2ZYAA

Dimeric 6-phosphogluconate dehydrogenase complexed with 6-phosphogluconate
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
465
structure length
465
Chain Sequence
SKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDACAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes associated with cofactor/substrate binding of 6-phosphogluconate dehydrogenase from Escherichia coli and Klebsiella pneumoniae: Implications for enzyme mechanism
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords 6-phosphogluconate dehydrogenase, decarboxylating
total genus 176
structure length 465
sequence length 465
chains with identical sequence B
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2zyaA02
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 2zyaA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zyaA01
2BF7A 4RQUA 3VPHA 1GU7A 4TRJA 3BYZA 5KJEA 3FNFA 4IDGA 4YEDA 4JBGA 1IPFA 1VE9A 1I3MA 3UCEA 3JQFC 5CEEA 3BMOA 5AXDA 1P1IA 1VJTA 2WD7B 1I8TA 3TJRA 4D44A 1E7MA 5KVQA 4P4LA 3FWNA 1KEWA 1E3EA 4XJTA 2Q4EA 3B1KA 4NMHA 1PU2A 2NV6A 1MUUA 3TF5A 1WW8A 5IF3A 3RUIA 2X22A 3BIOA 3WSVA 5TC4A 3JQGA 5DP1A 5KKCA 5ITVA 1OX3A 1IB6A 1NP3A 1UXJA 3GK3A 3VZRA 1BG6A 4DC0A 4WGGA 3QWAA 1HKUA 2H6EA 4JP2A 1PS9A 1KEVA 5DCYA 4CQMB 1R0KA 2NUAA 3AI2A 3WR5A 3RC9A 4BQPA 4NHEA 2AHRA 4CL3A 3WXBA 1X15A 2FMUA 5JCJA 4NJOA 3VPXA 3AOGA 1GUZA 4PLCA 3CKYA 1GYRA 1HYEA 4Q3NA 3RC1A 3IUPA 1GUFA 3GZ4A 4WEOA 4KDFA 1R4MB 4WK6A 4OHUA 1XG5A 5KJCA 3DAFA 2HSDA 4UREA 2HLPA 4O6VA 2OGUA 1LXCA 1YWGO 3OQ1A 1WNTA 1HETA 2PZJA 2QZZA 3K2BA 4EYEA 3WIDA 3GEGA 3G17A 3MZ0A 3D0OA 3DHYA 1ZXLA 5JPIA 4YAGA 4BNKA 3PWZA 4PG7A 2O3JA 2C7VA 4UVDA 1ADFA 4E5MA 3DBRA 1E7QA 3GH3A 5AYVA 2VHXA 4AICA 4CMJA 3EDMA 4E5PA 3D5QA 4W4TA 5IZCC 1E0DA 3DL2A 3U09A 3HSKA 1O6ZA 3OBBA 1WZIA 1ISJA 2ZYAA 2D0IA 3I4CA 3BMOB 4LW8A 3AI3A 1HT0A 3ZZNA 4PRLA 1NWHA 2NVBA 3OETA 4CLOA 5DF1A 4J0FA 4J43A 4M86A 4QEDA 2TMDA 3ZV4A 4D7AA 4EUFA 5ILOA 2EGHA 1OAAA 3INRA 1RWBA 5JAIA 3KETA 4Q39A 5DBGA 3LT1A 4OAQA 3ENKA 3VKVA 2PA3A 4CMEA 4PG4A 3TRIA 1PJ4A 1B3BA 2C2YA 4OGWA 4GX2A 5JDCC 2BFMA 1OZAA 4DIOA 3TSCA 1A72A 3B70A 4FPXA 1RYEA 4TKLA 2VHWA 3KYCB 5ICMA 4WJZA 1HDYA 4CUZA 4BNFA 5A06A 2AW5A 2H5LA 4GL4A 1EVJA 4GVXA 3VH4A 1Z7BA 1EK5A 1KY5A 4DBZA 1IZ9A 1NAHA 4J4HA 2V6GA 3A14A 1HDZA 5JSFA 3S1LA 1Y8RA 4J2OA 1HE2A 4RJTA 1ZK3A 4PG6A 5KVSA 2BFAA 2IEDA 3JCZA 3Q9NA 4FQ8A 2B4QA 5CDTA 1A4IA 4GSKA 1P0CA 2QRLA 3E18A 1LQUA 2DLDA 5L4SA 5L7WA 4G5HA 3GFGA 4B79A 3ZWNA 3NKLA 1R4NB 4J9VA 1ZNQO 2A92A 3GGPA 1HSZA 3V8BA 3Q9UA 4OKIA 3R1IA 1HSOA 5A9SA 3GGGA 4BO4A 1NQ5A 1U4SA 3SBOA 3OH8A 4DIBA 5ES3A 3AUSA 2EV9A 2O2SA 4YJGA 4YT2A 2BELA 3CSDA 1JDJA 3EZYA 4OXYA 2V6BA 3F5QA 4LISA 3OIDA 3HN7A 1NAYA 2DKNA 1P74A 4RV9A 3WGZA 4BKQA 3CMCO 2YUTA 5DCWA 3I6QA 1WMBA 1MB4A 3I9KA 1BW9A 3HZZA 4M89A 1YBAA 4TQGA 1K5HA 3DQPA 3DDNA 3GMDA 3QV1A 1I30A 4P22A 1XQ6A 1B26A 3O26A 4E3ZA 1K6XA 1HWYA 2DTXA 3E9MA 3W4KA 4WE3A 3E6AA 1PJLA 4L0QA 2JFGA 2DTDA 1MGOA 1O9BA 1SPXA 1RM4A 2EP7A 3KZVA 4PRKA 4RVFA 5J23A 4LK3A 8LDHA 3ETEA 1Q7GA 2IXBA 1BTOA 3GVCA 4LRTB 5TX7A 3N7UA 4XWYA 3ZW8A 3O8QA 1HE4A 3K9QO 3QWBA 1G1AA 3LF1A 3MJCA 1VJ1A 5L4NA 3UUWA 5JW6A 1F06A 1F17A 3CINA 3HHPA 3L9WA 5JAZA 3ENNA 2AEFA 2P9GA 3L07A 3LVFO 4YAEA 4XRGA 3ZU4A 4UULA 4DWVA 4FFNA 1XYGA 1TT5A 3RVDA 4BGEA 6LDHA 3E5RA 3AOEA 3QWIA 5BNIA 4E4YA 3LK7A 1YQGA 3FPLA 3PFWO 5CG2A 4GMFA 4W82A 1H94A 3OECA 2C54A 3JQAD 2Y99A 3WFJA 3PHJA 1VL8A 3K73O 2J6IA 3GMSA 1H0KA 2D5CA 5ILGA 3PJFA 1KERA 3DR3A 4BNJA 1DAPA 5JY1A 3P19A 2O4CA 4BO3A 4IXTA 1QYDA 4MVJH 1Y9EA 4R1NA 1PGJA 1NXQA 1U2GA 4AJIA 5G0UA 3SXPA 3W8EA 4XQEA 5LC1A 3LC7O 4A03A 3ZU2A 4DUPA 2PLAA 3I9NA 1I32A 2IYOA 1I0ZA 1NR1A 2R2GA 1MG5A 2NQTA 2WEKA 1YOVA 4Q3BA 4WLVA 5TJ9A 1LBEA 3LF2A 2EHDA 3PZBA 2I5PO 3JYNA 1A9YA 4E13A 9LDTA 2D8AA 1RM5A 3ZWPA 2J5KA 1H2BA 3DMTA 4E33A 3QSGA 4KUEA 2G76A 3KLPX 4L4SA 4RPGA 1EUDA 5EIOA 4CM8B 2DBRA 3LT4A 3U4IA 5T6BA 3I1JA 5KNLA 1I5RA 3PYXA 4RCVA 1DC3A 4DRYA 1DOHA 2O3UA 5KVCA 4CV3A 5EMHA 1JAXA 1NM5A 3DWFA 4DYVA 1BXGA 2O4UX 2AQIA 3U4HA 2O7SA 4W9NA 1KOLA 1T1RA 3P2YA 4Y9DA 4ZQFA 3DFZA 4ZJUA 5HWSA 4URFA 4AJJA 2GZ3A 3LSYA 2GCGA 1TT5B 5T8KA 4HY3A 2AXQA 2D59A 1EDZA 3V2HA 3BMQB 3EGOA 3EHEA 1I2BA 3WQRA 1UXKA 3ZV6A 2EKLA 3HDJA 3VH3A 4C4OA 4XKJA 3PRJA 1PGOA 1ZJYA 1Z6ZA 2GO1A 4G65A 5K6AA 2BH9A 4FN4A 4Q3AA 2X1HA 1EQUA 3WJAA 3GUYA 1H9BA 1A27A 3IAHA 2R00A 1AA0A 4CJXA 4I9HA 4OOEA 3KOUA 4LSMA 3H2SA 2RCYA 1IHYA 2PD3A 4KMSA 1T1SA 2X0IA 3PWKA 4M49A 3WQQA 4CLDA 3WWZA 3JD3A 4QO7A 3GVXA 4IIVA 1PZFA 2JFFA 3G0OA 4B4WA 2JCYA 4GSLA 3RBXA 3H6KA 1ZMOA 2Y66A 3WYCA 3HE3A 1SB8A 1LSJA 1Z45A 5AVOA 2WSBA 4A5OA 3A06A 2HK7A 1J49A 4GMGA 3SJ7A 1E3LA 4RDHA 1N9GA 4FFLA 3EUWA 1C3VA 3FBGA 4HFRA 3EYWA 1YO6A 1PR3A 4N54A 1UP7A 2PNFA 3BHMA 3NX4A 3S2GA 2CF6A 4CM5A 1I01A 2Q3EA 4NFSA 3VZSA 5DN9A 4YJDA 3OQ6A 3PDUA 1XA0A 4BNVA 1EE9A 1E5LA 1ZIDA 2SCUA 3SC4A 3VVCA 2HMTA 4R5HA 2O3SA 3COSA 2XPCA 4FBGA 3GLQA 3PTZA 5BSFA 2ZATA 3VVBA 2ZB3A 3GHHA 2EKPA 3PEFA 1A7AA 1OBFO 1RM0A 2X9NA 4BNIA 4LN1A 2G82A 2GASA 3JQBC 1XSEA 1QYVA 1WDKA 3AM4A 5JCJD 2VYNA 4F6LA 3PDJA 