2ZYAA

Dimeric 6-phosphogluconate dehydrogenase complexed with 6-phosphogluconate
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
465
structure length
465
Chain Sequence
SKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDACAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-phosphogluconate dehydrogenase, decarboxylating
publication title Conformational changes associated with cofactor/substrate binding of 6-phosphogluconate dehydrogenase from Escherichia coli and Klebsiella pneumoniae: Implications for enzyme mechanism
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 176
structure length 465
sequence length 465
chains with identical sequence B
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2zyaA02
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 2zyaA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zyaA01
2E6UX 2JAHA 1Q7GA 1PTJA 2R2GA 1BRMA 1CEQA 4NMHA 2X0JA 1V3UA 5A1TA 4I5FA 2ZCVA 1VKOA 1MB4A 3UICA 3BTOA 1EE2A 1E5QA 4IINA 4J7UA 3VTFA 5HM8A 2IEBA 2HMTA 3K8ZA 1FDTA 2VUTA 2PV7A 1PZGA 2Y1OA 2P5UA 4CM5A 1U8FO 1XHLA 1P9LA 5HS6A 3IP3A 4Y6PA 5KCZA 1GADO 3QLJA 4RVSA 2VN8A 5L4LA 3W4KA 4M55A 1Z73A 4XYBA 3ZV3A 1Y1PA 4FS3A 2W98A 1UAGA 1E1LA 3I6QA 1RWBA 2Q2QA 1BSVA 3RFTA 1YDWA 2IE0A 1IHXA 2XXJA 1YRLA 3AOEC 3LF1A 5AOVA 3RAJA 3DZGA 1U3UA 2C2XA 4DLAA 4E33A 3DR3A 4FFOA 3EGOA 4BGIA 5EMHA 1D1TA 4N18A 4RQTA 4LRSB 3ETDA 3OA2A 4FOOA 2VHWA 2HRBA 2EEZA 2Y67A 2IDZA 4BNGA 2I99A 1UJMA 4QO8A 4RPGA 1UUFA 2DBZA 4AJJA 1EFKA 3D5TA 3Q6IA 1XU9A 4JX8A 4PIVA 3GAFA 2PZMA 5TRTA 3CTMA 4CM4A 1KVRA 5DN9A 1U28A 3GQVA 1GU7A 1FJHA 3ROPA 2C0CA 1PJ3A 3WGOA 3I6IA 4INAA 5L40A 2VTDA 3GDFA 4XJTA 2WE8A 4YT4A 3AI1A 2Q1WA 4KQWA 5IZCC 3KYCB 3FCOA 4GI2A 4ZA2A 1I2CA 2BKAA 4RF4A 4E5PA 3TRIA 2OP1A 3IKVA 2I3GA 2NVWA 1R6DA 1VPDA 2O3QA 4HNGA 5HS4A 4FFPA 4WECA 5T67A 1DLJA 1ISFA 3RJ9A 5C7LO 3UCXA 3DOCA 2CY0A 1DDOA 4CR7A 3IAHA 2H6EA 4KWIA 4R41A 1VSVA 3RFXA 2VYVD 1ENOA 4AJIA 4U8GA 5GZ6A 2Q2WA 5I7SA 3M2PA 4M89A 2CFCA 4ALJA 2HCTA 3O8QA 5CPFA 1R4NB 3KUXA 1P1IA 5DCWA 2HJSA 1NHWA 4FSHA 3WDSA 3D4OA 4YEDA 5DZSA 1E3WB 5CDUA 5L7TA 2AQHA 4CR8A 4XDYA 3CMMA 3W8FA 3GGOA 4QUKA 2GLXA 2Q45A 1XA0A 4YPOA 1JU9A 3ZHBA 2GASA 1JVSA 4FJ1A 2WTBA 2I76A 4ZQGA 1GQ2A 4OKIA 5A06A 1CF2O 5DULA 3WBBA 3NTOA 3NGLA 4RV9A 4TSKA 3TFQA 3C7DB 4CUJA 1EQ2A 4CMBA 4NJMB 3P7MA 3ZZNA 5KJ1A 4KZPA 3VTZA 2G1UA 4L9RA 4C4OA 3MWEB 3B20A 2NNLD 2D5CA 3HNPA 4LK3A 3ST7A 5F21A 1HDOA 1HT0A 3LT2A 4TRMA 4U0JA 5EQFA 3WLFA 3BMCA 4OXNA 4C7JA 3KXDA 1VJ1A 4RVDA 3ENNA 2EG9A 3JV7A 1JA9A 3RUCA 2NTNA 3TOXA 4D79A 3TFOA 5H82A 3DMYA 5FFFA 2D1YA 2XPCA 3VAZA 4DBVO 1P1FA 4WJZA 4L75A 1EVIA 1GEGA 4QECA 3E9NA 3JQ7A 4DA9A 1B8VA 1YJQA 3GDGA 4MVJF 5CG1A 3VVBA 5JAZA 3G0OA 3DTTA 4FDAA 4A03A 3ZWMA 4ALMA 3W4JA 1KBZA 3W1VA 1YDEA 1A7AA 2W2LD 2O4CA 1MG0A 2YFHA 3F5QA 4OMUA 4J2OA 3KLMX 2X8LA 1XLTA 4DQXA 2P4HX 5BQFA 4RF2A 2PY6A 4IXWA 4NU5A 3HHPA 3NDJA 4CLXA 3W4IA 3GZNB 4BNLA 4RVFA 3PJGA 3K2EA 5K6AA 1QR6A 5U9CA 4NFSA 3WS7A 2OXIA 3RJ5A 2EKQA 3DXFA 5C7OO 3DOOA 2VOEA 3L6OO 5DCYA 2I67A 1IL0A 5EPOA 4Q9NA 4R16A 1I30A 4JBGA 4B3JA 3V2UA 3H3JA 2FR1A 2FY8A 1JDJA 3SX2A 2EF1A 2Z1MA 1LSJA 1LSUA 1NQTA 2VHZA 4BNMA 4WK6A 4DTIA 3NKLA 4NK4A 2ZTMA 1CERA 2UUOA 4YDRA 3EVTA 4H7PA 1HLDA 1XQ6A 1K6JA 3PYLA 3I9JA 2YYYA 3NRCA 1R0SA 2HUNA 4R5HA 3RASA 4PZEA 2PR2A 4E2XA 3WQSB 3E82A 4IIUA 1JN0A 4D46A 1UP7A 3KZVA 1W6UA 3DAGA 3RWBA 3P2YA 2BMAA 2O3TA 4IIVA 4RO0A 5B37A 4URFA 1X15A 1YXMA 4W82A 4D45A 1SMKA 4FR5A 1O89A 4QO7A 4IQGA 2V6MA 1T2DA 3NT2A 1GYRA 5MDHA 2H1SA 4I08A 4XQCA 1M76A 1Q0LA 4CLRB 1QV6A 1NWCA 1QYXA 5G4LA 1WXDA 1Y9AA 4JJGA 3STHA 3T4EA 2Q4BA 1EVYA 4UVEA 3RUIA 1PGJA 1CDOA 5JC8A 5KOIA 2IXBA 4CL8A 1Q0QA 1C1XA 2XF8A 1KEUA 1K2WA 2VQ3A 4PLCA 2Y93A 4DXHA 3PJEA 2VRBA 1I3NA 1UH5A 5JS6A 3K92A 2JHGA 2GD1O 2DPHA 1XSEA 1YB1A 5I7VA 4NDNE 1BHSA 4B4WA 3GHHA 4E5KA 3WSVA 3BA1A 5IDWA 4IJKA 1I10A 2O23A 3I1JA 1I3LA 4CQMD 4FCCA 3HSKA 3PHHA 1E1KA 5COAA 4YWJA 3WQRA 1GD1O 1U2DA 3HFSA 2BFMA 3C8MA 3FBGA 4LCEA 3RBVA 2A92A 5ITWA 3RSHA 1WDLA 1BW9B 1KERA 3JQGB 4W6ZA 5IN5A 3UAGA 3QVXA 2HLPA 1AXGA 1ISJA 5ER6A 1WDMA 3JQCA 2PH5A 3NGXA 5EESA 4BO9A 2CZCA 4AJEA 1GQYA 5IAAA 4BNXA 1AXEA 3MZ0A 1E7MA 2I6TA 2EGGA 4IZIA 1WVGA 1OFGA 2HK9A 4R1UA 2NTJA 4JK3A 4NNJA 4XQGA 1EBFA 1YJ8A 4BO6A 2B69A 1O0SA 1SPXA 3PDJA 4JNKA 3H9JA 4N54A 3LSYA 1A27A 3ZWPA 1LA2A 3L4BA 3ABIA 1YO6A 4H16A 2FP4A 1N1GA 2VHYA 1TT5A 5CP8A 1U4OA 4J1TA 3PHLA 3DWFA 2OOSA 3IJRA 3DHNA 2YDYA 3QWFA 4AJ2A 1Y8RB 6ADHA 4IS3A 1EE9A 3A4VA 5JMWA 4XWYA 2QQ5A 3D3WA 3NDIA 1UXIA 2GRAA 4OSOA 5IDQA 4P4LA 1GUFA 4HFJA 5IDXA 7MDHA 3DZIA 3KOUA 4QTZA 1G0NA 4Y6RA 3TZHA 1EEHA 1ZSNA 2YV1A 4CV1A 4MVJM 5IDYA 3PP8A 4MVJD 4G2NA 2CVQA 2HKIA 3F4BA 1YB5A 5GZ1A 1U5CA 1PS0A 3V2HA 4FFLA 4WKGA 3ZW8A 3DZFA 4OH1A 1E7RA 2UAGA 4XCVA 2EP7A 4BVAA 4DIOA 3GRKA 1PL6A 3OBBA 4HFMA 2FPPA 3GEMA 3ZV6A 3CXRA 1HZJA 3PVZA 1L7DA 4EJMA 5KVSA 4OJNA 3COSA 1EUZA 3EYWA 3I4FA 1FDSA 2YY7A 4BV9A 4ESOA 2E37A 3OA0A 3OIFA 1P74A 3MCVA 3M6IA 4L0QA 1RYDA 3EAGA 4TROA 2C82A 5KKAA 1E3IA 4YJHA 5COBA 3C7CB 2BI8A 1Y5MA 3Q11A 2WYUA 3R3SA 3S2IA 1ZEJA 3ZWVA 