4IHQA 5BW5A 3IJPA 4XGKA 1IATA 3H1HJ 2I3AA 1SQPK 5IRCD 1E2UA 5AHRA 3GF3A 4U9HS 3F96A 2OORC 4LRYA 4U1RA 4AJHA 2WD7A 3IRVA 3MRVA 4BASA 3C45A 1IFIA 3T3GA 1W2EA 5LDGA 4DCSA 1NGSA 4Y1EA 1Q92A 2JLCA 3HU1A 1NI4A 3ETDA 2YNMC 5F73A 2B1IA 1QG0A 2B8WA 3U7RA 1JSZA 1NPYA 5I9NA 4J0CA 5I9BA 2P2LA 2W42A 2GM4A 2L0XA 1SWVA 4AUEA 4TM7A 1XKTA 1NTOA 2MMGA 4DBVO 1KZGB 3DHVA 4ZD6A 2JFXA 3H65A 2WSSA 1F3LA 3I01A 1Y7HA 3C7CB 4D0GA 4BNXA 3CLHA 3UATA 4L08A 2CCGA 5IUNC 1A4IA 1KFEB 3N8DA 4JI2B 3HE3A 1WUJS 2DWCA 3FYUC 4XJSA 3ACBA 4UULA 4Q82A 2AS0A 1YZLA 3GNTA 3PRYA 1ZCJA 1PZGA 3KVYA 3ZWAA 4ZP1A 4DWOA 1G3UA 3VJRA 2UZ1B 2KLVA 5KAFH 1UMBB 4YJ3B 2HA0A 5I4BA 3NUZA 4ZI5A 4JSTA 1MJ5A 2H08A 3RSZA 4W1SA 4IO0A 1FBNA 4YCNA 4C7KA 3UENA 1YCDA 2HJRA 4IDFA 3D1VA 1ZVJA 2JGJA 4A0SA 3Q0TA 4QPZA 4HNHA 1B42A 4TLFA 3ZE6A 3K32A 3CVYA 5B3AA 1SUPA 2NACA 1R0ZA 1YNOA 2Q4TA 3FSEA 1SHKA 3F5QA 1YQGA 1AHNA 4IIDA 4HDRA 4Q3KA 1G6Q1 4ESEA 2VH2A 4V0ME 2C4VA 1L4KA 1Y9JA 2A9RA 3TIXB 3AE4C 4I3GA 1JWLA 3MMZA 5B2ZA 3JQ8B 4JUIA 3AL0C 2HCBA 3F1LA 3DNPA 2A5JA 2J5UA 3VO1A 2ETXA 3I1IA 3CX6A 4HV4A 2HSZA 4BX8A 3W5SA 1S9KE 4PEVA 1S2EA 2WQZA 4K9NA 3CW2A 3ZE8A 5LU8A 3SQMA 1QU3A 1XZEA 1LNSA 1K89A 1G55A 2E37A 2VDRB 2JP3A 4C2TA 2IBTA 5HIMA 4RC9A 4KN6A 5K0FA 4NJEB 1QGDA 1E7RA 1NLYA 4PINA 1G8FA 2DFKB 1NG1A 3GJYA 3LIIA 2XAUA 1ID8A 1NUTA 1DJOA 1U7UA 2RE8A 1T2CA 2Z9DA 5JDCA 1B8UA 1L4NA 4P31A 3LZDA 5CHXA 4PG8A 1AIPA 1U1CA 1EGVB 3FNEA 4ZCTA 4RXUA 3GNQA 5BN3B 4AZTA 2XE4A 1ANKA 9LDTA 4P3KA 3FKQA 2OGTA 5F7XA 3UWSA 4LE1A 4KOEC 1N2CA 4Y7CA 1TF2A 5HSGA 4FINA 4OMCA 2XWSA 2XNXA 3C85A 2CJWB 1G20E 4J07A 4CCAA 3WKAA 2O0JA 1WCV1 1VIYA 1T8YA 3MGGA 1GV1A 1S8NA 4OQLA 4EL5A 4EX7A 3PDUA 2OOSA 3JSXA 4JL6A 