1GZ4A 1XKQA 2BD0A 1WLYA 3H5NA 4R4JA 4HADA 1JKIA 1ONNA 4I5DA 4NK5A 4FW8A 4XGNA 4TRMA 3LU1A 3WBBA 3KEQA 2I9PA 4R01A 4I1IA 2WJPA 3HDQA 3KYDA 1XDWA 2PKQO 1A5ZA 5C5IA 4WECA 1LDEA 3DBRB 1VRWA 1FJHA 5DT9A 2NVUB 3UCFA 3JSAA 2FSSA 4LSWA 4EITA 5CEJA 5HS4A 1VKOA 3PYLA 5F5NA 4E6PA 3RQSA 2Q45A 1UZNA 1TT7A 3E9NA 1FDSA 1ADGA 4XZ3A 3OHSX 5C7LO 1G0OA 3OMLA 4W99A 4BNMA 2UYYA 3GNSA 4D46A 4PG8A 5JC8A 1T4BA 2IDZA 4B4OA 2QRJA 4IDFA 2W8ZA 4ILKA 2P9EA 3SLGA 4B3JA 4NJMA 2BGMA 3HADA 1GCOA 3JYLA 4OOFA 1JKJA 2GN6A 1PX0A 3RUCA 1GEEA 5KJ6A 2J5RA 3O4RA 5I8ZA 1Y8QA 1ZH8A 4J90A 4ZD6A 2DUWA 4TKMA 2I3GA 2X0NA 2RHRA 3W4IA 3ULKA 1VSUA 3W4JA 3WIEA 4BUCA 1VJ0A 5IZCA 2VQ3A 3GEMA 2Z1MA 4RZHA 3HG7A 4OSOA 4WEQA 1LLQA 1XQ1A 2BI7A 3JYPA 1H9AA 5F3RA 2VYVA 1DXYA 4G81A 4L73A 1B15A 1HTBA 4KWIA 3WQSB 1IPEA 2YV2A 3A1NA 2OHXA 1R15A 3I23A 3KM0A 3GNQA 4FFPA 1YQDA 4GWKA 1NQOA 3ZHBA 4ND4A 4NH4A 4UUNA 4CR8A 4XR4A 3QLJA 1H6DA 2IRWA 1PL6A 3EVNA 1RKXA 5L9AA 3K6JA 4KZPA 3FNEA 1IUKA 1FK8A 3D7LA 2AMFA 4RF3A 4KOAA 4RGBA 3RWBA 4FJ0A 1PGQA 3GC6A 4UUOA 4Y6RA 3WX0A 4K6FA 4GX1A 4QX6A 4QFCA 1T2FA 5BSHA 2YHIA 4E21A 4TWRA 5BR7A 1N92A 2W4QA 5KWEA 4G2NA 1E3WB 2FHSA 4AL4A 4S3MA 2OOSA 1H6CA 2OBNA 4RQTA 3ZH2A 5JAMA 1QXSA 1UR5A 2HMWA 3GGOA 4K9DA 3Q0EA 1NHGA 1P1HA 7MDHA 4JP3A 1Y5MA 1SB9A 1PEDA 4FGWA 3C1OA 3D1LA 4BNWA 2J3JA 4JJFA 3JQAA 2NWQA 4QECA 4C7KA 2C2XA 4DMLA 3HFGA 1ADCA 2YFHA 4R3WA 2ZIZA 1M67A 3EAGA 3P2OA 4IQ0A 1E7RA 1UXIA 1AE1A 1P45A 3DO5A 3W1VA 4BNHA 5T57A 3VTFA 2WE7A 5F1PA 1AGNA 4W7IA 1B8UA 4NBTA 1Y6JA 2AQ8A 2RIRA 2X9GA 1SOWA 3L4BC 3O8QB 5HRUA 4B7UA 1V6AA 4I9NA 2Q1UA 5KKAA 2HJSA 3EK2A 1DRUA 1LTHR 3PHLA 4BNGA 1CIVA 4WASA 4B3HA 4PLVA 2JD1A 4CM4B 1YL6A 3M1AA 3SC6A 4D79A 1AXGA 1LX6A 3INTA 4BS9A 4DLAA 1M6HA 4DTIA 3JQFA 1ZMTA 5LDHA 1W0CA 4HNGA 4CMGA 1BMDA 4KUGA 1FDUA 4DQXA 3U62A 3KYBA 4YVFA 5B4UA 4CR6A 1YRLA 2O3QA 4Q9NA 3HDHA 4QUKA 8ADHA 1E6EA 2CVQA 1GUYA 4KQWA 4OXNA 4CLEA 3WLFA 1E1MA 1PZHA 1Q1NA 3IKVA 5G0WA 1EUZA 4A73A 5C3MA 2EG9A 3JQEA 1SMKA 1PJ3A 1R0SA 4XX0A 4Y67A 5HS6A 3TL2A 4DXHA 2JD2A 4J4BA 1T2CA 2O2YA 5IG2A 4GPD1 4MP3A 3C7AA 4BO5A 5CEFA 4R1UA 4AJEA 4RL6A 2IZ1A 3C7DB 4Y6PA 3PQEA 5JNLA 2FZWA 5KJ1A 2HMSA 4DMMA 3KSDO 4ALNA 4BKPA 5TRTA 3ROKA 2OFPA 5K0ZA 3TN7A 1X7HA 2XXBA 3ZN2A 3JQCA 3JQ7A 3U9LA 4BKRA 3JQ9C 4PN3A 4KTTE 1P3DA 1NVTA 3GVHA 4RF2A 4CLOB 1GADO 3DFUA 2FOIA 2V6MA 4MVJP 3KO8A 1FDVA 4K26A 2WE8A 1VSVA 2JCVA 3OFSA 4YAIA 2PGJA 3AUUA 3IJRA 4Z0PA 4R51A 5JFOA 4FC7A 4IJKA 5L7YA 2PD4A 4CUKA 2IE0A 3DBVO 1V35A 2W98A 2PH5A 4YT5A 2WYWA 3KLMX 3LDHA 4FOOA 4NBVA 4PLGA 4Z9FA 4B7XA 1PQWA 1NFRA 1ZW1A 1AHIA 3R6DA 4BV8A 5HBRA 4D42A 3QRWA 1QYCA 2GNAA 4IPTA 2YW9A 3D4NA 1TXGA 1PJCA 4R68A 5IFLA 2JD0A 1C14A 4DGSA 1QP8A 3MJ4A 4WCFB 1UJMA 4GVLA 4NK4A 1K3TA 2POQX 2DTEA 5TT1A 2PD6A 5ICSA 5A05A 1KEPA 3QVXA 1X0XA 1JU9A 1B16A 2GYYA 5DDIP 3RU9A 3D5TA 1DPGA 4BKOA 2VOJA 5A9RA 1KVUA 1J0XO 1JQBA 3L4SO 1PL7A 5JBIA 2VUUA 4XRRA 1Y8QB 5HA5A 3TL3A 3NT5A 4BMNA 3Q1LA 4FC6A 3NJ8A 1DIBA 3S55A 1NHWA 4LCJA 4MVJM 2DBQA 4BO9A 3MJSA 2EWMA 4J91A 4Z3KA 5GY7A 4B8ZA 4EZBA 3H5AA 1ORRA 3JQDA 4NBWA 1SO8A 4YDRA 1VL6A 5GZ6A 1I3LA 1BRMA 3JD0A 4HWKA 4JBIA 1U5AA 1Z73A 3C7CB 4EGFA 4Z0HO 3RASA 5THQA 3ADOA 1QKIA 2QQ5A 2VZ0A 4BOYA 3ICCA 4M55A 3VPSA 4XYEA 2DUUA 4HBGA 2WD8A 3RKUA 4QQRA 4D41A 3GEDA 3F1LA 4K1LA 1E5QA 3VH2A 2W90A 3RUEA 4U0KA 4LMPA 5DP2A 3PWSA 3K31A 3U4DA 1YL7A 3RC7A 3WGYA 1K0UA 5IDWA 3IC5A 1S7CA 3ZNPA 1ZK1A 1WXDA 3VPGA 3NJ4A 1T2DA 4XYLA 2ZCUA 3UAGA 1VLLA 2C82A 5U9CA 1L1FA 3R0IA 1EEHA 3JQAB 2ZB7A 3Q6IA 4IMPA 1HF3A 4AJOA 4CMAA 3WNVA 3VDRA 3F6YA 4BNLA 4BB6A 4ALIA 3SEFA 3UKOA 3WICA 3K30A 3JQ8B 1QMGA 1UDCA 5KOIA 4YCAA 2FSVA 5ER6A 3FHLA 4YRDA 1WPQA 2OO5A 5JLAA 4IJUA 2FPGA 3KTDA 2C59A 3E82A 4XD2A 2VWGA 3I52A 4R69A 3DTTA 3ZGYA 5I9NA 2RAFA 4J1SA 3WYBA 3MWDB 2E6UX 1K6JA 1YGYA 1U2DA 4N5NA 4D3FA 1HDCA 4UVEA 3LLVA 1ENOA 1M76A 4CQMD 3JYQA 3U5TA 1MG0A 3FF4A 1HZJA 2P9CA 3W6UA 1TB4A 3HJAA 5ER9A 4U5QA 4RF4A 5TSDA 1PQPA 1ZZEA 2BGKA 2C07A 4B7CA 3ZWCA 2HCTA 1UH5A 4L9RA 1U3UA 3GPIA 1Y9AA 2JL1A 1PR9A 5EN4A 1J4AA 1XU7A 2QYTA 1ONOA 2NADA 3TFOA 2NVUA 1I10A 1LDMA 1FDWA 3DXFA 4IINA 3X2EA 2P5YA 3F3SA 3DZJA 5I9LA 3T7EA 4CL8A 5T8KC 4E0BA 1DAOA 2ZTMA 3ZWVA 1ENPA 2Q2VA 3UN1A 1EK6A 2F00A 2Y1GA 3ETGA 1D7OA 3ANNA 3IDSA 4IIUA 5L3ZA 3ETDA 1KY4A 1ISFA 1P9LA 2VWHA 1HDOA 3G3EA 4IGFA 4RVUA 3STHA 4A0SA 3T7CA 2BFPA 5A02A 4ALKA 1O8CA 1LDNA 1Q2XA 2J3KA 1T4DA 3AY7A 4MVJI 3S8MA 5KIAA 1E1LA 2O23A 1HE3A 1CETA 3HUDA 4E30A 1RM3A 1GPDG 2NSDA 1P0FA 4Y6SA 5TQVA 3I9LA 4EW6A 2UDPA 4WLUA 1G0NA 3ZHXA 4NBUA 1E6UA 4I8XA 3KSZO 2GRAA 4DLLA 3MJTA 4H3VA 4FB5A 3WMXA 2VHYA 3QA9A 4JJIA 5IAAA 4P4NA 2DBVO 7ADHA 4YAJA 2G5CA 4Y98A 2P4HX 5GMOA 1D1TA 1KYQA 3WTBA 1R12A 4DQVA 4EUHA 4CMIA 1DFGA 4YJHB 4CMBA 4INAA 4ZN6A 3ZWWA 3IP1A 2AA3A 2Y93A 4CM4A 3ON5A 2C5EA 1N8KA 1XCBA 1ZJZA 4PVDA 1Q0QA 5I7SA 5DULA 2J8ZA 2WD7A 1DB3A 4BO2A 3QIVA 4RPLA 4OKNA 1GQ2A 4NFHA 1LRKA 3TDKA 2NTVA 2R6JA 1O94A 4MP8A 3CUKA 3OICA 4YAKA 4YRBA 4MVJE 4XGIA 4BNYA 1ISMA 3H3JA 1YL5A 1XU9A 3NDRA 1U4OA 4L8VA 1U1IA 3W6ZA 2HKIA 2WYVA 2ZKLA 3D4OA 1GQYA 4GBJA 3T4XA 5I7EA 2QYSA 3BTUA 4I08A 