2ZYAA

Dimeric 6-phosphogluconate dehydrogenase complexed with 6-phosphogluconate
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
465
structure length
465
Chain Sequence
SKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDACAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 6-phosphogluconate dehydrogenase, decarboxylating
publication title Conformational changes associated with cofactor/substrate binding of 6-phosphogluconate dehydrogenase from Escherichia coli and Klebsiella pneumoniae: Implications for enzyme mechanism
pubmed doi rcsb
source organism Escherichia coli
total genus 176
structure length 465
sequence length 465
chains with identical sequence B
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2zyaA02
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 2zyaA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zyaA01
3BMQB 3A06A 2VHWA 5JAIA 3ZHXA 3OQ1A 4MKXA 4O1MA 4BMNA 3A14A 2JAHA 3D1LA 4HUJA 1H6BA 4O6VA 3ZGYA 2PV7A 2OOSA 1Y5MA 2A4KA 4II3A 3GVXA 4WLFA 4JJFA 1XR3A 3GN1A 2P9GA 2NUAA 2X4GA 3QWIA 4GH5A 5JDIA 3S55A 4NU6A 4ROSA 1R0KA 2GD1O 1P1HA 4RVFA 4BO9A 1X1TA 1PJQA 5ENDA 1ZK2A 3D3WA 5COBA 3LYLA 3AI2A 3M6IA 3ANNA 3ITDA 3ZWCA 1W73A 2J8ZA 1ZO8A 4RJTA 3C7CB 1U3UA 1GPJA 2YJZA 3MCVA 4LVUA 3CMMA 5EQDA 3ENKA 3MWDB 3ICPA 5I7SA 2J6IA 1M75A 4FOOA 2YYYA 2I6TA 3CXRA 2EP7A 3PWSA 1MUUA 2ILTA 4JN6B 1TB4A 1JKIA 4DPKA 4BNGA 3DO5A 3PHLA 1P1KA 1DC6A 2FZEA 3I9JA 2JJYA 4DGSA 4XCVA 2X7HA 1O6ZA 5DCUA 4EI2A 1PGNA 1PJTA 3IJPA 1JKFA 4E33A 3BMOB 3FTNA 2GUGA 1E0DA 3ETGA 4JP3A 3WOHA 4EGFA 3Q2KA 4BNFA 1DAPA 3E9QA 3DFZA 5K6AC 4NK4A 3UKOA 3KXDA 3GMSA 1GZ6A 3AI3A 3GNSA 4A10A 1J0XO 1T2AA 3GNQA 4CQMB 4E31A 5TLSA 3JTMA 4PLYA 3ZZNA 4CLXA 2DVMA 3KVOA 5JCJD 4BO4A 3ON5A 5IXYA 4DUPA 1DHTA 1UXGA 2VHVA 3UF0A 2Y67A 4TKLA 4BO2A 5AVOA 1SNYA 3VZRA 5A5EA 1ZXBA 3WSWA 1H9AA 5AXAA 4Z9YA 3IJRA 5JY6A 2V6FA 2AQKA 2YQ5A 1NVTA 4R1UA 2C59A 3FTPA 3L9WA 4Y6PA 1E92A 4R9RA 4UVGA 3TNLA 1PTJA 5C7LO 1I2BA 1A9YA 