2ZYAA

Dimeric 6-phosphogluconate dehydrogenase complexed with 6-phosphogluconate
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
465
structure length
465
Chain Sequence
SKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDACAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes associated with cofactor/substrate binding of 6-phosphogluconate dehydrogenase from Escherichia coli and Klebsiella pneumoniae: Implications for enzyme mechanism
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords 6-phosphogluconate dehydrogenase, decarboxylating
total genus 176
structure length 465
sequence length 465
chains with identical sequence B
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2zyaA02
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 2zyaA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zyaA01
2ZYGA 1HDCA 1ZXLA 3GNQA 3H9EO 4Y8VA 3AM3A 3HDHA 1LLQA 4RVDA 3UCEA 4J4HA 3W6UA 1XA0A 4FFLA 3OQ1A 4QSMA 4YRBA 1DEHA 3BMCA 4FDAA 1X15A 2NTVA 3DAPA 3UN1A 3WIEA 4E2XA 1LC0A 3AOGA 2ZCVA 1DC6A 1JVBA 3FPLA 2AEFA 4IQGA 1I33A 1AXGA 3VPFA 1N2SA 1QRRA 5G0SA 1A7KA 5L3ZA 3I23A 3N74A 2ZYDA 3V1YA 3KXDA 5HBRA 2X0RA 1K2WA 1RM0A 3IAHA 4JJIA 4IDGA 3FSRA 2ZTMA 3CE6A 3ORFA 3ROQA 5A5FA 4NIMA 3LT1A 3E6AA 2P5YA 2D5AA 2VT3A 1P45A 3GF4A 5CDTA 4PLHA 3V1TC 2DPHA 3TPCA 4R16A 1GQ2A 2Q45A 4XYGA 5EMHA 4C7KA 1QLJA 4YWJA 3JQAA 3LSYA 3CEAA 4HFRA 5G4LA 3TZKA 1BDMA 1C1DA 3O03A 2YJZA 2WDZA 4D45A 3L77A 1NQOA 3WSWA 3K2BA 3EHEA 2GN4A 1GFSA 4XEHA 4XDZA 3WQRA 3NKLA 4J2OA 4BB6A 5CG2A 4EZBA 4CMCA 3BA1A 3ZV3A 2GF2A 4IDDA 1ZVMA 3HJAA 3ETGA 3DZKA 4WOKA 4BO8A 2AXQA 3VTFA 3IP3A 1B26A 3RASA 4ALMA 5B4TA 4OSOA 4NFSA 2X0JA 2FR1A 3G49A 4N5NA 3T7CA 5JAMA 3DBRA 4HUJA 4TMFA 3O8QA 2D2IA 1UXJA 2BF7A 2OL4A 4YQZA 4ONEA 5GY7A 2X1HA 3EZLA 2NWQA 1Y8QA 1NVTA 2C59A 1SO8A 4Q3EA 3A1NA 4RQTA 3OJ0A 3VZQA 3PYMA 4YAEA 5L4SA 3BTOA 2CF5A 5H81A 3BMNB 3WMWA 5IJZA 1N9GA 1EEHA 3UVEA 3ADPA 2GN9A 5IG2A 3F4BA 1PQPA 3INTA 2PLAA 3GGPA 3JQGB 4NHEA 3B1KA 4XWYA 3WJAA 4E5KA 1CWUA 1R4NA 3W1VA 4CQMA 2JCVA 1YKFA 2W4QA 1PQUA 3GEGA 1HXHA 1GCOA 1WDKA 2X0NA 3U4CA 1LRKA 4G5HA 4ZICA 1NQAO 1C0IA 2PH5A 4DXHA 3AOEC 2NUAA 4JQCA 5THKA 3PWKA 3S55A 4E31A 1I2ZA 4AJLA 2O3RA 2EF1A 5TX7A 1I8TA 1S6YA 4TVBA 4C4OA 4FOSA 3RC9A 2FR0A 4OQYA 1TT7A 4ZQGA 2Y05A 4K26A 1M75A 5TF4A 4O59O 2GLXA 2IXAA 2GERA 2CFCA 5AXDA 2I6TA 3ST7A 2HUNA 4XRGA 3JCZA 4IS2A 4CMEA 4GSKA 1FJHA 3PWSA 1LEHA 3QE3A 1UP6A 4ND2A 4JBHA 2AQHA 3CXRA 3EMKA 1EDOA 4BNHA 5KVCA 3E18A 3GRKA 1DRWA 4HY3A 4YACA 3F9IA 4FGSA 1NYTA 1M76A 2GO1A 2RH4A 3C1TA 4TSKA 1E7YA 3I6IA 3ZWCA 4WEQA 3GK3A 2WYVA 3B1FA 1PJTA 4J1TA 4NJMA 4NNJA 1XKQA 1SAYA 2DBVO 2W8ZA 1TT5A 2Y1EA 5JNLA 4HNHA 1QXSA 1IULA 4E21A 3TJRA 2Z5LA 3LF2A 4XYMA 1JTVA 2CMDA 3K9QO 3D64A 4QFCA 1GAEO 3WG9A 3PRJA 3QP9A 3ENNA 4ZQBA 5IAAA 4UEJA 5TSDA 3F5SA 2QRJA 3LC1O 4O0LA 3O26A 4P22A 4FOOA 3OA0A 4MP6A 4BMVA 4E5MA 5KWEA 3S2GA 3KYDA 5ADHA 1IUKA 1Z82A 1M67A 2Z95A 1ARZA 4BNFA 2ZCUA 1VJTA 4FFRA 4FN4A 2VN8A 1JKIA 4HADA 3E9QA 4ZRNA 1VM6A 2VUUA 1GCUA 4TZKA 5A9TA 1H2BA 1D8AA 1ORRA 4R3NA 3IQDB 1JKJA 3ICPA 4QO7A 2J3KA 4CJXA 2Y1DA 1LXCA 1FMCA 4JLWA 1NFFA 3DBHB 4JXKA 1XDWA 4O63O 3DXFA 1BXGA 3O9ZA 1I36A 4L76A 4ZGWA 5DCWA 4M87A 3L4SO 3D4OA 2XAAA 3IKVA 2AQ8A 1KETA 2JD2A 3DZJA 2BFMA 4CMEC 4L0QA 3H2ZA 2PD3A 3H5RA 3PLNA 3MJTA 3Q2KA 4CLRB 2H6EA 3Q9NA 3JD2A 3WXBA 1LSOA 1ZCJA 2PNFA 1T2AA 3D1LA 4BO4A 4HFNA 2Q4EA 3F4LA 1KC3A 2X58A 4EI2A 1ID1A 5TT1A 4E12A 1ENZA 3C24A 3MOGA 3FRJA 4HWKA 4D79A 2WEKA 4MKZA 1D1TA 1CJCA 4ZJUA 1UDAA 2WTBA 5HS4A 3V1UA 2JCXA 5A05A 3A4VA 1FXSA 1G1AA 2C29D 4GLOA 4KP7A 1YOVA 2GSDA 4E5PA 1AE1A 2Q49A 3WMXA 3F5QA 3PHLA 3DAFA 3D4NA 1R4MB 2I3GA 1BTOA 4OH1A 1XIVA 4QFDA 4I9NA 3ZWNA 1YBVA 3RUAA 1T25A 1NVGA 2UV8A 1LLDA 3WGGA 4NK5A 1YL6A 4ALLA 4LK3A 4KOAA 5F1KA 8LDHA 3OJFA 3JQCA 5AYVA 2IXBA 4IDEA 2C2XA 1UXGA 1HDXA 1C3VA 1SB8A 3G1TA 3ZHYA 5L4NA 3E82A 4CMIA 4WLOA 1A9ZA 4NPCA 2X22A 3JQ8A 3UXYA 4LRTB 1GZ4A 3UH1A 1HLPA 2GZ1A 4FC6A 1H0KA 2VHXA 3HFSA 2G76A 3AM4A 3X2FA 5I9MA 2JAPA 3FCOA 1SEVA 4EYEA 1WMBA 2Q3EA 2BFOA 1U8XX 1LDBA 4DMMA 4WE3A 1Z74A 1QYXA 4J1SA 1SOVA 3F1LA 4JNKA 4DL9A 7ADHA 3IKTA 2IODA 3F47A 5C7IO 1ONOA 1ISJA 1N7GA 3IP1A 4Z9XA 3SLKA 4E30A 1MG0A 3ZV4A 4B7XA 3G17A 4GI2A 4U8GA 4XR9A 1EDZA 5KTKA 2PA3A 1DFHA 3RFVA 2E37A 3AU9A 1UXHA 3PQEA 1MG5A 3VAZA 4A5OA 4E5YA 1X0XA 1O94A 1Q0LA 4Z0HO 3DC2A 1Y9EA 1ZMTA 4PCVA 1PJCA 4ALIA 4YAJA 4NFHA 3BMQB 1GR0A 1O0SA 3GRPA 1Q7BA 5JAZA 2E4AA 3EDMA 4D7AA 3A06A 2HJRA 5JMPA 2RH8A 1YQXA 5I9LA 1GEGA 5GMOA 3DTTA 4BL5A 2QZZA 4CLRA 1N1EA 5KJFA 1EBUA 4E6PA 1J0XO 1ZK2A 4KQXA 3GNSA 1P1HA 3EVNA 4YJHB 1IPEA 3OIGA 4CL3A 1PGOA 2V6FA 1VLLA 2X8LA 1J49A 2QQ5A 3NDIA 4LGVA 1CIVA 3UF0A 1DJNA 4WUVA 4FFOA 2P2SA 4MINA 4CUZA 3PWZA 5TJHA 1YGYA 4XIJA 1KEPA 4YRAA 5BR7A 5IXYA 3QQPA 3U09A 1RM3A 1VL8A 2ZIZA 4JP3A 5TC4A 3E03A 3TQHA 2OBNA 5DBGA 4NQZA 4GX2A 1PZGA 5BNFA 2CD9A 4AVYA 4AJOA 4CMJA 4M89A 3AY3A 1GUYA 2OGUA 3LK7A 4M54A 5EINA 3S2IA 5BSFA 2DU8A 4J0EA 1R12A 2JD1A 1D3AA 1YE3A 4YCAA 4RPHA 4CMIB 4YRDA 4X54A 3L9WA 2P4HX 3WNQA 2W98A 1R4MA 4RVGA 4FJ2A 4CV1A 4TWRA 1EUCA 