2Q3EA 1J5PA 3B1JA 2ZQZA 3PQDA 1E7QA 1BTOA 2PD3A 2D5AA 2O7QA 4WLOA 1IY8A 2AQIA 1ISIA 3KB6A 3NT5A 4BGUA 3I9OA 3PDUA 2A9FA 3LQFA 1DFIA 3NYWA 1WMBA 5ENDA 4A7PA 3KLPX 3SJ7A 3T7CA 4E2ZA 1ADBA 5BSEA 1O9BA 5KVVA 2V6BA 1YOVA 5TF4A 4J16A 1GQQA 3QWAA 3S2EA 1VJTA 2UVDA 2WJPA 1XCBA 1HSZA 4DRYA 1R4MA 1ZNQO 2PGJA 5TJHA 2JFHA 4CQMA 2DUUA 3JD2A 3H9GA 5BSFA 2P5YA 4P8RA 3GLQA 3LC1O 4W9NA 1E77A 3WX0A 3OH8A 4Z0PA 3TZCA 3VHRA 4PFJA 3QWBA 5A04A 1LC0A 2J5KA 5ICMA 4Q3NA 4FGWA 3MJEA 2ZTLA 3IC5A 1Y81A 3GK3A 3IIEA 2IYPA 2BI7A 4PG8A 5I7EA 1N8KA 2TMGA 4JIGA 1X1TA 2NTVA 4E12A 5G4KB 1C0PA 1N7GA 3DONA 1OBFO 4LVCA 1YQXA 4WLNA 1LRJA 2NQTA 3DMTC 4TZTA 4BNYA 1RM5A 1M66A 4KUHA 2D59A 2FPIA 2C59A 3JQBA 1YQDA 1A9YA 2BRUA 3D7LA 4A27A 1BXZA 4J90A 2AXQA 2F00A 1NPDA 3PJDA 4NR0A 2GR9A 1H9AA 1N9GB 3WGGA 5AXCA 4Z0TA 3KYDA 5FI3A 1KIFA 1PQPA 3A1NA 1U1IA 3E03A 3I52A 3VZSA 3I9LA 5CPBA 5B1YA 1DFGA 1X0XA 4YAKA 4MVJA 1P1KA 4CLHA 1D7OA 2OFPA 3MOGA 4RCVA 4NG5A 3WJAA 3NT4A 3DDNA 1QMGA 2DFVA 4E21A 4YT8A 2JFFA 3OJLA 5A9RA 2OHXA 4ND4A 5B4VA 2EW8A 5FWNA 1PL7A 1UDCA 4RQUA 3TZKA 1IB6A 1Y5RA 3VKVA 4ALLA 1BG6A 2NU7A 3MTGA 4RGBA 1HKUA 4HXYA 5CDTA 2PKQP 2JCXA 1VL0A 4R5MA 3RVDA 1EZ4A 2X7HA 3U09A 1I5RA 1LLDA 4RZHA 3BHJA 4N5LA 4Z3DA 1O6ZA 3DQPA 2O3RA 3ZGYA 4MKXA 1ZZEA 1ULSA 1F8GA 2YV3A 3BMNA 3AU9A 1DC4A 1QORA 2ZCUA 1X7HA 4ND3A 2PKQO 3KEOA 2NLOA 4BKOA 1PS9A 3BXXA 3IQDB 3ON5A 1E0DA 1PJLA 3F9IA 2J3JA 4WLFA 3IKTA 1X7GA 3QVWA 3D0OA 4PCVA 1TA4A 5T8KA 1H0KA 1LLCA 2H5LA 1QYWA 3GNTA 3IDSA 1D3AA 1I2BA 2B0JA 2ZB7A 3NTQA 1PEDA 4IS2A 3GH3A 1F0YA 2DU8A 3KRTA 1LBEA 1Z74A 2X23A 3H5NA 3WJ7A 2XXBA 3MJTA 3QP9A 5EERA 3WGYA 3PZBA 1GUYA 3K31A 4YXFA 4K6FA 1LXCA 3KEQA 1P1HA 2NQ8A 3V2GA 2GZ2A 3RUFA 4FPXA 1ZK0A 1E6UA 5C3MA 2J3HA 1NVTA 1H2HA 1O95A 4XJSA 3JQFA 3DHEA 2XOXA 3JQAD 3VH2A 1CETA 3EZYA 3OETA 3R6DA 3E18A 4UVGA 2ZB8A 4BNUA 3ONEA 2QZZA 3ZI0A 4I9HA 4WASA 1T2AA 3OMLA 2DQ4A 1GDHA 3N74A 3RBXA 1V8BA 2X86A 4Z9YA 4IJUA 4CMIA 3L9XA 5JDCA 1U2GA 1AVYA 3OM9A 4KOAA 3QVTA 3RROA 4YAGA 1QLJA 4FBGA 3AFMA 3ZH2A 5CEFA 5JY6A 1O94A 2E49A 5TS3A 1K5HA 5I9NA 4CMAA 3IUSA 3Q9UA 1M75A 1G1AA 1JVBA 4E30A 4FOSA 3KSDO 5JAQA 4E0BA 1B3RA 1JTVA 4Y67A 2VT2A 1R0LA 1I8TA 2DM6A 5JNLA 4UUNA 3RC7A 4EW6A 3MJSA 4AJNA 2WDZA 1X14A 1Q0HA 3JYLA 2O50A 1FK8A 4A26A 1NQOA 1UXGA 4LSMA 3ZU4A 3FSRA 4HY3A 4CPDA 3OSUA 4OOEA 3LT4A 4D3DA 4GKBA 3BTUA 3JQ9A 1PJCA 3RIHA 5B4TA 2H63A 3ORFA 4XZ3A 4ND1A 2YFQA 1DXYA 5LDGA 3OJEA 2B5VA 4NJOA 3I3OA 1Y8QB 4HFNA 3JD4A 1TT7A 3NV9A 4EZBA 5TT1A 2X0NA 1M6WA 3ZWAA 5G0UA 1J6UA 4MKZA 3ZNNA 4YRBA 5KJCA 4IXTA 2NSDA 2D0IA 1E3JA 2WD7A 3GY0A 2B37A 3PLRA 2VYNA 4OYRA 3SXPA 4I5GA 2AG5A 4CLEA 1MC4A 3GGGA 4MIOA 4YQYA 4BB6A 4XYMA 5A9TA 4FB5A 2HMVA 2EXXA 4F6LA 4K28A 5JMPA 5BR7A 4OO3A 4XA8A 1F17A 4CM6A 1BXGA 2HK8A 4WLVA 5TSDA 4MOWA 1ENYA 4J4TA 2CSUA 3LF2A 2POQX 4PLVA 1DC6A 3PZRA 2GCGA 1SBYA 2VWPA 4KDFA 4XR4A 3SVTA 3MTJA 4R51A 4B7UA 4OXKA 2IZ1A 3AM3A 3D5QA 4B4VA 3G17A 1ZXBA 5TQVA 3GVCA 3B6ZA 1W73A 2GF2A 4GBJA 1PIWA 2WSBA 1C3VA 4GSKA 2ZIZA 2EJVA 3WG9A 1PGQA 5JO0A 1DAOA 1R66A 2VRCD 3JQ8A 3L6DA 2E4AA 2X0IA 2AA3A 1DFHA 3GNQA 4Q3DA 4WOKA 3V1TC 4DC0A 1W8DA 4MP3A 2QW8A 2Y0DA 1BDMA 3OJ0A 5L7WA 4K26A 1LNQA 3D3EA 1PJBA 8ADHA 2DTXA 2EKLA 1LI4A 5A3JA 1LLUA 3PYMA 4M87A 3WWYA 3BTSA 5EL0A 4E5MA 1WWKA 4G81A 4ZHSA 3AUTA 1JW9B 2GZ3A 4DLLA 5CDSA 3B1KA 3W8EA 1XYGA 3WMXA 5CG2A 1PZFA 1MV8A 1SC6A 3JQAA 3LU1A 2JFGA 5K6AC 3BHIA 3EZLA 1BXKA 1VSUA 2DAPA 3BMOA 3GMSA 3EVNA 1QLHA 3M1LA 2P68A 1I3MA 1OOEA 4JROA 5G0WA 2ZQYA 3PYXA 1CJCA 5A05A 4Z3KA 1SZJG 4J43A 2BELA 5TNXA 3DBHA 3RUEA 1GV1A 3VZQA 4OQYA 3IL2A 4F45A 3HWRA 4GL4A 2EGHA 3JYPA 4HKTA 2F1KA 2QRLA 6LDHA 2EERA 4ILKA 3AUAA 3GFBA 4L4SA 5A9SA 2WWRA 2Y0EA 4IPTA 5EN4A 3C24A 4CMEA 4BO0A 3DBLA 5JO9A 1E3SA 4YJFB 2FHSA 3GVIA 5KVQA 3UH1A 5DNAA 1NPYA 2OUIA 3DC2A 3GA0A 3VPXA 5IZ4A 1PX0A 3WNQA 3ANLA 1EFLA 3CEAA 1H9BA 4DBZA 1ISHA 5I9LA 3I5MA 3E8XA 2ZTUA 3M1AA 3MJVA 1E6WA 3TL3A 3OF2A 4LMPA 3ZWWA 4JXKA 3RKUA 2AE2A 4G65A 4NPCA 1B8PA 2PFGA 4IUYA 3F46A 4W99A 4H15A 3RU9A 4AFNA 1P1JA 5DCUA 3BMQA 3K2BA 3IP1A 4IJWA 4OOFA 2GGSA 4A2CA 1A4IA 1I0ZA 4Q39A 4WCFA 1ZBQA 1HDGO 1UZLA 4BKRA 1UZNA 1XEAA 1HTBA 2Q50A 4FW8A 3SC4A 1NM5A 5T6BA 5DBIA 3S8MA 1ZSYA 4FFNA 4BGVA 4CMGA 3FPCA 5CHEA 1HYGA 2NVUA 4M8SA 5FF9A 4YAIA 3WQQA 4HP8A 4N7RA 4ZRNA 4J6FA 5DT9A 1PQWA 1PWXA 1VC2A 2X9GA 1V3VA 3PWZA 3PJFA 4TWRA 2PGLA 4XDZA 5F1OA 5JFOA 1RM3A 1MA0A 2I9PA 2ZTVA 3O38A 5CFZA 1I01A 3WOHA 1W4ZA 3UW3A 4EUFA 5B4UA 2HO5A 1X13A 4TRRA 3F47A 1E92A 2AQKA 5ENVA 1UAYA 3LK7A 4I9UA 1ZK4A 3ICPA 1MX3A 4GSLA 4NH4A 1ZH8A 3GOHA 3INRA 3ZWXA 2CVZA 1V0JA 3GVXA 3AWDA 1XWFA 3ANMA 1U3TA 5BNIA 4GGOA 4L4XA 2JCYA 4E3ZA 1VL6A 1IPEA 3ONDA 1ONOA 4YVFA 4N5MA 4B4OA 1ENPA 4I5DA 5IJZA 4O63O 4TVOA 2PWZA 5AXDA 1N5DA 3X2EA 1V35A 2YHIA 1UR5A 2EV9A 1Z82A 1ULUA 4LN1A 4R1SA 4RLHA 5L7YA 4BNIA 1TT5B 4YJGA 4D44A 2B83A 2X9VA 2EHDA 3EMKA 3L4BC 5EIOA 1Z75A 2ZATA 4CMCA 2JD1A 4WGGA 1OI7A 3KM0A 1WP4A 2J3KA 3UCFA 1QKIA 3SBOA 3QW2A 3WFJA 1B16A 4WLUA 4ND2A 5C37A 3DEYX 3QRWA 4PLPA 4U0KA 1PJ2A 3T7EA 1NR1A 2B35A 2BGKA 3ASUA 3N58A 1GUZA 4EYEA 5LDHA 2W90A 1DRWA 2PD4A 