3ADBA 4Z1OA 3DW3X 4P32A 3B5EA 4OI2A 4KL8S 5ARDA 3GFFA 3WAJA 1LWNA 1IY2A 2Y1WA 4CQLA 1KO8A 3V2QA 2ZYIA 2P3LA 1L5LA 3RAGA 4R7TA 4F56A 4M86A 3FPHA 3LA6A 3R7WB 1QPGA 2R84A 4QUDA 1NUAA 3VOSA 3EVBA 4JS0A 3HU3A 1J25A 4NYJQ 4L0QA 4MP6A 1GZ3A 4TTRA 2O07A 2Q3FA 4YRJA 4X1YA 3FOWA 1Z83A 3UKDA 4CCWA 1SQPD 4S1NA 2G9NA 2OBFA 3IS3A 4MIYA 4CLRA 3G0CA 3G2OA 2GXSA 4KLNA 2GBLA 3SX4A 3BXFA 3A4YA 2ZT9D 4MS1B 4WLEA 5B1IA 1NL3A 4OHMA 1NU1E 3HCCA 1U3GA 2XXJA 3HDVA 1D7OA 2A9FA 3MWDA 1L7OA 3FI9A 4MYHA 4ZZ0A 2REQB 2HBYA 5DT2A 4AY3A 2V9ZA 4ZOLB 2BFCA 2DW3A 4RDIA 4IIYA 4TVBA 3IBGA 2JGLA 2EQAA 1U1DA 4FUQA 3H16A 4DYDA 5B30A 4OXYA 4BLUA 5H2FH 1WO8A 5G0UA 3KSZO 1JJ7A 4CFYA 4TT8A 3QVJA 4JLUA 4AQYB 4WHMA 4K9LA 1FU7A 2C20A 4FCWA 3EN0A 1XP5A 2HTEA 3DTVD 3C70A 4BYMA 4BQIA 2FUNB 1RLTA 3I2JA 2KE5A 2AZTA 3LF1A 1XCGB 3UV3A 1H6CA 3OAAA 1VPVA 4FHGA 4LNHA 3NDPA 3KZIH 1EYZA 1TQ2A 2PSHA 2ID9A 4JUFA 6AT1A 3UG6A 3W8RA 2P75A 3NBYC 3ZVNA 2D8MA 1KU6A 4TMWA 1T9GS 1WRGA 1F2UB 1SVFA 1YQQA 3JQAB 4QU9A 1NVKA 4DAEA 3NXKA 4JKOA 4NABA 5HIIA 3AF3A 1I9GA 3ZHSA 5C3UA 2ROQA 2O50A 3IUSA 4HGZA 4Q24A 1SHTX 5JVDF 5D5QA 3SZUA 4M9SA 2GHIA 3CCRP 2BLNA 3QH9A 3JV7A 1OVGA 4GYYA 3RVJA 5B58C 4A5SA 4EKEA 1RADA 1E1MA 4DHEA 1K86A 3VX3A 3WDKA 4GODA 1QVRA 2IBZI 2UU9B 1CF2O 4H18A 3QU7A 3QG1A 3REGA 1N8TA 3BTOA 3SC3A 3AHCA 1YB1A 3WIUA 4IS2A 4U9IS 5C5IA 1PNVA 3ZQUA 3A3YB 4IJWA 3KK0A 4EAQA 1K9SA 2IVFA 3LS2A 3W2IA 4CHTA 3F6YA 1Z4LA 2OYIA 4ITRC 1XTZA 4BWNA 4PR3A 4WCFC 4G6ZA 5APQA 3FZGA 1TZKA 4F4CA 1ULHA 3PITA 4L74A 4ZYZA 4BRYB 2WMDA 1HYQA 1IFXA 1B3RA 2XB2A 1KYVA 2NO5A 4J29A 1BWQA 1XEWX 1JFLA 2Q4DA 2FJPA 1AD2A 2M2IA 2H43A 1EZ1A 3KZMA 4DR7B 4YRTA 1Y9ZA 4TV9F 2GLXA 1GPMA 1JL3A 1N77A 4EG4A 