2ZYAA

Dimeric 6-phosphogluconate dehydrogenase complexed with 6-phosphogluconate
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
465
structure length
465
Chain Sequence
b'SKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDACAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-phosphogluconate dehydrogenase, decarboxylating
publication title Conformational changes associated with cofactor/substrate binding of 6-phosphogluconate dehydrogenase from Escherichia coli and Klebsiella pneumoniae: Implications for enzyme mechanism
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 176
structure length 465
sequence length 465
chains with identical sequence B
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2zyaA02
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 2zyaA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zyaA01
3VC7A 4RL6A 2WYVA 2WE7A 3OA0A 5DZSA 3U3XA 1PR3A 2GUGA 3RI3A 2BKAA 3WR5A 4FBGA 4TRRA 2UUOA 3RUIA 3N7UA 1VL0A 2CMDA 2HRZA 3ICPA 3OM9A 1J0XO 3FNGA 1LBEA 3C8MA 3E82A 3L6DA 4J4HA 1E7QA 3PQDA 4TQGA 3FSRA 4EI2A 1QR6A 4J16A 1YE3A 1SZJG 2ZQZA 4XKJA 2V6GA 3BMCB 1AGNA 2PGLA 2QRJA 1NWCA 4R41A 1I10A 1T25A 4MDHA 1ZNQO 3D3WB 4U0KA 2X0RA 1M2WA 5AQ1A 3H65A 4MKZA 5A02A 4CQLB 3EVNA 4XYBA 1MV8A 1NQAO 4D45A 3CZMA 4IY1A 3STHA 1HDGO 4JXKA 3VZSA 2B37A 3ZWNA 4UEKA 2PKQO 3WBFA 3ADPA 5THQA 3GMSA 3E6AA 1QMGA 4I5DA 1IZ0A 2P9GA 3GEGA 4E2ZA 4LRTB 3K30A 4YA6A 2CVOA 1LU9A 3ZWMA 4R9SA 5DT9A 5K0ZA 1Y5MA 2EKLA 3D0OA 4IXTA 3TRIA 5BNIA 3G0OA 3S8MA 3GN1A 4XQCA 1ARZA 2E49A 2Y1CA 3GVXA 1P1RA 3VKVA 5HRUA 4RF5A 3H9JA 2W2LD 3TF5A 1HDZA 1GYRA 4WEQA 3WLEA 4D46A 4DIBA 1WPQA 3LT0A 2C0CA 1PEDA 1VI2A 4Q3AA 1T1SA 5CPBA 4DC1A 2IYPA 4QO8A 1YOVB 1Y9AA 1JKJA 2I66A 1XR3A 1ZUD1 3CE6A 2ET6A 4GX1A 4BNXA 1E3WB 1UXHA 1LRLA 3DAFA 5EQDA 1I8TA 3ETDA 3E18A 1BXGB 5KWEA 3NTQA 1PGNA 1KIFA 4ZD6A 3NTRA 4YJFA 1BWSA 2X4GA 1ZK2A 3CTVA 3U4IA 3N74A 1PS0A 1I2BA 2HKIA 4HFNA 3MJCA 4PG5A 4AL4A 3SC4A 3GK3A 4GGPA 1KOLA 4CM9D 4BKOA 3JQGA 3UOGA 3DZHA 2NNLD 2DQ4A 2VUUA 1UP7A 1E3SA 3IUSA 4XYGA 5AOVA 5IZCC 5KCZA 1R6DA 3HDHA 4EUHA 4B79A 2X9GA 2YJZA 2GCGA 2NU7A 3JQAA 3E1KA 2Q46A 1HXHA 3T7CA 3ZHXA 2Y05A 3PK0A 1ZK4A 3IJRA 4ROSA 1U7HA 4R4JA 3L4BC 1ONNA 4JN6B 2X86A 4DC0A 3OQ6A 4YT5A 2OGUA 4UREA 4KOAA 3ZNNA 1BRMA 4EUEA 1KS9A 5BNTA 2R2GA 2VZ9A 4L8VA 3O26A 4KTVE 1OOEA 4UVGA 3VH1A 1J5PA 4EBFA 2J5QA 1IHYA 1PGOA 1A4UA 1P1FA 3I9NA 3KBOA 5EQFA 3QJ5A 4JJIA 4NU6A 2B5VA 5B37A 4FC6A 4M87A 4W99A 2P5YA 2J3IA 1YB1A 1YB5A 3DFZA 4L74A 4OL9A 3WGOA 4BKUA 5JCJD 2VYND 3UHAA 1XA0A 1KYQA 1YL7A 2GO1A 4R1NA 2UDPA 3E03A 3GH3A 2Q2WA 2OL4A 3LYLA 4BV8A 1GQQA 3DBRA 4BMSA 1Q2XA 1LA2A 1LLUA 2B36A 3F3SA 3GEDA 3GUYA 4KDFA 5JXWA 2ZYAA 1NQTA 2Z1NA 4XGNA 2EERA 2O2YA 2EHDA 3GOHA 4HADA 5F3RA 1X1TA 2O23A 2WD7A 2X58A 4D44A 1A9ZA 5TC4A 4OOFA 2DKNA 2DBVO 3GUCA 4XQ9A 2I9PA 3U0BA 2B4TO 1CQIA 4OXNA 4BKQA 3IP3A 4ALIA 3JQ7B 2NU9A 1DC4A 3EAGA 2XXBA 1D4FA 1HL3A 2AXQA 4AG3A 4CV2A 3F5SA 1BG6A 3FCOA 1U3TA 4P38A 4CM1A 3QVXA 3B70A 2LDXA 3HB4X 4M86A 5JY6A 3ADOA 4XWYA 5GZ6A 4CUZA 3RU9A 1P74A 4GLLA 4OH1A 4Z0HO 2PFGA 5EJ2A 5TT0A 2EW2A 4E5MA 1E7YA 3OECA 2PA3A 1UR5A 1O0SA 2CF5A 5JDIC 1R0KA 4ND1A 3PZBA 2DFVA 1JA9A 5KJCA 3F1LA 1WVGA 5MDHA 2PKQP 1GUYA 4IDAA 2I76A 1Y8QA 3TZCA 2YYYA 1ZSNA 3I4FA 4FN4A 2O2SA 1VRWA 4NBRA 1BTOA 1EBUA 5DBGA 3BZUA 5DCYA 2YV1A 4DPLA 3EUWA 5CEFA 2Y1DA 4FD3A 5JO0A 5JFOA 4D79A 1DFGA 4D41A 4TVBA 5BSHA 4RCVA 1PS8A 4Y8VA 4H3VA 2Q2VA 4KP7A 3RC1A 4BMVA 3OJFA 3BHMA 4TWRA 6ADHA 5TS3A 1WMAA 1MG0A 2Q1SA 4PLHA 1CETA 2ZB8A 4A7PA 3R1IA 1WDMA 1DRUA 4II3A 1EK6A 5ITWA 4DBVO 1CEQA 5IN4A 4M1QA 2PK3A 2D0IA 1WP4A 3BMNB 3DQPA 2H6EA 5JDIA 1SEVA 1YQGA 3TFOA 1VC2A 4DGSA 1BVRA 2FOIA 1ISJA 1O89A 1OAAA 5F5LA 1HLDA 1PWXA 3AU9A 3CPSA 4ALKA 2JAPA 1OC2A 1HWYA 3VTFA 3JD1A 4TMFA 1EUCA 3F46A 4XB2A 3ZI0A 3HQ4O 3BIOA 4IJWA 4JP3A 2C2YA 4HBGA 2C54A 4MIYA 4E3ZA 4XZ3A 2B4QA 3LC1O 1GZ3A 5L7WA 1PJ3A 3U4CA 5JPIA 4BGEA 3JYLA 4N54A 1U3WA 1PGJA 4YRAA 4AJ1A 4XX0A 3O8QA 4KMSA 2GNAA 1LSUA 1H93A 1QLHA 3AUUA 1L1FA 3Q2IA 2EGGA 1DC5A 1HE2A 1IB6A 2AE1A 4MP8A 5I7VA 4D0RA 4WASA 4ID9A 3WWZA 3RBXA 4YT8A 1LDNA 4CM9A 3TL2A 3LC2O 1ONOA 2VT3A 5KVVA 3A1NA 3RQSA 1I33A 3MEQA 4BV9A 2IXBA 2ZATA 4HV4A 5KJ1A 2D4AA 3GDOA 3RFXA 2UV8A 3ROQA 3AFMA 4FB5A 4WGGA 4O5OA 4P22A 4YAJA 4L4XA 5I8ZA 4O6VA 3PPIA 1T2DA 1LI4A 4QECA 2DT5A 1RYEA 1M6WA 5KVSA 3D64A 4BNGA 4Y9DA 3NDRA 2XXJA 4TRJA 3I52A 3U9LA 4XGIA 4HXYA 3GDFA 2VN8A 4EJMA 1HTBA 2BFAA 1ZK3A 3I3OA 4ZN6A 2EP7A 2OP1A 3IAHA 3QP9A 3WQRA 1A7KA 4UVEA 5BR7A 2PGDA 3KYCB 2NV6A 3ENNA 2G1UA 1ADFA 4J1NA 4B4WA 2QHXA 2DTEA 4YJHB 5KKAA 1R4NB 1ENYA 3CIFA 3PJGA 2HU2A 3L0DA 4P8RA 4CLRB 2E4AA 3RUDA 4EW6A 2C5AA 3DBLB 4G5HA 3X2EA 1F06A 4JX8A 5I7SA 3ITKA 1N9GA 3C24A 4RZHA 4CR8A 3P19A 5B12A 4O0LA 1B3RA 3GMDA 3OETA 4CM3A 3PHHA 3PXXA 1RKXA 3CMMA 3FD8A 3PVZA 2PH5A 4JNKA 4CV3A 4EJ0A 4WOJA 4PVDA 4BGVA 3W6UA 3GAZA 3PP8A 3VVCA 1LDBA 1E6EA 4TZTA 2WSBA 2R00C 5ER9A 3K96A 4J3FA 4P4NA 1DDOA 5KOIA 3VKUA 3ANNA 1ZKMA 1KBZA 3RUAA 2J8ZA 4CL3A 1NR7A 4B8WA 4NBTA 4GPD1 1QYCA 1PIWA 4ZA2A 1HE3A 2ZB3A 4ND2A 4IJVA 5KNLA 