4J9UE 4HXYA 4XYGA 3PQDA 1I36A 4BHTA 1DIHA 3NTRA 4FGSA 1OOEA 2PZKA 2AQKA 3KEOA 2NTNA 3BMCB 5COAA 3ZWXA 1JLLA 3WNQA 5B4TA 2ZK7A 5A5EA 1DO8A 4QFDA 1KVQA 4CPDA 3K2EA 3QWHA 2YHUA 3BTOA 3WDSA 3RAJA 4YB8A 3ZNOA 4JLWA 4I5FA 1ONPA 4R16A 1LDGA 3TZCA 2ZTUA 4BO1A 5JYDA 4XEHA 3OJLA 3ZCXA 3HQ4O 3NYWA 4IBOA 4IDBA 3P5SA 4R1TA 1ISGA 1KVTA 3ZHYA 1FMCA 3WSWA 2G17A 1E3SA 3LYLA 1E77A 2Z5LA 4XIJA 1IYZA 4DYDA 5H82A 4OIMA 3ABIA 3TZ6A 3OA0A 3AI1A 2F1KA 3GZNB 2JJYA 5CG1A 2C5AA 1BVRA 4IXWA 2NU6A 2C7GA 4XB1A 4RVSA 2FY8A 1ULUA 3DHEA 1M6WA 2VRCD 4E5NA 4YR9A 3AW9A 4J16A 2HK9A 1B8VA 4NBRA 2DFDA 2GD1O 3F4LA 2CF5A 4W9NC 5T5QA 1F0YA 1LSOA 2Q1SA 4PFJA 1YB5A 3LLSA 4E31A 1WDMA 1NX6A 5FWNA 1ZK0A 4XYBA 4XGKA 4RVHA 4MKZA 1L7DA 4BNXA 1YB4A 4HV4A 5GZ1A 2P2SA 1ULSA 3N74A 5JO0A 3IIEA 3LC2O 1P1JA 2HO5A 5G0VA 3HFSA 1VKNA 4WCDA 4ND2A 4AJ4A 2EW8A 2ZCVA 4M87A 5U4QA 5L7TA 3DBHB 3CH6A 4YACA 1VPDA 1BDBA 2Y1DA 1KETA 4ZQBA 4DA9A 4B3IA 1LEHA 1FDTA 2WYUA 3DHNA 1YJ8A 3AFNA 2UV8A 4N5LA 5C7IO 1GL3A 2I3AA 3OJFA 3OM9A 4FS3A 1JKFA 2PKRA 4LMRA 4BGVA 4XQCA 4CV2A 4R9RA 1HRDA 1PGNA 2B36A 4MO2A 1DC4A 2C0CA 2HMUA 2PH3A 4JJGA 3WLEA 3PHIA 3FR7A 1CEQA 4DPKA 3CE6A 2UVDA 5JS6A 2GDZA 5BNTA 3GPDG 2NVWA 3F1KA 2GR9A 3UW3A 3QVOA 2QIOA 2Y1FA 1DDOA 3ZU3A 1WAMA 4YJFA 1C1XA 1ENZA 3MWEB 3IJPA 3O9ZA 3QVSA 3TOZA 2RBEA 4ESOA 3WYEA 1C0PA 2P68A 1MA0A 4BQRA 2JKVA 1NNUA 3MOGA 3PXXA 2IZ0A 3DONA 3QY9A 3MJEA 3WGQA 1GR0A 2YYYA 4J6FA 4LCEA 4KP7A 5BQFA 3GUCA 1JWAB 3SJUA 3FN4A 3GVIA 4IDDA 2VT2A 5TNXA 1P33A 1U28A 3DMTC 2EEZA 3RD5A 3G49A 3GN1A 4AJNA 3WGTA 2NU9A 3EY4A 3OJEA 2OMEA 3GDGA 1GFSA 1M75A 4FDAA 1RJWA 3BMQA 1A9ZA 3WTCA 3IMFA 1OC2A 5EL0A 4HNHA 5TF4A 4PLWA 4Z9XA 3WOHA 1D1SA 1KVSA 1LLDA 3TZHA 3RFTA 3ANLA 3KRTA 2D3TA 2Q4BA 3PJEA 4MIOA 2X5JO 3FNGA 3LT2A 1R0LA 2I65A 1GV0A 3NDIA 3PHGA 1N1EA 5AXCA 3IOYA 4K6CA 1YXMA 4M8SA 3F4BA 2XXJA 4DPMA 4ZRNA 1EBFA 3JQ9A 2PTGA 3RUDA 4GX5A 4HX5A 2IZZA 1GTMA 5TIIA 4YJHA 3M2TA 1ZBQA 1GQQA 3UH1A 4RPKA 1DRVA 3UFXA 2X4GA 4CQMA 4FR5A 4JROA 1FXSA 4AJKA 5DZSA 3U49A 1O95A 1LC3A 1LSUA 3TNLA 3ZV3A 1WWKA 5EPOA 4FD3A 3TZKA 2ZYGA 1PSDA 4A27A 4P4GA 2WDZA 1CRWG 2PK3A 4DQUA 4J7CA 1ZKMA 4EEXA 1GV1A 1EE2A 2Q2WA 4BL5A 3LT0A 2FPIA 4DREA 3G1TA 5BSGA 3DZBA 3WGIA 1B2LA 1F8FA 2OL4A 3H5RA 4PVCA 5F1OA 3GG9A 1RYDA 3GG2A 1LJ8A 2AEMA 3ZDFA 3NAQA 5G0SA 1PTJA 1UAGA 2EXXA 2WWRA 3GOHA 4PZCA 3ZWAA 5HTOA 1U3TA 3MTGA 4OJNA 4DPLA 4PLZA 3NEPX 4JBHA 4XQGA 4B8WA 4TZTA 2YDYA 3MJVA 3TFQA 3VZPA 3P7MA 3R3SA 1C1DA 4CMCA 4IJWA 1ZEJA 4ZICA 1JTVA 2B35A 3L4BA 4BO0A 4DC1A 1MP0A 3JQBA 3WG9A 3ONEA 4ZHSA 4RLSA 5F21A 3AM5A 4RZIA 5CPFA 5L40A 1I2CA 1QLHA 4UVIA 3NT2A 2YV1A 4E5KA 3LQFA 4F45A 5I7FA 1B14A 1OMOA 2X6TA 3UOGA 4B4UA 2Y05A 4IUYA 4MOWA 1AN9A 4LRSB 4OH1A 3O03A 5CDSA 3B20A 1QV6A 4CM3A 1Y81A 3WGGA 4N5MA 1EFKA 1W73A 4AFNA 1KIFA 4CM6A 2CMDA 3OF2A 5IZ4A 3OJ0A 2IODA 4FJ2A 5FI3A 4TRNA 2B4TO 1BGVA 1ISIA 1XGKA 3GY0A 1KC3A 4GGOA 3ZWYA 1Y5RA 1XWFA 4BGUA 1HYGA 4IZIA 4EI2A 2PGDA 2OP0A 1GCUA 1NBOA 4BNZA 2JHGA 3NGXA 5LDGA 4A10A 2VYVD 1DC5A 3E8XA 5IDXA 1E3JA 1N2SA 1I3NA 4WLOA 1JVBA 4F46A 5A3JA 2HK8A 2GERA 5COBA 4J4TA 4NI5A 3X2FA 1A7KA 3I9OA 3F9IA 1ADBA 2JFHA 1ISHA 1HDXA 2TMGA 1P1RA 3EW7A 3BMNA 4AJLA 2NLOA 2ZQZA 2QX7A 1OFGA 1KC1A 4R41A 3VOSA 2PV7A 1NPYA 4II3A 1D8AA 3RSHA 5DBIA 1LNQA 1OC4A 3NT4A 3MCVA 1LSSA 3EMKA 3H9JA 2A4KA 4JX8A 4JIGA 3WFIA 4PZEA 1QG6A 1C1DB 1MX3A 4U8GA 3S2FA 5DOVA 2Q50A 3RJ9A 1EMDA 1IULA 2H63A 4FSHA 1ID1A 3GQVA 1F12A 1GPJA 3LZ6A 4D43A 3KSUA 4IQ8A 1Q7CA 1ML3A 1AHHA 2B5WA 2FR0A 4XB2A 2EJWA 2W2KB 2AE1A 5IDQA 1NVGA 1H6BA 3UF0A 1XIVA 1Z74A 2BI8A 5EQDA 4TMFA 2XOXA 1TLTA 1K2WA 5CAEA 2CUKA 3CZRA 1PS0A 4NQZA 1HE5A 1CF2O 1HDGO 2Q49A 3FCOA 5I8WA 4B4VA 2FPPA 3PQFA 1YDEA 5LCXA 1V3UA 1A71A 2GZ1A 2VYND 4PLTA 3CPSA 4MP6A 2JAHA 4IS3A 1E3IA 4CV0A 1DHRA 3GDFA 3H9GA 3ANMA 3FD8A 4WCFC 3ICPA 5H81A 4X54A 5L45A 3RBZA 4GKVA 1JW9B 2VZ9A 4K28A 1BVUA 2VN8A 4CM7A 2V7PA 3QJ5A 2OBYA 3PGXA 3E48A 1T25A 1MV8A 4ZQEA 4NDNE 1DEHA 1YVEI 1DJNA 3A9WA 1Y7TA 5BNFA 3DB2A 1N7GA 3H9QA 1JAYA 2V6FA 1D3AA 4EDFA 1V3TA 2W2LA 3FTPA 3PI7A 4GH5A 5EESA 4ZU3A 5A9TA 4A7PA 3RROA 5F5LA 5AOVA 2VHVA 1CJCA 2NTJA 1M66A 4O63O 2OXIA 1X1EA 4H15A 2QW8A 3D4PA 3GAFA 3ROMA 3KYCA 1T2EA 3C1AA 3ST7A 3ITDA 3EVTA 4CODB 4E2ZA 1NVMB 3IUSA 2UUPA 2YV3A 4YYZA 4R3NA 3PYMA 3ZWBA 3C24A 3FWZA 2O48X 3IP3A 2O7QA 1GDHA 1W6UA 3TZQA 4IY1A 2GSDA 2ET6A 3DOCA 2FRDA 4HFJA 5IN5A 5T67A 1YOVB 3GRKA 3UVEA 2ZYDA 4J1NA 1LI4A 4F6CA 4BIIA 3QP9A 4NNJA 4U6SA 4D45A 3FNHA 3H2ZA 1P31A 4BV9A 1WP4A 4RLHA 2EW2A 1W4ZA 4NG5A 1NAIA 3OEWA 2X5KO 1YH3A 5TJHA 5G4KB 3Q11A 2VNAA 1ZSYA 2QHXA 2O50A 1DFHA 2B37A 3VDQA 1YS4A 1R16A 1UDAA 3F47A 4YPOA 5IN4A 3C3XA 4UEOA 1CWUA 4XYMA 1LC0A 3V2UA 2H9IA 2ZB4A 1EVIA 4S1VA 3G1UA 1LQTA 2Y0CA 4YT8A 5JYEA 4MINA 1EVZA 4OYRA 2DQ4A 5ENVA 4BB5A 4BNTA 1QR6A 2VUSA 2AG5A 4U0JA 4YT4A 1SEPA 2Z1NA 4O1MA 1B0AA 1NFFA 3BTVA 5I9MA 3VC7A 4JGBA 3BHJA 2Q1WA 4BO6A 1EUCA 4C7JA 1BSVA 2JCXA 3AFMA 3ONDA 3F46A 1ZXBA 4CM9A 1O89A 4DLBA 4FFMA 1J5PA 4TZKA 1NQAO 3OQBA 4QXMA 4HKTA 4BO7A 4CMIB 1X1TA 5ITWA 5AXAA 2GUGA 2UAGA 1YB1A 5DNAA 2HAEA 5A4DA 3V2GA 5DBFA 1Z75A 2O3TA 4NU6A 