2YDYA 5IDWA 4YAGA 1YB1A 4Q3CA 4K1LA 3PIDA 1PGNA 1KEVA 3M2TA 3VVCA 3H5NA 1HL3A 1B0AA 3CMCO 2NM0A 1A27A 1HRDA 2WD7A 5MDHA 1O95A 2DBZA 3UCFA 3LT0A 4BO5A 3M6IA 4YT5A 1LQUA 3ASVA 4UEOA 1HYGA 4K6FA 1A4UA 3JD4A 3TSCA 4UVHA 1P1JA 2BELA 3HZZA 3FD8A 3SBOA 3RBVA 4CR8A 4BUCA 3LC2O 3JQFC 1Q0QA 2DTDA 1N5DA 2GN6A 4W6ZA 4L8VA 3ZU2A 3K30A 1Y5MA 3U4HA 5CPBA 4FS3A 1MGOA 4N7RA 1R15A 3IL2A 2OFPA 4NBVA 1BW9B 3D3WB 3ZU5A 1SCUA 3LVFO 3F1KA 4WGGA 1NR1A 5KJCA 1NQTA 1YXMA 2F1KA 4EITA 2FSVA 4PVDA 3RJ9A 5DT9A 3JQ9C 1JKFA 3DR3A 4LSWA 4P38A 4GWGA 1C0KA 2DAPA 3UKOA 3D5QA 3V5NA 3K8ZA 4RVSA 5HRUA 3UOGA 4BVAA 3RUFA 3ETEA 5JY6A 4R3WA 3CTVA 5IN4A 4E2ZA 3KYDB 3MTGA 2DC1A 1OAAA 1I2BA 1EMDA 3PQDA 3Q2IA 2X9GA 3WWYA 1QG6A 1ZJZA 4CV2A 2W2KA 2PGJA 3UFXA 3O4RA 2ZB4A 4IDFA 3ONDA 1HE5A 5F21A 3D5TA 4UUOA 1U3VA 3PP8A 2QG4A 3I9NA 1X13A 1I32A 2O2YA 1I30A 5H82A 4ZQEA 2X9VA 4U0KA 3FTPA 3WJ7A 1ZKMA 5CPFA 2YQ4A 2NVUA 2GZ2A 3ZWXA 1UDBA 3DMTC 4XQ9A 3HN7A 1VJ1A 1DLIA 4UVGA 3S2EA 1GDHA 3I6QA 4B3HA 1CRWG 4XGIA 3VTZA 4DPLA 4MO2A 2Q99A 2FRDA 4MVJM 5G0UA 1Z7EA 1CF2O 4XJSA 5ICMA 5FF9A 3JQDA 1PWZA 4RF2A 5F1PA 3TF5A 1YJQA 1Q1NA 2VUSA 3TFQA 3WQSB 2LDBA 5JO0A 3I9JA 2GUGA 3HADA 1GYPA 2OO5A 2YYYA 3JYPA 1I10A 4KMSA 1ONNA 1LU9A 3ZWMA 1F8FA 4NU5A 1YOVB 3G1UA 2DUWA 3L4BA 4WASA 1E1NA 4RQUA 2D3TA 2FPIA 5FI5A 2LDXA 5A4DA 4BNXA 3NX4A 3RFTA 1DBVO 4FFMA 3QRWA 1R0KA 1KS9A 5J23A 1H6DA 1QKIA 4RZHA 2NU6A 1GYQA 2AEJA 1NFQA 4ND5A 4R01A 4BQRA 1R4NB 4BKRA 1H6AA 3ZHXA 1PS9A 3Q1LA 3HHPA 1U3UA 1LDNA 4R9SA 2YHUA 3PDUA 4E32A 2FZWA 2X5JO 2X6TA 1LDYA 3M1LA 1WDMA 1SPXA 3OH8A 5IZ4A 4EUFA 3N7UA 1KOLA 1HKUA 1GPJA 2GD1O 1ZK1A 1YBAA 2OP1A 3WSVA 4R1NA 3WB9A 1XWFA 2WWRA 4ND1A 4CLOA 3WIDA 1LBEA 2Y67A 4J16A 2Q2VA 2O50A 2G82A 4J1QA 1EVYA 3L4BC 4BMSA 2HAEA 3QWHA 4AJPA 4MOWA 2ZQYA 1I24A 4DLAA 2H9IA 2TMGA 4A2CA 4Z9FA 3BHIA 5JCJD 3S2FA 1M66A 5CEFA 4PG8A 4O6VA 3PK0A 5K6AC 4QT0A 5L7WA 1E1KA 3CINA 1C1XA 1ZEMA 3C7AA 2JL1A 1XHLA 3RD5A 1MB4A 2HJSA 2FR8A 2J5RA 1DHTA 1NP3A 1PEDA 2I67A 3CMMA 1BVUA 4GAEA 3PEFA 2Y0EA 5DOZA 3JQAD 2VWGA 5BNIA 5CG1A 1ENYA 3FNEA 4A26A 4TROA 1FDSA 4LN1A 5LC1A 4L73A 5DCYA 1C1DB 3X2EA 1R0LA 3FPCA 2EKPA 4PG7A 4Z3KA 1AXEA 1NX6A 1K89A 2H63A 4F6LA 1D7OA 5T64A 3MJVA 2AHRA 4FPXA 4W4TA 1BWSA 4DREA 1R0SA 2B69A 5TT0A 1ZEJA 3PGJA 4PLVA 4IIUA 3NRCA 2ZATA 3H9GA 1F8GA 3VKUA 1PGQA 4GMGA 3NUGA 3OSUA 4ID9A 3GEMA 4NBRA 4B7CA 5T5QA 1Q7CA 3VVBA 4MDHA 4BO3A 3ZH2A 4L75A 3QV1A 2PZJA 5IZCA 4H3VA 1P1KA 4RPLA 2GPTA 4DA9A 4LW8A 5JCJA 1DHRA 2E6UX 3ITDA 1LRLA 4H15A 4M1QA 2Q1WA 2JJYA 4BV9A 2O4CA 1ZXBA 4EEZA 1H93A 4EUHA 5TLSA 3TFOA 3FR7A 1E3WB 2Q46A 2RAFA 3GVIA 3LC7O 4UAGA 3GUCA 3WFJA 1F0YA 1VC2A 3GT0A 5FFFA 3GPIA 1HDGO 3B1JA 5K6AA 1P0FA 1XLTA 4WK6A 4DMLA 3JQBA 3KEOA 1LA2A 3JD1A 3P2OA 1T4BA 4NR0A 4NK4A 1PSDA 2PZMA 3LF1A 1JA9A 2CDCA 4OSPA 4XGKA 2HMTA 5IZCC 1E92A 5CDGA 1DOHA 4EJ6A 1EZ4A 1WVGA 1ISFA 4JJFA 4XGNA 1W0CA 2VRCA 3D4PA 4J7UA 5T57A 3HSKA 1X1EA 3P7MA 1GZ6A 3PZBA 4OO3A 3RUCA 4B8ZA 5ENVA 1GTMA 4DC1A 3ZHZA 5B12A 1HE4A 2JFGA 2OMEA 2Y93A 3G79A 3RU9A 2HK8A 4DIBA 4CV0A 1GY8A 1PZFA 4XKJA 2DUUA 3SC6A 3GH3A 3RBXA 2O7SA 2YW9A 4B3JA 2CF6A 3VOSA 3WBFA 4J0FA 5T6BA 1NPYA 4RJTA 1EK5A 1PJQA 4IXTA 4U5QA 2PZLA 4MVJD 3VH4A 3WTCA 4TRMA 5JYEA 4M86A 1S7CA 5KJ6A 2H5LA 2A92A 2UUOA 1ZFNA 1VSUA 1QYWA 2EWMA 3OP4A 4J2HA 1AA0A 1JN0A 3V8BA 3OA2A 1PL7A 3GR6A 1L7EA 2EIHA 1E7SA 2C7VA 3AI3A 3JD3A 4BO2A 3ULKA 5L95A 1D4FA 1XU9A 4I5GA 1FDUA 2NVUB 2D8AA 5CHEA 2P9EA 3C1OA 1U3TA 2CZCA 3ITKA 5G0VA 2X9NA 1OFGA 2EERA 4CM5A 3B70A 3UGKA 3WQQA 1TA4A 3H7AA 2CY0A 2CVZA 1O9BA 1PQWA 2I76A 4MVJP 1RYEA 3SLGA 2GDZA 2PKQP 2JAHA 3EYWA 4DC0A 1MLDA 2D0IA 1HF3A 4Y9DA 3KOUA 2VOEA 3DMYA 1HSZA 4GWKA 4H16A 4AJHA 4WPGA 4YT8A 3E1KA 4N18A 3BTUA 1E7WA 3PPIA 4R1SA 1ULSA 4YJHA 3RQSA 3H9QA 4UUMA 2EXXA 4G81A 2PZKA 4TKLA 3OEWA 5JAIA 1B3BA 3HDYA 2Y68A 2OBYA 1E6EA 1DIHA 3E48A 3EC7A 5EQDA 1TI7A 4P8RA 2VYNA 5TJ9A 4E4YA 1E3EA 1E1MA 4BNTA 2X5KO 4XDYA 1MX3A 4N5MA 5ITWA 5DBIA 3GMDA 3T7EA 3ZHBA 1TT5B 1DIAA 4E13A 1T2DA 3DTYA 1EVIA 1CQJA 4R9RA 4JP2A 4BNJA 1DC3A 3ZZNA 5JBIA 3ZV6A 4XRRA 3WR5A 5KCZA 1SC6A 2ZKLA 1HSOA 3HFGA 3OQBA 4I9HA 1IL0A 5CDYA 3EY4A 4YR9A 4ZHSA 5IF3A 5F5LA 5DOVA 4ILKA 3VHRA 5H83A 1U28A 4HNGA 1SNYA 1DXYA 2RHCA 3RCBA 1V3TA 1PL8A 4RPJA 1WP4A 4AFNA 4FCCA 1YL7A 3PYLA 3RBZA 4CM1A 4CM9D 4E0BA 4IXWA 2BMAA 2UAGA 3COSA 5DULA 3FNFA 3MTJA 4GKVA 2Y0DA 3PJDA 2AQKA 4PRKA 3RC2A 4PLYA 1SB9A 1UXKA 2ET6A 2V6MA 4ZN6A 2Z1MA 3O38A 1EK6A 3WWZA 1K6JA 2HMSA 1LDEA 4OM8A 4FJ0A 3GN1A 1ADBA 3BTSA 3WYBA 2YHIB 3QWAA 4A0SA 1QP8A 2EHDA 2Y1OA 3GDGA 3QVXA 2VHZA 3ROMA 1ZK4A 4BNGA 4PLTA 4QTZA 4IDCA 4IJVA 3PJFA 1JDJA 4ALNA 4CMKA 1E5LA 4QUKA 3EK2A 5L40A 3F3SA 5JFOA 1P1FA 5G2OA 2HDHA 2J3JA 2Y0CA 2Y99A 3WTBA 5KVQA 4PG6A 3JSAA 2NACA 4W99A 1EFKA 3FWZA 5TGDA 1P44A 3QIVA 3ZW9A 2DLDA 5F3RA 4J4BA 3KHUA 1ULUA 4R51A 5L7YA 1K0UA 3ZN2A 4HFMA 4BKUA 3O8QB 3FBGA 4FW8A 3ZWPA 3PHGA 2EKQA 3RSHA 4B8WA 3DBLB 3IIEA 1SBYA 1LLUA 1KBZA 2PV7A 2B35A 3NDRA 4GBJA 4MJLA 1HWYA 2YV3A 2NQ8A 4IQ8A 5ILGA 3WOHA 2EEZA 2FMUA 2CDBA 4GVLA 2NU9A 4KUHA 1T4DA 2NVWA 1Y7TA 2JD0A 5L4LA 4MP8A 3KETA 3H5AA 3NTOA 1Z7BA 