2CFCA 4GKVA 4XQEA 1GFSA 3HN7A 2JD1A 3H5RA 3NEPX 4BNWA 4BO8A 3ICCA 4MIOA 3ZNQA 5IDWA 1DRVA 1T24A 3ZWVA 2YQ5A 4AJIA 5F1OA 3QVOA 1KERA 4NJMB 4YB8A 2QYSA 2ZTVA 4DIOA 3QSGA 1O95A 1H2HA 1Z6ZA 2SCUA 1WLYA 5A5EA 2R00A 2Y66A 3FTPA 4L76A 4PLYA 1D8AA 3CEAA 1E0DA 2WDZA 1U2DA 3NT2A 4Y6RA 3V8BA 3IIEA 2JCYA 3KLMX 4B8ZA 1TA4A 1YO6A 4AJPA 1DIBA 1HYHA 4NNJA 3ZWAA 5EPOA 2VHXA 3RC7A 3ZU4A 4PVCA 1C3VA 3D5TA 5KJEA 4BNJA 4NK5A 4RVSA 3NJ8A 4D43A 2OOSA 3G17A 4FOOA 3WGTA 1LLCA 4XR4A 2OBYA 2WWRA 3LDHA 1BGVA 3PLNA 3W8FA 5GZ1A 3AOEC 2IYOA 2BGKA 3GFGA 3DOOA 3NKLA 4QFDA 3TOXA 3RFTA 4LVCA 3HN2A 4QT0A 3DHNA 1R16A 1T2FA 3H5AA 2EW8A 3UW3A 1NFQA 1YL6A 1CJCA 3PI7A 2ZTUA 5HA5A 4ALNA 1WNTA 2GASA 4RPHA 3QV1A 2IE0A 1YONA 4CQMA 1PTJA 1KY4A 2X8LA 3MCVA 4BO1A 4NBUA 3I9JA 3RCBA 4BNHA 4J7XA 1GZ6A 3ZWCA 1DIGA 1I3MA 3DZKA 3QVWA 5I9NA 4PCVA 4RVDA 2O3SA 2B0JA 5EESA 2GLXA 1NQ5A 3AOEA 1UUFA 1YBAA 3NT5A 3WSVA 3ZV6A 4UVIA 2VHYA 3A28A 2C20A 3IUPA 4CUJA 4R5MA 1R66A 3IKVA 4FOSA 1V9LA 5L40A 1C0PA 1M76A 3WGZA 4PZDA 1U8XX 1CYDA 3E5MA 4BO7A 2TMDA 4C7JA 4CM8B 1PQPA 1VJ0A 4E0BA 5ICMA 3CXRA 5TLSA 2E82A 3OQ1A 5FI3A 4IQGA 1U3VA 1Q0LA 3DFUA 2YHIA 3F4LA 3HB5X 2A4KA 4PLCA 1HLPA 2NM0A 5JCXA 3ASVA 3OBBA 3AUSA 3BTUA 2DC1A 3EY4A 4RVGA 5J23A 1SPXA 1PX0A 2VYVA 3IS3A 5DN9A 4MVJD 4J2OA 3UUWA 3QLJA 1Y8RA 1ADCA 4DPKA 2AE2A 5L4LA 4B3HA 3I83A 4LGVA 1SAYA 1BW9B 4LVUA 4M8SA 4NH4A 5CP8A 4I8XA 1Z82A 1MXFA 2X5JO 5DOZA 4JJGA 2NVUA 3TNLA 3WTCA 4CLDA 1Z74A 3KV3O 1E7SA 5HBRA 1YJ8A 3X2FA 2F1KA 4QUKA 2FHSA 4URFA 5FYDA 5TF4A 5IDQA 2CD9A 2VWHA 1SMKA 1ZFNA 4IMPA 4J1TA 4Z9YA 3WICA 2GN6A 4FCCA 5B4VA 1ENPA 1V3VA 1E1LA 2C59A 1NBOA 1LRJA 4HFRA 3OH8A 4FIZA 2GF2A 1J4AA 1A4IA 3DBVO 2X23A 1LSOA 4U6QA 1QYXA 5T64A 4PLFA 2EKPA 4UUOA 1F8FA 4XYLA 1XHLA 3GNQA 3BHJA 1H9BA 1N2SA 4H15A 3D4OA 1P77A 2VNAA 5KVQA 4G81A 5CEEA 4R1TA 4F3YA 1RM4A 2O48X 4PRLA 4HNHA 2C29D 5T8KC 1XG5A 1VL8A 2QYTA 4E31A 1W6UA 1ML3A 4KUGA 3H9UA 4KZPA 1E7MA 2D1YA 3GVIA 1LLQA 3UF0A 3COSA 5JBIA 3U09A 1Z75A 1DJQA 4Y98A 4BO5A 4I9UA 3QY9A 3TOZA 3LVFO 1UZMA 2G0TA 1EE9A 3QWIA 3ASUA 1N7GA 1TT7A 5I9LA 4IDEA 5A06A 1A9YA 1VSUA 2G82A 3F9IA 3OSUA 3UICA 2JAHA 3OJEA 4QTZA 1JW9B 5JE8A 2AG5A 1MA0A 4J6FA 4JIGA 4XGKA 4DQVA 3AM5A 3H6KA 3ZV4A 1EVJA 2WYUA 3B1KA 1GU7A 4C7KA 3JYQA 4D3FA 1FXSA 1IHXA 2Q3EA 3DBHB 4RDIA 1O9BA 4GBJA 5EINA 3IKTA 3AWDA 5T8KA 4PLVA 5IXSA 2O7SA 4XB1A 1KVTA 1BXKA 1KEVA 2BD0A 1U1IA 2YV3A 4XJTA 2JKVA 3JD3A 2X5KO 5AYVA 3VZQA 4B3IA 5AXBA 4DQUA 1RWBA 1JWAB 5JNLA 1DIRA 2AQKA 4J0EA 3Q0EA 4I5GA 3F6YA 4LMPA 4TROA 5L7TA 1DB3A 3ZGYA 3JQDA 3UCXA 3VOSA 2NQ8A 1AA0A 4KQXA 1E7WA 3S2EA 3AY6A 3FN4A 4YJGA 2DTDA 4TKLA 1HYGA 3FNHA 4IDFA 1E6UA 4NK4A 3QWFA 1I24A 2GN4A 3WNQA 5JYDA 4PZCA 1G0NA 5A9SA 2NTVA 3T7EA 5L51A 4ND5A 1HKUA 5JAMA 4YCAA 2A35A 2E6UX 5I7FA 4FQ8A 1H94A 2ZK7A 3AW9A 2BF7A 4FGSA 4XDZA 3ZHZA 1U5CA 1GPDG 2PZMA 4C4OA 5DBFA 2HK7A 4GMFA 1ZIDA 4HNGA 1AHIA 3BTSA 3VHRA 2PLAA 1GUFA 4Z0PA 4IS3A 4FFNA 2DAPA 2RCYA 3FHLA 1VJ1A 3LU1A 1LLDA 4WLVA 1PJBA 1UZLA 5I8WA 2A9FA 2H63A 2H9IA 4IDGA 3P2OA 4PRKA 1U5AA 3GRKA 4JQCA 3ROPA 1IPFA 4MP6A 4YBZA 3TFQA 4ALMA 2D2IA 2NACA 1HDOA 5EERA 3ONEA 1QRRA 2NTJA 2HRBA 1NYTA 1ADBA 4ZU3A 5TT1A 4UEOA 3CH6A 3A14A 2GYYA 2RIRA 4IDBA 1NP3A 4BL5A 3D3EA 4MIEA 1E3LA 3Q9NA 5H82A 3C85A 1XQ1A 4LCJA 3L9XA 1K2WA 2ZCUA 1B2LA 2GGSA 3I9LA 1G1AA 5H83A 4KTTE 4FPXA 1FDTA 1ISFA 2W2KA 3JYOA 5ICSA 3EHEA 4E32A 1Z7BA 4UUPA 4CLOB 1UP4A 4BB6A 5ENVA 3TN7A 4NDNE 1LSSA 4J90A 4KUEA 1LC0A 1GEEA 3NX4A 5IDXA 3WMWA 1CIVA 1MLDA 5C5IA 1LDYA 2P68A 7ADHA 4EZBA 1DSSG 2YFQA 3KSDO 2GDZA 5DDIP 1E5QA 1NHGA 4R54A 3OICA 5IXYA 4B3JA 3M2PA 1PS9A 2X7HA 4N5NA 3OP4A 4I08A 5ILGA 2GN9A 3IL2A 3M2TA 2IDZA 3ZWOA 4JLWA 3PDUA 1DHTA 2R6JA 2Q4EA 4MOWA 3ZH2A 5AXDA 1TXGA 5CG1A 3QIVA 4PLZA 1CDOA 1I3NA 3PJEA 4BKRA 1UAYA 3DOCA 4CMCA 2V65A 4IDCA 2EG9A 5EL0A 1UZNA 3C1OA 3HG7A 3RAJA 2CNBA 3IDSA 2J3HA 5B1YA 2E37A 5COAA 4MVJG 5ADHA 5ITVA 4R68A 1AXEA 1YJQA 3GDGA 3DDNA 3UXYA 4GL4A 1E3IA 2CDBA 4E5NA 3KYBA 5CFZA 1LDEA 2V6MA 1OMOA 3H7AA 1T2AA 3PIDA 4X54A 2VTEA 1OX3A 2JJYA 3V1TC 2JFGA 1DO8A 2VZ0A 3L77A 2IEDA 2PZJA 5C37A 2OUIA 4KWIA 1C0KA 4WUVA 3D1LA 2P4QA 6LDHA 2V6BA 5JYEA 5HWSA 3MWDB 1NM5A 1HYEA 1QG6A 4I1IA 1X1EA 1DEHA 4J49A 4AVYA 4QQRA 4J7CA 2UVDA 1ZJYA 5FEUA 1E6WA 5KJFA 4WCFB 1NAYA 5G4LA 3L6EA 3LQFA 4FGWA 1J6UA 4EUFA 1ORRA 4PGFA 1AE1A 3NGLA 2VCYA 3PYXA 4IIVA 2ZYDA 2AEJA 4OMUA 3SXPA 4B4VA 4B4UA 4CPDA 1IL0A 4RZIA 2FZWA 3AUTA 5G2OA 2ZB4A 1PGQA 3Q1LA 1X0XA 4PG6A 5DF1A 5BQFA 3BA1A 5IZCA 4ND4A 4TKMA 5F1KA 1BSVA 4EEZA 3H5NA 3JQBC 3PWZA 4XEHA 5BSGA 3DHEA 3GAFA 1FJHA 5C7OO 3E9NA 3I9OA 2YZ7A 2GERA 4E2YA 3L4BA 5H81A 3C1AA 3BMCA 5IJZA 3MJSA 2O50A 3WGHA 1GV0A 5MGBA 3DONA 3NDJA 3D3WA 1JAXA 3GNTA 3OEYA 4L73A 4IS2A 3FI9A 1HEUA 4J0FA 4ZHSA 3HUDA 4AJOA 4BO4A 3W4IA 1YBVA 1GTMA 2VOJA 2YHUA 3SX2A 1W8DA 2WEKA 4QSMA 1KEWA 3EZLA 5DBIA 1VJTA 4MVJH 3S2IA 2EJVA 1K6JA 4I9NA 5JS6A 3M6IA 3JQBA 3PQEA 1B14A 4YR9A 3K73O 3GVHA 2FMUA 1WXDA 3V2UA 3RUEA 4WOKA 3TL3A 4IMRA 2BLLA 1CQJA 1ZO8A 4WJZA 1B3BA 2BFPA 5L3ZA 2RHRA 3FPCA 3KYDB 4M54A 1IULA 1GZ4A 4R9RA 2ZJ1A 3TZKA 4HWKA 3S2GA 4P4LA 5K6AC 1OC4A 3LF2A 