1A4UA 4BGIA 4KDEA 3OP4A 3OIFA 3RI3A 3PLNA 4QO8A 3ZV5A 5CHEA 4J49A 1U5CA 1LLCA 1VM6A 4L4RA 2RH4A 3HNPA 5FYDA 4ITUA 1GEGA 1Q7BA 4OL9A 4XR9A 3RBVA 1E6WA 1W8DA 3JD2A 1ZO8A 3I83A 3WWYA 3NTOA 1NQTA 3GVPA 1E92A 3L6OO 1SOVA 1UUFA 1HYHA 3UGKA 5AXBA 2B69A 2OP1A 5L95A 4AJ1A 5T64A 4DBVO 5A03A 3DTYA 4WLFA 2A94A 4HUJA 4OO3A 4WOKA 4HFNA 4YBZA 4OQYA 1JA9A 2ZJ1A 5EINA 2D2IA 3FTNA 1IHXA 3QWFA 1EDOA 3BMNB 3FSRA 3ZU5A 4A26A 4E5YA 4XA8A 3PLRA 4Z3DA 3K8ZA 5JDIC 4EEZA 1BWSA 1ENYA 3KVOA 1LDBA 4WNIA 1QSGA 1E7YA 2DPHA 3AY3A 4FFRA 2HDHA 3BHIA 2GPTA 4GAEA 4CLRA 2A9FA 2OORA 1H5QA 2EP5A 1LU9A 4YWJA 1CQJA 2D5AA 3NTQA 2DT5A 1T24A 3H7AA 3RIHA 4J7XA 1U8XX 1YBVA 1YJQA 3VHRA 5B12A 3NRCA 1XELA 3PIDA 2GGSA 3H4VA 4WUVA 1PIWA 2VNSA 2VT3A 3VZQA 1LRJA 1X7DA 3E03A 2V65A 4KWHA 4N7RA 4L74A 1Y1PA 1DBVO 4GGPA 3TQHA 3AUTA 3A28A 3HB4X 2Y1CA 1AVYA 4BMVA 1ZSVA 3CMMA 1O0SA 3FBTA 2YJZA 2I6TA 4Q3EA 4W7HA 4GLLA 3M1LA 3O38A 2FWMX 1C0KA 4E2YA 5COQA 5G2OA 3TOXA 4Q3DA 1X14A 2B83A 4WNCA 4PCVA 4ZA2A 1F8GA 4QTZA 3DZIA 1T26A 4Z0TA 1U7HA 3I5MA 2EJVA 1Z7EA 3PIIA 2VRCA 4NIMA 3WB9A 1BXKA 4CQLA 1Q0LA 1CDOA 4J3FA 3V1TC 4YXFA 2FZEA 3L77A 4BNUA 3TWOA 4L75A 5CP8A 3L6EA 1MFPA 3BTSA 4PLHA 4CMKA 2BMAA 2BKAA 4O0LA 3RFVA 4PLFA 3SX2A 1N5DA 4GI2A 4L76A 2EGGA 2HRBA 4XDZA 2VRBA 5JDCA 4AVYA 4H16A 3INGA 5KTKA 1P1FA 4AJPA 5CDYA 4U7WA 3D3EA 3WMWA 1ZFNA 2NQ8A 3QW2A 3AU8A 2YFQA 3K96A 3B1JA 4PLPA 2VCYA 2PZLA 3I4FA 3DZKA 1TVEA 1C0IA 5TS3A 4O59O 4FFOA 1QYWA 3U4CA 2HJRA 2PWZA 1PJTA 3CZMA 4AJHA 1DHTA 4IJVA 2HUNA 2LDBA 4PGFA 1TI7A 1UXHA 1WDLA 4E12A 3DAGA 4WLEA 1DJQA 1IE3A 3OEYA 3C1TA 1EFLA 2DVMA 4L4XA 2Z95A 4R54A 4WOJA 3KXDA 3RU7A 3ITKA 1HEUA 2PZMA 4WCFA 3VTZA 2B0JA 1ZK4A 5TLSA 4DL9A 1N9GB 3VH1A 4TVBA 4WPGA 3ZHZA 5I7VA 1E7WA 3JYOA 3IL2A 1C1XB 1PJQA 3OJOA 3H9EO 5JC1A 3K5PA 3CTMA 5EJ2A 3PP8A 4ALJA 3HN2A 1K6IA 4MIYA 5JAQA 1I3KA 2CDCA 1UAYA 4DVJA 3AM3A 4NU5A 2NM0A 2C29D 3JD4A 2BLLA 2GLXA 1K89A 4ALLA 1B3RA 1UDBA 3KUXA 5A04A 1YE3A 4TSKA 3IQDB 3H8VA 1F14A 1D4FA 3KYDB 3UXYA 4KUHA 3DBLA 3ROQA 2BGLA 4F3YA 5A1TA 5JMWA 3B6ZA 2E49A 3GAZA 1MLDA 2HU2A 4MVJG 4AG3A 5IXSA 2QRKA 1E3WA 1VC2A 3GF4A 3JTMA 5L53A 3GDOA 3ONFA 4UUMA 4ZRMA 3PK0A 2YQ4A 2GZ2A 3NUGA 2CVOA 4J0EA 5EERA 4A2CA 4E2XA 4ND5A 4II2A 5K9ZA 1P44A 4N18A 3ORFA 3WGOA 1XEAA 3R3JA 4MKRA 3SVTA 3RJ5A 1GZ6A 4WLNA 4J1QA 3BA1A 1R66A 4UUPA 4Y8VA 2FR8A 4ZQGA 3JQ7B 2CY0A 3FR8A 3DC2A 4P8RA 4CUJA 3AU9A 1U8FO 4JK3A 3B1FA 4RVGA 1FF9A 3V5NA 3AUAA 3EZLA 1KS9A 3KHUA 4GKBA 5JMPA 3DEYX 3D3WA 3DOOA 1TEHA 1UXGA 1DIGA 1QRRA 4D0RA 1WVGA 2YY7A 2FP4A 4RPHA 5FI5A 4FOSA 4NPCA 5EQFA 2DBZA 3AOEC 4IDCA 1PZGA 1YKFA 1T2AA 5B4VA 1ZSNA 4GQAA 3U3XA 4BKUA 2X58A 3LC1O 3CIFA 4CLRB 2BFOA 4IZHA 2ILTA 3GA0A 4R9SA 5IDYA 4LVUA 4RF5A 2Y0EA 2YDXA 2Y1OA 1BW9B 3FI9A 4MJLA 2E37A 1G6KA 3CTVA 3MOIA 3BZUA 2LDXA 1OI7A 4IDAA 2P5UA 5B37A 2Y1EA 1I2ZA 1N7HA 1Q0HA 4W6ZA 1JVSA 3V1UA 4YJGB 3CEAA 3M2PA 3ZNNA 4IMRA 4M54A 4NZ9A 5BT9A 4E2WA 2HRZA 3ADPA 2ZJ0A 4UEKA 3H3FA 4AJ2A 1NASA 4ONEA 5H83A 2VWQA 4H7PA 5DCUA 3RUHA 1B7GO 1ZEMA 2AG8A 4GX0A 4KTVE 1SC6A 4PG5A 1PJ2A 1E7SA 1S6YA 2J3IA 3GT0A 4MVJD 6ADHA 1Z82A 4OXKA 2E4AA 2Y68A 3AJRA 3DZFA 1N1GA 1JN0A 1X7GA 4PLYA 4FCCA 3I3OA 4O5OA 1V8BA 2CD9A 1PQUA 2NU7A 4QT0A 2GN8A 2B5VA 3DZHA 1R6DA 3HDYA 3KB6A 3H9UA 4CMHA 1MFZA 2E82A 3QVTA 4LGVA 1H93A 2ZB8A 4EJMA 1BHSA 1MXHA 5TT0A 4EJ0A 1EZ4A 2X5OA 3H65A 5ENDA 3G79A 1YONA 4P38A 4Q3CA 2NU8A 2EF1A 2YQ5A 4ALMA 3PHHA 5A3VA 2OUIA 5MDHA 2DM6A 2Y0DA 4YQYA 1HZZA 3EC7A 4NFYA 2RH8A 3S2IA 4D3DA 5IJZA 3A4VA 3PZRA 3GN2A 3SLKA 2IEBA 1GD1O 4IGEA 3E1KA 1NPDA 3N58A 1RPNA 5FEUA 3JV7A 2D1YA 5KVVA 4YQZA 4BVAA 5HM8A 2DU8A 4RPJA 2VOEA 5A5FA 1ZUD1 3JQ8A 2P4QA 4CLXA 1DLJA 5AQ1A 3IKTA 3PVZA 1I24A 1WMAA 3MEQA 1UZMA 5FFFA 1UP6A 3ZWMA 3ZWOA 1KEUA 2A35A 3IS3A 1E1KA 1HXHA 2I67A 3PPIA 3VKUA 1PWZA 1MC5A 1BDMA 2C20A 1U3WA 4ZVVA 2DAPA 3VAZA 3ROPA 4UEJA 1DRWA 3I9MA 1P1KA 3E9QA 4OQZA 3ZW9A 1H6AA 2X0RA 2BHLA 1R4NA 1U7TA 4QSMA 2VHZA 4GWGA 2IYPA 1QV7A 1SEVA 2I76A 3QVWA 1IY8A 4CQLB 2X86A 5U1PA 4Z6KA 3CXRA 1ZVMA 2DC1A 4J1TA 1R37A 4JQCA 2W2LD 4XIYA 4XJSA 2WMDA 1KBZA 1V3VA 1YDWA 5CFZA 4MKXA 1ARZA 1PJBA 2AE2A 1GYQA 1WZEA 1C0LA 1U9JA 4RDIA 2E48A 4Z9YA 5A9SB 3WGHA 4RVDA 4IM7A 2DFVA 3W8DA 3ZNQA 3U0BA 3RFXA 4BNNA 2AEJA 4J2HA 3HWRA 2X7HA 1I33A 5G4LA 3KBOA 1R4MA 2EKQA 1SCUA 2D4AA 1BXZA 3Q2KA 1B8PA 1NR7A 1CERA 2Q2QA 3OSUA 2B4RO 5FF9A 1SNYA 3DOJA 2J3HA 1LA2A 4XQ9A 2CSUA 1TA4A 1IZ0A 3PJGA 4OM8A 4GLOA 5JE8A 5JCXA 3PGJA 1UP4A 1XLTA 3WBFA 3S2EA 1X13A 4TVOA 3I9JA 2CFCA 4MVJA 1EQ2A 3RCBA 1Y8RB 1NPTO 2VZ8A 2Q46A 1NWCA 3AWDA 4YA6A 4OSPA 1ZCJA 2FN7A 3MTJA 1DC6A 2GN9A 1P77A 3UHAA 5DOZA 4ROSA 5GZ3A 2VUTA 3GRPA 4D3SA 5JO9A 3FRJA 1NYTA 1EVYA 4YJFB 1QYXA 5MGBA 2CDAA 1L7EA 4YRAA 4CMEC 4ZGWA 3GNTA 1ZK2A 5KJFA 1PGPA 4TROA 5THKA 4MIEA 1AUPA 3ASVA 1M2WA 4XCVA 1AXEA 2PY6A 4EJ6A 2PFGA 4JNKA 5C37A 1NTOA 2AQHA 2JHFA 2ZTLA 2Q99A 3L9XA 3RKRA 1HLDA 2QG4A 1QORA 1DSSG 3BAZA 1XR3A 4TRRA 1NFQA 3E5MA 4CM1A 4RORA 3NV9A 2PGLA 1HLPA 1LRLA 4UVHA 1V9LA 3QE3A 3W8FA 4I9UA 2I99A 2WTBA 5K6AC 1DIRA 3AY6A 1HDRA 1H2HA 2H1SA 4R5MA 2EERA 3GZNA 3DAPA 2EIHA 5KCZA 5G4KA 4YTEA 3DZGA 