2C20A 5L3ZA 3E48A 1IZ9A 2O3SA 2BF7A 2PFGA 1UP4A 3JQAA 4BNKA 1V0JA 1VKOA 1Y6JA 1JA9A 4HBGA 5KIAA 5JPIA 4IMPA 3K8ZA 3ZI0A 3PJEA 4NZ9A 1I3MA 3WTBA 2ZQYA 4P4GA 1AXGA 3IS3A 1O89A 4GGOA 5F1KA 4RDHA 2PTGA 1KEUA 2YHUA 3AY3A 2AEFA 1YWGO 1D1TA 1IZ0A 2E6UX 4IDFA 1PZGA 2Q1TA 1TLTA 5C7IO 3OSUA 5CDGA 3Q3CA 1GQYA 4BV9A 2O4UX 2GN4A 3K73O 4P8RA 4U0JA 4BNWA 1NQTA 1CWUA 4O0LA 1WNTA 3DBLB 4WCDA 3VH2A 4KP7A 1EBUA 5BT9A 2R00C 2A92A 1EVIA 4PLGA 3JQ9C 3I83A 1X14A 4C7KA 1J4AA 1DHRA 1ISJA 3RUCA 3RJ5A 2B5WA 5U9CA 5I7EA 1YOVA 2P9CA 1E7RA 1HYGA 3AJRA 1LUAA 1BRMA 5A03A 3W8EA 2VT2A 2WD7B 1YVEI 1D4FA 4YJFA 3UHAA 2YDXA 1C1DB 1EFKA 3OM9A 2AEJA 1HDCA 4FW8A 3WGTA 2Z5LA 3HDJA 3I1JA 3ZH2A 4BHTA 4W7HA 4KOAA 4CM4B 2RHRA 1KVRA 1FDWA 1HDXA 4NBUA 2WSBA 1C14A 1ULUA 1WDLA 2C0CA 4PLPA 1GY8A 4IQGA 1I36A 3DEYX 4X54A 3VVCA 4RL6A 1HT0A 4K6FA 1ARZA 4BKOA 5G0SA 2X8LA 1UZNA 4FJ0A 3T7CA 3DAGA 1PX0A 1PGPA 5T67A 3SC4A 4KWIA 1O9BA 3GFGA 3NX4A 4BO5A 2VNAA 2QYSA 4GX2A 4J6FA 3HDHA 1ADCA 4OH1A 3ZU3A 3GR6A 4R68A 1QP8A 3WNQA 3INRA 1NPTO 2IZZA 2VWGA 5IAAA 3VPHA 2IYPA 1LBEA 3GF4A 4L4XA 4PG8A 3TL2A 3R3SA 1ZK0A 1E5LA 2Y68A 3RC7A 2GO1A 1BXGB 4OL9A 4R3WA 5AQ1A 4D43A 1WZEA 5KCZA 3B6ZA 4I9UA 5A04A 4J9UE 3FD8A 3FBTA 5DCWA 5KVQA 3AM5A 4Y98A 5G4LA 3NDRA 1I33A 2ZATA 2X9GA 1IYZA 4U7WA 1SPXA 2NV6A 3ROKA 1K2WA 4J9VA 4FGSA 1NR1A 4BO6A 2NVWA 3LT0A 1SZJG 2WE7A 1FMCA 3H9EO 3OQBA 3PFWO 3IUSA 4KQXA 4Q39A 4ZHSA 3BHJA 4CV1A 2DBVO 4L4SA 2YZ7A 1I32A 3GH3A 4DIFA 2P4HX 3PJGA 2GZ1A 4O63O 4IMRA 5DF1A 1UAYA 4Y6RA 4L4RA 2AEMA 1V6AA 1P9LA 3U09A 4XR4A 2HMSA 1U2DA 2VOJA 3MEQA 4GL4A 1E3LA 1ENZA 1GPDG 1VI2A 4OSPA 3AY7A 3JQEA 3MJCA 3LC7O 4JBGA 3DBHB 1AGNA 1UAGA 1YDEA 3DOJA 1NM5A 3WQSB 2Q2WA 3RVDA 2ZTLA 1QV7A 3JQ7B 4JROA 2AQ8A 4P4NA 4YJHA 4CR8A 1QKIA 3RBXA 2I67A 2JL1A 2ET6A 4E2YA 4ZRNA 4PG6A 1MX3A 4UVEA 3HFSA 1ZK3A 3GEMA 4F6CA 1QYWA 3H5RA 3ZU5A 2BFOA 1YKFA 1X0VA 3JQGA 3DBRA 4IS3A 9LDTA 3I4CA 4F6LA 3OJLA 4R1NA 3EVNA 1ISMA 3PYXA 1U8XX 5EQFA 2QYTA 5FYDA 3WWZA 5B4VA 1B7GO 1DB3A 1GV1A 