3NGXA 5KVCA 2QG4A 1QV7A 1EVIA 1T2CA 3JYNA 4BKPA 2EWMA 4UVHA 3AFNA 2HMUA 1BMDA 1FDSA 1X7GA 1B8UA 3H2ZA 2AA3A 2PD4A 3T4EA 1U3UA 2CSUA 4Z3DA 4CMGA 1E3EA 4FR5A 4D3DA 5CDYA 3AOGA 4A26A 1A71A 2DUUA 3K2EA 1ZZEA 4CUKA 4RF3A 5CDSA 2G5CA 1BXZA 3TPCA 2JCXA 4R69A 4Z9XA 3P7MA 1W4ZA 1A27A 3NUGA 4FFMA 1ISGA 1KVQA 3BYZA 4LN1A 1RM0A 4RGBA 2G76A 3TZHA 2I3GA 1C0LA 2C7GA 3K2BA 3WXBA 4ZJUA 3AU8A 1NVGA 5G0SA 1BVUA 4B7CA 3QW2A 5CAEA 3CTMA 3RSHA 4YQYA 1U8FO 4DTIA 3WG9A 1JU9A 2W2LA 2FZEA 2FSSA 1QSGA 2VHWA 2Z5LA 1RJWA 1YVEI 3DZJA 4MKRA 3ZCXA 4MVJM 4O1MA 3AY3A 2RAFA 4RVFA 5GZ3A 1EE2A 1P0FA 3I5MA 4WNIA 4GMGA 1LRKA 5DP2A 3ANLA 4KQWA 4OXYA 5JLAA 1VL6A 5ER6A 4J2HA 1DAOA 3BHIA 2H5LA 3JD4A 4E12A 4RQTA 4ZQEA 4GWKA 4YYZA 4E33A 3ITDA 5JMPA 2O7QA 2J5RA 1SB9A 2OZPA 2DBRA 4BNFA 4E2XA 1EUDA 3PHJA 4CMKA 2XPCA 4F46A 5CHEA 2I67A 4I5EA 3RUCA 4YPOA 4L9RA 4CL8A 2B35A 1HDYA 2QZZA 2YQ4A 4IIUA 2CDCA 3SLKA 3P2YA 3GG9A 4I9HA 1TT5B 1WAMA 3KZVA 3PHGA 3OF2A 4TRNA 3OQBA 3A9WA 3U4DA 1E1MA 1UXJA 1XU7A 1M66A 2UYYA 3QHAA 2PD3A 4E6PA 3PJDA 1Y7TA 2AEFA 2HLPA 3TJRA 3KETA 4Q3NA 1LDMA 2PGJA 1PQWA 2DBQA 3P5SA 3SBOA 4Y6SA 1UDCA 3RIHA 1RPNA 2Y68A 3F5QA 4RF2A 4GLOA 5JC1A 4RF4A 1NVTA 3C3XA 4RO0A 1O6ZA 3DZBA 1VM6A 3F4BA 2Y1OA 4QO7A 1HRDA 3BMQB 1PJCA 3JQ7A 4Q3EA 3UCFA 4ZICA 3KLPX 1X7HA 3E5RA 1YL5A 3DMTC 1ISMA 1PJQA 2GD1O 4HFMA 3C7DB 3OHSX 2P9EA 2EV9A 3WIDA 1EDZA 2CVQA 1FK8A 1T2EA 4F45A 1LDGA 2GN8A 5JCJA 1M6HA 2VYNA 1N5DA 3L4SO 5HM8A 4J1QA 3GLQA 2HJSA 3DAGA 1HETA 2AQ8A 5KIAA 5F1PA 1IZ9A 2BELA 1I0ZA 4CLEA 4YXFA 1HDCA 1ZK1A 3BMOB 5T5QA 4GSLA 3C7AA 4WLOA 4R1SA 2C2XA 2I6TA 4UVDA 4LRSB 3KOUA 3U4HA 2WD8A 3RWBA 4A03A 3JSAA 4LSMA 5DULA 4D0SA 2DUWA 1LQUA 3H9QA 1YRLA 4AJ4A 4W9NC 1GDHA 4IM7A 1P45A 4RQUA 3DMTA 3RUHA 4JGBA 2X0JA 1P44A 3H8VA 5T6BA 3WJ7A 2VHVA 1YQDA 3KTDA 5T67A 4OQZA 2FN7A 3W4JA 4BO6A 3ANMA 4ZQHA 4OQYA 2RBEA 3E8XA 4XD2A 2AMFA 2FWMX 4BS9A 1A7AA 4CMEC 4XYEA 1ZEMA 1QV6A 3H3JA 1CERA 1DOHA 2VRBA 3AUAA 3BMNA 1D1SA 3GR6A 3U49A 1X13A 4N5MA 5EN4A 4BUCA 2WMDA 1C1XA 2A94A 3S2FA 1Y6JA 4PZEA 1RM5A 3MJTA 1NX6A 3K5PA 3ZZNA 5TNXA 3WWYA 1QKIA 4W9NA 1JVBA 3MZ0A 2X0IA 2A92A 5EIOA 4FJ2A 2IZ0A 5AXCA 4HP8A 1CRWG 4JBIA 4D3SA 3WQSB 4CV0A 3ON5A 4DIFA 4A27A 3UAGA 1E3JA 3DC2A 3CINA 4DMMA 3Q11A 3JD2A 3KO8A 1DXYA 4U7WA 3FR7A 5EMHA 1L7DA 3GGPA 4QEDA 3WBBA 2GZ2A 3ZDFA 3JYPA 2YY7A 5BNFA 4E5YA 1E5LA 4E4YA 2BGLA 2BI8A 4GWGA 4UEJA 5IFLA 3OA2A 1AUPA 2FRDA 5L45A 3GFBA 3DHYA 2IZ1A 3DL2A 4JCOA 5CDTA 3OMLA 4NU5A 3CSDA 3ZW9A 1Y1PA 8LDHA 2UUPA 1IYZA 4L4RA 1DC6A 1AN9A 1Y9EA 3LSYA 1GPJA 3D4PA 2Q45A 1EQUA 5C7IO 1J49A 1V6AA 1ZK0A 3KSUA 3ETEA 4L4SA 1OBFO 3TZQA 3QE3A 3Q3CA 5IDYA 4XYMA 1ISHA 2BHLA 2NWQA 1TLTA 1QORA 4N18A 4E21A 1M67A 3K6JA 1YGYA 1UDAA 4M49A 3ZHYA 3DO5A 3G79A 3WSWA 4WEOA 4J9VA 2RH4A 1ZBQA 4ZRMA 4WLEA 4DXHA 3TQHA 3MOGA 5G4KB 3EDMA 3G1UA 4RPJA 3WOHA 1EK5A 2VHZA 4PLTA 1GQ2A 2WE8A 1HSOA 3RBVA 4DL9A 1SNYA 1UH5A 2GPTA 3GPIA 1KVSA 4BNYA 4K6CA 2NQTA 4WPGA 4YJHA 1GCUA 1R4NA 5COQA 2HAEA 1E77A 1EBFA 1PJ4A 3CZRA 4JP2A 2PWZA 3GVPA 4YT4A 7MDHA 1I2CA 3DBLA 2P4HX 3CKYA 1FDVA 1ENOA 3LLVA 3H3FA 3L6OO 2OORA 1D3AA 3INGA 4RDHA 1B7GO 4CMIB 2D5AA 4DA9A 3JQ8A 1U4OA 1ZJZA 2PTGA 3MTJA 2PH3A 2AG8A 2D5CA 4MVJE 1XGKA 3A4VA 5G0TA 1U4SA 2OXIA 3QWBA 4CM4A 4PG8A 3PHLA 1M75A 1ZW1A 1XYGA 2OBNA 3H9GA 3GVCA 4CLHA 1XEAA 1B26A 4OSOA 1B15A 3FBGA 2BFOA 1H6AA 2UAGA 5TRTA 4GX5A 4A0SA 4BNIA 2GRAA 1PL6A 1PZHA 4BNLA 1U9JA 1K89A 2PR2A 5A4DA 4DYDA 3M1AA 4Q39A 1QLJA 4MJLA 3MJVA 3GY0A 2ZTLA 1B0AA 4II2A 4JBGA 1V3TA 1VSVA 1C14A 1JWBB 2AQIA 4XIYA 5A9TA 5IF3A 4PG4A 2PV7A 4WLFA 3RD5A 4DPMA 3AK4A 5L7YA 1D1TA 1N1EA 1Q0HA 1AXGA 2DTXA 4J4TA 1DIHA 3ONDA 1LUAA 2DVMA 3JQ9C 3PGXA 4ITUA 1LXCA 2NTNA 2FPGA 3OIDA 1R12A 4AJHA 1YB4A 5IN5A 1UP6A 3C1TA 2VTDA 4PN3A 4OYRA 5CDGA 3G49A 3O38A 1GADO 1JVSA 4HFJA 2C7VA 5U4QA 4DUPA 4YAIA 2HO5A 4WKGA 4ZRNA 4NBVA 1DJNA 4OOEA 2NVBA 5FI5A 4MPDA 3PHIA 1ZSYA 2EIHA 2W8ZA 3INRA 2GR9A 2QRKA 3IC5A 1V8BA 1JTVA 3FNFA 3I23A 4NG5A 2X22A 2FP4A 1PR9A 1X0VA 1KETA 5HTOA 1R0LA 2I3AA 1F0YA 2HMTA 1JKIA 4BVAA 4CM5A 3WFIA 3ZU2A 1EVYA 5DCWA 2WTBA 4NR0A 4DYVA 2VRCD 2WYWA 1GY8A 1IE3A 1MC5A 2VUSA 2I99A 1FF9A 3FTNA 3ZU3A 2B69A 4EJ6A 4E30A 4FSHA 4UAGA 1C1DA 1ZH8A 2FPIA 2W4QA 1MX3A 5L4SA 4MP3A 3WJAA 4M55A 1UXIA 4NFSA 3HFGA 1BHSA 3JCZA 1DFIA 3W4KA 2YDXA 4P4GA 1OFGA 1I3LA 4YJFB 4YDRA 3VPGA 2VWPA 1OI7A 2E48A 3WX0A 4ALJA 1WW8A 2Y99A 2POQX 3JQFC 3MTGA 1GD1O 4OIMA 4J43A 3W8EA 2O3JA 3ENKA 2Y1GA 5COBA 1IOLA 1R4MA 3JQGB 2QW8A 1GYPA 5HS6A 3DB2A 2W90A 3UN1A 5BSEA 4IQ0A 1N92A 1RM3A 3KM0A 5A05A 3QVSA 3IQDB 4FC7A 1EZ4A 1HE4A 4CM8A 5THKA 4JROA 3JQAB 3NDIA 4WE3A 2V7PA 4YT2A 4LK3A 1P3DA 5AXAA 1UDBA 1D7OA 3F1KA 3NAQA 4GX2A 4CR6A 4IZIA 1X14A 3JQ6A 1DBVO 1HT0A 3I6IA 2ZJ0A 4IQ8A 2P5UA 1IY8A 3K92A 4OGWA 4CR7A 3EYWA 2B83A 3GZNA 2HMVA 1XKQA 5IG2A 1BW9A 1HF3A 1SOVA 4HX5A 1VKNA 2NVWA 2JFFA 4FW8A 1V0JA 3NJ4A 4ZQFA 1FDUA 4A2CA 3WGYA 3QWHA 3NYWA 1K5HA 4IJUA 4FS3A 1FDWA 4BNVA 1F12A 4JJFA 2W98A 3FRJA 3OJOA 3KVOA 1LNQA 4LCEA 1O5IA 3VH2A 3DXFA 5I7EA 3MWEB 4FJ0A 2VUTA 3DBRB 2PY6A 5ES3A 4BNUA 1KC3A 1QP8A 3VTZA 4CV1A 4Q3BA 3KB6A 1ZCJA 3NV9A 5TIIA 