4PZDA 1PL8A 2X23A 2NNLD 1GY8A 1VL0A 4FIZA 1E1NA 4HFMA 3D3WB 4ND3A 4PIVA 4JXKA 1DIAA 3D64A 5B1YA 1EBUA 4ND1A 5CDUA 4UAGA 3Q2IA 4LVCA 5CDGA 3PFFA 3HB5X 3KV3O 4U6QA 1DLIA 1MC4A 1PWXA 1HL3A 1SBYA 2CVZA 3JD1A 3M6IA 5CPBA 5L51A 1GZ3A 5G0TA 2VTDA 3QHAA 3RC2A 5ADHA 4JN6B 4EUEA 4NJMB 5JXWA 4ID9A 3DBLB 3BMCA 3BXXA 5IXYA 3C85A 3RUFA 3WS7A 4XDYA 3GFBA 3DBHA 3Q3CA 3UICA 3F5SA 1PS8A 4CM8A 9LDBA 2ZTVA 4CM9D 2HQ1A 2NACA 4IDEA 5TGDA 4CR7A 1SAYA 3NGLA 2IXAA 2W2KA 3TPCA 2GF2A 1VI2A 3WJ7A 2X9VA 3GHYA 3JQ6A 3L6DA 1CQIA 5BSEA 3ZI0A 2G1UA 4IQGA 4WKGA 3C8MA 2OZPA 4UVGA 1UZLA 2WM3A 2P91A 4DIFA 2CZCA 1LUAA 3JQGB 3RUAA 3T4EA 1IOLA 1KVRA 2XF8A 4I5EA 4KQXA 1J6UA 2PKQP 1YQXA 4JCOA 2X8LA 2ZQYA 4CV1A 1QLJA 2QZ9A 2YZ7A 2FR1A 1BXGB 2HMVA 5JY6A 2Y67A 1LDYA 1MXFA 3ASUA 3V1YA 4BMSA 2CNBA 2J5QA 3L0DA 1O5IA 3K92A 1JWBB 4NR0A 2RHCA 4E32A 3VPFA 4I5GA 1PJSA 2R00C 4MPDA 4CLHA 2YHIB 4FJ1A 2UUOA 4RO0A 4OMUA 4J7UA 2VTEA 4BO8A 3QQPA 5L4LA 4R1SA 3PJDA 5C7OO 2Q1TA 1GYPA 2VWPA 5JDIA 2G0TA 2GN4A 1XHLA 3NDJA 2JAPA 2PR2A 3FPCA 4MVJF 4IS2A 1IL0A 3OIGA 2X0JA 4EBFA 2XAAA 1PZEA 1GAEO 2I66A 5F1KA 4D0SA 4MDHA 1YBMA 2CDBA 1CYDA 1U3VA 1V0JA 2DPGA 3AK4A 3OA2A 4ZQHA 1SZJG 3I6IA 2BRUA 4M1QA 1LLUA 2O3RA 1X0VA 3DMYA 3GR6A 1DFIA 4HP8A 3UCXA
chains in the Genus database with same CATH superfamily
3T52A 2V1UA 1OTXA 221PA 4YEDA 1BEEA 3UWSA 1PUXA 1T6XA 3R4VA 4KRYA 1JB1A 2YXLA 4TUYA 1VE9A 5AICA 1I3MA 3UUFA 4BXOB 2A45I 4I8DA 4J8PA 1P1IA 1VJTA 4PCUA 4LOJA 4YI5A 1KJZA 2XW6A 1WL8A 5IAOA 3P27A 3SBDA 1RWWA 2XMRA 3TIVA 3LL4A 2BE7A 2Q4EA 2Z08A 2ZSUA 3B1KA 1M6VA 4N8EA 4RWEA 4W9RA 5HOQA 3MMNA 4ZTZB 2HSJA 4BFVA 4QVGA 2X22A 1EHCA 3VOPA 4BE4A 2QU7A 2PEZA 4U6NA 1R8JA 4GOND 4S2UA 4JL8A 3AHGA 3E1RA 2HK6A 3EOZA 1E9EA 3SZUA 4BFUA 3FAKA 4BX3A 5A3QA 3R4YA 2YZ2A 1UFKA 3GK3A 2ARKA 2G09A 4IEEA 1N6KA 2WWYA 2EJUA 1BG6A 1G8KA 1UBKS 4ITRC 3FXAA 4ENUA 5GTHE 4WGGA 3OW2O 4J29A 1PS9A 1RI1A 2DEUA 5DCYA 4CNQA 3PDIB 1R0KA 2NUAA 4Y2YA 1I7DA 3BRSA 4NHEA 3UJ3X 1QGYA 4KH1A 1SQXK 2QRZA 3A1FA 3OX3A 2UXBB 1Z18A 3WXBA 2FFBA 1VG0B 4JODA 1JIVA 2FMUA 4JBNA 2NOAA 2PRSA 4NJOA 3VPXA 1GUZA 3R41A 4B6FA 5B1EA 2WHRA 3K7EA 4LRXA 1UIXA 1T9GS 4I1RA 3IPYA 5CJJA 2HYIC 5JROA 1GUFA 1OJ7A 4WEOA 4DCJA 1KJQA 3IAM1 4MEBA 2W11A 1CE8B 2XDWA 4CYMA 2X1MA 1ZR4A 2CKMA 1T29A 3PSHA 5ALEA 1MVOA 2LE0A 4YXDC 3PGMA 5LJLA 3HSSA 1T3HA 4MR8A 1KQGA 1AZLA 1XTUA 4X6LA 4C4SA 3QKSB 2QMZA 4JKIA 5BYBA 5DX8A 1XPUA 3EXHB 2A3RA 3PXAA 1NO4A 3F7NA 5APSA 2VSYA 4KX5A 3G17A 2H92A 4ZV4A 3DHYA 4UM5A 1ZXLA 5JPIA 4YAGA 4JLVA 4RM3A 4BNKA 4G0QA 2A7QA 2AN4A 4DJDC 6NULA 4UMVA 4XWWA 3B4SA 2ESRA 4S1NA 3O2SB 2V7QJ 4UVDA 1QTQA 5TPWA 5JAUA 5DNCA 2YYAA 3DBRA 3LZCA 5G1OA 2N42A 3HFRA 1KMIY 2E21A 4KT0J 1SG9A 4QPZA 3TTSA 1K97A 4EQZA 1DJLA 2WJ3A 3EDMA 3VJMA 3BXZA 5ELLA 3HXOA 1E0DA 2ZRPA 4F60A 3TW8B 3VSBA 1PR1A 5LBTA 2YXEA 1ISJA 3WYDA 5FDFA 3R5HA 4F21A 1K8ZB 3GWZA 2ZJ6A 5L4NA 1HT0A 4EELA 1QQBA 3P8CE 2JI9A 1BZYA 3M4NA 5BQPA 4QEDA 3ZV4A 4DNPA 5ALXA 5CVUA 2NTYC 4WN3A 1E9FA 5CRIA 1SU8A 3ZZMA 2H7CA 1P7ZA 4CT4B 3F7TA 5FFNA 1JY3N 4QDKA 1AU9A 1NTZG 2QVXX 2JDIH 2R79A 4C03A 1BHO1 4E1VA 3W5SA 1KFEB 2V6IA 1OQAA 1V39A 3NYRA 4PG4A 4BVEA 5IUKC 3CXHH 2YCLA 1CRLA 1PJ4A 1M8OB 1NI4B 2IP1A 2IUEA 2YOGA 2ZIUB 3K5IA 4GX2A 2W7TA 3AEQB 1W47A 2OYRA 5ABPA 5H2FH 1A72A 3TSCA 3UTCA 2I78A 5KDOA 3ZV7A 1K04A 1G7RA 2J9XB 5DM60 3ZWDA 5ICMA 2WSCH 4I55A 1DQNA 2ZE5A 5CFPA 2YN0A 2AW5A 4ZPXA 1UQUA 2HPCB 4DGQA 4AKHA 3CBGA 1EX6A 1PFGA 4MS3B 4CW7A 3VBCA 3M9BA 2XU6A 1ESCA 1Z7BA 1JU3A 1A9XA 2XGGA 3L8GA 3QBDA 4DRZA 2D2CB 1IZ9A 1V6SA 2JA1A 3AVXA 4Z1OA 1LJ2A 4HTFB 1TW3A 2NPSA 2DWUA 3A0BE 3DHVA 2MINB 3CLRC 3V2IA 1NXPA 2QP3A 1QO0D 1Y8RA 1HE2A 3V6MA 2XDQA 3AJAA 3TQTA 2V0NA 2BFAA 5EUCA 4B3CA 3VNVA 4JT8A 5DI9A 1R0YA 4GSKA 3ENQA 1I1HA 4TSRA 2QRLA 3TB4A 4BBPA 1LQUA 1NLZA 1B0PA 2DLDA 4G5HA 1H4SA 4J0DA 4MICA 3ZWNA 1JLSA 2K2QB 3B5EA 4HZIA 1M1JC 1DQZA 4M9UA 3FGPA 3O47A 3WNCA 4BKMA 2HQBA 4YDQA 4RAOA 1HSOA 5A9SA 1KQFB 2CFOA 4ZT6A 1NMSA 1KJYA 2GCOA 2I4OA 3QE4A 1FJXA 2E85A 3T7IA 3SBOA 4QUAA 1MNAA 3IEMA 3SQLA 4BY9E 3UC5A 3AEXA 4HEJA 2EV9A 3FZYA 5B5EH 3EIUA 2BELA 2QV0A 3CSDA 3O94A 1XF1A 3F5QA 2IXEA 3OVMA 4LISA 1K7XB 5A6SB 1NAYA 1PG5A 4M3LA 1YA4A 2JIRA 2R87A 3DF9A 2W6CX 1G41A 2WHQA 4HYTB 4BKQA 4JJKA 3AESA 5KYUA 1WMBA 3VTAA 2FCAA 3G9QA 2VG8A 5L3RA 4PO9A 1KILD 2BSXA 3OWXA 1KBOA 4HAXA 1I7NA 2YIJA 3LUPA 3LUBA 2SCUB 4W8OA 5KYXB 1WB9A 3GGDA 2OO5C 3QE2A 3I2GA 4FS8A 1IUNA 4U3JA 9ATCA 4P22A 1AGXA 2OGTA 3CB4A 1KNXA 1RI2A 3KBBA 2I2AA 4YC7A 1K6XA 4URWR 1JWLA 3FY4A 5H7XA 2ADMA 1XCGB 2FW6A 1B00A 4IVNA 4LKRA 2R84A 5HGJA 2FMIA 2V3VA 1EWQA 2E89A 1B73A 4XWAA 4EITA 3VI3B 4PPNA 2PUBA 2DTDA 4JI4B 1HUCA 1N4AA 1H65A 5CLQA 5BV2P 2FK8A 3GLVA 1N9KA 2EP7A 4D9HA 2QW1A 1ZD5A 1QHHB 1YJAA 2X77A 4PRKA 3T9DA 3V3KA 3ZCPA 2EG5A 3OTWA 4RULA 1M33A 5LD2B 5JS1A 2H8PD 3SF8A 5TX7A 3LI2A 3V7YA 2HPCA 3QWBA 3MUNA 5JW6A 1PFQA 2NUBA 3PL1A 3UICA 1F17A 1EFDN 1HYBA 3NIWA 1ZN8A 3OQPA 4O4IB 4QBFA 1WZNA 4RK1A 4EKIA 3QOYA 4YAEA 3D7SA 2AN5A 4Q4DA 2Z8YM 1IXRC 2Q4RA 2YMQA 3EJ6A 1TKCA 1GKKA 1FE8A 1ZVJA 4EB6B 5IZCA 4H4CA 4CIYA 3WL6A 2XMGA 1BGYE 4EJFA 2PSEA 