2DFDA 2EJWA 4OMUA 2EKLA 4CUKA 1V6AA 3OFSA 5COBA 4A7PA 2BGLA 5L45A 3SXPA 3W8EA 2WM3A 1B8VA 3LYLA 4OGWA 1U8FO 5B4UA 3C8MA 5IDXA 2B4TO 1HZJA 3RJ5A 1LC3A 3P2YA 4FFNA 2ILTA 3DB2A 4A10A 3EUWA 2D4AA 1MFZA 1C14A 3PHIA 4OAQA 2VYVD 2JFHA 3SJUA 1GV0A 3IJRA 4BS9A 4F3YA 1DLJA 1R37A 4PG5A 2VTEA 3NAQA 4YEDA 3WGIA 3MJSA 1UP7A 1NTOA 2AE1A 1Y8RA 2O3JA 4CV3A 3H2SA 4QQRA 4KUGA 1KY4A 4PVCA 4ZRMA 4IZHA 2VUTA 4O1MA 5I7FA 4AJKA 4JBGA 4OJNA 2O4UX 3F6YA 3LT4A 2B36A 2JHGA 2AMFA 3BZUA 1EUDA 3I4FA 2HMVA 3KEQA 3GN2A 3I4CA 3MJCA 1RM5A 4WLNA 2BHLA 5HS6A 1JU9A 3ANNA 3LT2A 3GG2A 2XOXA 1Y9AA 3ZWAA 4RLSA 3ZW8A 4RF4A 5BQFA 2Y66A 1T2CA 4DQUA 1ISIA 1P33A 2VWQA 3PTZA 3QW2A 1E6WA 4GVXA 2O48X 5EL0A 4CM6A 1NPDA 1KIFA 3KM0A 3RROA 1P1IA 4B7UA 3ZGYA 1PS8A 3L6EA 2QRKA 4Z6KA 4YPOA 4BO9A 1DFIA 1T1RA 3VPSA 3DQPA 3ROKA 5KJ1A 5JE8A 4UVIA 2X0IA 1M2WA 4IGFA 4UVEA 3GOHA 3VZRA 4BKQA 2QYTA 5I9NA 4MVJH 1LX6A 3WX0A 2VHWA 3S1LA 3GAZA 3HDQA 2BKAA 4TRJA 2G0TA 1DDOA 5KNLA 2FSSA 4MKXA 1R66A 4BNIA 2QRLA 3JYNA 4YBZA 4DYDA 1VKNA 4YYZA 1YRLA 3I52A 3KB6A 3E9MA 4OKNA 1DIGA 4HBGA 3VZPA 4R54A 1V0JA 3GPDG 4KTVE 1L1FA 3AFNA 4IMRA 4N5LA 1DFGA 1E7MA 3AOEA 3RIHA 2VCYA 1LUAA 4DBZA 4IBOA 1Z45A 4IY1A 3GZ4A 4IGEA 3DFUA 3JTMA 4Y6SA 3UHAA 4DQXA 3PFWO 3KBOA 4S1VA 1KVUA 2OP0A 4UVDA 5KIAA 2C0CA 5BSEA 3DFZA 3GGGA 4KQWA 3ZNNA 4K6CA 3OEYA 4Q9NA 5B1YA 3IDSA 3CPSA 4AL4A 1XQ1A 2IDZA 1ZBQA 1X1TA 2GYYA 3KLMX 4FIZA 4NU6A 1QYCA 1NXQA 1YB5A 4JN6B 5ILOA 1ZSNA 4JJGA 1U5AA 3C7CB 2IZ1A 5IN5A 4IIVA 4BIIA 1E0DA 4KDEA 1H9AA 1G0OA 4YB8A 5LCXA 1MA0A 5A04A 3V2GA 1PS0A 5TQVA 3OHSX 1ENPA 1B3RA 4GX1A 4WCDA 1IHYA 4TRNA 3W4IA 1H6CA 3U3XA 2QW8A 4ESOA 5TNXA 5JC8A 1OX3A 1C0LA 2QYSA 4IDBA 4EJ0A 2X4GA 2W2LA 2X86A 1DC4A 1HDRA 1X7HA 3K5PA 2DBRA 1PJLA 3JQAB 4FB5A 4S3MA 2C5AA 2PH3A 4I5EA 1VL6A 2IZZA 1JQBA 4D3FA 1TB4A 3C85A 3OJLA 1GZ3A 4BGEA 3EVTA 1BGVA 3RVDA 1VL0A 2GRAA 4KWIA 1AGNA 4OOEA 3DBHA 4E33A 3KUXA 4CL8A 2V6GA 2VYVA 1FDWA 3FR8A 1ZSVA 4XYBA 4D3DA 4ZA2A 4CQMD 2POQX 4UULA 1PJSA 1YL5A 3JQ7A 2VHYA 1EBFA 3U49A 4M8SA 1F06A 1W4ZA 1MV8A 5JW6A 3QVTA 3HUDA 5KJEA 1PR3A 1DC5A 3HB5X 2Q50A 5ITVA 1IB6A 4DLBA 3QVOA 5DN9A 3STHA 5GZ6A 3RWBA 5JXWA 2YFHA 1Y81A 3EAGA 3EGOA 3DMTA 5IXSA 4YA6A 1AVYA 1V9LA 4XD2A 4B4WA 4IUYA 2EGGA 2QHXA 1N9GB 1U1IA 4OQZA 4J43A 4R1TA 3ADOA 5TIIA 4FR5A 3IMFA 3HDJA 2DT5A 2YFQA 3KYBA 1XQ6A 1BSVA 2DKNA 3INGA 3PIIA 1F14A 4W7HA 1RYDA 9LDBA 4F6CA 3AUSA 1Y8QB 2W2LD 3Q6IA 1ZMOA 3VKVA 4BKPA 1OOEA 1ONPA 4CLOB 3VH3A 2X5OA 1DRVA 2YZ7A 3ZV5A 1KEUA 1RJWA 4YJFB 1IHXA 2XXJA 4MVJI 3ENKA 3C3XA 5JC1A 3JQ8B 4CPDA 1PJBA 2PFGA 4A03A 4GGOA 3DO5A 3EZYA 3U4IA 4D3SA 4AICA 4XQEA 1BXZA 3BMOA 4YJDA 2PGLA 1PX0A 3HQ4O 5L7TA 2P68A 2WE7A 2PD6A 4BB5A 4XJTA 5A1TA 4RV9A 1B7GO 2RIRA 4ZD6A 3CIFA 3WGYA 1A72A 3WLFA 3WYCA 1VSVA 3DAGA 3K31A 4EUEA 1G6KA 4Q3BA 5ER6A 3ZWYA 1TLTA 1HTBA 3A28A 3I9LA 4ZQFA 1XELA 3RKUA 3OETA 3DBVO 5KOIA 1BW9A 1PWXA 4DGSA 1ISGA 4EDFA 1WXDA 1E1LA 4HFJA 4WCFB 3KTDA 4YAIA 3C7DB 1IYZA 4B4UA 4BGIA 4Y67A 3CKYA 1JWAB 3PI7A 4BNNA 1YH3A 3GG9A 3DHNA 4YXFA 1GEEA 2GASA 2DTEA 1WWKA 5ER9A 1E7QA 4C7JA 4OL9A 4D0SA 4CM9A 5U1PA 1XEAA 1VPDA 1ZK0A 3AI1A 4Q3DA 4XQGA 1DJQA 5AQ1A 1RPNA 2WD7B 2HKIA 4Z0TA 3KLPX 3PVZA 1DAPA 3RUHA 1N92A 4DTIA 3QWIA 5GZ1A 3ZWVA 4P4LA 4RL6A 1BMDA 1P31A 3H9UA 3RU7A 6ADHA 1HLDA 2PR2A 3JQ6A 5KVSA 4LVCA 4CLXA 3CZMA 3E9NA 4JGBA 1EVZA 2E48A 3I9KA 4LRSB 4U7WA 1GV1A 1XG5A 4DLLA 3OJEA 1LSSA 2EV9A 1HYHA 1KEWA 5BT9A 1JAYA 3VPHA 4BNVA 1DIRA 1Z75A 3BXXA 4RVFA 4XA8A 3PHJA 1PJ3A 2PTGA 2I65A 3CTMA 2H1SA 1LJ8A 1VRWA 1VKOA 2NADA 2AE2A 1EVJA 4N54A 4RORA 1QR6A 1E77A 1KVTA 2Q1SA 2E82A 4CM3A 1NAYA 1GQQA 4BKOA 3SVTA 1P0CA 3ZWOA 1BG6A 1DAOA 4D0RA 1WZEA 3KSDO 5KVVA 3WGOA 1NPTO 4CM4B 3G0OA 4RVHA 4OXKA 1M6HA 1E7RA 1UH5A 2HU2A 3I1JA 1E3LA 3RUEA 4YT4A 3GA0A 2P9CA 3MCVA 4NJMB 1ZO8A 1UAGA 4OYRA 5LDGA 4D41A 3GGOA 2BLLA 3AM5A 3PJEA 1HE3A 1PZEA 1GU7A 1PU2A 2FPGA 2P9GA 3GHYA 3ZNPA 2B37A 3FI9A 4PIVA 1OMOA 3DOJA 3P5SA 4L4XA 1DIBA 5AOVA 1GD1O 2FOIA 3I5MA 4B4OA 4AJIA 4RF5A 5G4KA 1GYRA 2HCTA 2FY8A 4BMNA 3TOZA 1P77A 1VJ0A 3D3EA 4R41A 2VZ9A 3GHHA 4GKBA 1F12A 1MC5A 4FC7A 5BSHA 2HQ1A 2RCYA 1DB3A 3UUWA 3ZNOA 4PFJA 3IUPA 1V3UA 5B37A 3ZI0A 2FN7A 2HSDA 3T4EA 5C3MA 4II3A 1C1XB 2Z1NA 2AG8A 2ZJ0A 5JMWA 4KWHA 1NHGA 5EJ2A 1U2GA 3TZ6A 1FDVA 3E5RA 3TWOA 3AFMA 5A5EA 1MFPA 2OXIA 4EW6A 5FWNA 3AJRA 2HRZA 5B4VA 2HK9A 2GR9A 5JCXA 5BSGA 1KVQA 1O8CA 1B14A 1TVEA 4EEXA 1I5RA 3W4KA 1QLHA 2JFFA 4BNWA 5EESA 3TNLA 2UYYA 1BHSA 2JHFA 4XZ3A 5DCUA 1V8BA 4YJGA 4BQPA 1XCBA 4PZDA 5JY1A 1DRUA 3NDJA 3KO8A 4AJ4A 1NBOA 4OKIA 5EPOA 3NJ4A 3GFBA 3WGHA 5U9CA 1KVSA 3QHAA 3LU1A 4R69A 1XU7A 2DQ4A 4TKMA 4ZQHA 1SMKA 4NBUA 4AJJA 1PJ4A 5JDIC 3GDOA 5F5NA 2O3UA 2JCYA 3B20A 4DVJA 3BAZA 1ENOA 4ND4A 3JV7A 1ZK3A 2GCGA 2VWHA 2Q2QA 4DPKA 1NVMB 4BOYA 4CR6A 2YHIA 2W90A 3IJPA 1HYEA 4KTTE 2C82A 4I9UA 5T8KC 1E6UA 5A3VA 3DBRB 3WBBA 2IEDA 1M6WA 1OZAA 1E3WA 4PLPA 1W6UA 3CH6A 5JLAA 1B2LA 2IYOA 5DP1A 2EW2A 1I2CA 1DO8A 4OOFA 3GDFA 3AWDA 4WECA 5MGBA 5DDIP 3ZWBA 1ZW1A 2BH9A 1LSUA 4WOJA 4GGPA 2VZ8A 3BTVA 4URFA 5CDUA 2P5UA 4NBTA 1H6BA 2DM6A 5BNTA 3VC7A 4XCVA 3G3EA 1K6XA 4FSHA 3WGQA 