4R01A 2WD7B 1EUZA 3GQVA 5DCUA 2EP5A 4WLUA 4B4OA 3H4VA 3RROA 2P9CA 1E1NA 2YUTA 4MVJA 1MXHA 2HCTA 3Q9UA 1F14A 1PGPA 4BB5A 1YDEA 3SEFA 2Q1TA 1H6CA 1MP0A 4BO0A 4RLSA 4E5PA 4EDFA 2DU8A 1KC1A 3Q6IA 1ULSA 3ZWBA 2AHRA 1T4BA 2PZKA 4W4TA 3RFVA 2Q4BA 3ROMA 5A3JA 1VE9A 4Q3CA 1XCBA 2DM6A 3ZHBA 1P33A 4Z6KA 1LJ8A 4BO9A 5ENDA 2Y1FA 1EFLA 4JK3A 3GRPA 3GG2A 1YXMA 3OJLA 4IPTA 1N8KA 1MC4A 1B8VA 3W1VA 1UXGA 3QWAA 4BNZA 3ZNOA 5HS4A 3SVTA 4OKNA 4IBOA 1P1KA 4GGOA 1Y8QB 1NXQA 1PJSA 5TX7A 2X0NA 3W6ZA 3RJ5A 1KVRA 4O59O 4XJSA 4XA8A 3DBHA 4RJTA 2PNFA 2OP0A 2CUKA 3LC7O 2Y93A 3NT4A 3Q2KA 5TSDA 1NPDA 4IUYA 1SC6A 1KEUA 4W6ZA 3RJ9A 3CUKA 5L53A 3RC9A 4GKBA 4G65A 4U5QA 2EF1A 2CF6A 9LDTA 2IZZA 3E9QA 4TSKA 1T4DA 1PWZA 4XR9A 3WGGA 3PLRA 1ID1A 3HSKA 1KVUA 3ORFA 4PG7A 4WECA 2I65A 1E92A 3O03A 4ZGWA 3DTTA 2OO5A 2CDAA 3INTA 3DWFA 1Y5RA 3HNPA 3VDRA 1JN0A 1VKOA 5TQVA 1PZEA 4YEDA 4IINA 4GI2A 5JY1A 4R3WA 2VRCA 4IZHA 5KJ6A 5JW6A 1LEHA 2FR8A 2PZLA 4AJ2A 1GYQA 3EC7A 4Y67A 3AY7A 4E2WA 3D7LA 3I9KA 3CMCO 5A3VA 3ZV3A 4RV9A 1TVEA 3GGGA 4NPCA 4ZVVA 4CJXA 2ILTA 3IMFA 3O8QB 4AJLA 5LDHA 1UXKA 3JQEA 3VH4A 1EMDA 3GT0A 5JC8A 1GAEO 3VH3A 3GEMA 3GN2A 4DBZA 4J9UE 3JTMA 4G2NA 4BIIA 1XIVA 1SBYA 3V1UA 3RKUA 3PYLA 3TSCA 4EEXA 1JAYA 3SC6A 4N5LA 4OO3A 4Z3KA 1NVMB 2B5WA 1O8CA 1U2GA 4OAQA 1ZVMA 2QQ5A 4IJKA 4BGUA 4GQAA 1MG5A 3D5QA 1K6IA 2EXXA 2X6TA 2Y0DA 3GC6A 4JBHA 3ZN2A 2ZKLA 4NIMA 4BQRA 3KRTA 4BGIA 1U28A 2JD2A 2YFHA 4CQLA 5FF9A 5GMOA 5DP1A 4K6FA 3MJ4A 4AJJA 3LLSA 1N7HA 4LMRA 1GR0A 2D59A 3UVEA 1LTHR 3WFJA 1AVYA 1NNUA 2X5OA 5T57A 3B1JA 4GAEA 3SLGA 4YAGA 5C7LO 4DQXA 4S1VA 2ZIZA 4NZ9A 2ZYGA 1SO8A 4CLOA 3LT4A 4TVOA 3F47A 4FDAA 3ST7A 4QXMA 1TB4A 4BNTA 4FFPA 1ZXBA 3ZV5A 1HZJA 1CF2O 5B4UA 3EW7A 3QA9A 3HWRA 2J6IA 3R0IA 2NU8A 5IAAA 1A72A 2EKQA 4DWVA 3FBTA 3PWKA 2LDBA 3U62A 1EQ2A 1PL7A 3LT1A 4F6CA 2J3JA 3M1LA 1YOVA 4BHTA 5U9CA 3E9MA 3WS7A 1E3WA 3O4RA 3KSZO 1N9GB 1NASA 1BXGA 2NADA 4YAKA 2EEZA 4XRRA 1EVZA 2JCVA 4WCFC 3HE3A 2IEBA 4RVHA 3AM3A 1HSZA 3OFSA 4TRMA 4CMAA 2CY0A 5K6AA 2IODA 3EZYA 3K31A 4YQZA 4CODB 5JAIA 3DTYA 1G6KA 1H6BA 4ZQGA 2HSDA 2JFHA 4Q3DA 4D42A 9LDBA 1HZZA 1S7CA 2V6FA 1NPYA 1E7RA 1W73A 2QX7A 2WM3A 4INAA 4O63O 4BMNA 5A1TA 2RHCA 4UUNA 3RBZA 5L4NA 3ROKA 4TZKA 2WJPA 3BAZA 3PIIA 3OIGA 3HZZA 4KDEA 5TJ9A 4BO3A 3ZWYA 1YBMA 5F21A 4NBWA 4E13A 4BO2A 2VQ3A 1ZXLA 1DLJA 3HFSA 3GHHA 4WCFA 1ZEJA 2DLDA 1Q7CA 4NJOA 5FFFA 5TJHA 1C1XB 1T26A 3HDJA 4J91A 1I5RA 4F6LA 2BMAA 3EMKA 3DOJA 3GPDG 2VOEA 4J1SA 3WQQA 4FFLA 1MGOA 4AFNA 2EGHA 3WYBA 2Q99A 4B7XA 1P0CA 4DLLA 1DHRA 3AJRA 1ZMOA 2O3QA 2NSDA 1B8PA 3HDYA 2Q2QA 2DBZA 3PDJA 4YWJA 3G1TA 4CQMD 4RVUA 4XQGA 3PRJA 3FR8A 4WLNA 3SJ7A 2FR1A 3SJUA 2FY8A 2Q1UA 3I4CA 3FNEA 3JV7A 3VAZA 3E48A 3ZWXA 3GHYA 1IUKA 3DR3A 2HJRA 4ILKA 4RPLA 1LX6A 4FFRA 3TDKA 1NWHA 1Q7GA 4Z0TA 4H16A 3ZWWA 4ALLA 5CPFA 1G0OA 1YS4A 2HQ1A 3UCEA 2FR0A 3JD0A 1GQYA 2YW9A 1XSEA 1DAPA 4GH5A 2P91A 3UFXA 4HKTA 3FWZA 1PL8A 1SCUA 1DIAA 2VWGA 5JAQA 4OSPA 4RLHA 4DVJA 1I3KA 1BDBA 3BTOA 1OZAA 3QQPA 3RUFA 5DNAA 4Y6PA 3BTVA 3KYDA 3ZU5A 4CQMB 2VYVD 3EGOA 1XQ6A 2OMEA 1WDKA 3V1YA 3NTOA 3PZRA 3RKRA 1B16A 2Q50A 1MFZA 4YRBA 3HHPA 3H2SA 4J7UA 3W8DA 3I9MA 3OJ0A 2XAAA 2TMGA 4K26A 1H2BA 4AJEA 1K6XA 4FFOA 1H0KA 4MO2A 1TI7A 3N58A 4DMLA 3L07A 3TWOA 4EYEA 3IJPA 1GEGA 3K8ZA 3QVTA 4QX6A 3K9QO 5JO9A 3R3SA 1K3TA 4XIJA 1VPDA 3WYCA 1HDRA 1JLLA 4OXKA 1ULUA 2VZ8A 1UAGA 3ZW8A 4CMJA 2D8AA 3KUXA 2DPGA 4MKXA 1RYDA 2YHIB 2G17A 3FWNA 4LISA 3JQ8B 4ONEA 4U0JA 2C5EA 3I6QA 4K1LA 4CM4B 5A9RA 3D4NA 5G0WA 4HUJA 4BQPA 2JD0A 1Z45A 1DC3A 4J4BA 1N1GA 2I5PO 3VDQA 1YH3A 4A73A 1P31A 1QYWA 2Z95A 2GZ1A 1I30A 3PWSA 1XELA 3PGJA 4UUMA 4OJNA 1MUUA 1Y8RB 2AW5A 3HDQA 4MVJP 4XCVA 3ABIA 4PIVA 4BNMA 4PLWA 4YRDA 4WCDA 2IRWA 3PFWO 5DOVA 2HDHA 2NVUB 4OHUA 3BXXA 3EK2A 3PYMA 5G0VA 5CEJA 1W0CA 1Y81A 3L9WA 1HE5A 4OKIA 1IPEA 1YQXA 3WTBA 1E1KA 1SOWA 3R3JA 3MOIA 1YWGO 3I1JA 4DREA 1ZMTA 2DPHA 1Q7BA 3DZFA 1P1IA 3OEWA 2Y0EA 3PEFA 4CM6A 1ONPA 4XDYA 3PJFA 1HDXA 4R1UA 3VPHA 4CMEA 2F00A 1I01A 1NAIA 5JMWA 1BDMA 2QZ9A 4KWHA 4ND3A 4MVJI 4NQZA 5C3MA 5CDUA 1Z73A 2NU6A 2NLOA 3C7CB 2XOXA 2CVZA 4BNKA 3RC2A 3AI1A 1P9LA 4AJNA 3EVTA 4R5HA 5LDGA 1XWFA 2OHXA 3GZ4A 3HJAA 1T1RA 3GA0A 1WMBA 1QYDA 1TT5A 4K28A 3ETGA 4LSWA 1Q1NA 2B4RO 3DMYA 1GV1A 4IGEA 2C82A 3S55A 4NFYA 3UGKA 4ESOA 2J5KA 2XF8A 3B1FA 3VZPA 1X15A 3DZIA 2C07A 2HMSA 1QXSA 4R51A 3VZRA 2FSVA 3LT2A 2FPPA 2ZQYA 1ISIA 1XLTA 3ONFA 1SEPA 3B20A 3PFFA 5G0UA 1KEPA 1R15A 4HY3A 3V2GA 1XU9A 2X1HA 2PD6A 3BMQA 4R3NA 2YDYA 2EJWA 3ZWPA 3WYEA 4W7IA 2JHGA 2RH8A 3KHUA 3KYCA 1P1JA 1ADGA 4YACA 1DPGA 1EEHA 3WIEA 3HADA 2Y1EA 5TGDA 4AICA 3AI3A 4EITA 5CG2A 2Z1MA 1WZEA 1C1DB 1H9AA 1Z7EA 3GGOA 4FJ1A 5AVOA 4CLRA 3S1LA 1A5ZA 3IOYA 4AJKA 2ZB7A 4GVXA 5ILOA 4S3MA 2O3TA 5IZ4A 3PTZA 4NI5A 2X9NA 3V5NA 1NPTO 1ENZA 3BMOA 5LC1A 1K0UA 3V2HA 1XDWA 4CM7A 3JQCA 5LCXA 2HMWA 1F17A 1KY5A 1NFRA 1LSJA 1S6YA 2BH9A 1R4MB 3KEOA 1Q0QA 3FF4A 4RPGA 2GZ3A 4I5FA 4YJGB 2VWQA 5BSFA 1R37A 4ZQBA 1DRWA 3MJEA 5I9MA 4IDDA 1PZGA 5A9SB 4Z9FA 5F5NA 2BGMA 3G3EA 4H7PA 4WNCA 2GSDA 4RORA 3WLFA 2ZCVA 4NMHA 4W7HA 4PFJA 3RVDA 5FWNA 4YAEA 4UULA 2IXAA 1O94A 