3CPSA 4QXMA 2P91A 3FNFA 4XIJA 2IYOA 3L77A 1EVJA 4XX0A 3I23A 5LC1A 1SEVA 4A0SA 3RD5A 3HN7A 3CTVA 1HDCA 3GDOA 3MJCA 4JP2A 4IDDA 2AEMA 2Z1NA 3KTDA 5C5IA 4KMSA 2GN4A 1NPTO 2Y1DA 1DO8A 4WCDA 4BO3A 1DIAA 1L7EA 1Y9EA 3LC7O 1B26A 5DF1A 5C7IO 3U3XA 3O4RA 2VYVA 1K3TA 4XGKA 2NU9A 4XGIA 3GUYA 4PLFA 1QG6A 2YZ7A 1H93A 3KYCA 1I2ZA 3KO8A 3QIVA 1VLLA 3H8VA 4U5QA 4BHTA 1EK5A 4YTEA 4L4RA 4YRDA 4YJDA 5JDIA 4BS9A 4IDEA 1TVEA 4ZN6A 3O9ZA 3VH1A 5EQDA 3H3FA 3EY4A 4PN3A 3WIEA 4XYGA 3ENKA 1PZEA 3C1OA 3CKYA 1WNTA 4XQ9A 5JW6A 4O6VA 1P33A 2PK3A 3FTPA 5JYEA 1B15A 1YOVB 3VDQA 2O3UA 1ZUD1 2FR8A 2PZLA 1HLPA 3DTYA 4DMMA 2J5QA 3GR6A 1HZZA 3WGZA 1E3WA 1I3KA 2Q4EA 4MVJI 2GYYA 4B8WA 1XQ1A 1H6BA 3CZMA 1EUCA 1WAMA 1XELA 5J23A 1GTMA 1JLLA 1PJSA 4XEHA 3BTVA 4J2HA 4BO2A 3R0IA 4RVGA 5JCJD 3RFVA 3PHJA 1MLDA 5L51A 4W9NC 4EEXA 3TN7A 4PG5A 1Z45A 4YT5A 5ILGA 4ZRMA 1Q7BA 4NJMA 1I36A 4YAJA 3ZN2A 4K1LA 2G5CA 1ZCJA 1IE3A 2Q2VA 3PHGA 4XB1A 4JQCA 2OORA 3Q1LA 2QX7A 4F6CA 3ITDA 4L8VA 4UEOA 1EDZA 4ZQBA 4MVJE 3UXYA 1MFZA 3CH6A 2W2LA 1XGKA 3WTCA 4CJXA 1E1NA 3JD1A 2X0RA 5L4SA 3AY6A 3H65A 2QYTA 3DBRB 4YA6A 1U3WA 1U7HA 1WLYA 3G1UA 3WLEA 3PWSA 1X1EA 3JQBC 3IUPA 3D64A 1GEEA 3HDYA 2W2KB 4LCJA 5F3RA 4D7AA 3D1LA 1HDZA 3L0DA 4Q3BA 2HQ1A 1DHRA 4BNVA 1PWZA 2SCUA 3SC6A 2NU6A 4HNHA 4CQLA 4DWVA 4RLSA 5HTOA 1LDMA 1HRDA 4QQRA 2IEDA 4HUJA 5A4DA 3FPLA 1GPDG 3GZNA 4XB2A 3UF0A 1KC3A 2PA3A 1GL3A 1JQBA 2AMFA 1LDNA 1NVGA 2GN8A 4GVLA 4IQ8A 1UDAA 4CUKA 1T24A 3ROQA 3ZW9A 1DIGA 3PIDA 1MFPA 2NADA 2VTEA 2UV8A 1YVEI 2ET6A 3WBFA 2DTEA 2WMDA 1BVUA 3AK4A 4H3VA 4I1IA 4UVIA 1C0IA 3WGQA 5THQA 4RPJA 5T64A 4I8XA 2ZB4A 1GZ3A 1HDXA 1V6AA 2IZZA 1P45A 5T5QA 3ULKA 1D4FA 3DAPA 4CV3A 4PZCA 4D0SA 3TWOA 4EITA 1IZ9A 1XIVA 2J6IA 4IGEA 3S1LA 2IODA 3FWZA 3FF4A 4BKUA 4BKQA 3JYNA 1AE1A 4L76A 5DOZA 1YBAA 3FNEA 4FC7A 2VHVA 2AE1A 1QYVA 2I65A 1XR3A 2FR0A 1BGVA 1UXKA 4KWHA 2BH9A 4MVJP 3W6ZA 2CF5A 3DFUA 3S2FA 2WYWA 2Z5LA 3PIIA 5TLSA 2C5EA 1OC4A 4DMLA 2Q1TA 4DL9A 4Z0HO 4ZQFA 2G76A 4FIZA 2YUTA 4B7CA 4YR9A 3ZWYA 4J91A 2CMDA 4BIIA 5KJFA 4CLRA 4YB8A 3D4NA 3IOYA 3PHIA 4J4HA 5T8KC 3DZHA 1UXHA 4GPD1 3DL2A 5IXYA 4J0FA 1SEPA 4RZIA 5A5FA 2DVMA 1K6IA 1C1DA 4ROSA 5JAMA 4DPKA 4EDFA 1YL5A 1LRLA 3I9KA 2CF6A 3S2GA 1QXSA 4IM7A 4Z6KA 1DC3A 4XIYA 4BNTA 1LEHA 2O2SA 4PLHA 3K96A 1OC2A 4KDEA 3UVEA 9LDBA 4B7XA 1VE9A 4QFCA 2DBRA 3LVFO 3MOIA 4KP7A 3JQFC 2ZYDA 3F1KA 2AG8A 4BNHA 4DQUA 3TDKA 4M54A 4YYZA 1XU7A 1NFFA 3AJRA 2NWQA 2J3IA 3WYEA 1A9ZA 4IMPA 5A03A 2YV2A 1J49A 1P0CA 3Q2KA 3I83A 3HE3A 1DJNA 1BW9A 2OBYA 4B3IA 5HWSA 1E1MA 5JDCC 1IUKA 4PG7A 4W7IA 3NTRA 1HL3A 3QE3A 4YACA 4S1VA 3VZRA 3ZV4A 2EW2A 1IPFA 1ZMTA 4XRRA 2A94A 3GEDA 4M1QA 1AHHA 2WD8A 3I9MA 1P31A 3GVHA 3GMDA 4BO4A 1YL7A 4PLYA 2GSDA 4GX2A 4MP8A 4ONEA 1ZJZA 3QVOA 3RU7A 3WWZA 5F5NA 4DPLA 4BMNA 1PGOA 3JCZA 4XGNA 1MXFA 4DUPA 3GG9A 4R69A 4BUCA 1EQUA 1NP3A 2X5JO 2BFPA 3CINA 1NAIA 2JD0A 4BQRA 5TGDA 5THKA 2CNBA 3JQ9C 3U4DA 1HE3A 4QEDA 2UYYA 4J9VA 4CLOB 3PWKA 1KY4A 3FR7A 4AJ4A 1HDYA 3FRJA 2RIRA 2IRWA 1Q2XA 3WB9A 3KVOA 2OGUA 4J1NA 1ZVMA 4JBIA 1JWAB 1RKXA 3INGA 4GKVA 1HE5A 4TQGA 5IFLA 3GNSA 4BNFA 2X9NA 4A73A 2BHLA 3OJOA 1MG5A 3GF4A 1QRRA 3I9NA 1EMDA 4EUHA 1U3VA 4DLBA 3I4CA 4LW8A 1XG5A 2GN9A 4MVJG 1MUUA 4QFDA 1U7TA 1J0XO 2BD0A 3H9QA 4ND5A 5F5LA 1NWHA 5GMOA 4O5OA 1A72A 4CM8A 1Z7BA 3AI3A 4J0EA 1P44A 1MXHA 3EC7A 3GN2A 3HQ4O 1Y6JA 2R00A 2NVBA 4R1NA 1WZEA 1DSSG 3UOGA 4EJ6A 4QX6A 3FD8A 1PR9A 1GZ4A 3GFGA 4MIEA 4CM1A 1NNUA 2HAEA 3OFSA 5L45A 1HYHA 4NBWA 4YRAA 4PRLA 5GZ3A 3RQSA 1S7CA 4YBZA 1T26A 3QSGA 5EINA 3VOSA 3OHSX 4GVXA 2JCVA 1MGOA 3JTMA 4GAEA 4W7HA 3INTA 1JWBB 3G79A 4E5NA 2C5AA 3PEFA 4NFYA 5I9MA 1LSOA 4RPLA 3T4XA 1YBVA 1V9LA 2D3TA 4CV2A 1ISGA 2WM3A 4EBFA 1KOLA 3V5NA 3OQ1A 2YDXA 3KSZO 3TSCA 3F3SA 3E9MA 3GG2A 2DT5A 4J1SA 4LRTB 3QJ5A 5COQA 1I32A 1KVSA 2CDBA 3VH3A 4CM4B 2ZYGA 5DP1A 4RL6A 3ZHYA 2QYSA 3A28A 3D4PA 4Q3AA 2HDHA 4ALNA 1FDVA 3JQEA 2Z95A 3HB4X 4RORA 4OQZA 1ZMOA 4WNIA 4NBRA 1Y7TA 4KQXA 1AHIA 5HA5A 4GH5A 2PZJA 1IHYA 1GPJA 1GYPA 3E6AA 3HDJA 4IDFA 3KV3O 1ZEMA 2BFAA 5A9SB 5L4NA 2RBEA 1FF9A 3ZHXA 2LDXA 1VKNA 2VNSA 1YKFA 4EUEA 3RC9A 1HXHA 1GCOA 2X6TA 4AJKA 4EGFA 1VJ0A 4O59O 1DPGA 1MP0A 4BNKA 4CMEC 3W8DA 3VVCA 2X22A 4UEJA 3QWHA 5G4KA 2A35A 3O8QB 4OSPA 2B5WA 1QYCA 4W4TA 3U4HA 1CQIA 2DLDA 4ZU3A 3ETEA 2Y99A 4NIMA 1TB4A 3TPCA 1ZK1A 3VPSA 3RC2A 1ZW1A 3ZNPA 7ADHA 3TJRA 1HYEA 2G17A 2V6FA 3LT1A 4NHEA 4EI2A 1JAYA 1N9GA 1W0CA 3V1YA 1ENZA 1LDGA 3ANNA 5I8WA 4BKPA 1LJ8A 5CDGA 1CQJA 1VI2A 4PGFA 3LDHA 5L95A 2ZYAA 4JN6B 1F06A 4WCFC 1DIHA 3IS3A 2V7PA 1UP6A 5JY1A 1GR0A 2AQ8A 3ZWNA 3LT0A 1ORRA 1NXQA 1SCUA 3ZU5A 1RM4A 4E6PA 1B2LA 3U4CA 4XD2A 2AEFA 4BQPA 4WEOA 3SEFA 2JL1A 3W6UA 3BMCB 2VZ8A 5AYVA 2X4GA 3JYQA 2HSDA 5ITVA 5TX7A 4ZQHA 3WGIA 4BNJA 1KYQA 4IBOA 1ZK3A 5TC4A 3U49A 1P0FA 4R4JA 3SJUA 5L53A 3O26A 2Q49A 2YHUA 4U6SA 5AXBA 2LDBA 2RCYA 3CE6A 3JQ7B 1L1FA 5ICSA 5B12A 4IDCA 3WIDA 3R3JA 2ZB3A 4UAGA 2FWMX 2YHIB 3GGPA 5IF3A 3ZDFA 1NQ5A 1HE4A 4YJGB 1C14A 5KJEA 5ER9A 2CDCA 4HWKA 3DOJA 4IDGA 3LZ6A 2EP5A 3GPDG 2YJZA 4CV0A 1B0AA 2B4TO 3NAQA 3P19A 2I5PO 1NX6A 1KY5A 3K73O 4P4NA 3DZJA 1T25A 3WFIA 