4IPTA 1ZW1A 2GCGA 2C7GA 4IDGA 1ONOA 3KRTA 5AOVA 2CY0A 4LN1A 3E8XA 5JCJA 3JQBC 1I5RA 5JNLA 2D59A 1N1EA 3HE3A 3IUPA 1E3JA 1AVYA 4I5EA 2EP5A 1I01A 4M89A 2J3IA 2J3HA 3UH1A 1PQUA 1O8CA 1HLPA 1MXHA 4GWGA 3QLJA 1HLDA 4AFNA 3KOUA 5JYDA 5L45A 3WJ7A 5A4DA 3U49A 1N92A 2FR1A 1U4OA 3E82A 3G79A 5TT0A 1TT5A 1NFRA 2GGSA 4DLAA 2Q1UA 2G17A 1EDOA 3FWZA 3HSKA 3RQSA 2GN9A 4GSLA 2VT3A 1HZJA 1XSEA 2DBQA 2ZKLA 4OXYA 2X5OA 3QWBA 2UUPA 4HV4A 3BHIA 2R00A 1PJLA 3RD5A 3BIOA 4RO0A 1E1KA 1WDMA 3LVFO 3JQ9A 5TSDA 1LDBA 3SBOA 1NAYA 2C2YA 1XIVA 3LC1O 3I23A 2HLPA 1ZSNA 4CMHA 2Q1SA 2XF8A 2TMDA 1ZSYA 2EGGA 2FRDA 5L40A 4Z9XA 3ZWMA 2B4QA 5FI3A 2VHZA 4E3ZA 1R4NB 4E5KA 3W4JA 4FBGA 5G4KA 1WWKA 3WJAA 1B8PA 3PZBA 5IG2A 1P44A 4B8WA 4D3FA 1SAYA 3E6AA 2NQ8A 4RZIA 5T8KC 4CMIB 5GMOA 3JQ6A 3E03A 4OHUA 3D64A 1I0ZA 2OP0A 1HDYA 1FDUA 1UZLA 1JKJA 4E6PA 4AJIA 1BXKA 1LI4A 1E7MA 4PLHA 3BXXA 3V8BA 3WLFA 3SC6A 2P68A 5KKCA 2EGHA 3ABIA 1Q0LA 1MP0A 1PEDA 1ZBQA 3U0BA 4BOYA 2P91A 1ONNA 3AOEC 3PDUA 4JCOA 3JQDA 2F00A 1R4MB 3W6UA 1KERA 3GZ4A 1ULSA 4QXMA 5L7TA 6ADHA 5DN9A 1PZEA 1T25A 2Z95A 4PG5A 1KEWA 4R4JA 5F1OA 5KVVA 5DBIA 5JAQA 1E7YA 2ZYAA 4JXKA 3TZCA 1E3WB 3WX0A 3I3OA 5DP2A 2D5AA 4HFNA 1VKNA 3W6ZA 4CMAA 3LK7A 4I5DA 1A4IA 3LU1A 4DIOA 3VH4A 4B3HA 4CL8A 1GUFA 1PJSA 3O38A 5DOVA 2O3JA 3CZMA 4JX8A 3VPSA 4RPKA 5TC4A 4D0RA 2V6BA 4E12A 2G0TA 3HHPA 4AICA 2WWRA 3B1JA 3QP9A 2NTJA 4PLWA 4AJ1A 3BMCB 2Z1NA 4MIYA 4R1SA 5ER6A 2R6JA 5ITVA 3G0OA 1EUDA 2OBYA 4RV9A 3BMNA 3JQ8A 3DONA 3TOZA 4WECA 3FPLA 1E1MA 5EPOA 2OGUA 1QLJA 4ZD6A 3WYEA 3OEYA 3ZWAA 3EY4A 5JDCC 1N8KA 4AJJA 2NM0A 4K9DA 3P5SA 4DIBA 3ONEA 1MXFA 2C5AA 2WD8A 1XGKA 3EDMA 4FPXA 1QMGA 4PLVA 3RU7A 3WIDA 3VOSA 3I52A 3C1TA 4XB2A 1M2WA 1JTVA 1DRVA 2WJPA 1C3VA 3AY6A 3L4BA 1T4BA 2BFMA 4DREA 3PP8A 3TZKA 4W82A 4UAGA 4INAA 4WLOA 2FSSA 1P1JA 1IY8A 1FK8A 2G76A 4IDAA 1H5QA 1TI7A 1T24A 4AG3A 4TSKA 1YB4A 2CZCA 1I3LA 2EERA 4J7UA 4BNMA 5I7FA 1Z75A 1J5PA 1JDJA 3JQBA 2DPHA 3DHYA 3DAFA 4DQVA 1LSJA 4FJ2A 4OOEA 4YVFA 1YB1A 