1SB8A 2AQHA 1EDOA 1JQBA 2VNSA 2ZTMA 3WDSA 3VVBA 3WGQA 4DLBA 5A04A 3NRCA 1PU2A 3H9EO 4E5KA 3GZNB 1F8GA 1PJTA 4RPKA 1X7DA 3KXDA 3QRWA 4Q9NA 4CMHA 3UKOA 2YV2A 1U7TA 4NJMA 4B7UA 1V35A 4NHEA 4LW8A 4R16A 1TEHA 2NUAA 4XRGA 3VPFA 4YVFA 3WNVA 2H1SA 1GCOA 3RU7A 3GF4A 5A03A 1JDJA 3UH1A 4KUHA 1PJLA 1PQUA 5KKCA 3U5TA 1NAHA 1VLLA 1V3UA 3ULKA 1WDLA 4BOYA 1LQTA 3WGIA 2QIOA 4CMBA 2DFDA 2W2KB 4GX0A 4DRYA 4CLXA 1WZIA 4PLGA 1NR1A 3A06A 2Q49A 2BRUA 2QRLA 2Y0CA 3OIFA 4IXWA 4YTEA 1NTOA 2BFMA 2O3UA 4MVJF 3RASA 3JQ9A 3VPSA 4N7RA 4IGFA 4PLPA 3FPLA 1EFKA 2OFPA 5JSFA 4YJDA 4DLAA 2BI7A 4NFHA 3ZNPA 2P2SA 3LK7A 3JQAD 2J3KA 5BT9A 3VPXA 2D3TA 4A10A 2O4CA 5JDCC 1L7EA 1R0SA 4QFCA 2O3RA 4K9DA 1PSDA 1YDWA 4U6SA 1H5QA 2CZCA 4D7AA 1DFHA 1GUZA 1NHWA 2PKRA 1FMCA 5U1PA 2AEMA 1I36A 2JL1A 3GNSA 2VT2A 5G4KA 5K9ZA 5L9AA 4EGFA 4MINA 2X9VA 5A5FA 2Y67A 1C0IA 2HK8A 2Q1WA 1GL3A 1CWUA 4U8GA 3TZ6A 3LF1A 1LC3A 1YKFA 3IP1A 3PQFA 3R6DA 5L95A 1UJMA 1ZSVA 1PJ2A 5JDCA 3O9ZA 1NQOA 8ADHA 3DAPA 1I32A 5KTKA 3AI2A 1H6DA 4CMIA 1JKFA 1MB4A 3KEQA 2HK9A 4A5OA 1QYVA 5GY7A 4OM8A 3LZ6A 1MFPA 3B6ZA 3DEYX 1AHHA 5JAZA 4L0QA 4L75A 1P1HA 3DZGA 2JHFA 1I2ZA 2O4UX 4WK6A 4GVLA 3T4XA 2HUNA 3WMXA 3AM4A 4BNNA 5B4TA 1WWKA 1NFFA 4M89A 1DLIA 3JQFA 4W82A 4GSKA 3WB9A 1PZFA
chains in the Genus database with same CATH superfamily
3BCCG 4JC0A 2GUVA 4IH1A 5E1MA 1GN9A 1S2NA 3KE9A 1QR6A 4J16A 4EHKA 1SZJG 3U1BA 2ZVNB 2RGUA 2PGLA 2QRJA 3OHMA 3GJTA 3FETA 2D2VA 2R6CA 3Q7QA 3C5EA 1YJCA 4MKZA 3HRKA 5H5JA 4RYDA 3AVPA 2PT5A 1E0AA 1GCAA 3STHA 4ZODA 2HA0A 2CLKB 1Z39A 1NT2A 3RYIA 3OP1A 5MN5A 5DM4A 1KILB 1XAJA 3JR7A 1LD3A 3D9QX 5IANA 4EG0A 3WL3A 4XWGA 3WLEA 3E3LA 1WPQA 2XDJA 2PSSA 4HNUA 2I66A 1FUKA 2GK6A 2Z6UA 1MJHA 1WUIS 4BRYA 3ETDA 3E18A 2R5FA 4YJFA 1BWSA 5CVEA 2WYIA 1AA9A 1QCCA 3UUFA 1Q86Q 2DWCA 2NNLD 2BGNA 4G84A 4D1YA 3MUDA 3I45A 3VYSB 4IL6X 3A4YA 2I1JA 1AB6A 1R9MA 4DG9A 3A3KA 3OQ6A 2FQ1A 2F8TA 4L8VA 2J5QA 1MOZA 4D3XA 2XUDA 4W99A 1M1YB 4XFJA 3IOCA 3WGOA 4BKUA 1OFVA 3OZFA 1GQQA 1SQVJ 5JV5A 3N2KA 3C48A 2ZYAA 5LMCA 4QJIA 3KQYA 3DUFB 4MLDA 5FWYB 3C8ZA 4XQ9A 1FFXB 4UTRA 4H0FA 4PO1A 5AW6A 2E4ZA 2P9QA 5JNUA 4EECA 5NLLA 1U3TA 3GNLA 4N39A 4N0QA 4TOIA 4US0R 4L27A 3GI1A 5DX1A 4J0KA 4I66A 1HYQA 1JMKC 2JR8A 4DJGA 2O2SA 4Z4HA 4HAZA 4EOTA 4AY6A 2VS1A 1AKWA 1U80A 3DW3X 4H3VA 3RC1A 2XA2A 2RH5A 3GEBA 3QVJA 4M9XA 1NTKD 5JDIA 2CXPA 5J2UF 5F5LA 1HLDA 2ZFCA 5SZKB 3V2PA 1EXWA 1FS6A 1NVEA 3E53A 1WLSA 3BGWA 1VDFA 5LU8A 3V8MA 4WASA 3HP4A 1E9DA 4YT8A 4YGXB 1CZRA 5GOZA 2SKCA 4F1JA 4ECEA 4BV9A 3LPDA 4Z1MD 2D4AA 3P2MA 2XE4A 3QM1A 4MQEA 2Q1YA 1LI4A 2QGNA 3M6FA 4B35A 1YI8A 4WXEA 5H9WA 4F3CA 4X41A 3DAOA 1WUHS 3RREA 1HTBA 1S2EA 5BSTA 4B6SA 5F33A 3W68A 4IF4A 4DS3A 4Q05A 4EW6A 5I7SA 5IXJA 1N9GA 1WVIA 2CL5A 3OI7A 3AV3A 1LTQA 1E2FA 3W1EA 1PR4A 1ZUNA 5KOYA 1RKXA 4NPHA 5EGNA 5IWCA 3W6UA 2GVZC 3QZUA 2PU7A 3DE7X 2VQEB 4EENA 4QUGA 3FLAA 4C43A 4TKVA 2AXCA 4BNWA 1XRNA 4P33A 3VNVA 3LUKA 1JHUA 2H2DA 3INYA 5HIMA 2FX5A 1PCXA 2OAEA 1UMBB 4BJ1A 4B8ZA 1TA4A 1U0GA 4PX5A 5T3YA 4IKPA 4QGSA 5EPOA 1HH0A 2P9ZA 3E2MA 1LLCA 1SOAA 5LA6B 2FZ5A 2H3HA 5EIHA 2LXCB 2GTHA 2XMBA 4ZV7A 1E4OA 1XRMA 3RFTA 5IAJA 2PMWB 2P9HA 1CY6A 1YL6A 4KREA 5HA5A 3PQ8A 1MR3F 3OEED 4RTJA 1ILWA 5HOQA 3IP5A 2A14A 2AB0A 5BQ5A 3NHWA 1G64A 3PD0A 1XPOA 5IJAA 4DA6A 3CXRA 3PKIA 2K88A 2GFIA 1QOZA 1UBUS 5E0OA 3U7IA 3ASVA 2FQYA 1PX0A 2O8BA 5DN9A 3V7UA 4YRSA 3H0CA 1KU0A 1SAYA 4HPJB 4LVUA 4JI0B 2WAOA 5KDDA 3RU2A 5LFAA 3RS5A 2CD9A 2X8AA 1QK4A 3WICA 4H44D 1E1LA 1V3VA 1T5LA 2IV3A 4K3UA 1P77A 5BNWA 2JDIH 4YRTA 4GOJA 3L72D 4HNHA 4X95A 4RKRA 1U1GA 3WMM0 2BFCA 3BD6A 3RGWS 3MMXA 1DKMA 5FAKA 3ASUA 5I9LA 5JD4A 3Q10A 3NM6B 5GTHE 3VPBA 2XWQA 2IWRA 1NLUA 3SSNA 1K66A 3GAAA 3N8NA 2HJGA 4UM9B 2HJVA 4GR9A 3AI7A 4L0DA 4FU0A 3QVUA 2FRVA 5K0BA 4Q15A 3WNBA 3JQDA 5TQJA 3OX1A 4JXJA 1I24A 3ANXA 2GKSA 3DXYA 3JAWA 1I2DA 1C4XA 4RK7A 4FGSA 4R8SA 1LW7A 5J9FA 4HKZH 4RTOA 4HNGA 1CUFA 1AHIA 2UYCA 4C88A 2YW2A 1RZ3A 3HB9A 2PN1A 1ZBDA 1G7SA 3M5WA 4GUDA 4PRKA 1B23P 3GFQA 3ROPA 4JOBA 5KTRA 3P8MC 2D2CB 3QXHA 5TT1A 3RG2A 4LDJA 4OP2A 4LCJA 1G8AA 2WICA 4JPZB 3H2JA 4LYGA 1EAYA 4UUPA 1NUAA 4NDNE 2KUBA 1SOMA 3LOUA 1K7EB 1NTZJ 3KSDO 3DYVA 1E5QA 3OICA 3D6FA 2IDZA 1TXGA 4QRDA 4LGYA 4IDCA 3JALB 3C1OA 2JH9A 3SS7X 2PX5A 1SQPG 1E3IA 3IN6A 4W1QA 1LJUA 1XEFA 1LPSA 4B81A 5C32A 1EDEA 4YRZA 1KPHA 3LXMA 3KP1A 1SQFA 3FUCA 2KS1B 1YB7A 3JRNA 1A5SB 4HAUA 3BJEA 1H8HA 2UVDA 4ZAWA 3SBEA 1ORRA 3QELB 3B8EA 3SXPA 1IL0A 2FZWA 1ODTC 2ZB4A 3EDOA 5BQFA 3PPWA 1ZYUA 4GPBA 5EKSA 2WRZA 1SFCC 1N2CE 2F9FA 4HLDA 5IJZA 3NDJA 4FZJA 1JAXA 1HJBA 4NRDA 1VCIA 2B8WA 2C2ZA 2ACKA 2GM4A 3W4IA 3FMGA 4DR2B 2OFWA 2E89A 1VJTA 1ICEA 5JS6A 2EFCB 1WXDA 2BLLA 2BFPA 4M54A 2N1BA 1IQ0A 1NYHA 1VQPP 2GM5A 3R4YA 3W5VA 5KVCA 3DWIA 1W1IA 3IAOA 3ZUGA 4H7EA 3OKAA 3UMCA 1E99A 1CK4A 4KYTA 6NULA 2FG6C 4MCJA 3NEAA 2OV3A 2MSKA 5FL3A 1NTKE 5IC5A 3BT7A 4R8VA 1W4CA 2I4TA 2JFYA 2QAIA 3S5JA 4LQCA 2QU8A 1BCCD 2AJCA 4B7CA 4CCYB 2VR1A 2VJLA 3DG9A 2VHWA 3UXHA 2ZE6A 3L2OB 4YASA 5EE0A 2VATA 4NARA 4DFDA 4TT3A 3W5AA 3R5HA 1Z63A 5AVUA 1WB4A 3PQCA 4KQWA 4ZVTA 2FMIA 2FZLA 1W30A 