4TTVA 1KJ8A 3A0BE 3ON5A 4OXRA 4EUKA 3TTWA 4DSNA 1L4GA 4NP6A 3QUQA 1SCUB 2GI4A 1CFZA 3TGPA 5DGHA 2BR4A 4W5WA 1N7SC 4RY8A 4BB9A 4BMVA 3UK0A 5E0OA 2OYCA 3QPDA 3B13B 4WKGA 2B69A 2O0HA 5F5NA 3M83A 2NO4A 5DHSA 2TMGA 5F5XA 3X2FA 5DM60 1IQRA 1P2DA 1JMBA 3KTAB 3VBEA 3RRYA 1KDTA 4A03A 1YBHA 1ZNWA 2YJGA 2L19A 1G9TA 1RAGA 4RSMA 3RV4A 4ML3A 5E6RB 5A9SA 3RJ5A 4GI2A 2YWRA 2IP2A 1RKBA 2FF7A 4FC6A 2FETA 4H7HA 2O8EA 5BSFA 3GLIA 2H2IA 4NNJA 5CNIA 1DZ3A 1P7CA 3FCXA 3RVKA 3R44A 3S8YA 3ORFA 2YZMA 1IAQA 4MKZA 3K1AA 4JQYA 1X79B 1KIAA 2Z0MA 5HQTA 2FMHA 3ZD7A 1O94A 3B3FA 4OH8B 1Z4OA 4JLKA 5IT0A 2FRXA 2Z2YA 3ZTTA 1GQRA 3N7TA 1AH2A 3CZQA 1SUDA 2WB4A 4NRDA 1RI4A 3TGWA 4DCGA 1YNSA 3FH0A 1FEZA 2AUMA 2ZI4A 3STVA 3SJCA 3ZIUA 2P9CA 2MHCA 1DEKA 2RH9B 1N2JA 2VNJA 3WB0A 2WWGA 4MIOA 4DM4A 3VJKA 5BWNA 5IVIA 3W3AD 2BFOA 1TZJA 1DT5A 1NW8A 1FNCA 2IS4A 3TOCA 4GOEA 4JP8A 4KW7A 5KREA 5FPTA 3ZV7A 4ZQEA 4RTLA 4FFVA 9MHTA 1GAQA 4ZCIA 4R84A 3M33A 3NI2A 2HBRA 2GAAA 2W2QA 3OTQA 1P17A 4HDCA 3QEBZ 4FDVA 5TMBA 4BXOB 3TOXA 1Y1TA 3QMMA 1UKAA 5LOVF 4LDZA 1VRWA 3D7KA 3PXGA 3TGUG 1OBFO 1ZXBA 4I19A 2C8KA 2WK1A 3ZD8A 1XMXA 4M49A 4NEGA 1BFUA 3THWA 4P8RA 4DE5A 3GH3A 4U00A 2H29A 3AHFA 4BQRA 3L0YA 4UCWA 2D00A 2WOJA 5BSTA 3EA0A 1JU3A 4LHYA 5BQOA 1NQWA 1AURA 4WN3A 5IPFA 1BXGA 4P4UA 3P0HA 5KYXB 4PO3X 3IV7A 3ZWVA 3ESZA 2VK4A 5FUMA 1WNTA 4YO7A 5BU8B 1PL5A 4DDUA 3GRZA 1BDCA 4A26A 3PE4A 2D1QA 2EZUA 5A06A 5CB4B 3MINB 2EP7A 3P9IA 4RENA 1FFDA 5AW2A 2RGXA 4KUGA 3DM9B 3UZUA 3HO6A 4GC5A 3AT1A 4ZU6X 1R5SA 5IARA 1AGPA 2GNAA 4R01A 1YBVA 2C9NY 2V9PA 2I34A 1OW7A 1WUYA 5IN4A 1JQ5A 3ZHXA 4CHGA 1P7PA 2RDMA 3Q3CA 2ORED 1UMDB 3VM6A 4HS4A 5B36A 2CXTA 2AMLA 2UYQA 2D62A 3K1JA 2X3FA 1V45E 