4MO2A 2YFQA 3JQFC 4CMGA 2Y0EA 2DAPA 3RUHA 2O7QA 3PEFA 1W4ZA 3A1NA 4IJKA 5EESA 1T2DA 3BTSA 3CUKA 3KV3O 4O59O 2IE0A 1HE5A 2YFHA 5JE8A 4J7CA 4MVJF 3ETDA 1MFPA 1L7DA 3ZWPA 3NYWA 2BI8A 1RPNA 4RPHA 2ZB8A 1E5QA 3IKTA 5C37A 4LGVA 4D7AA 1A7KA 3HN7A 1Z74A 4YPOA 3PXXA 1U1IA 4I9NA 3EC7A 4I8XA 2HCTA 3KLMX 4ALMA 3D5TA 3ZV4A 4CLHA 1I2ZA 4TMFA 5F1PA 1PS8A 5A9TA 3TQHA 3DXFA 3CIFA 3OEWA 2FR0A 1JVBA 1MC5A 4MKZA 5DP1A 3VTFA 1Y8QB 4ESOA 4YBZA 1GFSA 3WQRA 1OFGA 3OQ6A 5IN4A 2PGDA 3EZYA 4AJ4A 1LX6A 1Q0HA 3KYCB 5CDYA 3CH6A 4IDCA 5AYVA 3RJ9A 4CM5A 5JO0A 4PLFA 1MGOA 3TF5A 1YJ8A 3F1KA 1DRUA 1CYDA 3DZKA 3HADA 1KIFA 4FSHA 4QX6A 5DZSA 3Q11A 2J5QA 4BNVA 3FRJA 4FCCA 5T8KA 2D2IA 3KLPX 2QRLA 1DEHA 3RUFA 4CQMA 3Q6IA 1DIRA 1XQ1A 3IQDB 4XDZA 1UJMA 1Q2XA 1QYDA 4NI5A 2VNSA 2NU9A 5B4UA 1DAOA 1AE1A 4PFJA 1OC4A 4FQ8A 4ALLA 1BW9B 4XEHA 1X7DA 2JD2A 4E13A 1CIVA 2W2LD 4IJUA 4OGWA 3AOEA 5ADHA 3ZDFA 4XQGA 4ALKA 5A9SB 1MG0A 5JC8A 1Q7GA 1H6DA 2VUUA 2BLLA 1CERA 2AMFA 5GZ3A 2EEZA 1U28A 4MINA 1OBFO 3UGKA 3ONDA 5F3RA 1VLLA 3SX2A 3ZHYA 4DXHA 5L4LA 1I30A 3VH3A 1DC4A 3M2PA 4J4TA 3LT4A 1SC6A 1X15A 3AUTA 3GUCA 1U7TA 4ID9A 4OM8A 4HKTA 2FWMX 1IHXA 5CP8A 3F5SA 4XYGA 3S2FA 1O0SA 4D46A 4IJVA 5KWEA 3OFSA 4PLCA 2BGLA 5K9ZA 2HK8A 4QO7A 1CDOA 2H5LA 3S8MA 3BTVA 2YW9A 1XG5A 4A7PA 4M55A 4CR7A 1PU2A 5C3MA 1NQOA 3RUDA 4RVHA 1Z73A 4XWYA 5TJ9A 1YL5A 3WMXA 4BNXA 5IFLA 3VDQA 1KVSA 4CV2A 1QXSA 2JHFA 4ND5A 2ZQZA 4IQ0A 5HA5A 4GI2A 3TZQA 3K6JA 1N9GA 1UUFA 4ZQEA 5JDCA 3UCEA 4MVJA 1DLIA 4PRLA 1KC1A 1S7CA 1SMKA 2HKIA 1ZXLA 3HQ4O 5IF3A 3KM0A 2CDBA 2VZ0A 4S1VA 3DBVO 4GMFA 5AXCA 2O3QA 3G3EA 1GUYA 1ENYA 3GGGA 4PVDA 4PGFA 4HADA 4E5NA 3ZN2A 2EJVA 4G81A 1PJCA 3WFIA 2QHXA 3WGZA 1UP6A 1C1DA 4RVDA 3KEQA 3EK2A 3WLEA 2E37A 1UDAA 1CJCA 1TA4A 2IDZA 3PIDA 4CM4A 4IIVA 1XU7A 1E7WA 3Q0EA 2E48A 3WR5A 1JN0A 4CUZA 4FFRA 4MPDA 4IS2A 1R37A 1N2SA 1ZK1A 3RUAA 1NQ5A 3NT5A 4MKRA 4DTIA 1ONPA 3D4PA 2QRJA 2W2KA 3HB5X 5ICMA 4IGEA 3AU9A 2NACA 3JQFA 3GOHA 4WPGA 1PS9A 1UH5A 4M8SA 4GLOA 4HY3A 5GZ6A 