4GYKA 4E33A 2NW6A 1G2CB 4M1OA 2DSNA 4QLAA 1FW6A 3BXEA 1P4GA 4MGHA 1T2UA 4P2GA 1KF0A 3GG9A 3O1IC 3C14C 3KZVA 5BVGB 3OF2A 1EZVE 2P6NA 5DM0A 1U3CA 2C7OA 3GIWA 2GPAA 2HLDD 4N01A 3JC22 4P08A 3B2EA 4L5JA 5B58T 4Q3EA 1ORIA 3T7JA 3WWOA 2OYIA 4A92A 3WIDA 4RMIA 1T2EA 1W2EA 1KQFA 1N6RA 2CPSA 3OPXA 3CKMA 2VYNA 1OV6A 3R0JA 3M89A 4CLEA 1ZK1A 5BW5A 4O4JF 2WPQA 1NV9A 3B6MA 1K9SA 1KH2A 5DBOA 1KYIA 2QG9A 5IHXA 2HU5A 2WP8J 2EJTA 1GA4A 2I1VB 2X0JA 3LH5A 3W79A 2SECE 1YS9A 4PSVA 1RBQA 4HB3A 4RY0A 5EP3A 4PPQA 4X8LA 1WTCA 2HRCA 3EN0A 2VYFA 1RYBA 5CFOA 3HE5A 2FCRA 2Z6AA 5CX1B 4GT1A 3C41J 3KO8A 3GLIB 1RLIA 2HV9A 2R1TB 5CCGC 3WBBA 3FSEA 2NSHA 2YJ5A 1J1ZA 5BNFA 1JJ7A 1D7MA 4UEJA 3MQFA 4FYHA 3IPYA 1BQ4A 3ICEA 1VCMA 4G97A 1NXTA 1Y1PA 3VR5H 3VR4A 1IYZA 3AR9A 5CA0A 3OFND 4TLEA 3ETCA 2R85A 3DO5A 5IBQA 4WLEA 1HG1A 4DXHA 2EFGA 5B3LA 2NQTA 5COQA 1LF5A 4DJJA 4M60A 3AJEA 1ZDMA 2HHJA 4KFRA 1GU0A 2OCAA 1J5EB 4PHTA 5HE9A 2XT9A 4MRVA 1U4SA 1JU3A 3OOSA 3NM4A 1B26A 4F2GA 1ZX1A 1E9AA 3U4QA 1SQPD 3U19A 4NEHB 5GIPE 4BVGA 4FZ5A 3KAQA 3FWLA 5JZBA 3E23A 1O6CA 2K5UA 3NAGA 5JCOA 3AR7A 4G0OA 4O1HA 3BJIC 5A9TA 1U8TA 5D1NA 4HEQA 4DIUA 2DTXA 1DIHA 1OAOC 2AXNA 2QK4A 4AQRD 5IVDA 3ZLUA 1XYYA 4LJRA 4YTPC 1WKCA 4I8IA 3L72E 1CQZA 2OCPA 4MVYA 5FA6A 3L70J 2BKEA 3HD7B 2N1MA 3O2SB 5E2AA 4V1CI 4PXSA 5B3AA 5BT8A 4P80A 3A6FA 4ZO6A 5HE8A 2A5LA 2FMHA 2NO9A 2JLXA 3VO8A 5DNWA 1TA9A 4YRCA 4HLCA 1ZOYC 2R3SA 5HS6A 5FR2A 4P35A 1R7RA 1RM3A 5A05A 4WINA 4BKMA 1G5RA 1ZQ1A 2D00A 3AHGA 4K8RB 5BVZA 2J0EA 1V8FA 1LWUA 1P3DA 3PFKA 4TWAA 2J0QA 4JI6B 3DEZA 2QIWA 3EYWA 4HEHA 5AHRA 4EPYA 4U7FA 5K3DA 1LFDB 3LBIA 2Y71A 3OUUA 3SZUA 2BYTA 4NJEB 2H0RA 5LD2C 1SU8A 4KCGA 1NDUA 3AJ9A 1N8TA 1E32A 3J7TA 2YUTA 1MXHA 1RJ9B 4P2BA 2UKDA 1MP0A 1R10A 2W6ZA 5AW7A 4W1RA 2Z1DA 3U44B 3FKQA 3ROMA 1EB9A 2DM6A 2DFKB 3KCNA 3VDNB 2Y1FA 3CBGA 5BYBA 2QI9C 3I56P 3KQLA 3SHFA 2ONZA 2WBLC 4F71A 4RMJA 3TW6A 5ALJA 5EI5A 3IIMA 4RJTA 2K6GA 1IEVA 1GZSA 1JB1A 7REQA 2YXPX 2XZTA 4GKBA 1H66A 3VR6A 4K2HA 3BJZA 1C8VB 4MV3A 3PR3A 2QTFA 3M3DA 3VDRA 2O6LA 5TQVA 1VKRA 3ZDZB 3L73G 4LZWA 4HDMB 4AJLA 2KQUA 2LPMA 1PBNA 4BIIA 3V1UA 2O8FB 121PA 3MWKA 1ZVMA 4IJKA 2W2QA 4YJKA 4F60A 2BHRA 4I6MC 1NZDA 1S1MA 2Q5IA 4QTXA 3SQWA 4OYYA 1LTHR 2O8DB 1B1AA 2YS7A 3TAXA 3NNSA 2JZOA 2EFHB 4LHYA 2X3FA 1NZFA 3DBIA 3T7KA 1YI1A 2WIDA 5ULLA 3IA2A 2NU8A 3S7TA 2POHA 2Q8PA 3WVNA 3HCRA 2IYEA 3HLYA 2PWBA 4WY4D 3Q12A 1Z8NA 1VFPA 4N03A 3ZC3A 3I5AA 1JJVA 3OAAA 1EVZA 4WCFC 3BGVA 1BCCE 1VLQA 2CY0A 4CMAA 3K31A 1G6KA 1NPYA 4Z4CA 5JAPA 1MB2A 4TMXA 5A1TA 4UUNA 5IHPA 4DA7A 4BO2A 5ALLA 2VQ3A 3FKSD 4HQFA 3RS8A 4GL2A 1DLJA 1J1DB 2A06G 2DLDA 1Q7CA 1SQPK 2EWVA 2AN1A 1IO4A 1G2IA 4JGIA 3WYBA 1DHRA 2W6AA 4BXOB 3PDJA 3G1TA 3F5MA 2X2OA 8ABPA 1B6TA 3ZDAA 5JCPA 1RF1C 1D2AA 3VKHA 4ILKA 2VF4X 5A6SA 5C8YA 2VXCA 3E5NA 5IT9A 1BO6A 2VWGA 4RFVA 2R7LA 1KZ9A 4PW0A 3RUFA 2GAFA 1HE8B 2X1LA 3KDPA 1Z12A 2F90A 1GZVA 2HIMA 2PUHA 1WDKA 4EF4A 3HHPA 1LTIC 5BYJA 3W8DA 3THXB 4AJEA 2GYUA 1K6XA 1YOBA 1Y47A 4JYAB 1WUTA 3WYCA 4OXKA 1ZVVA 3UATA 1D6JA 2DPLA 3X1ZA 5TQ0A 3OX3A 1V1JA 4OX9Y 2OUKA 3KD3A 5JAHA 2O1EA 1JEQA 2NOAA 4WCDA 2HDHA 2VBCA 2NVUB 1JEKA 1VCHA 3VJKA 2Z9BA 1YJBA 1R0XA 4G41A 2N42A 3BWEA 4R1UA 3IE1A 5ECDA 4CMEA 1XLTC 5E6UA 4JHXA 3ZXXA 3K5WA 1JHQA 4TS4A 5C3MA 1RNLA 1W87A 2VTBA 1S3FA 5AESA 1XTGB 4QUHA 2MU1A 1XP8A 2RJ3A 4N82A 2YWDA 3CCCA 4Q21A 1B00A 3KE8A 3LPNA 3V3TA 1SG6A 3C6BA 2ZQYA 1OI4A 4WJKB 3D3JA 2RGBA 2X1HA 2PD6A 4HH3C 3AKDA 3A7EA 3RIMA 3HU5A 3FPSA 4G56A 2SPZA 1SHTX 5BV1A 1FP4B 1Z5WA 1YCGA 2VK1A 3FLEA 3E7KA 1YBKA 3RV4A 4CM7A 1S6YA 4D0LB 3K0CA 3KB8A 1DRWA 2XB6A 5APXA 3A3OA 2QBYB 3P0HA 5A9SB 4NBKA 3B13B 3LW5H 1E58A 4B2LA 1U0RA 2WKPA 3V34A 1JQBA 1K4KA 5BN4A 4X1OA 2JVJA 5ED4A 3O4JA 5A4KA 3LQQA 3CX5D 3L73D 4MUHA 2WSCH 1UM9B 4KUHA 3QE0A 1W44A 4Y0VA 2VCEA 1MAUA 2CW5A 4MQMA 3IQZA 1S8OA 1QONA 3DLAA 2CB9A 1JZTA 2B87B 4DLAA 1VZ3A 3ZNPA 3CY6A 4MUKA 4HB4A 3FYUB 1J56A 3DVQX 3PDCA 4D8XA 1Y6QA 1JI0A 2QR2A 4W63A 1YDWA 4XOIA 1H5QA 2CZCA 3D8UA 4YX9A 2AEMA 2XYRA 2VT2A 2XUIA 4QVKA 1E79D 5FOWA 1CWUA 2WJVA 4AP9A 3PQFA 5JTUA 5E2BA 2C3OA 5L95A 4IIJB 3U7QA 3O9ZA 2R6GA 4MYUA 2HK9A 3AWIA 2PSDA 3NLLA 3LDAA 1EJ6A 4ARBA 3G4SP 2O1WA 3SK0A 2EBUA 3WLHA 5KNBA 4RL6A 1BE3J 2M1ZA 5IBCA 2H5EA 1E1YA 2VG8A 5SYNA 1RC1A 4TRRA 2CVPA 3FNGA 3E82A 1ZMEC 2KX7A 5LZ8A 2XSZD 2ZQZA 2ZRHA 4Q7MB 2XUKA 1C9MA 4M7PA 2A06D 2JFXA 2Q27A 2AJTA 1PFGA 2FXMA 4JXKA 1CB7A 3NBQA 2W6JA 2HXYA 1LTTC 5AJHA 3TSOA 2P3QA 3KAKA 1LU9A 3ZWMA 1GNTA 2VBGA 4HWGA 3TRIA 3MOSA 1T13A 4DKJA 3P52A 2E49A 4GDMA 3HCWA 2H4JA 4CKCB 3MTEA 4GD3Q 3IRUA 4QYIA 4XLTA 4ACAA 3FVQA 1GR1A 1BFUA 1YOVB 2FF7A 3PUHA 1MTOA 4J3NA 5LSAA 4ZD6A 4KFCA 3TRJA 1N2GA 4FCVA 1Z5PA 3BGSA 3MS4A 4ZVQA 4GGPA 3BHNA 4NX2A 5KKZB 4DSTA 3H18A 3CZ5A 2GCEA 5BP7A 2R1VA 3ANTA 3IBYA 3JQAA 3V9AA 4RKYA 4ZK2A 4MQFB 1THMA 1IOZA 4A1FA 2A0FA 4FNGA 4L9WA 2WWTA 4YV2A 1XPJA 2IP1A 3LOPA 1OROA 3KKMA 1IN7A 1U2EA 4EG5A 4UTZA 1T9HA 3SSUA 3ZI4A 5IJ0B 2PLWA 1UZUA 4HADA 2X5XA 1H2WA 4KLCA 4OOFA 5FHRA 2DBVO 4GKGA 1MVLA 2YWBA 1EESA 3RK3D 2R11A 4JUDX 2B9BA 3SDBA 1PO7A 3W7VA 2B0CA 3EARA 3FCOA 4CM1A 3B70A 