5DZSA 3IS3A 3KSZO 5A03A 4CM8A 2C5EA 2V6BA 4RDIA 2NSDA 3DBLA 2XF8A 1PR9A 1QYVA 1WDLA 2I5PO 1UAYA 4I08A 1YJ8A 2HLPA 4YDRA 3PGXA 1LI4A 2VTDA 2EG9A 4PGFA 2I66A 4KUEA 1QSGA 1E3JA 1UZLA 1FDTA 2C07A 3AUTA 4DUPA 5I7SA 1CQIA 3JQEA 3VZSA 1I3MA 2HMWA 3V2UA 1Z6ZA 2XPCA 3DWFA 1XR3A 1VE9A 4XR4A 2BFAA 5IDQA 3ZNQA 4P4NA 4MP3A 5LDHA 4LISA 4BO6A 1NAIA 1CERA 2HK7A 2V65A 3BMCB 3E5MA 3PYXA 4M55A 2VYND 4OXYA 4YJFA 3RFXA 1CEQA 2A35A 5C7OO 3K92A 4CLHA 1NR7A 4BNYA 3JYLA 2WYWA 2IYPA 2SCUA 1MC4A 2A94A 3KYCA 2DPGA 1UDCA 3W4JA 2CSUA 4BO1A 1B8UA 1AHIA 2DBQA 2UVDA 3NJ8A 1NFRA 3H3FA 4EJMA 1OC2A 5DP2A 3ANLA 4AG3A 1I0ZA 2O3QA 4WEOA 2PGDA 4ROSA 5JO9A 4INAA 4UUPA 3WDSA 1P74A 4AJ1A 4DPMA 3WFIA 2VT2A 4E5NA 3VDQA 3TRIA 4CMAA 4FBGA 1HDYA 5IDYA 3H65A 4UREA 2WMDA 5CDSA 4XB2A 4NBWA 3H3JA 3GFGA 1PZHA 2XXBA 2YUTA 3K2EA 4GLLA 3TZHA 2RHRA 3W8DA 4U6SA 3NV9A 2NTJA 3H6KA 1YBMA 2C54A 3PXXA 1B8PA 4MVJF 3KV3O 1KYQA 2YDXA 3U5TA 2B0JA 3DOOA 4JIGA 1HEUA 3OM9A 4XX0A 1BXKA 3HE3A 4E2WA 2BFPA 3OF2A 3W8FA 4QX6A 3WS7A 4R1UA 5A02A 3DONA 3PQFA 3AUAA 3BHJA 4QO8A 1H94A 2A9FA 3C1AA 3L6DA 4JROA 5CP8A 3I9MA 2WD8A 1EQUA 2VOJA 3JQBC 4P4GA 5EQFA 3SX2A 3NGXA 4RVUA 1AUPA 1GQYA 3BMOB 3DDNA 5A9SB 4QEDA 5CFZA 1WZIA 2C20A 2I99A 4WKGA 1XGKA 2ZTLA 3A9WA 3ROPA 3DHYA 1JLLA 1K6IA 1SZJG 3K6JA 4R5MA 5EERA 4QXMA 4I5FA 4XIYA 2FHSA 4EBFA 4WCFC 3SJ7A 3RUDA 4MIYA 4NZ9A 2PD4A 3R1IA 3R6DA 4ALJA 1BDBA 3DZFA 3OJOA 4U6QA 3LDHA 5JPIA 1U3WA 4LMRA 4HP8A 2ZQZA 1LDGA 3SC4A 3ZU4A 4BNMA 4PZEA 1T1SA 1PL6A 1NM5A 1QYDA 4H7PA 3DZHA 3L0DA 5ICSA 1U7TA 3JYOA 1AHHA 4IJKA 1DSSG 2A4KA 2WE8A 3LLSA 4BGUA 1K3TA 3GVHA 4RDHA 3RC1A 4CMHA 3TOXA 3NT5A 3CUKA 1JWBB 3P19A 5L9AA 1A4IA 1OC4A 4Y98A 4MVJG 4OIMA 4TVOA 5CEJA 1UR5A 3OICA 3OQ6A 2ZK7A 4L4SA 4YVFA 3GEDA 5COAA 2AA3A 2BD0A 4J90A 1EE9A 1DPGA 2AG5A 3JQFA 4W9NA 2CVQA 5G0TA 1PGJA 3MJEA 4M49A 3EW7A 1MUUA 2OOSA 4HKTA 3ZU3A 3NT4A 1NASA 4MIOA 4MPDA 4GX5A 2IE0A 4CR7A 1MXHA 2HMUA 4J9VA 4Z9YA 1FF9A 5DNAA 1LRJA 3B6ZA 3GUYA 4RO0A 1X7DA 3N58A 5AXBA 3CZRA 5L51A 4CM4A 1RM4A 1T24A 2CNBA 1KERA 3WLEA 1JVSA 1ADCA 2Y1GA 3ICCA 3JQGA 4IPTA 5K0ZA 3HB4X 3F46A 1IOLA 4Q39A 3DL2A 4CQLB 4PRLA 2YV1A 1QV6A 2GN8A 4LMPA 2Q1UA 3GY0A 4WLUA 3BMNA 5JDIA 4J1NA 1N7HA 3GZNB 4B79A 2B5VA 2BRUA 1O89A 3AY6A 3LZ6A 5FI3A 5U4QA 4W9NC 2CUKA 3UCXA 4CQMB 4IZIA 1LSJA 4FJ1A 1U7HA 3GZNA 4EGFA 4PLGA 1YQDA 4DYVA 4DWVA 1GPDG 1T2EA 1GL3A 3OMLA 4J4TA 4UUNA 5EIOA 3I3OA 2FZEA 3ON5A 3RI3A 1LNQA 1O6ZA 5GZ3A 3OBBA 1Q7GA 3HG7A 4FQ8A 4NH4A 1O5IA 3M2PA 1HE2A 3D7LA 2O2SA 2R00A 3BIOA 1X7GA 1TEHA 2ZB7A 4PZCA 3BHMA 2HO5A 1QMGA 1ZJYA 2VRBA 2PKQO 1A9YA 4A73A 1SEPA 1WNTA 3V2HA 1H5QA 2VWPA 1GADO 1XYGA 2GZ3A 1ZH8A 2FWMX 1Z73A 1PTJA 1G0NA 3IOYA 2BGKA 4FFPA 2I3AA 4K9DA 3TL2A 2X23A 1UXIA 1IZ9A 4Z3DA 4RGBA 4B4VA 4FD3A 4J7XA 4BV8A 4IJUA 4NDNE 4R68A 5KKAA 4II2A 3VH1A 4GSLA 5HWSA 1ZUD1 2AW5A 3MWDB 3GC6A 1WAMA 4RCVA 4ZVVA 1WW8A 4RPKA 1N8KA 4L74A 2FPPA 2J5KA 5ES3A 5C7LO 5FYDA 4CMGA 5I7VA 4IM7A 1ADFA 1QV7A 1EFLA 5JS6A 3KRTA 3K73O 1EUZA 3U4DA 3CSDA 3R0IA 3Q0EA 4LCEA 3KYCB 1UJMA 1IE3A 2Q1TA 4HXYA 2ZB8A 1W73A 3QWFA 3H4VA 3QJ5A 2J5QA 1YB4A 3ABIA 2Y1FA 3RKRA 1C0PA 2J3IA 2BI8A 5HTOA 2NU7A 3RAJA 4O5OA 2IZ0A 4J9UE 2ZJ1A 4KDFA 2UUPA 4BNUA 2V7PA 2ZTUA 3MWEB 5AXCA 3ONFA 4R4JA 5JAQA 4DIOA 4K28A 2G1UA 2R2GA 4MIEA 4I1IA 5F1OA 4FGWA 4J6FA 1NHWA 1U5CA 1U4SA 4PLCA 4CQLA 3NEPX 1E5QA 1YWGO 4A27A 4XB1A 3I9OA 1RKXA 3W6ZA 2R00C 3AUUA 4IINA 4Q3AA 4JCOA 1A71A 1RWBA 1ZIDA 4DBVO 4PLWA 3WGTA 3DOCA 1PGPA 2NTNA 1CETA 2WYUA 5CAEA 1XSEA 1E3IA 4I8XA 2W2KB 4YAKA 3GVCA 3BYZA 2J6IA 4CM8B 2NVBA 4GQAA 3IC5A 1LTHR 1X14A 2O3TA 2I9PA 3FN4A 4MVJA 4GX0A 5I7EA 1VI2A 2IRWA 2O23A 1V35A 4BO0A 3MZ0A 2QIOA 4CLEA 1P1RA 1U4OA 5G0WA 2BI7A 3WICA 3DZBA 1PIWA 4GL4A 3OECA 3JQ7B 4F46A 5T8KA 1EQ2A 2D5CA 2ZYAA 3VH2A 2ZB3A 4WLVA 3ZCXA 5KKCA 2TMDA 3PHHA 9LDTA 3PLRA 1TXGA 3U62A 4HX5A 3VDRA 1Y1PA 2VNAA 5JDCA 3BMQA 3D3WA 4NG5A 3GLQA 2OUIA 4BNKA 4KZPA 3PJGA 1L7DA 5L53A 1W8DA 4G2NA 1IPFA 1B15A 4NI5A 5JDCC 1GUFA 3TN7A 1H9BA 3AK4A 1HT0A 3QSGA 4LCJA 4YQYA 1OBFO 3FTNA 5THQA 2R6JA 4WJZA 3QVSA 4CM7A 1JW9B 1BXGB 1HDZA 2YY7A 4ND3A 2IEBA 2GNAA 4MKRA 4XYLA 1WLYA 4E2YA 2B4RO 1WMAA 3QWBA 3HWRA 3NGLA 1R6DA 1Y5RA 2O3SA 1YONA 4WNCA 4XYEA 1BRMA 1LQTA 3H9JA 1P3DA 1X0VA 2DTXA 1J6UA 1UZNA 4Y6RA 3GQVA 4DRYA 2VZ0A 3DZIA 7MDHA 1YDEA 1LLCA 1T2FA 4RF3A 1KC1A 6LDHA 1I3NA 3Q3CA 4IQ0A 2OHXA 5IFLA 8ADHA 1I3KA 4DQVA 4CMBA 1PJ2A 4IJWA 1SOWA 3U0BA 3ZWWA 2PKRA 1ADGA 1Y6JA 2NQTA 4YTEA 2AEMA 2YQ5A 3SEFA 1JAXA 5HM8A 4QECA 3UICA 2NLOA 1OI7A 5I8ZA 3A14A 2VNSA 2QZ9A 4TQGA 3FWNA 5I8WA 1FK8A 3KSUA 1UZMA 5TRTA 1WPQA 1HZZA 2PK3A 3FNGA 3GVPA 3DEYX 5TS3A 3QLJA 1KVRA 2Y1CA 2JKVA 1IZ0A 3JYQA 1K5HA 3I83A 3AI2A 3UAGA 5T67A 4BGVA 1J5PA 1MP0A 4BNLA 4BO7A 2EP5A 3L07A 3M1AA 2O7QA 3WGZA 5C37A 1H2HA 4GMFA 5DBFA 1ISHA 1NAHA 3D0OA 2EW8A 3HNPA 3GMSA 1I01A 2YV2A 2B83A 3IUSA 1F17A 2Q2WA 4PLFA 4WCFA 2CVOA 3GVXA 3QA9A 1YDWA 4LSMA 3KVOA 3L6OO 4GPD1 3FF4A 3VPXA 3JQ9A 2E49A 2HRBA 4TRRA 4E3ZA 1YS4A 4PG4A 4WNIA 4WLEA 3UW3A 3PDJA 3AW9A 3VPGA 4UEKA 3OIDA 4D42A 4IMPA 4ITUA 2VHVA 5FEUA 1U2DA 3RC7A 4OXNA 2GGSA 5JSFA 4OHUA 5G4KB 4AJEA 