2Q99A 3I9NA 3U4DA 3RASA 5ITWA 2X5JO 3GEGA 3KEOA 1GCUA 4I9HA 5K0ZA 1GYQA 2PY6A 1WVGA 1K5HA 5TX7A 1SEPA 1BXGA 1D1SA 3UAGA 5G0WA 2VOEA 5AXDA 2Q4BA 4A0SA 2EKLA 1VRWA 3QV1A 3SJUA 4D45A 2BKAA 1GQ2A 3U5TA 5L95A 4GX0A 4ALIA 1YH3A 1Y7TA 4IM7A 1EZ4A 1OX3A 2VZ9A 3L0DA 1CEQA 3O8QB 5FWNA 5MGBA 1NPYA 2PGJA 1E7QA 3B1KA 4LMRA 5HBRA 4ZQGA 3ICCA 4EW6A 2BHLA 4CM8A 1D8AA 4DQUA 1LSOA 1U9JA 1R12A 4W9NC 3PIIA 1DRWA 4NBTA 3JYNA 3E1KA 1U3TA 4RVGA 2C29D 2J3KA 3S2IA 8LDHA 1NHWA 1HDZA 2GZ2A 4R9SA 3ROMA 5CDTA 3LDHA 3RAJA 2GSDA 1I3NA 1XA0A 3H9JA 3NTOA 4PRKA 4YACA 3ZWXA 3JD3A 2NVUB 4EUEA 3WB9A 1C1XB 1SO8A 4NJMA 3DMTC 1HSZA 4D79A 3WGYA 3PGXA 1VL0A 1LDNA 3GT0A 3PQEA 4D3SA 3RKUA 1Z7EA 4CR6A 4CMCA 2D5CA 3DBHA 3ZHBA 4Z6KA 1WMBA 4Z0PA 5CPBA 1NP3A 2SCUA 4IUYA 4YJGB 2VYVD 2ZTVA 3JQ7A 4FOSA 1EVZA 4XYBA 5C7OO 1NAHA 3EAGA 1Y8RB 2WYVA 1D3AA 4WKGA 1LQTA 1ZIDA 3R0IA 5TJHA 1A27A 1IULA 1X0XA 1ISFA 4HP8A 3ZCXA 2VTEA 1U4SA 3WDSA 2VQ3A 1SB9A 2P9EA 1JAYA 3DR3A 4E32A 2I99A 4W6ZA 1DIGA 4IZIA 4AJKA 2Q4EA 4BQRA 5CHEA 2BRUA 1B0AA 4LCEA 2J5RA 2NSDA 3FR7A 2B69A 4DYVA 1LNQA 3K30A 1ZKMA 2CUKA 3OIGA 2GN6A 4MVJM 4M49A 1XU9A 4YYZA 1IE3A 1XYGA 3H65A 4RF4A 5TGDA 3VPGA 1OI7A 4TRRA 3ZW9A 4AJNA 2I66A 2C82A 3I6QA 3MTJA 3NTRA 4JIGA 5HWSA 1HDGO 4ONEA 3BTUA 5I7VA 2NU6A 4DA9A 4FD3A 4CQLB 4JNKA 2W2LA 4P4LA 4NHEA 5JS6A 1ID1A 1EE9A 2B83A 4DBZA 3AM3A 3WGGA 1ZEJA 3BTOA 3U4IA 4IJWA 4NPCA 2OORA 4CJXA 1PSDA 4Q3NA 4IDDA 4NH4A 4J1TA 2HSDA 4IINA 3NAQA 1H2HA 2JD0A 4BO0A 1HRDA 4FN4A 1LLDA 4GBJA 3NTQA 3CSDA 3TPCA 4GWKA 3VPFA 2DQ4A 3ZWVA 4PG7A 3GHYA 1XWFA 4IXTA 4E4YA 4ZA2A 1NR7A 4QO8A 4IBOA 1E6EA 4GLLA 1ZNQO 4RQUA 4EJMA 4Q3BA 1UP7A 3DWFA 5I9LA 1A5ZA 2NLOA 4Q9NA 3K31A 4W4TA 3U4HA 1D7OA 3PQFA 3D3WB 2IYOA 2PD6A 1PZFA 2C2XA 3DOCA 3D4OA 1QORA 2GDZA 2Q1WA 3GGOA 5EERA 3WSVA 1LC0A 1PGOA 3H5NA 4UULA 1PWZA 3JD4A 3L4SO 2WDZA 3B70A 4AJEA 3B20A 4Z3KA 4FGWA 4CLEA 4EEXA 3TOXA 3EHEA 1GR0A 4CMIA 3GVPA 3ENNA 4N18A 1H0KA 5GY7A 3HJAA 4FIZA 4YRBA 1Y9EA 5ES3A 4BGIA 1WMAA 2PZKA 1P3DA 3AFNA 