3EDCA 1FZQA 1X7ZA 2R1UA 2J5UA 13PKA 3MCZA 1JILA 4P7JA 3C3AA 5A3RA 1RXSA 4M36A 4M7OA 2Z9BA 4BFCA 2H2GA 2OYHA 1TZJA 3BFVA 5M3BA 1QLWA 5I48A 4B47A 2RONA 3AEAC 2Q5EA 1X74A 4W82A 1J0AA 2QVAA 5BYAA 4B3XA 5JWRA 3WFJA 4YV7A 5LJIA 4ESEA 3K73O 2J6IA 1N0UA 2D5CA 2GCOB 1XL0A 3GMSA 2XCQA 2JI6A 3HRHA 2XCUA 3PJFA 1R9JA 2GK4A 1UJCA 1WETA 1RF1B 3NBZC 3QKRA 4O25A 2CXNA 2O4CA 3FSGA 4I81A 4BO3A 1OMIA 4QGBA 1ULAA 2R9VA 3F6CA 3M6VA 5EA2A 4ETNA 1DEXA 1PWHA 4BVFA 2G63A 3UK0A 1WMEA 2HL6A 2VPYA 1U99A 3LHDA 4R1NA 1PGJA 3LYUA 3EVGA 4U7JA 4HQNA 4QNRA 1DCKA 4V0KA 3SXPA 3UW3A 1I3OA 1UT5A 5H68A 5J4KA 5LC1A 3ZKAA 1JEEA 2N1TB 4RA9B 2VT6A 3HU5A 3QKTA 3U4MA 1AHNA 2P7JA 1ZNWA 3HCRA 2DX7A 5LQCA 1Z3IX 2DOKA 1FS6A 2VDJA 3JWPA 3E9CA 1I32A 1I0ZA 2R2GA 4JU9A 4U3JB 3O2NA 1YIOA 5B1SA 1FTYA 4HC4A 1YOVA 4AF7A 1SQSA 4WLVA 1M57D 2H2DA 2GPBA 2VATA 1BJTA 3KUKA 5GONA 1GFIA 3DAOA 1Z08A 2G8LA 5AOAA 3USZA 3WDMA 4ZNCA 4E13A 1W88A 3JZMA 4IIJF 4RJKA 4RESA 4TKVA 9LDTA 2JHAA 3AFHA 2A45G 5I51A 1G2PA 1RZ3A 2CCJA 1F60A 3FMVA 1FZCC 3AF3A 4TTRA 3OQIA 3T7JA 3FX2A 4R40A 3UHJA 2OHFA 2XH8A 3KLPX 3ACBA 4RS4A 4TXNA 5KS2A 1EUDA 2UXDB 2GUVA 5I4BA 1LTGC 4ESVA 3G0DA 3LT4A 5T6BA 1D2HA 2V7TA 4RCVA 4DRYA 5HYVA 8AT1A 4CV3A 3WNDA 1Z8NA 1I3CA 1ZGCA 4LJ7A 4BU1A 3RL0B 4AN4A 2IXDA 2H1HA 3CFYA 3FJOA 1AMOA 2I33A 1BXGA 4X1OA 2ZM5A 2I34A 3OT1A 4ML3A 3WYNA 3VYWA 3KJIA 3KLOA 1A8UA 3REQA 1MO5A 1VB5A 4YUXA 1F6BA 1W87A 5IAJA 5HRCA 3GJ3A 3DFZA 2FQQA 5KBYA 4ZJUA 5HWSA 4FYIA 1IHOA 4CDNA 1R5OA 1TUBA 2H0AA 3LSYA 1J1ZA 1BFKA 4D9NA 1WUTA 2XE8A 3OOWA 4RA6A 1VE6A 1RRCA 2ZRGA 2D59A 3VNUA 2QT1A 5E2AA 1T43A 2WSFH 3EHEA 1A8QA 4TUYF 1UXKA 1TK9A 4MWZA 3WQRA 3HDJA 3WQHA 3ZV6A 4C4OA 4CKEA 3I9V6 1Z6PA 2VDMB 4WFIA 4MAFA 2O59A 4G65A 5KTMA 4N7MA 2O8EA 4FN4A 4Q3AA 3V4RA 1QAQA 3EMVA 5ITZB 4MVYA 3FNBA 3TL6A 1CR4A 1WHTB 1EQUA 3E53A 2MMCA 3BK1A 3GPBA 3LVQE 3Q3VA 3P9QA 4HWGA 3NNDA 1A27A 4Q1BA 3Q88A 5HFJA 1AA0A 3TIXB 4BX2A 4CJXA 4ZAFA 1DZ3A 4I9HA 4F8YA 3U3DA 4CEHB 2MDTA 4FVTA 1X22A 4OOEA 3VNRA 1HO3A 1OFUA 3ZBQA 2RCYA 5K01A 4TL9A 2B1IA 3UT0A 4JVNA 1XVLA 3NBXX 1JDVA 1A82A 2XGMA 3ND6A 2B0CA 1KJNA 3O8OB 3EEIA 4HVTA 4M49A 5GM2A 2R66A 4CLDA 1I1OA 3WWZA 3K70D 3LCUA 1TOAA 4H35A 3QPAA 5F7JA 4RE5A 1O5OA 4IIVA 1RFGE 1ZBDA 2XQGA 4MMZB 4RVCA 5DT2A 5HG0A 3BXFA 3RBXA 4GSLA 4GOEA 2XWSA 4GC5A 4JUIA 3H6KA 3G2KA 2UZAA 2ZM6B 2PLFA 1KB9H 4M22A 2WIKA 4BLPA 1CNFA 1JS1X 4P35A 5CFNA 1Z45A 3W1EA 3WB1A 4A5OA 4HQKA 1SQBJ 2NT4A 1JVNA 3GRYA 1E2GA 4RDHA 3CM0A 1Y47A 4ZCIA 3FBGA 3ZH9B 1M5TA 4RNDB 4Y0NA 3WHPA 1TL7C 1X2EA 4IGKA 4XWGA 1PR3A 3S2GA 2I7XA 2WIGA 3INYA 1FSFA 1I01A 1XTPA 1DKUA 2I2XB 3NX4A 1PZXA 4OMFG 5AJUA 3TX6A 4PC2A 4YJDA 1EZVE 3LD9A 4EUSA 1SVMA 1FUKA 1XCOA 2NVOA 4JUDX 3T9BA 4ANFA 1E5LA 4GPZA 3QITA 1L5SA 5L3SA 2QENA 2QWXA 2O3SA 1RIFA 3PTZA 1RHJA 1BKDR 2GAJA 5LZ2A 3GHHA 4PR3A 2MCFA 3R7WA 2CZQA 3PEFA 5BMVB 3CJRA 3HGMA 4CHTA 4TWAA 4ZGGA 2TMYA 3P4XA 4FHEA 1RM0A 3GD5A 4MCJA 2HA0A 1Z7YA 4MSUA 3R8XA 4ZDJA 2VTVA 1IZ7A 2ZI6A 4B34A 3LKVA 2YJGA 2WU8A 4F5WA 5JNVA 4IQFA 4BJHB 1QYVA 1SZCA 3DKIA 4MV6A 4TKUA 4U2EA 4U1RA 1P5RA 3SAJA 4BE9A 4MULA 2XJ4A 3GEPA 1XKQA 2ZRFA 1PO7A 4R4JA 4LTDA 1NX9A 5F76A 1E2EA 1JKIA 1ONNA 3ELWA 2OQ2A 4NK5A 5AJTA 5IT9A 4EJSB 2G3YA 1VQ8P 2R5FA 1SG0A 3OZUA 5JIBA 2I9PA 1SQBG 1F9AA 2CSXA 1KKLA 2XUZA 3HDQA 4MUXA 4DCGA 1XDWA 2NG1A 3WJ2A 4QWMA 4AJ4A 1GQOA 1VZ2A 3OA7A 5DT9A 4B4KA 1MN6A 1FJHA 1GDDA 1VRWA 2QX6A 2NVUB 3UCFA 1MW8X 2FSSA 2JFQA 4EA7A 1KTMA 5HS4A 5J3JA 2AZDA 5F5NA 1PK7A 3PC8A 4OI4A 4N6OA 4DLPA 5DGCA 2Q45A 2AR0A 3ND7A 3A4YA 4PZ9A 1XEFA 1FDSA 1E6LA 3ODPA 2HRDA 1NJ5A 2ATXA 4NENA 5HK8A 4OA5A 2GXUA 5HKKD 2BP7B 2EFDB 4W99A 2OCIA 2FUNB 1WTAA 1BGWA 1HBJA 1UQTA 1VMAA 4FT4A 3WZLA 2SKEA 3A05A 4HB0A 4K9NA 1XZKA 2R7NA 4YDSA 2EVWX 3EWAA 1QH1B 2CNNA 2EQBA 2QRJA 3ETJA 1GSIA 1KDTA 1WKBA 3PDWA 4ME6A 1XAIA 2BGMA 3KS9A 1CE8A 2EZUA 3OZXA 4NNOA 3ZDZB 4BC1A 4BLVA 2UYHA 3ZLJA 3ZXUB 1R8XA 1YIJP 1J1IA 1JAHA 1NYRA 1PX0A 2BFWA 3FM9A 2C83A 4JLKA 4OSEA 1CUZA 4WBXC 2Y1WA 5KJ6A 1Z4JA 5IC5A 4I9GA 4F1KA 1ZIOA 1XT6A 1T5IA 4LZNA 1GL7A 1NTKJ 3FJ1A 4UTVA 2DUWA 3AE1C 1IH8A 1F3OA 1WUIS 1R5NA 2F1RA 2RHRA 3ULKA 3W4IA 3I72A 3CWCA 3S44A 3QEOA 2FFDC 1JLKA 1KC8Q 4H6PA 3JU3A 2ST1A 1DH3A 3JWGA 2Z1MA 3ZHCA 4Q4CA 4RZHA 5CA0A 5E1OA 5TPWB 3L05A 3TGPA 3ZX5A 2PG3A 4B83A 2IX7C 3RGGA 3T35A 1IK7A 3JYPA 2YO2A 3BASA 2IYSA 5F3RA 3AXSA 1ISRA 1KDVA 5EVJA 1VPVA 4D0GA 3B2NA 3WQSB 4J0KA 4PGAA 3WLNA 4KACA 4Z4QA 2OHXA 4BJ3A 3N0RA 3GNQA 3BWEA 2WPQA 4OYLA 3FTEA 4GWKA 1POXA 1CFZA 4HT3B 3ICVA 3ZHBA 2QIPA 3P9KA 1REQA 4PD4I 3HLKA 4IDOA 4XR4A 4CR8A 1MKYA 2JAOA 2IRWA 5JH7A 3M3DA 3EVNA 5EOVA 5GIOE 1NQVA 1RLJA 1RKXA 4LF4B 3KQHA 4LPKA 3G9TA 5EHQA 3QXXA 5FBLB 1IUKA 4RF3A 3RWBA 5ALWA 1YS2X 4KOAA 1FYFA 3GC6A 1JB9A 1SBCA 4UUOA 2GI4A 2ODQA 1BE3G 3HXPA 3CCUP 1P19A 2C7RA 1NZDA 3PDCA 2W37A 4TWRA 1UBNA 4OGQD 2IVZA 1EVKA 4LDRA 5BR7A 1N92A 2QTVA 3CX8A 3CC4P 5LUBA 1II9A 3P8CD 1E3WB 1OUMA 1SXIA 2PO7A 4PSUA 3V4LA 3UZUA 1NU8A 3QVMA 1BMQA 2ZI4A 3F5FA 5ALVA 4M1WA 3TFWA 3N5KA 1A9OA 2H9AA 2HMWA 4KLAA 2NUTA 1SU7A 3IP5A 2ZVNB 3Q0EA 1P1HA 1KRHA 2DCUA 5CFOA 1Y5MA 2QTLA 4EQ6A 4EMBA 