3INRA 4BHTA 4NMHA 2Q4BA 4JK3A 1EE2A 3S8MA 3GNTA 4R5HA 4Q3NA 5CEEA 4W7IA 3L9XA 4LVUA 3TZCA 3H8VA 1Q0HA 2C2YA 2X7HA 5A3JA 2P4QA 5DF1A 1E3SA 1U9JA 3K96A 2D1YA 2ZTVA 4RZIA 3DZGA 4YJGB 1HETA 2DVMA 4D46A 4YT2A 4RPGA 5C5IA 3FBTA 2VQ3A 3WYEA 5JYDA 2NNLD 2OORA 3R3SA 2EGHA 4DIFA 2G5CA 5A06A 4ZU3A 1CYDA 1A5ZA 1NNUA 4D43A 1Y8RB 5AVOA 4NFYA 3Q9UA 4JBIA 1R16A 4NJOA 5ENDA 2P91A 4RLHA 4TZTA 4CLDA 3WNVA 1D1SA 3AU8A 1B16A 2PWZA 3Q11A 4BNZA 4F45A 3ONEA 1NQ5A 4J91A 2WSBA 1NWCA 3ZDFA 4CODB 2J8ZA 1ZNQO 3RUIA 1Q2XA 3FHLA 1P9LA 3ANMA 2G17A 3MOIA 5EN4A 3JD0A 2RBEA 2UDPA 2BGMA 2B4QA 1T26A 3FNHA 3U9LA 1ISMA 1IY8A 2DFVA 3NYWA 4PLZA 1A7AA 1MXFA 1ZSYA 3GAFA 3PFFA 3R3JA 4WLFA 4XQCA 4CUJA 4AJ2A 2WJPA 1I3LA 5K9ZA 4MVJE 1QORA 2QX7A 3LLVA 3NT2A 1N1GA 1ML3A 4U0JA 2NU8A 4Y6PA 2PY6A 3TZQA 4HV4A 4GH5A 3ETDA 5A9RA 2VRCD 4L4RA 2B5WA 2FP4A 3OIFA 4D44A 1GUZA 2NV6A 4J49A 1UUFA 3AY7A 3E8XA 2CDAA 2EP7A 4J3FA 3HN2A 3TDKA 2F00A 2OZPA 4W82A 2EJVA 3NTQA 1YQGA 1AN9A 1LDMA 3QY9A 3LQFA 1CDOA 2C7GA 4G65A 4PN3A 5COQA 3T4XA 1KY5A 3PZRA 1NWHA 3QVWA 3MEQA 1BVRA 2J3HA 4I5DA 4AJNA 1ZZEA 3MJ4A 4JX8A 3DHEA 3TL3A 4B3IA 5HA5A 1YO6A 3ASUA 2AQIA 3NTRA 1V3VA 4ALKA 1UP4A 5A9SA 4J7CA 4Z0PA 4IS3A 3KZVA 4L9RA 1YVEI 5AXAA 2D59A 1J4AA 4IDAA 1HDOA
chains in the Genus database with same CATH superfamily
1MX1A 2XWQA 3WU2H 1Y48E 1ZXLA 1SHJA 3HRIA 2EQBA 5KDDA 4YJ3A 2GUWA 3AM3A 4KYUA 3HDHA 3H1HJ 1VBFA 3UCEA 3JXEA 3PWTA 1V8FA 4J4HA 4QWMA 3FUUA 3RJZA 4YRBA 1O97C 1XRQA 1W0JA 2CXTA 4MUNA 1NVAA 1G41A 1X15A 2NTVA 3D7RA 5BMOA 1E9FA 2X15A 4XOIA 1JEEA 1KMIY 1NLFA 2CUNA 4RHEA 1IVSA 5K8CA 1DC6A 1JVBA 2OCKA 3SU8A 4IQGA 4CEHA 5I7UA 4YRQA 1PZXA 2WVAA 3OO0A 5DLQC 1JTHA 5HKLA 1QRRA 1SC3A 1WDWB 5L3ZA 3I23A 2WW8A 2ZYDA 4HGNA 3KXDA 5KYVA 5HBRA 3EODA 5CCGC 4RSMA 4TPKA 5CNJA 3FCSB 4IDGA 1D6NA 1JT2A 2CXUA 3CE6A 3H1IJ 3VYSB 1ABFA 1CY1A 3LT1A 2P3LA 2P5YA 2VT3A 5EJGA 1P45A 3GF4A 3PXGA 4PLHA 2VPTA 5AMXA 3TPCA 1QIGA 4R16A 2Q45A 3ZEIA 1BDDA 2OLEA 4FYYA 3RHTA 4PCUA 1X0TA 4C7KA 1QLJA 2ZSAA 4YWJA 3JQAA 3VR6A 3LSYA 3RF7A 3AB8A 1C1DA 1EM8B 3PTAA 3L73J 3O03A 3HD7D 2GA9A 2CMGA 1N3BA 4OI1A 4CF7A 4QM7A 2JFZA 4EPWA 1FFCA 4RY9A 4QGBA 3HDTA 5A4AA 1NQOA 1E9CA 3UJDA 2J7PA 4XEHA 4XDZA 3ICOA 3SWYA 4C05A 5CB0A 2WAYA 2YYZA 4MTLA 4P4SA 3REGA 4PICA 4BTEA 1SQQE 1ZVMA 4EHAA 4L72A 2GYVA 4HJRA 3CLSC 1KKMA 3A1DA 3VSCA 3NWJA 4YRJA 1ZGBA 5KLVJ 1Y3CE 5KJ7D 1K6MA 4ZP1A 1P1BA 5BRAA 1B26A 1WY5A 1SBQA 2GT1A 4ZPJA 4ZYZA 4WKPA 4OSOA 4NFSA 3T7CA 2FR1A 3G49A 5B4TA 2RIPA 5JAMA 2V3CC 3DXZA 1J39A 2HXSA 2X8JB 3S5UA 1GQRA 3V7YA 2Y9ZA 5B57C 1LI7A 1AQTA 2OL4A 1FSFA 4ONEA 1KYYA 2PRKA 4K5QA 5KQLA 2OTLP 3N7NA 2C9YA 5EHIA 2DWCA 4PX5A 4MR9B 3IT2A 2OKGA 2C59A 3A9CA 4FOTA 5HEKA 3QXGA 3UC5A 3OJ0A 1K9MQ 4F6RB 1UIMA 2Y8EA 1K04A 4TQAA 3BTOA 1KQFB 4RC9A 5L4SA 2BEWB 2QUIA 3R23A 4E11A 2XZRA 1RP7A 2JGJA 2I8LA 3BMNB 2Z2YA 3SC2B 2G63A 1N9GA 3MPOA 4I55B 4YWHA 2W58A 4WADA 2I1VB 5JNUA 3T9DA 2M3BA 2C9OA 3U0VA 5B30A 4F6RA 3UJPA 3JQGB 1ESNA 1GPMA 3B1KA 1NQUA 4XWYA 1YR8A 1TIPA 2AXEA 3W1VA 3LKBA 4OAOA 1SBZA 1YKFA 1YIAA 2R65A 4O2LA 1KNQA 1PQUA 1XD8A 3GEGA 4Z86A 3UT5A 3VMYA 1GCOA 3WK6A 2X0NA 2QL6A 2H3HA 1RFGE 3HA3A 3E1RA 4G5HA 3TW8B 4ZICA 5G3ZA 5E2IA 2OCBA 1OROA 1J0CA 1KZYC 1LP1B 4RE6A 2IPLA 4YLYA 5BOSB 2Q4DA 5TX7A 2R25B 1I8TA 1THZA 1K5DA 4LXIA 3SD7A 3BXGA 3AFOA 1GUDA 4ZYVA 1YTZI 3EVGA 1TT7A 3MUDA 1WA5A 2DP4E 4HR7A 5DN6A 4B0OA 3DJYA 4R6XA 1SFCD 4LGCA 4C2BA 1WV1A 5LYJA 2ZIUB 2IX9A 3W7VA 5AXDA 2CFCA 1QU2A 4EF6A 5J2TF 3BDVA 2BMDA 2LTAA 2R7MA 2O7VA 3OURA 3DEJA 3MAGA 5K2OA 2YMKA 3PC2A 5CIQA 5SY9A 3JCZA 1FLDA 3BRWD 5ALTA 1P91A 1W4LA 1UJNA 3WZLA 3PWSA 1LEHA 2FN8A 4ZJYA 1UP6A 3CB2A 3LKDA 4ND2A 3RS8A 4HC4A 3ZGVA 2AQHA 2PSDA 3CXRA 1F0KA 1XAHA 2JGDA 4AZVA 2D7JA 1FZGA 1DQRA 1FU7A 1UJCA 3A25A 4PPNA 1DRWA 1JHXA 1SZPA 3TLCA 2V7QA 4J0KA 2JLSA 4HY3A 4YACA 1QQ7A 2C2OA 1NYTA 1M76A 1XRRA 2RH4A 3C1TA 4TSKA 2ZRKA 3TW8A 2HFED 3A27A 2MINB 4FU0A 3GK3A 5EHQA 1SC9A 3L18A 3OLCX 1AZWA 2JLAA 3UT0A 1MC8A 1EUDB 1TT5A 1GPUA 4A8JB 3IALA 3BWYA 5KLIB 5KQPA 3R09A 1P17A 3EJWA 4P2BA 4ZARA 2PQ2A 5CB6A 4EI8A 2Z4EA 1DKLA 2RG1A 5JSZB 3OC6A 2QP3A 4D4MA 2GVDC 2KK7A 1W5SA 4HGZA 2CMDA 2XNCA 2PUCA 3S99A 2A0YA 2R6AA 1RC0A 2EBWA 3AEQA 4UEJA 5TSDA 2FEPA 3F5SA 1J23A 2HMYB 3LC1O 2E18A 4UOZA 2H17A 3I61A 1A9RA 1PIXA 3PTLA 4QVKA 1OVRA 3NG1A 3LIPA 4TTSA 1CQZA 4XWGA 2AN4A 1YDFA 4HAIA 3KTAA 5AVVA 3VA7A 1A02F 2YS6A 3KOWA 1ARZA 1PDVA 1QP0A 2ZCUA 3WVNA 4FFRA 3CNOA 2FOXA 2VDJA 1GCIA 3GLHE 1DRKA 1S2GA 3BH7A 3OE4A 4HADA 4OGFA 1IHPA 2FYUD 2X8BA 3L74D 1GCUA 2GD0A 4D9MA 3OZRA 4NZMA 4TZKA 4PC6A 3EGIA 2EG5A 3LQRA 1JKJA 1U2PA 3B4SA 1SQ0A 1VQOP 2P9YA 2WPDA 4EA8A 4QZVA 2Z3ZA 3L0OA 4WKNA 4CJXA 2OOKA 4CIYA 2HFJA 4J3NA 4EELA 4B35A 5IH7A 1NVEA 1DCMA 1T29A 1PFQA 1F6WA 2F2TA 5APVA 4HXEB 3DXFA 2XUOA 5CU7A 3UHFA 3ZJVA 1QBKC 1N2ZA 3RW9A 5DCWA 5I7AA 4B0PA 4A15A 3NWEA 1RDFA 3CG4A 3H1JE 1OX5A 2FUKA 1UEIA 2CCKA 1FZFA 1KETA 3IKVA 3QU5A 4LYHA 3SDZA 4XVUA 5G53C 4AN0A 3DDSA 3CEJA 4NCXA 1R88A 4CMEC 3SQWA 1FPMA 1O95D 5EXSA 3H2ZA 2XTMA 2VC2B 3FHOA 1M1KQ 3DKKA 1U0LA 2GM3A 2XBLA 3W5HA 2IZ7A 1XUOA 4CLRB 1LSOA 5GIPE 4JLUA 