3L77A 4UUPA 3ZNOA 3U62A 1DJNA 5EL0A 5TNXA 1PL7A 5EMHA 1SB8A 5JSFA 3VZPA 4PIVA 2HJRA 2X9NA 3LF2A 1N7HA 4DLBA 4GPD1 4ZRMA 1X13A 1PS0A 3NDJA 4L76A 1HE2A 1O95A 4K6CA 1R4MA 1LDGA 5LDGA 2UYYA 2J5KA 4Q3CA 4RF3A 4G2NA 5K6AA 2W8ZA 3PYMA 2GZ3A 1JAXA 4MP8A 3SLKA 4BUCA 3WS7A 3K92A 5A9RA 3OMLA 3JSAA 1AXEA 2PD3A 4KQWA 3INTA 2HK9A 2VWHA 4R3NA 4NJOA 1LXCA 2HDHA 1UDBA 2B36A 2YV2A 4W9NA 2EIHA 4YT2A 5JBIA 4BO3A 2IZ1A 3JQAB 4YQYA 1DIBA 3HFGA 4DMMA 5A1TA 3H3FA 1E3IA 2I76A 2NVBA 3AUUA 2DU8A 4BMVA 4UUNA 4Z0TA 6LDHA 3NJ8A 2JFHA 2CD9A 1NYTA 1BMDA 3DMYA 1KVUA 3H9GA 4UEJA 5TRTA 2D3TA 3BMCA 1O5IA 2DM6A 4EEZA 3GY0A 4JQCA 4YQZA 2XAAA 3DMTA 4D41A 4HFJA 4UUMA 3H2SA 5F5NA 3ZV3A 4B8ZA 4YT5A 5G0VA 1RWBA 2JCVA 2WYWA 3INGA 4TRNA 3F46A 5C5IA 2H9IA 3KTDA 9LDBA 1HXHA 4JJGA 2W4QA 3PLNA 3TRIA 4J1SA 2D8AA 4QT0A 5LCXA 4BNIA 2PKQP 4FC7A 4EITA 4MIEA 4R54A 1U7HA 2FZWA 4PZDA 2FP4A 3T4XA 2GASA 3KYDA 1DFHA 4WLEA 1BDMA 2ZCVA 2YHIA 3ZNQA 5CDSA 3WICA 3GHHA 2ZK7A 3SLGA 2I3AA 1HEUA 1MFZA 1P1RA 2EWMA 4OOFA 1MB4A 4PG4A 2FSVA 1MA0A 3W8DA 1E1LA 4XZ3A 3WFJA 2BFAA 4XX0A 3ZHZA 5L4NA 1Y81A 4CM6A 1YOVB 3W1VA 1LLQA 3WMWA 3RCBA 1HYEA 4H3VA 1FDSA 2CDCA 4YJFB 2GPTA 2BELA 2VYVA 3H4VA 1OMOA 2D4AA 3PJDA 4WCFB 1XQ6A 8ADHA 4FFMA 4DQXA 5I9MA 2X0RA 2AHRA 4QFCA 3WTCA 4CQMD 3FN4A 1M66A 4JLWA 1W0CA 1LSUA 3H5AA 3LSYA 5BSGA 2VCYA 2AG8A 1T2CA 4NNJA 3RBVA 4L73A 3L9XA 3KUXA 1GL3A 4CLRB 3RC1A 4YEDA 2UDPA 3FHLA 3KB6A 1IL0A 1P45A 4XJSA 4RLSA 3H3JA 2PR2A 2X0IA 4NR0A 5T64A 5BNTA 3JCZA 3V2UA 1T1RA 5EIOA 4PZEA 4IIUA 2HMUA 2OUIA 3C8MA 4YDRA 4E30A 2JCXA 1GADO 3HZZA 3P2OA 2Z1MA 1KY5A 2A35A 1BWSA 1XELA 1UXKA 2B5VA 5JY1A 2HU2A 4F3YA 4GKVA 3ASVA 3MWEB 1A9ZA 2OL4A 3E5MA 2AG5A 5IDXA 2Y66A 1PJ4A 3RROA 4Z0HO 3KSDO 4HWKA 3H6KA 2PK3A 3IP3A 1GQQA 2VTDA 1ISIA 2FPIA 4BO8A 3GAFA 3HDQA 3HDYA 1IUKA 2O3UA 1V9LA 5B4TA 5IJZA 4PVCA 3L07A 4NBWA 3HUDA 3L6EA 4BS9A 2A9FA 2ZTUA 5DNAA 4WE3A 3FR8A 3F5QA 4F46A 3ADPA 3WBBA 4N5LA 2IXAA 2EXXA 4XIJA 1J49A 5TQVA 3WQQA 5AXBA 1B3BA 1UZMA 5KJEA 5EN4A 