1YE3A 3C1TA 4HBGA 2QG4A 2OBNA 4XYEA 3VPFA 1EDOA 4CMKA 4YAEA 2VT3A 3KETA 3F1LA 3PQEA 1PR3A 2GUGA 1YWGO 4XR9A 1OMOA 1ZFNA 1NAYA 1PU2A 3C7AA 1FMCA 3GN1A 5HRUA 1DEHA 2VWHA 5JYDA 2RHRA 4L73A 5F1PA 3DZBA 2WE7A 3BHMA 1S6YA 2D8AA 3FR8A 4PRKA 3FN4A 2FSSA 4P38A 5BNFA 1GV0A 2NV6A 3QY9A 2OO5A 3L07A 4IGFA 4D43A 1IULA 1I24A 4CMHA 3H2ZA 2C7GA 2PTGA 1E7WA 2E82A 4R3NA 4CLDA 2JJYA 3P2OA 4LMRA 4M86A 5JE8A 1DB3A 2J8ZA 3K6JA 1N92A 1SOWA 3K30A 3Q2IA 1NTOA 1E7SA 2CUKA 3FI9A 2DKNA 1KVQA 1R16A 1J4AA 2X5OA 3U62A 4FJ0A 5JDIC 4MO2A 2X1HA 3KBOA 1R12A 3OEWA 3ZNOA 1YS4A 1C1XB 4PVDA 3AM5A 1NASA 5A02A 3HN2A 3DB2A 3H6KA 1PSDA 4GLOA 2CVOA 1O8CA 3RBZA 3H4VA 4Q3CA 1QSGA 3ZNQA 4BL5A 4CMJA 4XRGA 2Y0CA 4BMVA 4E2YA 5TT0A 1JKIA 4FC6A 3FNGA 5JPIA 1PJQA 1CWUA 1SNYA 1FDWA 3PGJA 2Q1UA 3FWNA 2EWMA 1ZSVA 1ZXLA 2GN6A 3DHYA 3H5AA 3EDMA 3CSDA 4DQVA 5DBGA 3DZKA 4RPHA 3QWIA 1Y8QA 1Q1NA 1OX3A 3ADPA 4AL4A 2W8ZA 1DIRA 4HV4A 2HMUA 2VWGA 3UGKA 2V6GA 4BGEA 2FSVA 4LVUA 4PLZA 3Q9NA 1P1RA 2BF7A 1X7DA 3C1AA 4S3MA 2QIOA 4GX0A 5LCXA 1ONPA 4BB5A 1TLTA 4TRNA 3ONFA 2JD2A 2BGMA 3OQ6A 3QV1A 5CAEA 4LISA 3M2TA 2VRCA 2FZEA 5BSHA 3OEYA 2O3JA 1ML3A 3L9WA 3A9WA 3QVSA 4UUMA 4ZGWA 5F1KA 4Y8VA 1CYDA 4MP6A 3GAZA 3GUCA 5KJ6A 2D4AA 1U5AA 5IG2A 3A14A 3MJ4A 3IMFA 3HDHA 4JP3A 1PGPA 4FFRA 4TVBA 2GNAA 3AOEA 1EUDA 3D3WB 1YONA 4ZVVA 4UUOA 4F3YA 1DJQA 3E5RA 2A4KA 1M6HA 4BO7A 1A71A 1GYQA 1G6KA 2P2SA 4RVHA 3HZZA 2NU8A 1XKQA 4RF5A 4WLEA 3JD0A 4OM8A 1PZHA 4TZKA 4CQLB 2FOIA 1DLIA 3NUGA 3TQHA 1Q7CA 5JSFA 3UN1A 3WICA 4BV8A 2VHXA 4MIYA 3CZRA 3WYCA 3ZWBA 4II2A 3LC2O 1E7YA 4CM9D 4X54A 1IYZA 5G0TA 4TMFA 4GWKA 1RPNA 5BT9A 1YL6A 4RDIA 4U6QA 3WYBA 4DGSA 5IZCA 4FJ2A 4BO1A 1D8AA 2JKVA 2WEKA 4JJFA 3DAFA 1KVTA 1YQGA 3RI3A 4AJPA 1T2FA 1DIBA 3WTBA 5G0SA 1ADFA 1DC5A 4E4YA 3VKUA 2IXAA 3TL2A 1TI7A 2VNAA 4HFRA 4IMRA 4YJHB 2C54A 1T2EA 4ZD6A 1PGNA 3EW7A 2PZKA 2P9CA 2ZKLA 3ROKA 1K0UA 2FZWA 3AY7A 2GDZA 1GZ6A 4MINA 3GZ4A 1GAEO 2Y66A 1X0VA 1ZK2A 5HBRA 3UHAA 4DIBA 4G5HA 1CRWG 4WUVA 3E1KA 3BYZA 1K89A 4BO5A 2QHXA 1H6AA 4YJFA 3GT0A 1M67A 3H5RA 5L9AA 3OICA 4BNZA 5TIIA 4FFMA 2NM0A 3WNVA 4Q3EA 3U0BA 4NK5A 1WW8A 4DYDA 1R4NA 5GY7A 1YB4A 1PQUA 4UULA 4D3FA 3NJ8A 4GMGA 2IZ0A 3F6YA 3O03A 2HU2A 4ZQEA 3B70A 3CIFA 3GHYA 1R4MB 5IN4A 3E9QA 3LYLA 4CQMB 4M49A 2RAFA 3SLGA 1A5ZA 2YQ5A 1C1DB 1HWYA 4Z9XA 4D3SA 2Y1EA 1SB8A 1WZIA 5H81A 3B1FA 3TOZA 2PLAA 4R3WA 1ZJYA 3HUDA 3ZCXA 9LDTA 5U1PA 1C0KA 5K0ZA 3NEPX 5DOVA 5U4QA 4A5OA 5JBIA 5K9ZA 1U9JA 2DFDA 2TMDA 2HRZA 3Q3CA 3PQFA 1DOHA 2C2YA 1BMDA 2W4QA 3PXXA 2HMWA 4EJ0A 1LRKA 3TNLA 3R1IA 1KEPA 2CD9A 1DRUA 3VH4A 5JXWA 1NR7A 5KVCA 3K5PA 1LQTA 3JQ6A 5DDIP 5T57A 4YCAA 3RC1A 3MEQA 3ROMA 1H94A 3PFWO 2HMSA 3ASVA 3UFXA 1Z6ZA 3NDRA 1T2CA 1F8FA 3G49A 3V8BA 1O5IA 1LDBA 2ZJ0A 3VPGA 4JCOA 2DBQA 2GPTA 1EVZA 4NFHA 1PS8A 3DO5A 4MDHA 2FN7A 3KYDB 2GO1A 1WMAA 3HDQA 8LDHA 4CM7A 4AG3A 3U5TA 1ISMA 3KYBA 1LDYA 5A3VA 4FQ8A 2GERA 4J49A 4TKLA 5ADHA 4OIMA 1NVMB 2AHRA 1E3EA 2AW5A 2EKPA 2P4QA 2RHCA 4JJIA 4L74A 1F14A 5AXAA 3WGTA 4GWGA 1A7KA 4OKNA 4FD3A 4KTVE 1T4DA 1RYEA 4R9RA 1ID1A 3X2FA 3AY3A 4J4BA 4CM9A 3WSWA 3HADA 1TEHA 4OXYA 4DIFA 5KKCA 5BSGA 3DBVO 1AGNA 4UEKA 4UREA 3TZ6A 2BLLA 3UCEA 4OGWA 4XQEA 5JLAA 3TF5A 4MVJH 3FHLA 1EBUA 4ZICA 3GVPA 5KIAA 1P77A 3GPIA 4HX5A 3DFZA 3GRPA 4GQAA 5MGBA 1NQAO 2FRDA 1FXSA 3N7UA 1UDBA 3E5MA 3JSAA 3PLNA 1DRVA 3L4SO 4B8ZA 2Y1CA 2H9IA 1IZ0A 3ZWOA 4BMSA 1TXGA 4E5YA 4JLWA 4R68A 1N1EA 4U7WA 4D41A 2VWQA 2ILTA 2CDAA 3LLSA 4GX1A 1LX6A 3BMNB 3CMCO 1OZAA 3GC6A 3H9EO 4IQ0A 4Z9FA 4CM8B 2Y1FA 2P9GA 1PJTA 1HEUA 4FN4A 1VL8A 2AEJA 2BGLA 2E48A 3H7AA 3AU8A 2GZ1A 4E31A 2C07A 4OL9A 2I3AA 3WGHA 2VOJA 1NFQA 3E48A 1HSOA 4O0LA 4LSWA 5EJ2A 1WPQA 2Q99A 3P5SA 1XDWA 4NU6A 1LTHR 3ZWCA 2R00C 3WMWA 4Y6SA 1NFRA 5DBFA 3GEGA 4ID9A 1EK6A 2OL4A 3F4LA 1HE2A 2G82A 3EUWA 1BWSA 4KUGA 4GMFA 1WDKA 4Y98A 5DP2A 2BFOA 3H2SA 2QZ9A 2B4QA 4C7KA 4PLGA 1RJWA 3RUDA 1R37A 5KTKA 1SOVA 1D1SA 1OAAA 4PG6A 1C0LA 4QSMA 1H6CA 1KVUA 3UUWA 4CUZA 5JCJA 2PKRA 1ZIDA 3HB5X 4OAQA 4J7CA 1ONNA 3ZV5A 4NQZA 1LC3A 4RPKA 2Y68A 3WXBA 3BZUA 3OIDA 4MPDA 1LSSA 4NBUA 4AJHA 4II3A 2Q46A 3OECA 1LU9A 3PRJA 4YQZA 2PH3A 5KWEA 4RDHA 4CMIB 4IDAA 1JAXA 5CEEA 1PJ4A 2JHFA 3TZQA 3ADOA 2PNFA 4E32A 3PFFA 3CUKA 4JBHA 3JQGA 3OIGA 3RCBA 3LLVA 4YT2A 1QYDA 4GX5A 4PVCA 5BNTA 5H83A 4FGSA 1E5LA 4I9NA 4WNCA 2DC1A 3C3XA 4IDBA 1G0OA 3UKOA 4AJ1A 1B7GO 1Z7EA 3F5SA 2RH4A 1NBOA 4OHUA 3RKRA 4MKRA 3EK2A 4AJLA 4DREA 3AW9A 3ETGA 5FEUA 2ZK7A 3OQBA 3PPIA 4KUEA 1E6EA 3ITKA 4KTTE 3QQPA 1LUAA 4ZJUA 1B3BA 2X58A 3FNHA 4IZHA 4J1QA 2Q1SA 5AVOA 5G0VA 2O4UX 1AA0A 1DAPA 3WR5A 1DHTA 4UVDA 1Y8RA 2DPGA 4WOJA 3DBRA 4NBVA 5AQ1A 1T1SA 2NACA 3AI2A 4J3FA 4TRJA 4J7XA 2P9EA 4B79A 1QV7A 1T4BA 2W2KA 2WD7B 3K9QO 2EIHA 2R6JA 3HG7A 3PI7A 4NI5A 3FTNA 1DBVO 2OP0A 5JCXA 3S55A 1UP4A 3H9UA 4IJVA 4O1MA 1ZKMA 1HETA 2O3SA 1QP8A 1U8XX 2HJRA 3HJAA 2B4RO 3AFNA 1BXGB 2DTDA 3L6EA 4B3HA 3VDRA 1VM6A 4F46A 3FBTA 4CM3A 4PLWA 2D2IA 4E2WA 1FDUA 1RM0A 1KETA 3AM4A 2FPGA 2DBVO 2WYVA 4QT0A 2HK7A 1GCUA 4CODB 3A06A 5FYDA 1ADCA 1UZMA 2XAAA 1AUPA 3KHUA 1NYTA 5KNLA 2VYND 5IXSA 2YQ4A 4WPGA 4TKMA 1KS9A 1ZO8A 3AOGA 