2XUIA 4HFNA 4H77A 4YCSA 3F5DA 1DBWA 2CHEA 3MINA 5FPPA 3LNCA 1IDOA 3LX5A 4XD7A 4IOIH 4EI2A 1DDIA 2NYVA 1SXGA 3NCHA 4RY2A 1TCBA 2IP2A 4U4AA 5TT1A 1PNOA 3MOGA 1ISSA 3FRJA 1J0BA 2WEKA 5CA1A 2R5BA 1OILA 3FTQA 4FHFA 2X7XA 1I4WA 3GAMA 1XX6A 3ZE7A 4A6PA 1FXSA 5BV1A 2BSQA 4GLOA 2C3OA 3LQKA 5JSQA 4EARA 4GLFA 3CNHA 2YZGA 2RH0A 5B3JC 5EE9A 3MFYA 1TCCA 1R4MB 1X7XA 1BTOA 1ZM7A 4QFDA 4YGYA 3ZWNA 5BWCA 1NA5A 5AVSB 3ED1A 1PV2A 1T25A 3CN9A 3NFQA 3GGSA 4LK3A 2JF0A 4QTUB 4KV9A 4Y6OA 3ZEAA 3AHFA 4GBMA 3JQCA 5AYVA 4KL8S 4ZDWA 5IC4A 1ECCA 2IBZI 1AZSC 4ZEWA 4EJFA 2QM8A 1HDXA 1C3VA 1UXGA 2TSYB 4W8HA 4R2MA 4LJYA 3QKRA 1DV2A 1U6JA 2C97A 1JHYA 3X43A 1L4LA 2JVJA 1XMXA 3IQFA 3RVSA 3G02A 2JB9A 3FUXA 3JQ8A 4FEAA 2VT6A 3QVUA 1SQPJ 4LXUA 1U7DA 5CLQA 3E7FA 5CEFA 4LF8B 1HZZC 3RK3D 5CITA 2GZ1A 1TC2A 1XDGA 4FC6A 4KOEC 1KB9I 3AM4A 3L7LA 4WD3A 5I9MA 2JI8A 1BIFA 4NMMA 1J5XA 4LTNA 4M0EA 4XJXA 2GPJA 3HPQA 1LDBA 1TF7A 1KH1A 3PHBE 4DMMA 2CMFA 2Q8QA 1M7LA 1Z74A 4PD4I 3EFEA 3N6RA 4JNKA 4UXIA 4BJ6A 4DL9A 2VTBA 4PHCA 1CZLA 2IODA 2FXVA 3IKTA 3TTXA 1OIPA 1KYWA 4UQPA 1WULS 2YJ4A 2JIZA 2QLFA 5H70A 3IP1A 2OV4A 1GFZA 1ZJ5A 1C9KA 1LTKA 1R6UA 1J1ZA 3I72A 4HX2A 1PP9D 1UJ4A 2Z2ZA 5JSYA 3A70A 1M33A 3TLKA 4E30A 4PX9A 3VOBA 5AUPB 3SJCA 1SHTX 3G17A 1EC5A 4QGSA 4TMZA 2GM4A 1Z5PA 3A58B 4KH0A 5HM6A 5JJBA 1PDWA 2NSJA 5BSMA 5ALZA 5TB5A 3WO0A 4WW0A 2DFLA 1DFHA 4JP5A 2WVRA 4EUNA 1UXHA 2YIUB 2G7MC 3CURA 2Q8PA 4QARA 4XFKA 2VUIB 1E63A 2ZT9B 3QWOC 1O94A 2EATA 4HWPA 4DCJA 3E0XA 1Q0LA 4Z0HO 2NX2A 3P8CD 3DC2A 5FORA 2V7WA 1PJCA 2RAVA 2VNJA 4F85A 1LK0A 1L8XA 2RGNA 3E27A 3NUQA 5JAZA 4BY9E 4WN9A 4QREA 2VJAA 4D7AA 5B2EA 3A06A 2HJRA 5EOVA 2X76A 3K05A 3CLSD 2B1GA 2DJIA 3VHXA 4DT1B 3FYUB 1NJIQ 5JI2E 1GEGA 5GMOA 3DTTA 3CU5A 4S1NA 4YREA 3UWDA 1RHRA 3HUEA 3N86A 3DWGA 1QFYA 3MSXA 2ZXXA 5CYOA 5IARA 3VR6H 2ZIAA 3QM1A 3GNSA 4BU0A 1YIDA 4YJHB 4CL3A 5IKEA 4LGVA 2X8LA 1QIJA 1U02A 3LFTA 3UF0A 1YS7A 4GXRA 2E43A 1DJNA 2N3ZA 1SUDA 2NG1A 2Q5CA 1MQ9A 3TEJA 1PR1A 4QPCA 2P2SA 5H1YA 3VGPA 3AJAA 4FONA 5IJ9B 3RRBA 3EZFA 3PXBA 4XIJA 2PZBA 3TINA 4Z53A 5SZKB 4TWBA 1OYYA 5BR7A 1AK2A 1GNSA 1MX9A 4EG0A 3U09A 3RSZA 2V54A 1NU1E 1GPLA 2ENUA 4JI1B 2YVKA 1FFWA 1JV2B 2ONJA 4L4UA 3TS1A 3KQNA 2OBNA 5BWOA 2YH2A 1QVGO 4NQZA 3OCZA 2XUFA 4GX2A 5HOQA 4OEHA 3H1JG 2N46A 3PD0A 1G38A 4A2PA 2QA4P 4AJOA 1KJIA 5F3DA 3PNOA 2QMYA 2ZIVB 5HF5A 3KQUA 3AY3A 1W59A 1VCMA 4M54A 5EINA 4L5CA 2IY8A 4CIDA 2AUMA 2ZT5A 2O8NA 5J59A 4EJ2A 2IK8A 2X4IA 3KQHA 4EOTA 1YE3A 4LX8A 4RPHA 3JZAA 4AWBA 5KO2A 4GF5A 4YRDA 2Y2VA 3L9WA 1XQXA 1CJMA 2QDXA 2W98A 2HSJA 2WSMA 2BLNA 2HF9A 4PC1A 1EWKA 1CY7A 5A6VA 4CV1A 1LQ2A 3MM4A 5H0IA 1XTUA 3HJNA 2OY0A 2AOVA 2GAAA 5ARCA 1FVHA 1SCAA 2FX5A 4O8ZA 4PX2A 3FOBA 3T35A 3KPEA 2XHEA 1J42A 1NTKJ 4DT0A 1I5EA 3HD7A 3LQQA 2P62A 4TKZA 2WSEH 5CVUA 3NTNA 3V2RA 5AJTA 4K9SA 1N73A 4G97A 4WZBB 4QHSA 3KS9A 4WTOA 5H68A 1QHEA 4RMGA 3SWKA 1XRMA 2YO3A 1HYGA 1Z4JA 3FDFA 5E6SA 3A0UA 2AEEA 1DXHA 2HLHA 2ZAOA 2FDCA 5BMVB 1KQLA 3OHMA 1CJUC 3M8KA 4F97A 1RLTA 2C4VA 2BKVA 2OHGA 3AG5A 3X1MA 1FLAA 3RBVA 3IVGA 3IT3A 3NFRA 3QUCA 3GB9A 3UWSA 4W8GA 3IQIX 1LX7A 1Q0QA 1N5DA 4TLEA 3VC3A 3PGKA 2QN1A 5F51A 1YQWA 1Y5MA 2YHBA 4Y9TA 4AY2A 3HJBA 1MGOA 4LIPD 3WUUA 1IRIA 2OFPA 1BGYJ 1BW9B 2WF5A 5DM4A 3U3ZA 1PHPA 3HXQA 3LVFO 4H3HB 2C4TA 1NVXQ 3EWIA 3F1KA 1YXMA 4WGGA 5LA6B 2QLTA 2CHGA 4DZTA 1VF5D 3KQLA 1KORA 2XB2A 5SY4A 4DANA 2BE9A 4HWSA 1N6KA 3FSGA 4JLOA 2YKQA 3GROA 4DKXA 1G59A 1A4XA 1JMBA 1PLLA 2DAPA 1GGHA 4IJQA 4NCNA 3V5NA 3R44A 1OH5A 4DR7B 5DWDA 4BFLA 1GTSA 1CNMA 2C9NY 5JY6A 2WAAA 1YZTA 4RUKA 4E2ZA 1S01A 1YVDA 1V96A 4P3KA 4F7WA 4MICA 1EAMA 5FPTA 1UPXA 3GV0A 1EMDA 2C2WA 1DPFA 1M72A 1M1JB 2HC9A 4B6OA 1G2CB 2FXIA 5FBWB 4TL8A 1ZJZA 2PUWA 3DS8A 5CT5A 2AD1A 3UFXA 3CUVA 1PL0A 1EFHA 1VPWA 3O4RA 3FKSD 3L4FA 1QIMA 1W96A 2X0FA 4BB9A 3ONDA 4MW6A 5F21A 1FP1D 1DKUA 3D5TA 4NECA 2CCJA 1Q77A 1WETA 1OTHA 4TM8A 1X13A 2YN0A 4UHFA 5E1BA 3H19A 5BW6B 1E1DA 3W2TA 1ZKMA 2YQ4A 3M1IA 2GZ2A 1ZHFA 3ZWXA 1U04A 1UDBA 2VXYA 3A4MA 1YR1A 3T7JA 4BKMA 3SJZA 2P41A 2HWWA 4MGHA 2H4YA 3S2EA 4R2HA 4F5ZA 2FSVC 5HZGA 2XKJE 5IC6A 5AUOB 1F0NA 3GGJA 1CRWG 1G66A 5I6DA 1J8YF 2GVNA 2X0DA 1QZ3A 2B98A 3TIXB 2IKSA 3TZLA 3ACDA 4QJBA 3F2VA 2WPSA 1N1MA 5E9AA 1FYWA 2FRDA 1LBQA 2HNAA 5ICMA 3JQDA 2DPXA 1V9CA 2FQWA 1TW3A 2BM8A 1MO2A 3KKMA 1YJQA 1KFMA 1JA0A 1N5RA 2VPZA 1RY3A 1ZCBA 4K3UA 2IYSA 1U2DC 3QYAA 2Z9DA 5BV2P 4JLVA 4AIRA 2I6XA 4F3RA 4BJHB 1AY0A 2Z1DA 5SZIA 2IHBA 3TOVA 2IKQA 3ZWMA 3B9PA 3DUFA 2XZLA 2GEJA 1DEEG 1FP2A 4FWBA 4PCLA 2HIAA 1NUHA 5FI5A 2DUWA 1I6KA 3FHJA 2D3TA 3SNKA 3EGDA 1Q83A 1T4MA 4UBIA 3IE1A 4OB7A 1EIZA 1N73B 2QRGA 4Q0MA 3I45A 2RGBA 4PPYA 4RZ2A 4TV9F 4D4KA 2QE7H 1EWQA 1BFDA 3QUTA 1Z56C 3HD7B 1QKIA 1UBKS 3IHTA 4EL0A 2RHHA 1GYQA 3GEIA 3NOVA 1E8MA 2P1ZA 2IDJA 4ND5A 4P3OA 3HCDA 1A5TA 1P8JA 2WYOA 2XZDA 4K2AA 1KTVA 3Q1LA 2MSNA 3HHPA 4LJ7A 4Q9HA 4ZC8A 4R9SA 1QCCA 4KRXA 3CI9A 1NIPA 2FZWA 3MA0A 1LPAB 2JEYA 2X6TA 2XRYA 4F3KA 3U60B 1BD3A 1SPXA 3AZPA 4BE4A 4BZWA 1K3FA 5KINB 3N7UA 3O5AA 1EGAA 4WY8A 2I3DA 2OTJP 4UBMA 2GD1O 1YBAA 2OP1A 3WSVA 4E4RA 4JL5A 4CTJA 1CZUA 1IAQA 