3GDFA 2FPPA 4MVJP 4CLOA 3PWKA 3GVCA 2IEBA 4MVJD 1YRLA 5KVSA 3NJ4A 3DB2A 1F17A 3KBOA 3LC2O 4GQAA 4AJHA 4OMUA 1Y9AA 4LISA 3R6DA 3NGLA 3S2EA 2JCYA 3TSCA 2CSUA 3I6IA 5KOIA 1YGYA 3TWOA 3H8VA 5BSHA 4YJDA 5BSFA 3AM4A 3ORFA 1HDRA 4B4OA 5CEEA 1NX6A 1GDHA 5A5FA 3QW2A 2HMWA 4YJHB 1KS9A 1LSSA 5A9SA 2O3RA 3AUAA 4Q3AA 1VSUA 1OZAA 2WM3A 1YL6A 4GSKA 1PGJA 3T7EA 1JVSA 1NFQA 4UVHA 3U4CA 1NTOA 1R16A 4GX1A 4RLHA 3JQGB 4DPLA 1K6IA 4CMKA 2P2SA 3PGJA 4IZHA 4FDAA 1TVEA 1AN9A 2LDBA 3ETEA 2RH8A 3NV9A 4OKIA 3GGPA 1HYHA 4YAJA 3AUSA 1VPDA 3OA0A 4R51A 2CDAA 1R0LA 3B1FA 3CPSA 4MVJG 2V6GA 3WXBA 4D3DA 3O26A 2PGLA 3TZ6A 1YE3A 3R3JA 2VYND 3PHGA 1SBYA 2NNLD 4YXFA 5CEFA 1VM6A 4XRGA 4TKMA 1LEHA 3I9KA 5L7WA 3AU8A 4J1NA 2VHYA 2Q49A 3CTMA 5KJCA 1HKUA 4Q3DA 3QQPA 4M1QA 3I9MA 4JK3A 1GYPA 2CVZA 4W99A 1N7GA 3DDNA 1E3EA 1NAIA 1BXZA 4DC1A 3OICA 1LJ8A 3COSA 4L0QA 1EK5A 5CDUA 3VZQA 1OOEA 1U8FO 2O3TA 4I1IA 4L8VA 3F9IA 4IGFA 4C7JA 2DFDA 5DT9A 4BNTA 3D3EA 3JD2A 2ZTMA 2R2GA 3KSUA 3QIVA 1MV8A 2GLXA 2QRKA 1QLHA 3BMQA 4Z9FA 1L1FA 3PWZA 5T5QA 2GERA 5FFFA 5G2OA 1R66A 2RCYA 1MLDA 4K28A 3FSRA 2C07A 2EW8A 4YB8A 3EMKA 3QVWA 2Y1CA 2HJSA 2YUTA 2H63A 1QG6A 4BMSA 2O23A 4N54A 2FR8A 3VVBA 2PA3A 3V1TC 2HAEA 2FHSA 3X2EA 1KY4A 3V2HA 4L74A 3QWHA 4QTZA 3GFBA 2Y93A 2UAGA 1T2EA 2NADA 5DOZA 3IP1A 4YCAA 3FBGA 4HXYA 1PJ3A 3QVXA 1DSSG 2Y1FA 4ILKA 3EGOA 1SOWA 5JLAA 3D0OA 1E6WA 4E2WA 4R16A 4WNCA 3F3SA 3GG9A 1P77A 4BNJA 2RHCA 1OAAA 2DLDA 2PWZA 1ZMOA 2CVQA 2FY8A 2WEKA 1H6CA 2F1KA 1T2FA 2X0JA 2Q3EA 4RPGA 4NMHA 4J0EA 2VUTA 2EW2A 2ZJ1A 4UREA 5KJ6A 3DZJA 1MC4A 2JHGA 3IOYA 3QRWA 3BMOA 2AQIA 3IMFA 1J6UA 1LLCA 3NEPX 4GVLA 4BL5A 3Q9UA 4ZGWA 3DFUA 4GGPA 2X22A 4XIYA 1BDBA 4DMLA 1BGVA 4B7CA 4FFLA 1X7GA 2NTVA 1K6JA 5BNFA 4FFPA 1N5DA 3O8QA 2CNBA 5L7YA 1BTOA 1XKQA 1AHHA 4UUOA 4EDFA 1NPDA 4AJPA 3PZRA 4WEOA 3IL2A 3JYOA 4I5FA 4ZQHA 4B7UA 2VHXA 1VC2A 1B3RA 1ORRA 1WPQA 2DPGA 2EV9A 2UUOA 3UN1A 4JJIA 3CZRA 1I3KA 3PDJA 4YTEA 1DC3A 4AJOA 4RPLA 3RFXA 1B26A 4BKQA 4M86A 1LDEA 2NVUA 1GZ3A 