3H4TA 1G2CA 3JPWA 4JUFA 2EL9A 1IG0A 2VPQA 3LW7A 2YC4C 2J3JA 4QGGA 4CKWB 1L6RA 4TYMA 2C2XA 3H1LE 2WU4A 1PV1A 5DU2A 3WADA 2PBFA 2YFHA 3R5JA 1NUHA 2XE6A 4W5QA 4EB0A 1U7UA 3P2OA 5E4JA 1TYAE 4ISBA 1UXIA 3HKCB 1WXIA 1QP7A 3IKLA 1JL3A 3W1VA 1G59A 1SUDA 4KE6A 3VTFA 5ISMA 2C96A 2BKUA 3RRMA 1IXYA 2A5DA 1GGJA 2BN4A 3AE7C 2WJIA 4QIHA 3O8QB 2RIRA 2R5WA 4I6JA 5HRUA 2QNIA 1Z4QA 2Q1UA 5KKAA 1XXHE 2H0RA 1DRUA 1P0PA 1FVOA 3EK2A 4HGRA 4HNUA 1RAFA 1W85A 4DARA 3PHLA 1LTHR 2Z5FA 4B3HA 4WASA 4BNGA 4MHSA 5K0FA 5KHOC 1PHRA 2JD1A 4FYXA 3M1AA 4CM4B 3SD7A 4D79A 1Y48E 1AXGA 3EZ7A 3UYKA 3IAS1 3HB0A 4YRQA 4QOJA 4FILA 1YI1A 3WKDA 1P0MA 4M0PA 4AI6A 4OHVA 4E1BA 1WEKA 1EK1A 2JGKA 2VH5R 4HGQA 4PPYA 3GGCA 1VDZA 2EC5A 5E2IA 3DE7X 1U0OC 3B8EA 2W22A 2VL7A 3E3OA 3HDHA 4Q9NA 3S40A 8ADHA 4LF8B 5JVDF 4D6TJ 4KV9A 4PC7A 4L6AA 1I13A 2V7EA 2MSDB 4UCFA 3UPTA 5KLVG 4IVRA 4FE7A 1EEXB 4BQFA 3H19A 1WUKS 2O2EA 4FYMA 3IKVA 4I14A 4A73A 2HR1A 1FDOA 2IA5A 3KZIH 1V11A 1PJ3A 2WQZA 4WGFA 4Y67A 5E6SA 4X41A 3AEUB 2EKDA 4MP3A 3RRBA 3DMRA 3A4IA 4IIYA 3OP1A 2Q9UA 1YR3A 4FFDA 4OI1A 2Q0HA 3L1VA 4J0IA 4RK5A 4BO5A 2WY2D 3DKKA 4C7VA 3LX5A 2PCJA 1MJ5A 5IJWA 3TNFA 1KB9I 3HUTA 3I04A 3TQFA 3ZU6A 2LXCB 2OTKE 1NZFA 5JNLA 2WQYC 4X3PA 2P2LA 2X3YA 3LLUA 5DIFA 1RQRA 4GPIB 4NULA 1Q3KA 5C1DA 5KAMA 2YZGA 5K0GA 2IUYA 1W2WB 1IZYA 1XLVA 3JASA 5K6TA 5HQ3B 3ESBA 2XXBA 4BKRA 4UU1A 4ARAA 4EQ6B 3JQ9C 3V4WA 4KTTE 4GFDA 4RV5A 3DOIA 3R2PA 2AN9A 5HBGA 3E05A 1F9EA 1Z62A 2VF7A 1AF4A 5B3JC 1GADO 5M04A 2IH2A 2OLEA 2Q5IA 1EFTA 4HN9A 3O1LA 4FMBB 1ZOLA 3FGOA 4MVJP 4Y6LA 4KPFC 1MNQA 5BT8A 4K26A 4HEA1 2RGEA 1TKBA 1XTVA 1IOWA 1L4KA 2JCVA 4JVMA 5JFGA 2RHDA 3AUUA 5CVVA 1GILA 2REOA 1QONA 4Q7JB 4FC7A 5CBNA 4R51A 1CZKA 4WTOA 4B75A 4CUKA 1BCCD 4C3VA 1JNMA 2R8ZA 1J7JA 3QEMB 4X84A 1OCEA 1P7CA 1T4GA 4UVEA 5CCGC 5D7BA 1EIWA 3IOMA 5KJ7C 3ESQA 1GZ5A 2H06A 4BYMA 4DJTA 3L7KA 4FOOA 3A9CA 1ZD3A 4REMA 5DGTA 3ANXA 1TJ3A 1K8QA 2ZU6A 5HBRA 4OD0A 3QRWA 4Q37A 2GNAA 3ETLA 5C8YA 1KDZA 2YW9A 3LYHA 3D4NA 5IFLA 3IT2A 4DMGA 2Z9CA 5HKOA 3WRWA 2XX3A 4DGSA 1QP8A 3MJ4A 4TT3A 3DE0X 1U8AA 2MINA 4C14A 5TT1A 3N2KA 2PD6A 4UTOA 3JWEA 3QVXA 4JZYA 1B6RA 5DDIP 1ZMRA 4G8JA 1ZCBA 3AB7A 4X1KB 2WU3A 4X7BA 3TE7A 5BUCA 2AFRA 2A1UA 3WAKA 1SVFA 2JJ2D 3FUWA 1N3LA 5GINE 1KVUA 1J0XO 3L4SO 2BDTA 2FMKA 5CYFA 3ZQJA 1Y33E 2QVBA 2H5EA 5JBIA 2VUUA 5HA5A 2P67A 4YMUA 4DM3A 3Q1LA 5BMVF 2TMKA 3O31A 1EUDB 1Y63A 3A6LA 3LO8A 1O0CA 4H13D 2DPLA 1XNJA 3NJ8A 3STWA 4CWAA 5EHGA 1DIBA 3NEJA 3WMEA 3QI7A 1DX7A 3P9RA 4MVJM 4TXLA 4WXHA 2DBQA 4YALA 1RF1C 4PYQA 4QA9A 3O1IC 2QMHA 4QQNA 3H6GA 2XRYA 4C3OB 1HJBA 4LDPA 4RAQA 1ORRA 3JQDA 3P94A 2E1PA 1WW2A 2X9LA 5BWCA 4UM7A 5I7OA 5GZ6A 4DM4A 1I3LA 2ZI5A 5FUBA 1BRMA 1ZN9A 3L70J 3FDZB 4FX5A 4HWKA 2LXBA 3NHFA 3E22A 3CCLP 2JH9A 5BWMA 3RASA 5THQA 2VZ0A 1O95D 2NXEA 2QQ5A 1RPAA 4RY9A 4BOYA 4UPEA 5AHOA 4RHYA 3A0HE 1PP9J 1I2DA 1V3QE 4M55A 4XYEA 3FLMA 5AKEA 2KI5A 1L0NG 3MFYA 3RC3A 4QQRA 2FSFA 3F1LA 4LSZA 1UM9A 4K1LA 4C4TA 3G0HA 2W90A 5B6IA 1XPRA 2R4TA 3OM8A 4U0KA 4LMPA 4BMZA 3WGYA 2YWCA 1TM2A 3ABOB 4C05A 4HJGH 2C92A 3IC5A 1A8PA 4KXLA 4Q7EA 4KKXB 3DAHA 3IEUA 4OQQA 1XA4A 3NJ4A 1T2DA 3T1YB 1OYYA 2ZCUA 2C82A 2AN1A 3HKDA 3WRXC 4NYMQ 5AKZA 4DLRA 2QL6A 3G88A 1GT6A 1RAEA 3N2LA 3MINA 1BE3E 1RC0A 2WIDA 4KVZA 3SJAA 3FDFA 3VOAA 3I0NA 1MZVA 1VJ5A 1FAVA 1KS2A 3K30A 4OJKA 4P80A 1QMGA 3KU1A 4A1OA 2P6OA 2Y9MB 2WUEA 2UUAB 2FSVA 5ER6A 3GJSA 5KYYB 2F4VB 5ILGA 2ZTHA 2X41A 2X7XA 4YRDA 1FCJA 2FPGA 3SR4A 1FP7A 1YVUA 1KK0A 3E82A 3WHLA 4XLTA 3SC3A 2WIFA 3HZOA 3IE2A 1XD2B 1ZGZA 3I52A 4DCUA 2GWRA 5I9NA 2WHXA 5LQAA 3WYBA 2HODA 3MWDB 1UPAA 4ZYXA 1Z39A 5DHQA 3P32A 3FPHA 4N5NA 4D3FA 3UAOA 3SQWA 2ADOA 1QB7A 1M76A 2PFKA 3GRZA 2HXGA 2YCBA 3COYA 5CCHA 4OB7A 1JY3P 4OHFA 3FF4A 1SFCA 3FCYA 1R00A 2IP4A 3TYXA 3HLTA 3PQ7A 1TB4A 2XRFA 1O96B 4IUBS 5E79H 4KPGA 3RS0A 1G3QA 1PQPA 2C07A 1ZUWA 4EFMA 4N3GA 5GIPE 2QKYA 1UH5A 1UPBA 3G7UA 3MCWA 1G6Q1 1U3UA 3GPIA 3UWPA 2ZXEB 3WU2H 1Y9AA 3I1FA 4AXXA 2WPDD 2JDIA 1NSYA 4M1ZA 2JLRA 4HL6A 1UPFA 1ONOA 2NADA 7MHTA 1P39A 3BJMA 1CUAA 2NVUA 3RVBA 1JEAA 1I10A 1I4LD 1FDWA 4XDHA 3DXFA 3X2EA 4EPWA 4ZOLF 3THYB 3DZJA 4DA7A 1NF9A 1NT2A 2ZJ2A 2PX6A 3T7EA 4JLDA 5GTDA 1Z5OA 5FORA 3N8KA 1OI4A 4EYQA 1NVAA 2Q2VA 1UBFA 1YR8A 4NENB 2QAJA 4RETA 5JSYA 2E2WA 4IRMA 4Q7QA 4Y9SA 4G07A 5L3ZA 3K1AB 1T8RA 1P9LA 3ETDA 1JHOA 1QJ4A 1HDOA 1PK8A 1LPMA 2CLDX 5FKJA 3TLEA 2GFIA 3D2BA 4X6YA 1RLIA 1ZMEC 3HR4A 4BWYA 5G02A 5KIAA 5F9FA 4TMKA 4WDRA 3X1DA 5EFOA 1OGYA 3NORA 5THXA 1M2VB 1O3YA 4AZ3A 2WSSA 3DLHA 1RM3A 1GGVA 1SOMA 3KOYA 4P84A 2ZYHA 1J8FA 5MGNA 1UT6A 3I9LA 1V5WA 1UK6A 1GCIA 5B5EE 1B1AA 2QUZA 4GZ5A 4HJXA 4I8XA 4NBUA 2RK3A 4JEUA 3MJTA 1U7WA 3PNYA 3RFUA 1QZ3A 1UWVA 4C4XA 3PA8A 3X43A 4D8YA 5LXTB 2DBVO 1W0KA 5JNUA 4FD2A 3WGVA 4Q12A 3H42B 4CL0A 1EINA 1CDDA 2HDWA 1S96A 5AI0A 1M1YE 1XNQB 4G24A 2IH5A 2N1BA 4YJHB 4CMBA 1N2HA 1PEAA 5DW0A 1ZUNB 4Q3OA 2Y93A 2VDKB 3QNUA 4F38A 1CJUC 4PVDA 3BORA 1ZJZA 1VKHA 1PEYA 3D6JA 4EYGA 5DULA 2QVGA 2WK1A 3BXGA 2ZIXA 3IERA 3TK1A 4M98A 1M6YA 2X15A 3SOZA 4EAQA 1YBFA 1HL7A 2QPTA 2X19A 4OCZA 1SQXE 5I8WA 3U0VA 3KD3A 4MVJE 