1LBIA 1XTIA 3P0HA 4O2BB 1F9EA 2BFEB 1WX1A 1NW8A 5DPMA 5MF6A 1KYTA 5MHTA 4GP6A 4J16A 4WZAB 5KNDD 3QVMA 4J76A 2GHRA 3OKCA 1FP4A 1EVYA 3Q85A 4JKOA 1EUCB 3L4BC 4Q93A 4BMSA 3FZYA 4EB6B 2HAEA 2E55A 3ILHA 4MOWA 4LGDE 3RRNA 1R5BA 2ZI3A 2TMGA 3R7DA 3ZTTA 1T6NA 3BHIA 5JCJD 3OAAA 2OHOA 1Z2OX 2NPIA 2AHOA 1G9XA 1SVUA 2JCGA 2PL1A 2MSLA 3CINA 1FBMA 3LRTA 3M6MD 3QVGB 4V2IA 5JZMA 4B4DA 4H6WA 3C7AA 2JL1A 1XHLA 4I1RA 1Q86Q 2WM8A 3NRBA 5F77A 5IH3A 3RD5A 1ODIA 1MB4A 1HTWA 1OXTA 1DHTA 2HJSA 4NICA 3M3DA 4C7MA 1SS1A 1NJ8A 4EWLA 4ZMDA 1BVUA 1Y3IA 3PEFA 1FMJA 5DOZA 1JYFA 4K9KA 4UOQA 5FLXA 1JALA 1EU1A 4Q7JB 1E32A 4BJ5A 2R97A 4DSUA 2IH4A 1ZC3A 3WBKA 4JUDX 1TMOA 2OCPA 4PSUA 5JSZA 4MPTA 2WHPA 3BQMB 3L7JA 4YIHA 4LJ5A 2IHKA 2NU9B 3R6WA 2CJWA 1DJPA 1WU7A 4LN1A 2FN4A 4L73A 2OFXA 1CZNA 1R0LA 2XUDA 2EKPA 4PFKA 1OHHD 4PG7A 1NX6A 4DA7A 3A9VA 1K89A 2KX7A 2PX8A 5E1MA 4DCKA 1BWQA 5GTHH 1IEXA 2AHRA 4HB0A 1XD2B 1BWSA 1R0SA 2Z0MA 2Y3IA 1KZHA 3BZWA 1KMHB 2I1JA 4WFKA 1PP9J 4Z4QA 4PLVA 4Y2JA 1T91A 3GLMA 3ILSA 3S70A 4E15A 3HLYA 3FTEA 3IF4A 5ECDA 3FJ1A 3TNFA 3KLNA 3DNMA 2CUTA 1B0UA 3GEMA 4HZGA 5T5QA 1Q7CA 1S9HA 4YUZA 2OMKA 3PNKA 1LKZA 2VP0A 4L75A 3VVBA 4CT4B 1D2GA 2PZJA 3Q7QA 4H2DA 3QVJA 5CCEA 2P2DA 4H3VA 3U59A 3V42A 5I4BA 3FYDA 3I53A 2OTKE 2EZ8A 3D6MA 4LW8A 1M1YB 4MWOA 4DA9A 3BN3A 4F4CA 2B3DA 4URXR 2JP3A 5DASA 3ITDA 3RR2A 1T5SA 1Q3HA 4M1QA 5CCHD 1T2UA 2ACWA 1UMCA 2O8VA 3EC2A 4PZYA 4M1ZA 4Q1DA 2E6KA 2JJYA 3Q3DA 1MEEA 4GM4A 4RD1A 1VLZA 1TJYA 4EEZA 2LIVA 1VDFA 1YJWP 4EUHA 2Q46A 3AEBC 2O07A 3F98A 4LRUA 4CKBB 2G36A 1TFRA 4W80A 2A9JA 2VDMB 3UT6A 4KPUB 1VC2A 1L5KA 3WL6A 4B83A 4DS3A 1XTZA 4MHOA 3DVAB 4R8MA 2QQFA 3BWCA 2K7ZA 2FQQA 3JQBA 4JDUA 1LA2A 4YRKA 3JD1A 5AFSA 1ZQ1A 3NO4A 3QEOA 1T4BA 4C78A 1G16A 1YGPA 2Z2KA 2DCMA 5CCHC 4IF4A 4MR8A 3N4XA 3BMXA 4B09A 5BVGB 4ARZB 2AVNA 2CDCA 2HCRA 2RB4A 3BG5A 1QVZA 3ESCA 3UGJA 1MA3A 3UUFA 4A6DA 4F91B 2WG0A 2B21A 5CDGA 1DIPA 2HRDA 1QH0A 3BATA 3KT8A 1WVGA 1ISFA 3C3KA 1H65A 1NN5A 4GXNA 1KB9E 4LXYA 4XGNA 4O02B 2J9XB 4YAWA 1R10A 4K6MA 4KNVA 1JPJA 3CF2A 3EB9A 3HCPA 5T57A 2O7RA 3P7MA 3PZBA 3RK2C 3HXPA 3KZIE 4MR9A 3HK2A 1GQSA 2FYTA 4B8ZA 3U7QA 1KK0A 3ZHZA 4ZEMA 3HGQA 3R5HA 5B12A 3ZDAA 1Z17A 3RU9A 4LF5B 1FIUA 4JHXA 5EJ9A 1PBTA 1R6TA 5FLKA 3S0JA 4MGKR 1BGXT 2QTVA 3AF0A 1NBMA 3GH3A 5FOTA 3WLOA 4Y1FA 3OQPA 2O7SA 4EHBA 5IKMA 1NTZJ 3K4HA 4OBBA 1QANA 2EHJA 4J0FA 4H1HA 2RGEA 1NPYA 3IFMA 2VK4A 3BXHA 4C4AA 4RJTA 1J09A 4WWHA 2X6RA 3MAJA 1EK5A 2EQAA 1P0IA 5F9MA 4EEXA 1VJDA 1PJQA 4I7ZB 1S2OA 2VPQA 4IXTA 2K5UA 1L5ZA 4U5QA 4UU1A 1L4MA 3VH4A 2IHZA 4LDZA 3RRJA 3N5KA 5D01A 2O5EA 4B6GA 3TLJA 1LTIC 4DJGA 3L93A 1KR2A 3DDZX 1S7CA 5D51S 5KJ6A 3HRNA 2YVUA 3H0EA 1ZMBA 1VCIA 1SKQA 3FYTA 2H5LA 4BTLA 3FOCA 2A92A 1UKBA 4YH1A 2GO7A 3OM8A 5J9FA 1EGVB 4A16A 2O1EA 4EGQA 4I7ZC 3PNQA 1JJIA 1UM9B 1S72P 1XAJA 2UZAA 2GN0A 2DYKA 1VZ3A 1SQVG 2Z2JA 3QFRA 3DE5X 3O8OA 5BNWA 5JJ5A 1PL7A 4HWGA 3UWOA 1RH5B 5IBQA 3GR6A 5DX1A 5TXGA 1P4GA 1T8WA 2EKBA 5FUYA 1ECLA 4W5JA 1L7QA 4GRDA 1RQVA 2FYUG 1E7SA 2CFSA 3CUEF 4X20B 3VR4H 1R3UA 1YA4A 4IDAA 3M0DA 3H1JD 2FG6C 1YE5A 2Q41A 2RGYA 3F3MA 3FZQA 3H5VA 4QDTA 3RS0A 4EY4A 1DWPA 4NZPA 2NVUB 3ZY5A 2D8AA 4I6JA 3AUXA 5CHEA 5AM4A 3W05A 4YMGA 3ZDXB 5CCGD 2P9EA 2O8FB 4X3OA 1XWIA 3PNYA 5HGXA 4KGVA 4M0KA 4CQJA 1P2TA 1Y37A 2EERA 1Q5PA 2F4NA 1M6VB 4MGEA 3UGKA 5BP7A 4CU2A 1S96A 2XDAA 3V8EA 5B1IA 1YF3A 1YMVA 2E5TA 2CY0A 3EDQA 2H2GA 1GR1A 2I76A 1WEKA 2X8WA 4WINA 3AIKA 1RYEA 5EP4A 3SLGA 2PKQP 2I3BA 3A3NA 2DERA 3KOOA 3O94A 1BE3G 1MLDA 1GZLA 1CZKA 2D0IA 1HF3A 3DDUA 3KDAA 4MS4A 3CXUA 5C53B 2VOEA 4GWKA 1HFEL 4DA6A 2KXPB 3QVGA 3AUJB 3TLZA 4MB6A 1PE0A 1DJOA 4GODA 2JFNA 1DT5A 4ECEA 3DT6A 3BCHA 2VDNB 3H9QA 1EXVA 2HV8A 1Y3HA 3SHOA 1JHVA 3ZQ6A 2JJ2A 1CI6A 2J59M 1SUCA 2OBYA 3EG5A 3E48A 1JGTA 3H11A 2XT6A 4P8RA 2Z30A 2D2VA 4YXWA 2BP7B 4ZCPA 4NE2A 1RRVA 4G07A 1XZMA 1OW3B 4XDYA 4JXZA 5ITWA 3PCRB 1MABB 5DBIA 4P4SB 2ZJ3A 3GMDA 4C6HA 3WISA 5JMTA 1YB7A 3OQMA 5E6RA 1IHUA 3ONWA 4K9QA 4Z7QB 4R9RA 2XXAB 2OCGA 3R4VA 3SJAA 3ZZNA 1RU3A 4G5YA 4BFXA 2C2BA 2BDTA 1KGSA 2ZRIA 3B2EA 4HQNA 1SC6A 3HU2A 1FA9A 2YJTD 3W79A 4L85A 1ZR2A 1HQDA 3PQ2A 3SYKA 2IW3A 1YK0A 4YR9A 5IF3A 1NP7A 4IX1A 2R6CA 4Q21A 3MRVA 3VHRA 1Z2CA 3BCSA 4OK3A 5CM2Z 2Q8NA 1DXYA 2RHCA 5CB8A 3BRSA 3D3QA 3RCBA 2O0HA 1V3TA 4RA6A 3DH0A 4FCCA 3PYLA 1UWVA 3USSA 4NX2A 4TLLB 4CM9D 1PRYA 2AG1A 4F7DA 1U63A 4F71A 2GTPA 3VTPC 2AK2A 4ZDIA 3COSA 3K0SA 2HADA 5KSPA 2Y0DA 4M2LA 3RAGA 3U3JA 1RS0A 1XALA 3MTBA 1SCIA 2XTJA 1TQDA 2I87A 1W5AA 4KI7A 3MMSA 1SB9A 1UXKA 2DQSA 2V6MA 2XYGA 3JR7A 2YXPX 1GDTA 2O2HA 3ZDYB 3LW8A 3E1SA 3O38A 1NVDA 1KPIA 2IPPA 1OAOC 1WPRA 2HMSA 3PNLA 3B85A 5B3LA 2FPRA 1M34E 4DUYB 4FJ0A 3F4KA 1ZNXA 3GRAA 4EX7A 3BTSA 3VR2A 3WYBA 3AMVA 1WD7A 1QP8A 1DTWB 1OX4B 2R751 2Y1OA 2YR0A 1KSJA 3GDGA 1S4QA 2NV2B 3C16C 2Z43A 3EOBI 4JC8A 2Q3MA 5BV0A 2F6RA 3MGBA 4HWOA 3RK2B 4AX8A 1RJDA 5CW2A 5IS2A 3FAKA 3A4IA 3OAKA 3ZE8A 4IIEA 3CX5H 3VX4A 1Z13A 3HN6A 5JV5A 2PL3A 1TAUA 1DP4A 3EK2A 3IEPA 1M3SA 2YX1A 2SKDA 3GLSA 4L02A 1NURA 3REFA 3G9UA 5G2OA 5C46F 2DUMA 1BC5A 4NMXB 4UFNA 5I7WA 5DGTA 5FQNA 5KVQA 