4Y9DA 3HFGA 4E13A 4WE3A 2O48X 5TJ9A 4RVUA 2OMEA 4P22A 4ALIA 5I7FA 2O7SA 3JQ8B 4NZ9A 5G2OA 1U4SA 1PL8A 1CIVA 4A10A 1IOLA 4IY1A 5CDYA 2DUWA 1B14A 1SAYA 2UUPA 3VC7A 3PK0A 4NBTA 4GGPA 1KEVA 1F12A 2VUSA 3V1UA 3PTZA 3RUHA 4WEQA 2Y1GA 2QRJA 1LLQA 2OZPA 3NJ4A 3OJFA 3RUAA 4DPMA 4R1TA 4AVYA 1KC1A 3JQAB 5FI5A 2C7VA 4UUPA 5L3ZA 3BMOB 2NUAA 3EHEA 4AJOA 5ES3A 4DYVA 1R0KA 1SO8A 3QA9A 4P4GA 4BOYA 3VZPA 4R54A 5I8ZA 2J5RA 3ICCA 2VZ9A 4CL3A 3DBHB 1K6XA 1HF3A 1LDEA 2I66A 3Q0EA 4CR6A 1NHGA 4XYLA 1HDRA 4DVJA 1BDBA 3AUUA 4HADA 1T1RA 4K9DA 3QHAA 1LQUA 2VCYA 1H5QA 1NAHA 3VPHA 1KEWA 3DBLB 1R15A 3NX4A 1UXJA 2B36A 2QRKA 1N7HA 2VZ0A 2EJWA 1ARZA 3JD3A 2C20A 4GLLA 4D42A 4ALKA 4B4UA 3JQDA 3DMTA 5A5EA 4MJLA 1M2WA 1N2SA 4J9UE 4RF3A 4XKJA 4DC1A 3C85A 3U4IA 4BNWA 5JAIA 2RH8A 4PLTA 2Y05A 3OP4A 4UVHA 4N5NA 1A4UA 1YH3A 1GY8A 3MWDB 1H2BA 4RJTA 2VUUA 4EEZA 4R01A 1MC5A 1I33A 3SLKA 2ZJ1A 1BVRA 3ZU3A 3BIOA 1AN9A 3BMQB 3G1TA 3PGXA 1H6DA 2PGDA 4I5EA 1GFSA 4JGBA 4WCFB 2O2YA 3KSUA 4R9SA 5ILOA 4AICA 2G0TA 3ZHZA 1E3LA 1VRWA 4BNNA 3BAZA 5CEJA 2V65A 1V3TA 4D0RA 3AUSA 4PZDA 2X5KO 4BO8A 2UDPA 1JKJA 2YW9A 1P3DA 4PG4A 2NVUB 2FMUA 3IJPA 1SB9A 1YBMA 3ZU2A 2PD6A 4K6CA 1JKFA 2JAPA 2C29D 3U9LA 4LGVA 1ADGA 4CLOA 1B8UA 1YGYA 5JC1A 3JYOA 4ITUA 3G3EA
chains in the Genus database with same CATH superfamily
3OWHA 3MJHA 3R8XA 4DA8A 1P18A 1CEQA 2YMLA 4MRMB 2Q6OA 2UYGA 3U39A 3BTOA 3VTFA 2GCOA 3B52X 1U8FO 4TS1A 5HS6A 5DXFA 3ZQKA 3V1KA 5CFPA 4Y6PA 1GADO 1RRCA 2G83A 5CFMA 4BBJA 5FHRA 5D5QA 3ZV3A 4XUGB 3CM0A 1FJXA 3NWPA 1OFVA 2ICAA 1U3UA 2P9HA 1XTIA 2YN2A 4QYIA 4LRSB 1HT2E 3IPLA 1XPJA 1A3CA 4RPGA 2BJWA 3N3BC 5AVQB 3I6IA 4AROA 2KLBA 3SF8B 3H1JE 1WB6A 1T1GA 4IJ5A 1BE8A 2VP6A 2RB4A 4WECA 2C97A 3VU3A 3ZZ0A 2UUBB 2HADA 3V4VB 1EI9A 4RD2A 4B6SA 3L5KA 3DDOA 3K6RA 2Q2WA 1D1QA 5JCPA 3LUBA 3NBUA 2BZ0A 1YITP 4YRNA 4QHYA 3P97A 4TV9B 4HQRA 1EGQA 2H8KA 5DZSA 2NSHA 3CMMA 4YHBA 1XA0A 2D2CC 2A5YB 1JCDA 2LW7A 1FNNA 5L8RJ 4G25A 4HGZA 5DHFA 2XMGA 3IMKA 4MR8B 1NW8A 1E2QA 1GR1A 3OFKA 3LIIA 4ZZ2A 3BL5A 3UW1A 1OXSC 4H4CA 5JZBA 3K0CA 1NYQA 1IM8A 3ZDYB 1KJ8A 3RU3A 1WY5A 3TFOA 5DNDA 2JEOA 3OZCA 1AIPA 1C9DB 3NW9A 2DFNA 4MS3A 2RC6A 4BEWA 2X8LA 2VF8A 2PY6A 4H7IA 4K3AA 3K2EA 3T15A 5JT1A 3F7MA 2EKQA 1T5SA 2ZI3A 3L6OO 1L5ZA 1IXSB 4YCLA 4UB8E 1FXWF 2PL5A 5AOCA 3K94A 5JXIA 4LDPA 5FKJA 2BV3A 2J3QA 3RASA 1Y9BA 2IY7A 2GBLA 1JN0A 3H8WA 1X1RA 1W6UA 3O9MA 3RWBA 5B37A 4Q7MB 4L8WB 1X15A 3TRFA 3F8WA 1EFHA 1VCMA 5MDHA 1OYWA 2IBZI 3ERCA 4J0KA 3P27A 1Q0QA 3ODGA 1QHGA 3SZ3A 1DO2A 5JS6A 1X22A 2HCJB 1QL2A 4FFDA 3BDIA 1OB2A 1Z29A 2IHZA 4NPDA 1AUXA 3FBGA 3P8CD 2OYCA 5EP1A 1FNCA 3NGXA 3W0LB 2WQYC 1AXEA 5AM4A 3JAMA 2DWPA 4NNJA 3FHCB 2Y2VA 3IMEA 1Z7GA 3L75D 1P7PA 3OAAA 3MWYW 1DD4A 3ZWPA 3MGCA 2C0PA 3IJRA 2JFXA 3A4VA 1W85A 5FWYB 4Q19A 4LY6A 2D62A 4MVJM 2C5HA 2CVQA 1YB5A 1XAIA 4BXLA 3MINB 5HNKA 4OH1A 4BVAA 1PL6A 4HFMA 3AE1C 1E9DA 1K0FA 1H65A 2YY7A 1E9BA 2WZQA 5DI3B 1RYDA 3EAGA 3GAAA 1XRPA 3C4VA 3UHPA 3DV9A 1E6CA 1K5GA 5AVRB 2HBYA 3KZIE 3GQBB 1FYWA 2QI9C 3ZJ4A 1MHTA 1IY8A 3JQPA 1RQPA 1B23P 3NYWA 3BD6A 2MSDB 4C46A 1S5PA 1HSZA 4JXJA 5TJHA 3EYAA 3A0UA 1OT5A 3USSA 3WV4A 2IIVA 3PHBE 3X43A 3BGWA 2YXLA 4HAOA 3HVJA 2ZTLA 3KOMA 2QSZA 4JC8A 5TDHA 3UOWA 4TMTA 3H32B 1MIOA 1O03A 5HG0A 3BH7A 3F6CA 1MQ9A 1KAQA 1YQXA 2NQTA 1WB4A 2XNSA 1IDOA 1ILEA 3TUJC 1W1UA 1NOKA 4JUFA 1L4UA 1OIXA 1RCTE 1HJ0A 3TOVA 4P81A 3CNQS 3P1JA 2XUDA 5CVDA 4CF5A 2XKAA 3OIUA 4KH0A 5EE9A 1SCUB 3T3GA 4MVJA 2J5XA 2W6CX 1ZRTD 3IEKA 4Q4LA 4NV0A 2G9QA 2XH8A 5DIFA 3G2HA 1NV8A 3LVBA 3OOEA 4JS0A 5IRCD 1PZMA 4XLLA 1XEWY 4MH0R 3A1DA 4PX2A 5F78A 1ZD3A 2VJAA 2XVYA 4ND3A 4H3SA 4EAQA 5DYGA 1W2GA 1PJLA 4C4ZA 4KHXA 3BB4A 1QPZA 2D0OB 3TR5A 3NTQA 5E1DA 3CX6A 3TINA 5EHZA 4V0OA 3KEQA 1NJGA 4M99A 1P1HA 1CZHA 3N05A 3CF4A 2WSSD 4LK2A 4ZYYA 3O90A 5KREA 1UDXA 4BQNA 2QZZA 4WZ6A 2A9PA 4RM3A 4CMIA 4CEJA 3PC8C 4DB4A 1X42A 2BCCD 3H87A 4TL8A 2E49A 5TS3A 1REQB 3EXHA 1M75A 3RC7A 1ZM9A 5K0SA 4YXWD 2EQAA 3JYLA 3BC1A 2QJYB 3K0FB 4WZAB 5DNVA 3RAPR 1HQDA 3RIHA 3STUA 4ND1A 3MOSA 5ANRB 1EESA 4UU8A 1RE4C 1ZLLA 1FFYA 2OGTA 4HBZA 2JARA 3H86A 5JH7F 3PQCA 4MIOA 5A9TA 2CBXA 2ZKIA 3BIWA 3MHTA 3GI1A 5BR7A 3V42A 4BFVA 2ZXUA 1P3JA 4REQA 1XA3A 4FOPA 1IHDA 4KDFA 2YWFA 1DD3A 1ZAYA 4KR2A 4LYGA 2ORVA 1LY1A 1RMQA 2GF2A 2WSBA 4GSKA 1TVKA 4KR0A 3GAMA 3JWIA 1DFHA 4EOGA 4JI8B 3A05A 4QWWA 4R2HA 3V3TA 1VB3A 4YJ2F 5EL0A 4FNOA 2XF2A 1Q1GA 4DBLC 4WUTA 3N0TA 5DV9A 3MT0A 2R8RA 1RQUA 4NYMR 4G8CA 1XDZA 5E9WA 1FEZA 1IXZA 4KU4A 4HKTA 3VPCA 4UQOA 3SYKA 2EERA 1EDKA 4YHHB 2NP7A 1JPJA 2FHSA 5IZ4A 3IAFA 3SEAA 5JHGB 2AJBA 4G67A 2C96A 2OG2A 3R4CA 5DH9A 1JIQA 2K5UA 3I5MA 3QMPA 2C9YA 2ZTUA 2OBBA 2ACWA 3CXHI 3ZLVA 5AJXA 5DCUA 4P7FA 3ZQJA 2GUSA 1UZLA 1TFUA 1TTPB 4S1TA 4CMGA 5KTMA 3PQ3A 2W2MA 4AT1A 3FCAA 3OE7A 2X9GA 1V3VA 6GPBA 4PV1D 3BREA 5JFOA 1I01A 4FMPA 3GF7A 4OQMA 4TRRA 1QFZA 1TZMA 2WTEA 4CKXA 2YCLA 3ICPA 3H3XA 5A0TA 3AG5A 4BLPA 3UHFA 1GDTA 4GGOA 4D9FA 2IU3A 3FCCA 5A6SA 3HP1A 5CDFA 4QQ8A 4K9MA 1G8FA 1ULUA 4BNIA 2B2NA 3NOVA 3L4BC 5FPHA 3A11A 3P4UA 1O97C 2B35A 4UM7A 4KE6A 3RV4A 1N73B 2X8AA 5HFAA 2BBWA 1DRJA 