2CBXA 3ICPA 1RS0A 5COQA 1LPMA 2WVHA 2VC2B 2E74D 3IQDB 1XTJA 2X1HA 1VGRA 1L1EA 2BF7A 3N86A 1H6DA 5KNBD 1R66A 2ZRQA 4ZCLA 4C6HA 1ZMEC 1ONSA 4JLSA 1GFIA 3P8MC 3ZI4A 3GLGE 1KO5A 4GGPA 1V11A 1K8AQ 1O3YA 3FIUA 4R1QA 5AVVB 1R2QA 2OL4A 1F06A 1O5IA 3H25A 5E6UB 3LDHA 1C9KA 4LSGA 2XUQA 4NE7A 5TV2A 1PL7A 3RFFA 3RRMA 1U8XX 3EISA 3ED1A 3WIVA 2EIXA 1G2IA 3HGMA 5J2TF 4AQ7A 3O4HA 1T2DA 1A98A 1W2HA 2C59A 3K9CA 1USUA 1ZPDA 3VP9A 5CH3A 4TROA 1Y6RA 2FWNA 2J3IA 4Q01A 5CVVA 1NN0A 2W2NA 2H1SA 1V25A 2E42A 4HAXA 1OFUA 5KLVJ 2H1IA 4C4ZA 3S81A 3AEFC 2JJ8A 2VATA 5IAKA 4I1UA 2QN9A 3I56P 4OX9Y 4H7FA 1EFVA 1ADCA 4F84A 1K9MQ 3HI6A 1T6BY 3C98A 3NCHA 2AF4C 2RGCA 4AQDA 3TNUB 1R7RA 3WKCA 4M9XA 3EXIA 3DFZA 1HH0A 3ZX4A 1HE5A 3BWXA 5KUTA 3L0PA 2ZXEA 1NW9B 2ZAMA 4GZ3A 1U9IA 3GD5A 5GJBA 4FDTA 2REBA 3VKHA 2FFDC 1QHXA 4GMDA 4ZJYA 3VTPC 1X1EA 3ZVMA 3A1NA 1I4DD 2FJUA 1Q0SA 2V9CA 3FTQA 4ZYXA 1JQEA 3WMEA 4FD3A 4ENQA 1VKJA 1NN1A 2NU7A 3U80A 1ZA1A 2HXGA 4CEJA 3CKLA 3R74A 2OFFA 4YRQA 4AQRD 1LUAA 3OIUA 5JNSA 4ZDJA 3IUQA 1OA0A 2Q6VA 1VOTA 1F1BA 3PHGA 1NJSA 2B83A 5JS6A 2ZBRA 4LZPA 4U3FE 3F7TA 3ONNA 3RVMA 1GGVA 2N3ZA 3SKVA 2QN1A 1XTIA 1SCNE 3UJHA 1QH8A 3ZDDA 3BILA 1D4FA 3RUEA 4LZWA 2ZS8A 4L4SA 3JVDA 4LFCB 1E9FA 1E1LA 1OW8A 3UOGA 3DVSX 2OXEA 1H05A 3DCYA 2XAAA 3OT4A 4K6CA 1PPJG 1D2MA 2VDMB 3JYNA 1GAJA 3PWKA 1VHWA 1GWNA 1TJYA 3JVEA 5HXAA 4YV2A 2EHDA 3SWFA 3SIPA 3H5AA 3DMPA 1UXJA 3S3TA 3B4SA 2G28A 1V6AA 5L8VA 1Q7EA 3GJ0A 4DDVA 4R8RA 2WJGA 1OASA 1KN7A 4NDAA 4UASA 4N82A 5B1YA 3ILHA 5ANRB 3LF2A 3S27A 4TWZA 3DOHA 2H00A 4KK3A 1LD3A 2BKEA 5H70A 1C41A 3L75E 3B1WA 1EDJA 2XVYA 3DFKA 1W4CA 1GAEO 5SYAA 2PMBA 1ZC4A 5JFOA 3DJFA 2QEXP 2QYSA 2KHZA 3ANMA 1PDWA 1LSOA 2I67A 3IQGX 