1XBTA 5E38A 1ATZA 2QUZA 1Y4SA 1L3CA 5KVAA 2XQGA 5AKXA 4Z0HO 3ZK7A 2XOKD 3KUDA 1AK2A 2PA3A 1DJMA 1R0KA 2VUHB 1A9TA 1JA9A 5A0TA 1I1QB 1FMTA 1YR2A 1BTOA 2AFIB 5T4HA 2FEPA 4AS1A 4FYYA 4X3PA 2R9VA 4RCYA 2QP9X 3EVBA 2PGIA 4DLPA 3BHMA 3JZFA 4LRUA 4U7TB 3ZBUA 1XVVA 1V9SA 2XDWA 2BCGY 4PICA 2Q6TA 2HYIC 1CRPA 2KXPB 1ZD8A 4B17A 1G5QA 5D5HA 2QZSA 3AUUA 3OY7A 1GAJA 2ZUVA 4Q1DA 1QVGO 1CPYA 3GCXA 1OH8A 3FCYA 5GGYA 5B7PA 5AJXA 5IEJA 1BXRA 1U5BB 2JAWA 3QX9A 1GFZA 3W90A 3NVAA 1SBQA 2P1DA 3D64A 4KXVA 2FPPB 3MBKA 4EJMA 1AX9A 1T6XA 1OUMA 4WSOA 4XTRA 2EP7A 5EE1A 1Z68A 3ILVA 2GCIA 3P2IA 4LF6B 1TMOA 2ANBA 4NCXA 1Y1TA 4K9SA 4NAHA 3OM0A 2JEYA 2I62A 4N65A 3ZVNA 4G5HA 5HEKA 3ITKA 4IRUB 1GKUB 3EGXB 3JATA 4OHPA 4QBKA 2VJMA 2R8EA 1IUNA 2NV2B 3RYHA 4NCNA 4WOJA 1C7FA 3ZDDA 4LZOA 2RK4A 4D98A 3B6EA 3DYBA 2I2XB 1R88A 3VKUA 2VF5X 2DR3A 2P6PA 3DE4X 2CMGA 4KGXA 4GMHA 4ZI2A 2GRUA 3OPVA 4C7NA 5AW2B 1T36A 2FE4A 1WSBA 1WLYA 1CX9B 1IK7A 2I71A 4RH0A 1T5TA 1T2NA 3SNHA 1JU4A 5IRCD 1CZUA 4NNJA 2VHXA 1ZJWA 4WBNA 4BNJA 1CJTC 2Z08A 2GN0A 3RS2A 1PV2A 2FJPA 3HBJA 4DDKA 5DASA 4KIWA 3P8CE 3DHNA 3UW3A 1CJCA 3C4QA 4J0JA 1N2EA 3O3CA 3CSUA 3QYAA 3Q6NA 3QUBA 2YO2A 5B57C 4AWXA 4PCVA 1IEXA 3DAYA 3BZBA 3IOMA 1TQHA 2C31A 1WW2A 3U3ZA 3VAYA 1CYDA 1VQ9P 4Y2UA 4TUYB 2IUYA 2YHIA 4A0QA 5J23A 3O90A 3DB1A 3PXCX 4J2OA 3CC2P 4D8YA 1Y8RA 1KZ6A 3I83A 3HUFA 1MXFA 3N8IA 4JJGA 4CLDA 1JT2A 4Z4QA 3STUA 4P54A 3I2KA 3IH5A 2QL5A 3WRWA 1GSOA 8OHMA 4KXFB 2VWHA 3R7BA 4PWZA 3ICOA 3OH8A 3E9CA 5C4IA 1RXUA 1F6BA 1IWOA 2QTWB 1XHLA 2ZXUA 3BHJA 2XCTB 2HSGA 3H2BA 3R9KA 4PRLA 2I6GA 4OG2A 3OA7A 1DEAA 4IRXA 4DCPA 1Z62A 3OZSA 1QH1B 4B74A 2X8JA 3UAVA 1JQ3A 1YA6A 3TOZA 1ILEA 2AHOA 2BFFB 3X1MA 3F9IA 5FB3A 1CCWA 3PC7A 1PLJA 4DQVA 2PVCA 5KYXB 3R4CA 4FDTA 4GBJA 2AMYA 5E7IA 1KVTA 1P39A 2BD0A 4DJAA 5ECYA 3PBKA 5B7NA 5KQMA 1FC2C 2ATEA 1JSRA 1DEBA 5DYWA 1M5UA 2Z57A 4D92A 4K0KB 3LS2A 1AA0A 3C6ZA 3S2EA 3OPMA 3L0PA 1TX4B 1KKUA 2TYSB 4NYIQ 3TUIC 5DWVA 1E98A 3AT1A 3PEWA 2O54A 2BF7A 1UJ5A 2O05A 4BNDA 5F78A 1R3DA 4FFNA 1J2YA 3HCDA 5JVDF 2ZRAA 4DCSA 5I8WA 1AKYA 4OBXA 1IPFA 3ZQKA 3O7MA 2PS0A 1P2DA 2E4WA 1LBQA 2AOTA 4QHSA 1E3LA 2KSQA 1PEYA 2HZ7A 5DV9A 3EHEA 4BB6A 3WDKA 1VLVA 3LIIA 3ZGLA 5C5IA 7ADHA 1WPRA 5AW3B 1QLWA 1L4FA 3PFIA 3EIWA 3GIDA 3PDUA 3D4LA 2QKYA 2DFPA 4TYWA 3QJGA 3BZWA 2I2CA 3PNYA 5JZOA 2OO5C 2FYUE 2NZVG 1YJQA 1EDBA 3T5PA 2Q6VA 1X8JA 3I34X 3D6UA 1S2GA 2Q5OA 3O8BA 5JSZA 5FPYA 1G5FA 2WSMA 2AKYA 4EATA 2WMNB 4FR2A 1CJBA 2OCYC 1TYZA 1NJIQ 5G1PA 1AMOA 1G20E 4UM8B 3HE4A 1IBMB 4PGFA 3AE1C 3NGLA 2VCYA 1QPGA 4JLAA 4BZXA 5G2OA 2PO5A 4TN5A 3EWNA 3I9V1 2IS1A 3KEGA 1DO2A 4EEZA 2PRZA 3QBVA 4RY8A 1ZGHA 2GBFA 1E1CA 3G5TA 2O50A 2OYHB 3EFOB 1G8PA 2P3SA 1L7RA 1O3YA 1VSQA 4J0FA 4AECA 3GMIA 3NYQA 4BO4A 4YRLA 3SX2A 1W8DA 3EZLA 4EIJA 3RM3A 1G3UA 5AKIA 1RD4A 3WK7A 1QHSA 2RHRA 3AV0B 2DWUA 4WX2B 4HWKA 3S2GA 1Q44A 3AEKB 3A9RA 3MAJA 3G9RA 3L7MA 5CVVA 3AFNA 2Y0BA 2Q0HA 4HYYA 5IAGA 3OZDA 1Z2DA 1BXZA 3UWSA 1YDHA 3TW8B 1BS1A 2OQ2A 2JDID 4RGBA 3TZHA 3DEHA 2G25A 3QNUA 4QODA 1YVEI 3AEQA 2W83C 4MH0R 4MKRA 1YQWA 3Q1MA 4C6SA 3I5MA 1A8UA 3ZY6A 3A4IA 2H5LA 4ZQEA 3R6LA 1MW8X 4A91A 2QTZA 5H7XA 4UQOA 1SB9A 2VK2A 4AF6A 4Y7DA 3CVJA 4E2XA 3KT6A 3TM4A 4DY4A 3A1CA 4X66B 5D85A 3H6PA 2OSVA 2AZXA 6Q21A 2XE6A 1C9NA 2PMEA 1DTSA 2IYUA 2XHEA 2G0AA 1JEDA 3JWJA 4URYR 5LYYA 1PJCA 3UCFA 2HWWA 2SKEA 2QXYA 2JRCA 1HQYE 1Y3DE 5EP1A 3WL6A 2EV9A 2TMKA 1RPZA 2IEIA 2R7NA 3MBIA 3BOSA 2YMQA 5CNKA 1HETA 2ZRPA 2XOEA 4GOLD 3B2QA 3A70A 3Q8LA 2WD8A 1TM3E 2FUNB 4LSMA 2BEVA 1LK7A 2M1XA 3PC2A 2NPFA 3WJ7A 4BO6A 1IN8A 3CNHA 3HK2A 4XYEA 1ZEMA 3H3JA 1FYVA 3AUAA 1NF8A 2JO1A 3QY0A 5AVTA 1IJFA 5AT1A 1G41A 1K3UB 1QKIA 1RTTA 4W9NA 3D7NA 2NUAB 3EF3A 3G2LA 4HQOA 3V6IA 1ZM9A 3IUMA 1FB5A 5CT5A 1CHDA 3WQSB 2BEJA 4DIFA 2BDUA 3UAGA 4POOA 3FPJA 2GUSA 4IWYA 3R3YA 4RVCA 5SZIA 4P32A 5E9QA 4IIYA 4MNTA 4QPPA 4YN3A 3DL2A 2FXPA 1BWPA 2R8XA 2FYNB 4JU9A 4KSYA 3QFRA 4R0VA 4OFXA 2UXCB 1XK7A 3KSUA 3NBUA 3ETEA 1OBFO 3N5KA 1WBDA 3LV8A 3NAZA 4OM7A 3O2QB 3T3NA 2HU7A 4GU5A 2YOGA 1ZBQA 1XKLA 2WE8A 3EMVA 1Z18A 4YGYA 3A1FA 3DLBA 4WPGA 2GEBA 1R4NA 3KSAC 1XL0A 5F2NA 4GEKA 4JP2A 4PQRA 1I6MA 4YV7A 2H5JA 2JIMA 2OOKA 3UGTA 4AZVA 3A04A 5G0TA 3RU3A 4DA8A 2NUPA 4MKHA 2AK2A 5K3SA 3TINA 2BFOA 3TIIA 4UD2A 2QJFA 3EFGA 3H1LJ 5A4DA 1GU4A 4NBNA 5JI2E 1U7WA 3GFSA 2AQIA 3LL4A 4O2BF 3FUVA 3L93A 4KW7A 4WZAA 1LUAA 2QVXX 3H5WA 2FPGA 2IIBA 5ALNA 5TMPA 3PNBA 2BONA 4OL0A 3LE8A 1H2EA 1V7PC 1KTIA 3QUQA 1VA4A 2BGGA 3RYIB 3SR0A 2QDXA 1OTHA 3GRCA 3BB4A 3KQOA 2B4AA 4YHBA 5IS2A 4LQ4A 3O74A 4YK7A 4BRYB 4UOEA 3I8OA 4B4DA 1KKLA 3LHDA 4YJFB 1DQRA 1VXOA 5C3UA 4EAAA 3KM0A 3FHCB 4U00A 1E62A 2V7PA 3VTAA 1Z7YA 3NAQA 4ZWNA 1AG9A 1X14A 2F8LA 4OGQD 4EEKA 2QZPA 1AZLA 3IVAA 4JJEA 3QNMA 2ZRJA 4IJUA 2ZI6A 1MB0A 4KVZA 1D4OA 2WV7A 5ANRB 1RACA 1JSLA 1QIFA 3BKXA 1WBBA 3FCEA 1MABA 4CV1A 4C76A 5KLVE 3PPYA 1ZISA 1EUZA 3AR6A 3A11A 4DT1B 3KZKA 1PGPA 3SEFA 4BO0A 5AW6B 2DU8A 4IF6A 4NYJQ 4BO9A 1ONSA 1MU0A 4HQRA 4IPTA 2EVWX 1B8VA 2R5WA 4CL0A 2IGBA 3KKEA 1RYFA 2FR8C 1ZZGA 3TLZA 1KEUA 4W6ZA 4H6WA 1L4BA 2IZZA 4N6GA 4RGQA 3VR5D 4MQBA 