5LC1A 1N73C 3CTVA 2BEUA 1SFCA 2FG6C 1SC9A 2GZMA 2QZSA 2GN4A 1IG3A 4JJ6A 1SQQD 1TRHA 5CVTA 1QO9A 5T4HA 3KPVA 2O57A 3SAJA 3GUYA 3U7RA 1H93A 1P2TA 3VR4D 5CB4B 2DLNA 4YJDA 5HZHA 2LR2A 1NAFA 2LP4Y 4XASA 2J32A 5CBOA 2PDAA 3AVWA 5HGJA 1OIVA 3LQ4A 6REQA 1AHPA 2GM4A 2GZRA 5ARBA 4BVLA 3HH8A 2A67A 3QFCA 2J5QA 2W58A 3GR6A 4GFDA 4KW7A 2SKEA 1E3WA 3H1FA 3GO4A 1GMJA 1FZAA 4I19A 4WA7A 3QVGA 2DT8A 4BFUA 5L51A 3PHJA 3ZHSA 1E32A 2BTEA 1JHUA 4LMBA 5JJLA 5GTHH 1UBOS 4JQCA 3A1SA 3KE9A 3ITDA 3SXUA 3SM3A 5HF8A 4BWVA 2X76A 1WCIB 4JJ4A 3HJFA 4IGIA 5EJAA 3V7WA 2J85A 3CX5I 2AI2A 4GL2A 3AYZB 5FOWA 2H88C 4G09A 4GLFA 3SFDC 1R2QA 4QE3A 1SY7A 4BNVA 3LIDA 4HNHA 1DP4A 3KQUA 4ZHQF 4Q01A 4H0LC 1JQBA 3IA7A 2HZ7A 4LIPD 1ZGJA 4RE5A 1NJ2A 5FUVA 3IE2A 1OVGA 1MOQA 2F8MA 5I7UA 2IZZA 3H1TA 1L7QA 3DAPA 1EDDA 1E0JA 2J6IA 3I5AA 3IBGA 3DKIA 4X3PA 2G0NA 4KV7A 1E2EA 3PIIA 5TLSA 3RAGA 3F2VA 1C9KA 5CA1B 5DJ5A 3TNYA 1UANA 3JVEA 1M2OA 3QKUA 4JI7B 4ARZB 4AMZA 5M34A 1HF9A 4PLHA 3CLKA 5LP1A 1XF1A 2W2QA 1TJ4A 3HKEA 4IMPA 4FDTA 3PFGA 1IBCA 2FZGA 3AF2A 4Z1MD 2Q6TA 1IPFA 1ZMTA 1Y89A 4HH0A 1O94C 1FUUA 1CCWA 3OEEA 3I9MA 2GYUA 5HKOA 3EZ7A 3AR8A 3LECA 4UMDA 1FE6A 3W5IA 1PQ4A 3JCZA 2G63A 4JT2A 1EQUA 2GJAA 3BULA 5IVPA 3C6XA 4MQEA 1NUUA 3KKMA 3WHLA 4GKKB 2KLVA 3NATA 3OZRA 2IPAB 2NUTA 1P61B 5CT8A 4RS4A 2XQFA 2BHLA 4BCCA 1U3VA 2WVAA 2GN9A 4HOYA 5F5LA 4K6MA 2PZFA 1QH1A 1FXWA 3IBCA 3CZAA 2ZE8A 1Z7BA 5D3MA 5E7JA 1ONBA 3SC2A 1KMHA 4IFIA 3GRRA 4AUMA 3DFKA 1XVIA 2Q3HA 4U2DA 1OWPA 5L45A 2LIVA 2OESA 3B1WA 1T26A 4L50A 2P9FA 2QUBA 3NTUA 3D6NB 1YQ3C 4AG6A 3F6EX 4NHOA 3MLEA 4LRTB 1QVFO 3IB3A 3FPGA 4AO8A 1P2UA 4RQBA 5AI4A 5E6RA 2PZJA 2GD0A 1GPJA 3KTAA 4Z54A 1FF9A 5AHOA 2OTKE 3ZS9A 3JAWB 5IAEA 2I29A 2I2WA 1V16B 4PRZA 4Y9RA 2B5WA 4W4TA 3FZGA 4I66A 4YMGA 1Z6GA 3GU3A 4NIMA 3IIKA 3BVPA 4BVBA 1B42A 3R8FA 2ROQA 1XWIA 3IVAA 3EULA 4H7FA 4PGFA 1UP6A 2ZDQA 1P4AA 1YGPA 3U4CA 2PMBA 3PL5A 1DGQA 4WEOA 1JH9A 3V4WA 5E4FA 2HSDA 2CB0A 3HRNA 4UKDA 2VSOA 1XTCC 5CXSA 4IX9A 3K05A 3GPBA 2ZUDA 1ABBA 4XJXA 1ODIA 4B6EA 4O4LA 2WTNA 1C14A 4AURA 1Q7RA 3GPDG 3RSOA 1KY5A 4C7BA 5HUJA 2C00A 5DSZA 2ZZMA 1RQ2A 2IVFA 4QGAA 5JYDA 5C1BA 3KG2A 3H19A 3P45A 3BF7A 1K7SN 1S8NA 2JG3A 2L2QA 2Q41A 3R5XA 1I6KA 3STXA 4C6TA 4FR0A 1NBWB 1MABA 5B7PA 4Y0NA 1DBIA 1MT0A 3AEYA 4U3JA 1EIWA 5KJ7C 4TLBA 3PNLA 4DNFA 1J1DB 3ZNQA 4CMJA 5JPIA 3Q6MA 1J1DC 2D2CD 4WH0A 3COYA 5CX1A 1RPJA 1XK7A 3AKZA 1BS2A 4NCJA 5LQRA 2GTHA 4WN9A 1JIIA 5JYCA 3ROEA 3T3IA 1R74A 4F38A 4BB5A 3HA7A 3OQIB 2QEXP 4FI3F 4BAZA 1RYBA 4GLJA 2IIPA 7REQA 2DKFA 2G7MC 4D82A 3CISA 4QGGA 2F43B 1VQ6P 4K35A 3L02A 3D8SA 5B7NA 4QBTA 4ZTUB 4CQLB 5AM2A 4MIYA 4H6WA 1X1AA 3W5CA 4HZUB 1J9EA 3VR5D 4RDIA 1D9XA 2ZRIA 2FSIA 1YQGA 2RG7A 1CUXA 1JDZA 3B85A 2J0EA 4JC5A 3SMQA 1BZYA 4MKHA 4EHAA 1U9CA 3E1GA 3R09A 3EGXA 1TAHA 2C2BA 5KKNB 3EW7A 2VCHA 3AY7A 5HBRA 1K89A 3HP7A 4OHXA 5I51A 5TIIA 1WKCA 2ZRNA 1QS0A 3OX2A 1XZ8A 1PT8A 2RAPA 4G0VA 1CVIA 3X3HA 4ZKPA 3O03A 3GHYA 5FLYA 2RKWA 3JAKB 1L5NA 4P0QB 2W6NA 2PLAA 2NQ2C 4LWZA 5K0ZA 3CZ5A 5C51B 2X5XA 1BGWA 3MWEA 1U1GA 1SJ9A 5JXWA 3JQ6A 1XCPA 3CXUA 3DDUA 1CZOA 3EBPA 1T5DX 4G9BA 1ADJA 3HBAA 3K15A 2QRMA 1KAOA 2ZT5A 4ER3A 3B89A 1ZP0C 1MT3A 1VXRA 1Q82Q 4CTJA 1ND6A 3C5EA 5FYQA 1RF0C 3I34X 4OIMA 3O75A 1NTKK 6PFKA 1SQXG 4G41A 3BH0A 4FWIB 4CM9A 4N78D 3AERA 1I2AA 2AUTA 1J1EC 5T41A 4UREA 1XRJA 2Z4SA 4YJ2A 3KOWA 5KIAA 3RS0A 4N5IX 3VNRA 4HNUA 4NTZA 3IEXA 3CN7A 1YB7A 1UBSB 1FXSA 2QJPB 3N7UA 4RY8A 1RIIA 2HLDA 2FW7A 3KLOA 1K05A 2P77A 1NI4B 1VL8A 3OZVA 1NVFA 2IYSA 1R8SA 1TM7E 3TTVA 1MKYA 3GEGA 5AW5A 2WAYA 4F4FA 1F38A 3WK6A 4Q1FA 2BEVB 1QX4A 1IAVA 4ZVUA 1KILA 1UK9A 1PUXA 4FZ3A 1EDIA 1TMKA 1LU9A 1L7RA 1XXHA 5GINE 3V2QA 1PJ4A 2Q3CA 2GJ9A 5JECA 4YC7A 5GVRA 1NQUA 4YT2A 5GTIE 5BNTA 3MTUE 3G68A 2XYHA 2BBOA 2BTQB 2UKDA 3CLUD 2C5LA 3EK2A 3AH8A 2PKCA 2WZDA 5FEUA 1OPRA 4DWOA 2Y1WA 3TTWA 2X58A 3FNHA 2ZM6B 4TXLA 4JYAB 3AINA 1GG5A 1T1SA 2VJYA 3CBQA 4Y2GA 3I2IA 2HRQA 1XQWA 5HP4A 4K40A 3FTNA 2QPLA 5REQB 2XCIA 1I7QB 3S6JA 5JD6A 3HM9A 1YUBA 2HJRA 4BPBA 2YYSA 1VM6A 4CM3A 5F7JA 4CODB 1ADCA 1TU4A 1AUPA 4G8BA 1KMQA 4TKMA 1KS9A 3HFGA 3DFFA 2D2FA 5BY2A 5I7AA 4HGPA 4NZ9A 2CC2A 3H05A 4BPRA 1JEAA 5K09A 3A10A 4GGPA 3NVAA 4DT0A 5CBKA 4B7ZA 1B4DA 2VTKA 1DO0A 2VR1A 2QUAA 1N1DA 5I4BA 1MEOA 1RHRA 2VZ9A 2GLUA 4PR0A 2I66A 2JJQA 2KJQA 2BMWA 3F5DA 1UOQA 4REMA 2ENUA 2GZDA 1PV4A 2QVBA 2FFHA 4D42A 2N1TA 3HDVA 4DC1A 1PPJG 2WBLC 3GRZA 3K5WA 4Q3LA 2AD1A 1MDBA 2JAOA 3OZSA 1BHJA 5JZ9A 5ADWA 3KSUA 2VBFA 3Q3IA 1V3TA 3DLTA 2KNCA 2LV8A 3SZMA 2UDPA 4XM0A 2IXTA 1Z3CA 1NVEA 2HL6A 3G1WA 1VQ4P 3IVGA 4DVGA 4X93A 3KQGA 3MTQA 4RETA 1OZHA 3G3EA 2FZVA 1QYIA 3ZG6A 5A1TA 2DPYA 4G36A 1E4EA 1O6FA 4FDLA 3FOWA 4O5AA 2C3UA 2X3UA 3DYIA 3HCEA 1G1JA 5L4LA 1M1XB 5EHGA 2YY6A 1JDPA 5CA0B 3ZH9B 4C7XA 3H9BA 1RF1A 4EFDA 1ORHA 4OHZA 3OJAB 2Q7DA 2VDUE 3Q6IA 2FMTA 2VJMB 1PR6A 1KZGB 2C8JA 1EXNA 5FP0A 3KYCB 3R0VA 4E5PA 1XE3A 2NVWA 3CWBG 1MW8X 4ZVLA 2BASA 1KJIA 1SBQA 1TJPB 4A36A 3Q15C 4RNCA 1W7AA 3QGMA 4D4KA 1XB2A 5DCWA 1TDJA 4Z2YA 4L9AA 1ZUIA 3GGOA 4HS4A 1P75A 1ZPDA 1JU9A 1QH9A 3F5MA 3EDYA 1GTSA 1EFAA 3AJ8A 3KJIA 