1B4DA 5BUCA 3P4UA 3PLRA 2Y0EA 2MSCB 1UBRS 2B1RA 1DD3A 5AOCA 5TEVA 3D3WB 5D8DA 3NM6B 3HB0A 4E5DA 4KR6A 3WISA 4BNTA 5AKJA 2IP1A 3KPEA 3JASB 1C7IA 1QL2A 2AH5A 2QD5A 4KV7A 1C1YA 3IR5A 4ZXFA 4MV5A 1JOCA 3F97A 3VR6D 3FBTA 3OY2A 2VJMA 3H9BA 2EHJA 4I36A 4L0MA 2IT1A 3Q15C 4NJMA 3STTA 1FFXB 4JENA 2QW1A 1RI2A 4L4XA 3WTCA 1Z4NA 3KB2A 5FB3A 4YI5A 3I37X 3WLRA 2P9ZA 1P0PA 3NCTA 1JSLA 1LPOA 2CUNA 3EG9A 2OYHB 1E5XA 2Y9YA 4DXHA 3MN1A 2FPPB 2V3CC 2O7SA 3KZVA 4OJKA 1ZW1A 3OE4A 2EP8A 3GAMA 3E4DA 1M6NA 1MZ9A 4HVAA 3Q3GE 4DDKA 1Y3FE 1ZUIA 3INYA 2C7QA 1JKJA 1VLVA 5ALRA 3ZQ4A 5BWLA 5J2UF 4UM8B 4D82A 2QRPA 3ZZTA 2F3UA 2BGUA 4IS3A 3LT5A 4MVJA 3GJSA 1DEHA 5CBPB 3MUDC 3V2RA 4TS4A 4CIYA 1D1PA 2CFRA 1KV4A 1QMGA 3P20A 3HYTA 1E1CA 2HRDA 1W0KA 4NK5A 4FHZA 3O75A 2H4XA 3DR5A 4R0MA 4US2R 2IPNA 1ZISA 1AVOA 4IWNA 1WXEA 4IILA 2WYHA 3AJEA 3WRXA 2Y68A 4QBTA 4HAOA 2Q6KA 2QPLA 2P2GA 4EZBA 3OPNA 3ZGXA 4CPDA 4ECAA 2O3QA 4A1FA 1TTTA 4BMXA 1I2CA 1SQQG 3F73A 1R10A 2CMHA 3L1VA 3HCAA 4HI0E 1GYPA 2LTAA 3T9BA 3CCUP 5IU6A 4ND8A 4YROA 1JIUA 4IDAA 2M8RA 4D9NA 4NCXA 4TKVA 1TEZA 3MS7A 5I7WA 2DTXA 4HLUC 4GMHA 1ZYUA 1E5DA 3ETNA 2HDHA 3RJ9A 2HRBA 2PH3A 2E76B 2ODQA 4B87A 5CXXA 1MKYA 3CF4A 4PRYA 4PG7A 3K9LA 1AXGA 4DUPA 2I4OA 3JQGA 4NHEA 3FR8A 4YDHB 3RHFA 4KNWA 2NSHA 3Q7RA 5HW0A 2VA9A 1XRRA 1TKCA 7MHTA 3G9QA 4LYYA 1WULS 1JG1A 3PNVA 2Q3JA 1HR0B 2XGSA 1DDIA 1DJLA 3A1WA 1JTEA 5BRNA 3IVAA 2PLFA 4XDYA 1KHTA 4Z7QB 1V1MA 4EX6A 2Z56A 4IQ0A 1R3UA 2FDCA 1JNMA 4HNTA 3CF4G 3KJQA 2QVGA 3OP4A 4WJZA 2Q1UA 4WQMA 1H6AA 2VPZA 1YL6A 4AP5A 5K6TA 3JD4A 2CN1A 4IIJB 3NAMA 4JBXA 4OGQD 3NNSA 2X3YA 4HRYA 4OPMA 4OFXA 4P98A 5CGQB 1KQOA 2C03A 4DIDA 1S2MA 4ZAYA 1F51E 4J43A 4FBLA 5BQ3A 2SKDA