1FU1A 2PMBA 2Z04A 4XDHA 1XO1A 1VSTA 3QFFA 3AY7A 3D7LA 3DOUA 3CMCO 3W5HA 4HGYA 5JC8A 3EIHA 3K70B 5TVGA 2R48A 2XWBF 1OWLA 1W2WB 5MN6A 1AU9A 3CXHI 3K71B 1JJAA 1WXIA 1H23A 1TW2A 4JUFA 3IEVA 4F1WA 5FF9A 2XKAA 3WXMA 4N12A 2QMZA 1N7HA 5ECWA 4TTTS 2Y9MB 3KAJA 2CNNA 1UBCA 1CF2O 1L0LJ 5A5DA 4MUIA 2VDQB 5AM5A 5F7XA 3RVNA 5G3ZA 1N9GB 2IF0A 2RI1A 3QKWA 4MYSA 2G71A 3KKZA 3AJAA 4XM2A 3QI2A 5C80A 2JIZD 3RBZA 1MNAA 1A02F 3MWDA 4KDEA 5TF0A 3ZWYA 4TKVB 5CYFA 5FBHA 3VUEA 3DTVD 1ZEJA 1KFMA 3A1VA 1C1XB 1QTIA 1NWQA 5AW4B 3CE9A 2B82A 4XQGA 5EKDA 2ZU0C 2FR1A 4MO9A 3E48A 5A3QA 1KYOH 4M7WA 1XWWA 3GF3A 4JA0A 5CB4A 4JMLA 3OZXA 1Z22A 1L4LA 1R64A 4HKTA 5AJTA 1KB9H 4CG3A 5KX5F 1E94E 3VZCA 1KKMA 4UPDA 2XEXA 2Y1XA 3UT5A 3H2SA 4OREX 4MICA 4DCUA 4FKZA 4MJ3A 4UNRA 5EJ9A 4FFOA 1FZAA 3K8ZA 4QX6A 4FQ7A 1NONA 2F3TA 4JLJA 1E0JA 2F8SA 3OU7A 4JYMA 1Z45A 4K9NA 4J4BA 4BQNA 3B6KA 4LAFA 1QYWA 2Z95A 1ORVA 1UEXC 4OJNA 5A2GA 4YMTA 5FPSA 1YHZA 3N07A 1RE4A 1WOMA 2HYNA 4KAAA 1LJLA 4POAA 4C78A 3ETLA 1VQLP 1TF5A 1TAGA 5HZMA 1CUYA 1YS2X 2QY6A 5HMMA 3EBOA 1Z73A 3H19A 3BCCD 3UWMA 2AEEA 2FWPA 3GZ4A 4UB8H 5FOQA 1WMBA 2G8NA 2AH5A 1Q1NA 3M6LA 2B4RO 2C82A 3EG9B 2XF8A 1FFGA 1LPPA 2D1SA 2J32A 1QIEA 1KEPA 3PE6A 1LNSA 1WD7A 2E5FA 3ZWPA 4W7IA 1VGVA 1DPGA 3D2AA 2FZCA 3IOYA 3K6KA 2O3TA 1XU4A 4A8PA 5IZ4A 5EZSA 5M1BA 1SG0A 1AV6A 1SOUA 1XDWA 2H8GA 1BD4A 1R4MB 2FTKE 5CB8A 1DWOA 4B3MB 3X1XA 1JTFA 4UU1A 1A5BB 4Z0NA 2BFWA 2R1UA 4TV8F 4PAQA 1CXZA 4RORA 3JAWB 1IBCA 2ZCVA 5BRNA 2HRQA 3KIPA 5DN6A 1OXBB 5LQNA 2K4MA 1EFCA 7GPBA 3V46A 4YUXA 4XA4A 4XWAA 1YZYA 1XROA 4TQ9A 4XRGA 2AN5A 4YVFA 2NO5A 2ZPAA 4PPNA 5CD1A 5J58A 5KKCA 4B3TB 1I7NA 3ICWA 5KCMA 3BK1A 4HAVA 4DLNA 1O97D 1TFRA 4B7AA 4IUCS 2BFMA 3RASA 1AKRA 2A1TS 1ODIA 2IPLA 3K8YA 2BI7A 2BMEA 2Q41A 2PJUA 5AD1A 2L18A 2CVHA 1PSDA 3DZDA 2HODA 1PPJE 1V1RA 2D74A 3NTNA 3GNSA 2OO3A 3H87A 3CCQP 4U8GA 3VO1A 2JJ2D 2LKCA 1ZSVA 4NMMA 1TL7C 5TMBA 3QH4A 3T3DA 5T4BA 1AKMA 3LY5A 5JNRA 1QYVA 5GY7A 2GQ0A 1QC5A 4RWEA 2O4UX 3H32A 1NFFA 1QHIA 1XZ8A 3OO0A 3WB9A 3SS9X 4ON9A 3R6TA 3B8EB 1CFZA 1WZ2A 5CM9C 4JT2A 3DPSA 3RRXA 1Z4MA 3WUUA 3MQ2A 2L42A 1NU1G 1QOPB 2WJ4A 1T25A 2A9RA 5AQ1A 1VE5A 3S28A 3VAAA 1NQAO 3WC4A 2ID8A 1GSHA 1MRZA 4MSUA 3R77A 4EGJA 5THQA 4EOGA 2P9GA 3OCWA 3M7IA 5EWMA 5AVRA 3AQIA 1NUHA 4QOSA 4PNEA 3K0FB 2Y1CA 1FTGA 1YAHA 1PEDA 2Q3MA 2QV0A 3GA7A 1YC5A 4KQJA 4FONA 2IDBA 4KO8A 1QANA 2YVLA 5DM70 2XNJA 3DQZA 3VPDA 3ZIAD 3V8VA 2ZM5A 2IPAB 2K7FA 3NW9A 2JLUA 5DCLA 2KNCB 1M1UA 3GLHA 5KKNB 3IDFA 4F4FA 5CM2Z 4DY6A 1IK4A 2XNKA 1IN6A 2WJYA 4OLHA 1P84I 3EEOA 1ZK4A 2PZBA 4G0PA 5JNWA 2XRMA 3ORHA 4JN6B 1I4WA 2Z5HA 4JYPA 2VZ9A 4EY7A 1UKCA 4MJXA 1OOEA 2A9JA 3NHUA 3FPKA 1YB5A 2Z2ZA 3EZ7A 4B3CA 4M36A 4BQQA 3QU4A 1EJ2A 5FFNA 1G3MA 1H5NA 4CU2A 1OX6A 4BMSA 3CV3A 1LA2A 1LLUA 4O25A 1X1TA 1NSYA 4D44A 421PA 3L7YA 4MWZA 1J0AA 4RZXA 5HZHA 2X2PA 2OYIB 4P38A 2OXEA 2CNDA 1KQFB 4M86A 4NAUA 5JY6A 4KYUA 4UARA 1IG0A 5GZ6A 2IW3A 1G5HA 2O01H 1E7YA 4HAOA 4BX8A 1USVA 3VR2A 2GM9A 3M9BA 2A6PA 1SIBE 3TB6A 2VBFA 5CJ4A 3EUWA 3MK31 1IN1A 1QCZA 3MGGA 1HBJA 2ZVDA 5KSZA 2Z4RA 4KVAA 1N6HA 2WUDA 3L1UA 2EDAA 5A2QA 1P9WA 3JD1A 4UDNA 1JYEA 3WLQA 1KZUB 4B2YA 3Q7EA 5HP4A 3HE5B 1MKMA 5AI8A 1QF6A 2ZRLA 3DCJA 1LSUA 1B8NA 3EQ2A 3L7NA 1LPNA 4TXJA 2J3EA 3PT9A 1ZI9A 5I7VA 4BCBA 3LC2O 3PUJA 5AICA 4KC0A 4P7GA 1T2VA 1SCNE 3FPBA 3SZRA 5JEEA 5CA0B 5LQKA 2DT5A 2SHKA 5DYIA 3U9LA 5F2OA 4I55B 1W4BA 2EF0A 3ENNA 1JPUA 5JJLA 4MI1A 4W5JA 1ENYA 3R0XA 3PJGA 2HU2A 2R7MA 4D4IA 3KL2A 1B6RA 1G6OA 3C24A 4NBLA 4HMOA 3ZH9B 1WVMA 3H9CA 2H2AA 2B9VA 1IHOA 1CQWA 1J90A 2FI1A 5J4LA 3U4QB 5LZ9A 3VVCA 3NIBA 5MGNA 3WRVA 5LP6A 5KMGA 3H1IJ 2JIRA 3LHIA 1SVUA 3OD5A 3UOAB 2C3UA 2JGRA 1QP4A 3BCCE 1I6KA 3I01M 4YCMA 4IFIA 3CVXA 4AZ3A 2QN9A 1OW3B 2V4ZA 4C20A 4LDAA 1UF9A 3S2SA 4IQ4A 1A9XB 1KJJA 5BQXA 4BJ3A 4EF5A 2OA0A 4EMSA 1H05A 2IYAA 3A4MA 4W9MC 2BGKA 3AUJB 4PFSA 1WO8A 4KXNA 2WHPA 5F4BA 2QQEA 3DV2A 4Y0NA 1IM8A 1NF3A 2GASA 3S0JA 3MA0A 4RSRA 5GONA 3IBFA 4QXAA 4DV6B 3BDIA 4C30A 4QQNA 2B0JA 2B6HA 2GVNA 2FWRA 4UVIA 3CWZA 3VHXA 1GO2A 4G5RA 4RM3A 4IFDK 1C0PA 3EEBA 1YR8A 1VQ5P 1U8XX 2DY1A 2DR0A 4DZZA 4BFTA 3UHFA 1WKBA 3RJTA 2QJKB 2DHEA 1LWUB 3Q7PA 3AE2C 4ED9A 1ZH4A 4TWIA 1R6VA 2NPSB 4F11A 1X8LA 4EL0A 5J40A 3PC8A 4M8SA 3EWIA 2M8RA 5T7BA 1KO1A 3TNLA 2JVIA 5HBRA 2YKQA 3M5CA 3OLWA 1XD8A 3FHJA 2V6JA 2A1UB 3Q7TA 3FOAA 1J4AA 4PAMA 3T9AA 4UUOA 3UT6A 1ZGCA 2XHZA 3EFFK 1YMUA 4CG1A 3ICQB 1L5RA 2Z4TA 5AW7B 1W6UA 3X1KA 2IKSA 2Y9PB 1E7MA 1T91A 3COSA 5JZVA 2G0TA 5B55A 1OJ7A 4QTZA 1JNYA 1JNXX 4J6FA 3AM5A 3U3JA 3B1KA 3JYQA 1J23A 1HE1C 1BXKA 1BZYA 4NAVA 3WLAA 7REQB 4OLAA 1IMJA 4GF5A 1SC1A 1FMLA 2ZIXA 4ENRA 3FWPA 2UZAA 4YJGA 3UG7A 4HZGA 4ASUD 2G70A 3EIUA 1TE2A 1CRLA 2NTVA 1E2DA 1SBCA 4H77A 4P83A 2VF7A 2FP3A 3LDUA 3HV2A 3BH0A 1GPDG 3G2NA 1UEIA 4WKCA 3VMAA 2Q1XA 4YRPA 4IS3A 4H3HB 2VJQA 1OW6A 1EFVA 3QEAZ 1XTZA 3OY2A 1E5DA 4PJ0H 1QRRA 2HIAA 3D6TB 3QITA 1V9CA 4ZU3A 3PSHA 4J07A 4QDOA 4YCLA 2ZE5A 1G4HA 1N5OX 2ZCUA 4E7PA 3AR3A 1LT9A 3KVRA 4R1QA 3ROZA 4KN9S 3RGUA 2Q3DA 2V5UA 1SLQA 4I1PA 2WPNA 3TN7A 2XDAA 3C70A 1M7LA 3GXOA 3IQEA 1OLOA 3GRZA