4NAVA 3PA8A 3V97A 1JHUA 5BR8B 3CWBJ 1MOPA 1DC7A 4C7VA 4LJ9A 4DVGA 4HWRA 3IIKA 3OP1A 4WZ6A 2IHVA 2DLDA 4WCVA 2A3RA 4RLFA 1SQBE 1VQNP 4XVQA 5LB2A 2B87B 2H9YA 1K0UA 1FS0E 3SMQA 1X8JA 3SNHA 4YV7A 3FBGA 2ARKA 3UUEA 3ZWPA 3RIYA 3RSHA 3RADC 3DOUA 1SBYA 2I8CA 2V58A 2IGBA 1LLUA 3JZDA 5CCGA 1L5WA 2H4JA 2HM7A 2PV7A 5J47A 5EMNA 3M9WA 3N53A 2HI0A 1T34A 3QFCA 1M2EA 3I4LA 2JAXA 4P9NA 6REQB 5JWHA 2CDBA 1K7YA 1MIOA 1ESCA 3E3NA 2ST1A 1UIIA 4HEA1 2GLTA 2HO4A 4ZGGA 5L4LA 5JJCA 3H5AA 3JW8A 3KUUA 1UKZA 2C2HA 1Z7BA 2EJWA 2CK3A 4M36A 4OMUA 2F8SA 2EKLA 2R84A 2YC4C 1JLKA 5COBA 3MRSA 4TSRA 1NMEA 3K6RA 1BHQ1 2BGLA 4IRUB 1G7CA 5K3FB 4D92A 5L45A 1P6XA 1M2VA 2WM3A 1V2HE 1JG6A 2BP7A 3LHIA 5HZMA 5TRTA 4TMVA 2O2ZA 2GXQA 3I73A 1VCOA 1HZJA 3E23A 3SYNA 5PNTA 4OH8B 1IWBB 5I8PA 5JAHA 3ZXYA 4ETIA 1L7AA 2RK6A 2VJOA 1FFEA 2Q6OA 2D4AA 3EUWA 1C14A 1PW7A 1MAVA 1NTZK 4AUKA 4YPVA 4BQOA 2G6BA 2BMEA 1E64A 3DCIA 5M5BA 4HH1A 2WWWA 1GV0A 2XNDH 1SRRA 3M3HA 5CFOA 5KLVK 5AW3A 1KOJA 1WUYA 4EW2A 4YEDA 1GGMA 2BZSA 4CPGA 2QIPA 2W6NA 3IUNA 4C1NA 4EL5A 2K87A 1PLKA 3A04A 2A3NA 1Y9ZA 2REBA 2WJ3A 4YAOA 1B1AA 5F73A 5J1SB 1YS9A 3F73A 1M6VA 2KP8A 1I1HA 4LUCA 4YMLA 1ZU5A 3IN6A 2VK1A 4HEHA 4QRHA 4B6PA 5I7FA 3IEVA 4JBGA 1XTPA 2HXYA 2O4UX 3LT4A 4ZANA 1KMMA 1UMBA 3DLAA 3IUMA 1SBNE 1ZUWA 2AMFA 1ZRTD 1T10A 1UKCA 3BZUA 3I4FA 4WT7A 3GCWA 4LYJA 2BM0A 3ITNA 1RM5A 2A9VA 2BHLA 4Y99C 1P5HA 4WLNA 5HS6A 5AW0A 5I51A 1S8FA 4W5OA 3BT7A 1J1UA 2MINA 3WYAA 3QH9A 3ZWAA 1XDDA 2BFBB 4RF4A 1KAHA 3AUYA 3OE5A 5BQFA 1QBGA 3NIDB 2Y66A 4P3NA 3EXG1 2PGAA 1L7BA 4L27A 4DQUA 2KNCA 4JB2A 5FNVF 1EDJA 1J24A 1D8TA 2GETA 3QW2A 4B81A 3TX6A 4RJLA 4BBZA 1NPDA 3GIDA 3RROA 2NZVG 3ZY3A 1P81A 3CR8A 4ZYTA 3B9RA 1R27A 1YJCA 2WA1A 2VF4X 4GKGA 5JS1A 1TM4E 4YPOA 5BN5A 3CUUA 3VPSA 1WHTB 4NH0A 1RI4A 3R2PA 3VZRA 2F1RA 1SQVK 2FNAA 3QPCA 5HMMA 3TB6A 4FD2A 1GU0A 5I9NA 4B3MB 3PQ6A 2ODWA 1KILA 1Q0RA 1XO1A 3CLQA 3QEMA 3CLTD 2FFDC 2O8BA 1DDOA 2ZUSA 1Q84A 4MKXA 1LNSA 1F4VA 1R64A 3UGQA 4AD8A 4YBZA 4LPSA 2I6FA 2P9QA 5K4HA 5KOYA 1KJYA 4YYZA 4D2IA 4BLUA 2F67A 1AX9A 3KB6A 4NCKA 2MOKA 3H1PA 3M34A 3EVBA 3FWHA 1O4VA 1L1FA 1IAVA 4GD3Q 1UWCA 4LY3A 5KX5A 1PT5A 2EX4A 3KE8A 3Q5PA 3WY9A 5A2GA 1L4AB 4MH0R 2YXDA 4ZT6A 4P0PB 3RIHA 3VRHA 1LUAA 1PG2A 5JH7A 4Q9DA 4O29A 4JUAA 1AA9A 1CFZA 2ZWVA 3F8SA 3CNNA 1Z45A 2I03A 3UA3A 4LWZA 3GZ4A 3GJ7A 3KBBA 4IGEA 1HC7A 4Y6SA 3UHAA 3GRFA 3PFWO 3DL7A 5BRNA 1KVUA 3N76A 1KEZA 4ENQA 1U57A 5JROA 2C58A 2C0CA 5BSEA 1UK9A 3CPHA 3GLHA 1BE1A 4P93A 2QMUA 3HHEA 4KQWA 4YAKA 1NXVA 1X1RA 2D0PB 4DQ0A 3TLXA 2PJRA 5B1YA 3T3DA 1QIKA 1NTMD 3JWJA 4IQ4A 4AL4A 4INOA 1ZBQA 1X1TA 2GYYA 3DP9A 3FXAA 3PUHA 4FIZA 4URUR 1DX9A 1OZGA 2AKYA 2ON6A 2QMQA 3ELDA 1XFDA 1JG1A 3MUFA 3UXEA 1RF1B 2XY4A 5GOTA 3IHLA 3PXAA 2I4TA 3FFBA 2EGUA 3HCWA 2WT9A 3P20A 1BE0A 2PM8A 1KJNA 1EDBA 3T5DA 4R0MA 4RCZA 3JWHA 1SU7A 3A1FA 1D0IA 5LQSA 4YP6A 1H9AA 8MHTA 2HD4A 1U1EA 4YB8A 1GAWA 2BM1A 1SZDA 3D6UA 5A04A 1JMVA 3TX2A 1BCCD 3FZEA 5HIIA 5TQVA 4RYLA 4DV7B 4MAFA 2R7LA 4X61A 5APQA 1UOOA 3LLMA 4BFTA 3KWJA 1IN6A 3BFPA 2W6JH 1XVVA 2A5DA 2QW8A 2RGXA 1C0LA 5JC8A 3KQPA 2ZPAA 4IDBA 1PKXA 1NF8A 1XTCC 3SR4A 3BKXA 2PX4A 1YNOA 2W2LA 3OE1A 4DMCA 3S3TA 2CDRA 1L4GA 2QD3A 2DW3A 4IRMA 5EFZA 3KUKA 1E9VA 1JHPA 2C5BA 3Q3IA 3T9AA 3R7AA 3SLKA 3DMGA 4LVOA 5JJLA 2DBRA 3ERCA 3JQAB 4RS3A 2C5AA 4FB5A 2C77A 4Z4CA 1JQBA 2FPUA 5B66E 4S1OA 3OJLA 1QFMA 4RNDB 4M6WB 4BATA 5APTA 3C3DA 4BGEA 2QEQA 3PUWA 4DZZA 3EFOB 4DDMA 3V55A 3P71T 3RVDA 2X7JA 4OREX 4B34A 1NI4B 4KWIA 4L7VA 5FI0B 3B6KA 4OOEA 4E33A 1KI9A 3DEIA 1CF9A 1E1YA 2IF2A 4DEXA 1ZSVA 3NBKA 4R2IA 1PD1A 4X1IA 3H2IA 1BEEA 3FYUC 4LMBA 4XVHA 3GLRA 4XYBA 1LI5A 4ZA2A 4CQMD 3E9RA 5JQGA 1YL5A 3JQ7A 3UG7A 1EBFA 1BCSA 3U49A 3U7IA 4M8SA 1F06A 3L0IB 4LXQA 1MV8A 3IQEA 2ISSD 4EF4A 3LIIA 4MQFB 1MDFA 1S02A 2VXCA 3HUDA 3PGMA 4YLEA 4N01A 5EPEA 1PR3A 2YJ3A 4UCQA 4BV3A 3WL3A 2DEUA 4JB8A 4UPDA 4ARVA 5ECGC 1X7ZA 3OTOB 3STHA 5AWFC 2CNNA 1ORVA 3LRXA 2NO1A 2XZPA 3W5VA 4A8PA 4HQ6A 4JT4A 5GONB 1GW4A 4GI5A 1QHNA 1GZDA 1U1IA 4QXAA 2ZI4A 5DWVA 1XK6A 3ADOA 3W5IA 5AHOA 3KYBA 5KTMA 1SD5A 1XQ6A 3BGSA 3A0BH 3L8GA 3PIIA 4W7HA 3ZZMA 1KB9H 4Y2HA 5JNWA 2W2LD 4KX5A 2OC4A 2WHYA 4IICA 1XMPA 4EUKA 3LY9A 4CLOB 4XCXA 1ONPA 1JR3D 2CKDA 1SQPK 2X5OA 3KZIH 5AHKA 2YYAA 2YZ7A 1TD1A 3KB2A 2YIDA 1RJWA 3ZV5A 1IHXA 3J7AC 5DRYA 1H9CA 2W8BB 5GWXA 1E61A 1PJBA 1F1BA 2PFGA 3J80A 1FSZA 2I3ZA 1JHOA 4GGOA 3EZYA 1Z6AA 4N9QA 1SXHA 4XQEA 3AQIA 3WB2A 2OECA 2VAWA 4QVGA 5CJ2A 5KCMA 4YJDA 1PX0A 3HQ4O 1GL2D 1UBUS 2WE7A 3CG0A 2PD6A 4M3LA 3EQ7A 1ZD8A 3HCEA 2QJFA 4CG2A 2RIRA 4ABYA 2NAPA 3WE7A 1K7EB 1NRJB 2C31A 4LSGA 1VSVA 1FX0B 4Q3BA 3GJ3A 1KP9A 5I3CA 3C3BA 4MRAA 2PMBA 1HTBA 5H9VA 2REQB 4FE4A 1R50A 3CWBD 4JJ8A 3RKUA 4AI6A 3DBVO 3JALA 1OTYA 2QJKB 1PWXA 1RVV1 4JASB 2XUPA 4TUYB 5DLPA 3AE1C 3R2JA 4FYKA 3RODA 4TYYA 3RYIB 3LZDA 1FW8A 3WLTA 3C7DB 1IYZA 1QLWA 4KXQA 4JLJA 1ZY2A 5AI8A 1GGJA 2X2FA 2ZBRA 2OPBA 4RTSA 3KKPA 1TZJA 3QTBA 4XH9B 1DH3A 3K0CA 1A8IA 2RE8A 2RC6A 2XMRA 3PI7A 4MVYA 1YH3A 5CT6A 1KD1Q 3IB6A 2XUGA 1R0XA 4YXFA 1GEEA 2GKSA 2GASA 3HKBA 2ZR7A 3EOAI 5ER9A 5FBQB 3KHTA 4IXDA