4LGMA 2OXTA 1DCFA 1QR2A 2D5CA 3HNPA 2E74B 1AKWA 1Y9ZA 1VJ1A 5LN1A 1QHHB 1ZRNA 5H82A 2XADA 1EVIA 2DX7A 1Y5LA 4INPA 1C7IA 5CG1A 4S1WA 3ZWMA 4JZKA 3RWMB 4ALMA 4YPFA 3W4JA 1YRHA 2YFHA 3NRBA 4OMUA 3E53A 2C9LY 3FYCA 3LXXA 4J2OA 2B87A 4RF2A 3DZDA 1DQSA 1O97D 3LNTA 1N6IA 1XAGA 3B9BA 4NFSA 3RJ5A 3D9QX 2C7OA 4RKRA 5C7OO 3E4DA 3EARA 2NUBA 4B3JA 3MQ4A 3QOYA 1YTLA 2W6AA 2FR1A 3H1KJ 2BR3A 1DX7A 1JSZA 3IF4A 2BP7A 1XQ6A 2YYYA 5BWCA 4BTLA 1RWOA 1ZL0A 3R5KA 4D46A 3IRVA 2ID8A 1SFRA 1FZQA 4RO0A 4FE7A 1Z35A 1SMKA 5JALA 4R2XA 1O89A 4IIHA 2H1SA 1OD6A 3STHA 1WXDA 5SYAA 5K0JA 5I9TA 3PDIB 3BICA 2ZS9A 3L8FA 2XUFA 1Y82A 2G5TA 4JQSA 1YB1A 4ZEVA 4AQ7A 4H6XA 4L5IA 2BM1A 3SFZA 2C4TA 3UMVA 1VLQA 5COAA 2IBZE 2V4ZA 5ITWA 1BW9B 4HN9A 2RGNC 1MB2A 5IAGA 3R8CA 1GQYA 2P2GA 3L1UA 4NX2A 2VS1A 4JF7A 3JWHA 1JJ7A 3NI2A 2J4FA 4JSRA 3PD1A 4V1CA 2OTLP 2FP4A 1N1GA 2G4CA 4A5SA 4F5WA 2UXBB 5LL6P 4TL6A 3PRKE 4HK4A 3GMTA 1U7OA 4OXXA 1UXIA 1Z0DA 1AS2A 3NIFB 4LXUA 2HK6A 4H0LD 1XMSA 3C45A 4DSAA 2UWJE 4LYJA 3IP8A 1DEBA 5GZ1A 3D71A 3T9CA 1EWYA 3UG7A 1I6MA 1Z4LA 1ZVKA 4RESB 5FV7A 3ZZTA 1NKNA 3UJ9A 4ESOA 1PK7A 2JAQA 2CHEA 5K6TA 2DKOA 3DLAA 3V2RA 3H99A 4M1WA 3CUWA 2GCPA 2XZOA 1LWUA 3W6PA 3PQDA 5AVTB 3DDHA 1RRMA 2YIMA 1ESMA 4QRHA 4BN0A 5KVVA 4NOLA 2VPXA 1PT7A 4YP7A 2ZFUA 3P2EA 4IOLA 3VR6A 3WYFA 4DRYA 2EZ9A 1XZFA 1QPBA 1DIOB 3MMXA 3PBKA 1OXKB 3WE7A 2Z04A 3N59A 1V1MA 2ORIA 4EPRA 3T4UA 3D70A 4RY9A 2L19A 4COKA 4UNIA 4PG8A 2OFFA 4WWIA 3JRWA 4LNUA 2XE4A 3EIQA 4FD2A 2PSJA 1EUQA 1XMVA 1O94D 3VO9A 4OLBA 3L1IA 1P4SA 4F4DA 1OA1A 2MYNA 1NO4A 4CWAA 9GPBA 3LOUA 1WUJS 3WL5A 5B1YA 2HPCA 4DDVA 5HRCA 1GQFA 2IYXA 2XQIA 1U3DA 3IEIA 1JBEA 4JGGA 3NCHA 1RRFA 1M1JC 4QARA 1PL7A 4LC1A 1YSCA 3DE5X 2RHDA 3HCNA 5JZMA 4MWBA 3T5MA 2Q4RA 4IDPA 2IYWA 1ZZGA 2VH2A 3PC7A 1YR2A 1TYDE 2YOFA 1JI0A 1ULSA 4HWRA 4DZRA 3T3MB 4BUJA 1SQVE 5KYUA 1JLMA 3CNNA 4BKOA 4WVZA 4WLFA 1JMYA 1X7GA 2H85A 1OLOA 3RANA 4QDJA 2Q4TA 1Z5ZA 5C1IA 3BE8A 3ICEA 3WGYA 3PZBA 2R32A 4I1RA 2WSSH 5EZ5A 1AVOA 5IDVA 4DG5A 3JSVC 1OAOC 8AT1A 5BMVF 3MRSA 2IBSA 1RJFA 1KMNA 3GJ3A 2I62A 4UU7A 3N74A 3OFJA 1P2VA 1YIDA 4ZK2A 1ZGZA 1ZQ9A 5EJ7A 2H0AA 3H0CA 4JLDA 1QF7A 1RAEA 5LJLA 2ZBUA 5AVSA 3ZJYA 3HLKA 1JHMA 4ZQIA 4GKBA 2WUVA 2H63A 1SUWA 5DNCA 1Y8QB 4HFNA 3BXFA 5KEIA 3PNQA 1ESDA 4OLAA 1P3Y1 4YP1A 2JI8A 4UHFA 3OD5A 4A8PA 2H43A 3K9NA 4PYQA 4CM6A 4WLVA 1ZIPA 1ENYA 3C3YA 2DCMA 3EXFB 1JFFA 1Y3IA 2C4NA 4QELA 4R51A 4B7UA 3GHGA 2EZ4A 1WW2A 4N5DA 3BCCE 5JEEA 4Q4JB 4HS9A 4IKEA 2I4NA 4EX7A 2GEBA 1GPH1 1QVAA 4B3SB 1SQFA 4ZHSA 4FMDF 4X8HA 1PNVA 4PQGA 1BXKA 2RIPA 3GMSA 1JE0A 3M1LA 1VLMA 3FY4A 3PYXA 3K72B 3IL2A 1IBMB 1G60A 2IPPA 4FT4A 6LDHA 4LGCA 4M9SA 1O2DA 5JO9A 1PFGA 5IT4A 2C95A 1OV4A 3U19A 1FE8A 1XI2A 4A2QA 3MWDA 3NONA 2KYRA 2EBUA 5KJ7D 5KTBA 4JODA 5IHXA 1FTWA 1JHVA 2OBMA 4WCFA 1RJ9A 1XEAA 3CKLA 4YLGA 5KTNA 1GJRA 3FPCA 1Q1ZA 3Q7PA 3DP9A 4AP9A 2MT9A 1IRIA 3O38A 4P9NA 3F47A 1ZK4A 3ZTWA 1GU4A 2CFTA 3GVXA 5AVZA 2JCYA 2QTVA 3MLAA 2BFWA 5EP3A 4X45A 3VTKA 5L7YA 4YJGA 1C9NA 4A4DA 4DCTA 3KM0A 1X7ZA 2VT7A 3O8ZA 4NCHA 7AT1A 3BDVA 3C3MA 1DJOA 3B6IA 3L43A 2EJCA 4X7RA 1SG6A 1CE8B 5F51A 2FFQA 4H9GA 1C81A 3VR4H 1S2GA 1I2ZA 3KO8A 2I2CA 1VLLA 1V71A 4KPYA 4PNEA 4BS9A 1U0EA 4MHTA 1OLSB 2BCJQ 1XUOA 4TXMA 1PZEA 5AP9A 1WNTA 3ICOA 1L0BA 1M2NA 2QRPA 2PUJA 3FI0A 3H1LE 1U2PA 3AUYA 2EEPA 2ZXEA 2O3UA 2OZVA 1KO4A 1H8AA 5DHTA 4AWXA 4R71A 3DMRA 1ZM7A 4MVJI 1L4KA 1WAMA 5J23A 1PJSA 4JT9A 5AUPB 2H07A 5JQWA 4MQMA 5IH7A 2XSZA 2X4IA 3TPFA 4LNHA 2O01J 4Z4QA 2AF4C 1PFWA 4CDMA 4E1AA 1I1NA 4ZYVA 1VKHA 3E22A 4EHBA 1ZWKA 5IVIA 2JFWA 4BN5A 1GA4A 5ICGA 4DWVA 1AX9A 5IWCA 3FDIA 1RQVA 2WTXA 4UTRA 3UWDA 5LQNA 2GN8A 1L4BA 1VE6A 2A0UA 5B1IA 4CHTA 4H1VA 3VXKA 1SIUA 4H3VA 4E07A 5M1BA 3ULKA 4GZ5A 4QDZA 3TWOA 1ZH0A 4U9HS 2WVGA 3FWZA 3JYNA 3GWGA 2C5EA 4ND8A 1OC4A 2Q1TA 5JSUA 1SU7A 4DOMA 3K4QA 3JR7A 2E3JA 3IOYA 3GLFA 3JATA 2O8EB 4TM7A 4EDFA 1KYYA 1D2RA 4FZRA 3GBSA 1SU4A 5EWJB 4JSTA 4P31A 5KDDA 3FMFA 3VI3B 1T43A 2FZLA 2DR2A 1XJCA 3G13A 4BNHA 4CIAA 2IHJA 2FDXA 4WINA 1PPJD 4Z1MH 4CT5A 4KIJA 5DGXA 1DKUA 2AXEA 2O1WA 1AHHA 4Z9AA 4DE5A 5I48A 1FB5A 3GVHA 3QFTA 3QVOA 5BUSA 2PZAA 3ZZUA 1G5IA 2ZIUB 4XH9B 3MTEA 4CDNA 4CG1A 3IOBA 2H7CA 2DHDA 4AJ4A 3L70D 4URXR 3SYLA 3WK4A 1A5BB 2BUCA 3ZEAA 1L6RA 1HE5A 1G291 1JVNA 2JA2A 3I1FA 3F49S 5JBNA 1LJ2A 1LNZA 3EVAA 2QLTA 3CT4A 4CIYA 1XQVA 2NVBA 5IK2D 2NPSA 4L3VA 5FORA 3ZC3A 1PK9A 1INLA 4MQBA 3RQSA 3HFJA 5EINA 1C7FA 1V7ZA 4EMSA 4H0FA 2VNIA 3TSCA 1CVRA 2QD2A 1GTZA 4TLDA 2ZYGA 3HVKA 3ZHYA 3SS7X 1NYLA 4I4NA 2OLKA 3F9RA 3QEMB 3CWBD 2CL6X 3AF6A 4PR3A 2HHLA 2QN1A 3V1MA 3VN0A 4JVSB 2AMVA 3NTNA 1DCMA 5B3JC 5HCIA 3O8QB 1B76A 1DTSA 1TKBA 1QYCA 1VZ3A 2QZJA 3AESA 2DLDA 1QMPA 5K8TA 4LSGA 4EFLA 1ZK1A 1XXLA 3SE0A 3EIFA 1Y3CE 1BH2A 1ZW1A 4OXRA 2G17A 2QVYX 3O3MB 1JAYA 4TV8A 4E7OA 4D96A 1T8WA 5L95A 1NTKD 1F06A 2EF0A 5FT9A 1OFUX 1JSLA 4UNSA 4FYVA 1OY1A 4XD2A 3DBIA 3HC7A 3SEFA 2GD6A 1J5EB 5AYVA 1JJFA 5HE8A 4LEIA 2YBDA 4XOUA 3OIWA 4JB3A 4I50B 5CITA 4TT3A 3SYMA 4HEHA 2YHIB 1FRNA 4MA5A 2QTAA 5AK5A 2YBEA 2ZIWB 1N3BA 2CDCA 4LF6B 2O2GA 2MYTA 1C8KA 2ADMA 1XJ0A 3K73O 