2WKRA 2YN2A 1ISMA 1FTSA 2CB9A 2XRZA 5AVRB 3NDRA 1MOPA 2NXJA 4EA8A 2CXSA 3U39A 1JEYA 2WYVA 2JCGA 4L9AA 1EWVA 4BVBA 3AW8A 1JXOA 4I1YA 1TO1E 4CEHA 5I7EA 2PSDA 3BTUA 1JTFA 5CCGD 3C6BA 1KARA 3Q2YA 1FA9A 1YRAA 4L7VA 3AB3A 4PYMA 3QXSA 4FGSA 4A8HA 4D1YA 3D6HA 4DJJA 3VJRA 1SVUA 2Y1XA 3TBHA 1RYBA 2AQKA 3KEOA 1ISPA 3AF2A 3IMEA 1Q11A 1X6VA 3E3LA 3WNQA 4LJ5A 5B4TA 4LOLA 4DADA 3TD6A 3A3YB 3G2OA 4QFDA 5ETJA 4EG4A 3JVEA 1SIOA 2AMVA 4MN4C 2GBFA 2YHUA 3D6UA 2QMEA 3WDSA 1K7CA 4RXUA 3ZDXB 3RAJA 2F17A 3KQVA 1EH5A 1IM8A 4I5FA 3ZNOA 2FFAA 5EQTA 4HRXA 3TZCA 3NR2A 2QTGA 2VBGA 3GMTA 4XEHA 3OJLA 1IEQA 2Q4OA 1N2JA 2W6JH 5A7GA 1DC8A 3HQ4O 3NYWA 4PD4E 1TNDA 3U26A 3P5SA 2BUBA 1KVTA 2N3ZA 4WQMA 1Q5PA 2BM9A 2G17A 3ZHYA 4ARBA 3B1VA 1FYEA 1MJGM 5FX2A 5C1IA 1QYRA 5TEWA 5JLJA 2Z5LA 1WZUA 1ZRSA 2Z09A 1K1EA 3SJCA 1NE7A 2OB1A 5BQ5A 4WBNB 5J4LA 3GA5A 4JR1A 4AF6A 3ZCQA 5KB3A 1T6NA 5JMOA 2A1TR 3KV1A 5DBHX 5LZ7A 5AW4B 3I9FA 1BO6A 2C5AA 3GRFA 2XA1A 5CG1A 3OQNA 3HDGA 4PWYA 2WQ6A 2WF9A 1KF0A 2K87A 1VI6A 2DY0A 3G0IA 5ALRA 4KKVA 3RVRA 3TGUD 1NP6A 2P9JA 3BD8A 1PYGA 2C7GA 1SVKA 4XB1A 2G80A 2FY8A 3PC4A 3MUOA 1IUPA 4RVSA 4CTNA 4ZYWA 1M6WA 4US2R 3QVJA 2OFXA 3HBLA 4WZBB 2HK9A 4S1PA 1L5KA 2O0MA 5HF9A 4NBRA 1RZUA 4R05A 1XZIA 5E7MA 2GD1O 4KH0A 4NNPA 2PQ6A 1UK8A 2CF5A 1T5OA 4J6EA 1L2TA 1UXOA 3IOEA 2FEOA 3JXEA 4MUGA 1F0YA 1RHMA 2YXDA 4MGZR 5CJPA 2PDAA 1VPLA 4S12A 5KYNA 4YHHB 4AKGA 1U4NA 3HD7C 4E31A 3SEAA 4XYBA 5GZ1A 1YB4A 1WQ1R 5AVRA 1U1EA 3CBQA 3N0VA 3N74A 4JC4A 3Q10A 4ZAWA 5JO0A 2P6PA 5G0VA 2B6HA 3W5HA 1V45E 1FP2A 2GEFA 2ID7A 1UBTS 5U4QA 1FJKA 3OU2A 5HKLA 4JBZA 5CFRA 1AUXA 3HP4A 4E14A 5CIWA 1ECLA 4FGUA 1U0GA 2PKEA 4EG3A 1KR2A 5D5PA 4C7OA 1Z37A 3OAAA 3W77A 3Q8XB 2RBGA 1FDTA 1XEXB 3MRTA 3K9BA 2UV8A 5C7IO 2DXIA 4N5DA 2ATEA 2REQA 3F49S 1A5TA 2PKRA 3LHFA 2M2IA 4JC0A 1NC3A 4KLRA 3NHSA 5EIHA 3WGMA 4C6SA 1DC4A 2WFLB 5BN1A 3GJ0A 2PH3A 2ZBUA 3N2IA 1OVRA 1CY4A 1G1IA 4JL6A 2UYGA 4RENA 2FFHA 1JHDA 4H17A 1JHAA 3PGKA 2HZ7A 2GEDA 4WDQA 3L75E 1CEQA 2IXGA 2P40A 2YH2A 4DPKA 1U8ZA 5A5VA 1JH9A 2IS6A 1N6PA 5JS6A 4N3BA 3CH7A 3WYAA 3N2GB 3FIJA 3FCEA 1C4WA 3FPAA 5AW0A 2NVWA 5J4VA 2NP7A 5KPDA 1A2KC 1J21A 3EMDA 2A67A 4P3PA 2H1VA 1PRYA 2A33A 2I7VA 1MAAA 5I4KA 3OAKA 4Q05A 3B1ZA 1NDUA 3L8YA 3V4VB 3EGDB 3ZU3A 3KQLA 1BNCA 3ZZTA 1MB0A 1HRKA 3KQOA 1OD6A 3CLUC 3DP7A 2X0FA 4BFSA 3FCAA 1OU0A 1V1MA 2C4UA 3CRMA 3PQ6A 5D3MB 3CUEF 1PE0A 2IEIA 2RBEA 4NAUA 4BQQA 4ESOA 1JSXA 2O2GA 1AY0A 3HP7A 3T8YA 3W5JA 1LK5A 4BQRA 5H4GA 2G9QA 3N7NA 5D2CA 2YY6A 3B5NA 1WSAA 3OTHA 4KP7A 4FZ3A 6AT1A 3NOVA 1JWAB 4AN1A 1QO7A 1BN7A 2V7VA 3LUJA 1P33A 5C34B 3KQWA 1XWIA 1GHTA 4P4TA 1BD4A 4H7HA 5A4KA 1H3EA 5EMNA 5FLEX 3I5CA 1PWEA 3PEUA 4HYTA 3RD5A 3TBKA 1KAEA 4UB8H 2I2BA 4INOA 4LYYA 3GOQA 3TGLA 1JCCA 2V7XA 3I6ZA 3WGTA 1U98A 2WM9B 2R97A 3HH8A 3GDGA 1ZISA 1H2EA 1QH8B 2GNPA 1KORA 2JIBA 4S04A 4FDAA 2NIPA 4MPRA 1TM5E 1NJGA 1A9ZA 5IBQA 3WTCA 1RVV1 1SQ5A 1TO2E 2I1QA 3FROA 2CUNA 3H13A 4QXQA 3F2IA 5JJIA 5AVXA 2JGIA 1QIIA 4HNHA 5JARA 3L72E 2WG0A 2FQYA 5KSZA 3GP5A 3UJAA 2DPXA 4L07A 5BWOA 3RB8A 3F5MA 3MW8A 3TB6A 3PJEA 1F8YA 1G1MA 1R4AA 3E9RA 4MIOA 2YKOA 1R0LA 2Z2KA 3U1VA 2I65A 2PTHA 5BU8B 2WDPA 4DDMA 3EIHA 5GQSA 3IOYA 2CYCA 4UHCA 5JG7A 4CKCB 3H2YA 2YBEA 2XXJA 2DR0A 5E4YA 1RYYA 4ZRNA 1T2KD 1SFCC 4LJ6A 3RK1A 4NICA 1X9GA 2WC1A 1UIMA 4D6PA 3IV7A 3RUDA 4L6IA 2I7DA 3H11B 3AR9A 1XXLA 2RGAA 4HX5A 3EAQA 4RGVA 4B6EA 3AUKA 2GAIA 5TIIA 1ZBQA 2I4MA 4B6SA 2EATA 2R6FA 2WWHA 4RPKA 2JC3A 1GU0A 2B2CA 2OENG 3ACDA 3C3MA 1H22A 3CLKA 4FNGA 4JB3A 4ZXPA 4D3XA 2JAQA 1TRKA 2QE7H 1BHQ1 1VJGA 2R3CA 3NTNA 1RNLA 3DVAA 4RCYA 1O95A 4P32A 3TNLA 4LZZA 1BE1A 4FD3A 1SKYB 2ZYGA 1PSDA 3MJDA 2BKLA 4OUDB 1IN7A 2BEUB 4U2FA 3OHPA 2WDZA 5B1IA 4PFKA 1CRWG 2PK3A 4NSNA 3WSTA 1UZUA 1Y9ZA 1ZH6A 2AV6A 2C4KA 4HMOA 4J7CA 4JYPA 2IYTA 1GV1A 4MDEA 1CNEA 1L5GB 3L74J 5ICEA 4CDMA 2HIHA 3IH5A 3DZBA 1RF0C 2PUEA 1B2LA 1EZVG 1F8FA 1QIKA 2OL4A 2P78A 1UC9A 3PKZA 3GG9A 3R6WA 4LHSA 5F1OA 4ZAZA 4DHWA 5K0NA 2WD9A 7YASA 2V9CA 1QCYA 5BRNA 4EKNB 1PTJA 3JW8A 1RCFA 2BAGA 4O4LA 3ZZUA 1UKYA 5HTOA 2VEDA 2IYQA 4FDLA 4O1HA 3T7TA 2WQ7A 4DPLA 3V55A 4W7YA 5SZHB 1I6MA 4CL2A 3ZE9A 5LSAA 2YKGA 2BE9A 3PPYA 4TZTA 3TEMA 1PNVA 2X1VA 4V1CI 4MDFA 5F77A 4ENSA 1V7ZA 1LWUA 5KYYA 5HIMA 3WKEA 1C1DA 2O2XA 4ZOLA 4PQFA 3FCXA 3DNPA 2ZUWA 1DJPA 1V4VA 1GNVA 1M0SA 3L4BA 4DC1A 1MP0A 3JQBA 3L7MA 3ZJTA 1K06A 4RJLA 2HWUA 1L4EA 1VECA 1P84I 2PZGA 3M1YA 5BR4A 4IV8A 2DP4E 1F2DA 1I2CA 2WNIA 3R7NA 1PP9D 3P4UA 3TSYA 3K6SB 4GW3A 2CT8A 1DX9A 1NXWA 4NE2A 3FYSA 2A5GA 3DC7A 1TAHA 3LQFA 2ODAA 1RRMA 2AOUA 3EB9A 2ZSEA 4B4UA 3QU4A 3B12A 2ABWA 1ZRTD 3CC2P 5TISE 4RTNA 4OH1A 2PH7A 2AR7A 2IZ5A 2NOGA 4PX3A 5CDSA 3IBCA 2FA9A 2PZFA 4R4MA 1DT3A 1ZOIA 1QFXA 2P2DA 4NMMA 3WGGA 2PP6A 1NUPA 2WINI 1L0BA 3JATA 1YJ9P 2HLNA 4ZEMA 1USUA 2VXBA 3TVDA 1EFKA 2IHZA 3O4IA 4JNCA 3G2QA 1TA9A 2OOKA 2Q0SA 1U2ZA 2RSLA 3JARA 2GTPA 2VH1A 2GZDA 3GA7A 3CLSC 3GY0A 3MG9A 2VDUE 3QBTA 1C8BA 4TWJA 1UINA 2XV5A 1WOYA 3A6FA 2LV8A 1HYGA 4YYEA 4EI2A 4QC2A 1KB9E 3BZBA 3NBAA 4B3RB 4M83A 1M2JA 4BNZA 3EFFK 4WADA 2JHGA 3NGXA 4F2HA 5LDGA 4URYR 2WJ4A 1U9YA