3WFIA 1YE3A 5KYXB 3E5HA 1CI6B 4KAJA 3GWZA 2QXUA 4YAEA 4Q93A 1YWGO 1K3FA 4F96A 3ZD7A 1PU2A 1KE2A 1CHDA 5HRUA 1E3TA 5F1PA 2OKGA 1JY3P 4RM2A 2D8AA 2HJGA 4PRKA 2P9QA 4GSYA 3I61A 1Q16A 3EX7C 2H31A 1CJMA 2NZWA 3JWJA 1EJ6A 2JJYA 3KZ1E 1N8NA 3FI9A 3DQZA 1R16A 4KHPB 1R12A 1C1XB 1PBTA 1Z63A 4U2CA 4FVTA 1RXSA 1QHYA 3PNPA 4UDNA 3MUDA 1FDWA 3M9XA 3IUNA 3O1IC 2FLVA 3AZQA 1RADA 4FWTA 1OX3A 4K0KB 3V4OA 5SZHB 3W04A 4OK5A 4HO1X 1TC1A 3WUVA 2GAOA 3O8BA 2ZXXA 3SVZA 1WQ4A 3PFKA 1KKLA 3CEMA 1T2NA 1FDMA 1SWWA 3A9WA 4FFRA 5CIYA 4QDOA 5ISMA 1I5EA 1L4HA 2ANCA 3AJAA 3P94A 1R6TA 3COPA 2QTRA 2VA8A 4ZPJA 4BV8A 3AL3A 3EA4A 1KMMA 5FJIA 4G4SO 3BD7A 2CXTA 4B3DA 4KWCA 2J67A 1EAYA 4QHTA 3VU9A 5T7BA 1CR1A 3PQ7A 2FSHA 5G0SA 3LYUA 5SYMA 3WLHA 3SE7A 1T2EA 2HC9A 1XJWA 2P9CA 4W1RA 3AKDA 4MINA 4V02A 1KZ1A 3OJCA 3LRPA 1PFIA 5L9AA 3TECE 1EE1A 3ZCQA 4NH0A 4JOSA 4D3FA 1IFJA 1KFMA 3A2KA 3LYLA 4M49A 1C29B 3RVLA 4PV7A 5HQJA 2O0KA 4D3SA 2P7JA 1JY3N 2AJTA 2BCGY 2LUOA 3HV0A 3CCFA 3LA6A 2JFQA 3ND6A 2DFDA 3Q3CA 1CNMA 3HJBA 5EWLA 1ZOSA 2J9ZB 5DDIP 2PRIA 1K63A 3NBMA 3ROMA 3PFWO 3D4IA 1T2UA 3BQMB 4QTYA 4BZWA 1PYOA 2DF8A 4QRIA 5BV2P 2BTOA 3M9HA 1VHTA 3MHVA 2Y9YA 2AC2A 3O8RA 3PE6A 2YNMA 4M38A 4MJ7A 1IZNB 1K3UB 4AN4A 3IELA 1X92A 2CLOB 2VJNA 4FE4A 3NMDA 3FOBA 2VTBA 3FHLA 2AN5A 5ES4B 4GI5A 1HURA 5E2AA 3EFGA 4J6EA 2Y1CA 5E1OA 1TTTA 2XWQA 3LLSA 2AMJA 2HFJA 2OHGA 3G0HA 4Z9FA 1XEWX 3WDLA 1UMKA 4ZI2A 1PJTA 1UIMA 1M90Q 2QAJA 1PSZA 2IYFA 1JFLA 5BYJA 1TQHA 2K88A 3E48A 1PWEA 5EJ2A 1T8SA 4XB6B 4IGKA 2OL4A 3UAXA 2JWDA 4I4LA 2WAOA 4ZALA 4HTFB 4U3FJ 1R37A 3DPUA 2AR0A 3CVVA 3JWGA 2W6JD 3BZUA 3QIAA 1JSXA 3REQA 4WBNB 2G77B 4CE6A 2PNFA 3V8NA 3QITA 3KJEA 5AVWA 1D04A 3DT8A 2H00A 2Y92A 4G5RA 1DC7A 4WNCA 4IHAA 1Z47A 3N76A 3DYBA 3QVVA 2P8SA 2IFTA 2RI6A 4G5YA 4UFNA 5JSHA 1TK2A 1MU0A 4TRJA 4KQHA 4J7XA 1PHRA 3FNRA 3VJLA 2HB6A 4DARA 5LD2B 3AHDA 1EQAA 4L5AA 1NU1J 1GKKA 1BCRA 3WISA 4A92A 1O9GA 5FOUA 1ODJA 1FYXA 3KHUA 3OKAA 4XWWA 3DE0X 3AE9C 2ZT7A 4LXQA 2OMEA 4P22A 2GETA 4U7JA 1EFVA 2PYDA 2HF9A 3NM4A 2OECA 2H57A 4IVNA 4XDGA 5CDYA 2H1RA 2QBYA 3PNBA 1XZAA 1H8EA 3RS9A 2XRZA 1AKTA 2BHNA 4I1UA 5KNDD 3JPWA 3MD9A 3L0OA 4CHGA 2QAGA 3ZI4A 4CEHA 4M0EA 4FE3A 2P9YA 1NAHA 1KQLA 1KEWA 1OH6A 2GLTA 4DIMA 1WCYA 2YJTD 2WU1A 4ALKA 4B4UA 1TD9A 1FP7A 4N5NA 1U2EA 2R6FA 1DUVG 3E35A 4WZBE 5ALDA 4U5XA 1S2MA 1E62A 2HQBA 2MIIA 1YB2A 3LXRA 4EB0A 3IJPA 2QJYC 3U9LA 1CRPA 3NQ41 2B4KA 2R8OA 3I9V6 2X0JA 1S5LH 1NOJA 1VKOA 2ZCVA 4ZVTA 3ONWA 2KUBA 3K9FC 1M8GA 1VIYA 5AKXA 1YRWA 4LOLA 1N0HA 2G04A 5JSYA 2ECOA 3N6VA 3E3MA 2X77A 4RJLA 5P21A 2EEZA 2PJRA 1UUFA 1Z2DA 3DLIA 1EFKA 5LIPA 3D5TA 3C3KA 1TVMA 1NSFA 1U28A 5IBPA 4XJTA 2Q1WA 2VHEA 3KNZA 2ZE6A 1R6DA 2XUAA 1ZOIA 1IMOA 2GILA 3N0RA 3WLTA 4HDKB 3M5CA 1G21B 3WGNA 2W37A 4JI4B 3IHKA 1SKAA 5AVVA 2HY7A 3KTOA 3W8FA 1PFUA 3CWQA 4RSMA 3STYA 4Q7EA 5ALMA 4CMBA 2HN9A 2HJ9A 2C5FA 3GPLA 2JLWA 3WWEA 1ZM4A 2W11A 4HCJA 3V97A 3RS7A 3CKKA 1G2IA 2BUAA 2B8TA 1JA9A 2UZ3A 4KMOA 4XEUA 1T9KA 2WU4A 4X44A 1BE3D 1B8VA 4A03A 4LJYA 3KDPB 2DH6A 5D6NA 3NDJA 2AI1A 3QNUA 3F6BX 4LJSA 4RVFA 2B99A 3SJZA 1BYIA 3FM9A 2BMDA 4PO8A 4JLJA 5C2JB 1NQTA 5F76A 1SVOA 5TGZA 4DV2B 2IOYA 4Q34A 1R0SA 1U2RA 4E2XA 1OZ0A 4IIUA 4Y1RA 1OLUB 4HMOA 3S29A 1ZAKA 1QHNA 3PA8A 3KCNA 4JJ8A 4BLVA 2WSEH 1QGZA 3ZVKA 3PJEA 2VRBA 1KARA 2DPHA 1XSEA 1ZI6A 4B4WA 1P6UA 2G09A 3I1JA 1I3LA 4DLZA 3WQRA 4HVTA 1U2DA 1KNXA 2BFMA 3C8MA 3RSHA 1YR9A 2ZI9A 4A82A 1EP1B 4AJEA 2HTFA 1TAUA 1G4AE 3HRIA 3PDJA 1A27A 1LA2A 4H16A 3Q87B 3U7HB 1C9YA 2H4ZA 1M3SA 2QL5A 4BTEA 4MW6A 3A2LA 3P0RA 1L6IA 2HH9A 2O1EA 3RARA 4K3UA 4Y6RA 4CV1A 1XZPA 2W0SA 3PP8A 4TLAA 3L73D 3E61A 1KZYC 2DUJA 5CLLA 2EP7A 1XVTA 3OCXA 3H6GA 3IALA 1A97A 2P2NA 2Z9BA 4GP7A 3RYCA 4L5YA 4GR4A 2XHZA 1NI3A 5CCGA 1UWVA 2BI8A 4Q16A 1E2DA 1Y5MA 3ZWVA 3B1JA 4ZGBA 1DKQA 2FWBA 2FVXA 2HWYA 4WBSA 1A88A 5KC9A 1CQPA 3REFA 4AYTA 4KIGA 3ANTA 1CUVA 1TEZA 1XRSB 4LJKA 5IARA 2Z3ZA 1NTMJ 3FFBA 1AUOA 3B2EA 4CQMA 4PFJA 5HX7A 2MR5A 3DG9A 2BZGA 3Q1KA 3W8RA 4ZC1A 4CZ2A 3RVJA 1VKZA 1JFSA 2BJHA 5G4KB 3KOZA 1UKVY 3IE0A 2NSYA 4U6NA 4NULA 3JQBA 4D81A 1BIFA 3P52A 4NR0A 1U9IC 3KYDA 5APSA 4HJXA 1IQPA 2XB9A 3BE5A 4G4GA 1JQEA 5KOHB 2VP3A 1VFNA 1GPUA 2XMDA 2FUNB 1S8OA 3HR8A 3WLQA 4L6AA 5EHXA 3EEIA 1DH3A 1VL0A 4TUYF 1EZ4A 4LYDA 3LL4A 4DV3B 4Z3DA 3SBDA 3SCZA 4MKXA 2ZCUA 1X7HA 3KAKA 2PKQO 3CRZA 3JU3A 3F67A 3F9IA 2OQVA 4ZYLA 2W93A 2YFYA 1SQXK 5T8KA 1H0KA 1GO2A 3IDSA 5KAIH 4KWTA 3K31A 3TLCA 2PLRA 4FPXA 3CC7P 3CZCA 1O95A 4XJSA 4Z7NB 3B9QA 1AURA 3JQAD 3KKLA 4BNUA 2JI6A 1Q7TA 1WMDA 2JIBA 1JM0A 1NYHA 1GTG1 3PT5A 4GDOA 3H18A 4OAOA 2M98A 2XKMA 2XEDA 2WDZA 1UEJA 4AN1A 1SXJE 5B4TA 5CCXA 1DXYA 1KA9H 1KBQA 2PX8A 1EDJA 3OJEA 4IQFA 3LGSA 2V9ZA 4Q4AA 3UT5A 3ZWAA 1E3JA 4QEZA 3GJ0A 4NYIQ 5JASA 5J58A 4PE5B 4CLEA 1MC4A 5EUCA 3D8NA 3D3NA 4XLTA 4OHWA 1EX9A 5INTA 1AKRA 4P3OA 4H7EA 4QT4A 4I55B 3ND9A 3C5HA 4UBLA 4ZCIA 2Y27A 2Q3IA 1H1LB 3NAGA 2PWAA 5JFTA 5EP2A 3KDSE 4B2LA 2PBFA 3DOUA 2EJVA 2L91A 3F8SA 2VIIA 1AGRA 2VK4A 2X0IA 1SVKA 2NU8B 4HDNA 3OZ7A 2GJKA 3WADA 1CFZA 5FWDA 1V6SA 1KHHA 5LVAA 3RK3B 2GEVA 2Y3IA 3HD7B 2W2XA 1BCSB 5CG2A