1C1XA 4XYMA 3C7AA 1B8UA 4E21A 4KUGA 4R5MA 1YS4A 3D5QA 2B0JA 2XXBA 3DTTA 1UXHA 2YV1A 3MOIA 3W4KA 3Q2IA 3QWFA 1HTBA 4GMGA 1AUPA 4LSWA 1RM0A 1TEHA 3PYLA 4UEOA 3IDSA 5JCXA 3ZWWA 3A28A 3UUWA 1H6AA 3ADOA 3PHHA 4RF5A 2X0NA 1GEGA 4R1TA 4BGEA 2O7SA 3DAPA 5KNLA 2PH5A 2OHXA 3ZNPA 4N5NA 5CG1A 2WE8A 1ISGA 4J1QA 2AA3A 4ZN6A 3ZU2A 3C1OA 4H15A 4ZVVA 2AXQA 1K3TA 4MVJH 2DUWA 1SEVA 2VWPA 4QFDA 4WLVA 4N5MA 5DULA 2Q2QA 1QRRA 5A3VA 1I10A 3K2EA 1OC2A 4TZTA 1DBVO 1FDVA 3DBLA 4J0FA 4KUEA 3FWNA 1HWYA 2OZPA 1KEPA 3LF1A 1Z6ZA 4WCFC 4EBFA 3CMCO 2EKQA 4CL3A 1UXJA 1VJ0A 3WYCA 3CE6A 3WGQA 4WGGA 5T6BA 4BVAA 5A06A 3GLQA 3L6DA 1RKXA 1KETA 3E9NA 1K0UA 2PD4A 3F6YA 4N7RA 2WD7A 4WLUA 2CF6A 4PLTA 1M6HA 3K5PA 1C0LA 4GAEA 4B7XA 1VJTA 4OO3A 4QUKA 2DBRA 3HB4X 1YQDA 2DC1A 2JD1A 2NTNA 3O9ZA 4XQEA 2WYUA 3E5RA 3I4FA 3LT2A 3ITKA 1JU9A 4Y6SA 1A7AA 3OHSX 3V2GA 3ZNNA 4LSMA 1DDOA 3UCXA 1PR3A 3TFOA 3U9LA 4LMPA 5HTOA 4NBVA 3O4RA 2B37A 3ZWYA 4CMEC 2E82A 4OYRA 4TZKA 1PL8A 2GRAA 4XYLA 3EW7A 1PIWA 1W6UA 2QQ5A 1VL8A 4XGKA 1C0IA 4B3IA 3OP4A 2P4QA 1R0SA 4J90A 1YQGA 4K1LA 4RPJA 1E7SA 1CETA 1RM4A 2VYNA 2VRCA 2JAPA 2QZ9A 3S2GA 1XHLA 2Q2VA 4XYEA 4W7IA 4UVIA 2BMAA 5IN5A 5BNIA 4A27A 1EUZA 2EHDA 5JAMA 4HNGA 2PZMA 3ZV6A 1EEHA 5COAA 2RIRA 2EF1A 5IZCC 2P5YA 1K6XA 4NU5A 3C3XA 4RQTA 4NBRA 1R6DA 1RM5A 3FCOA 3UOGA 1GD1O 1PQWA 1LDMA 5KJ1A 1LC3A 2BGKA 4OQYA 3PHJA 3GVHA 4P38A 3K2BA 4EJ6A 1BVUA 3RKRA 1XEAA 3EYWA 1H93A 2GNAA 4A26A 1LA2A 4J4BA 4WK6A 2HMTA 4DC0A 4OAQA 1KYQA 2X9VA 5A05A 4WLNA 1F8FA 3OH8A 4G5HA 4Q3EA 2JFGA 1FDTA 3DHNA 3PK0A 3NKLA 5DCYA 1ZUD1 3MJVA 4UVDA 5DBFA 1EQ2A 3STHA 4J49A 1JWBB 1B16A 4EYEA 2E4AA 3UXYA 3TZHA 3KSZO 2DTDA 3WGIA 4FJ1A 4ZQFA 1VE9A 1HDOA 2JFFA 5JO9A 3GAZA 3DZBA 4ALJA 1KEVA 2ZB4A 3ONFA 3JQCA 4JBHA 1YL7A 5ICSA 1E3SA 1DO8A 1NQAO 3JD0A 2YV3A 4U5QA 2I65A 4C4OA 2PH3A 4MP6A 2HK7A 1YONA 4KZPA 1S6YA 3TJRA 1NHGA 1YXMA 3VH1A 4K26A 3ANLA 4J3FA 4WUVA 4CV0A 3M1AA 4IQ8A 1P0CA 3FNEA 5A3JA 2ZB3A 5KKAA 1H2BA 3W8FA 4CM9A 3ZV5A 2C54A 1QV6A 2X58A 3ROPA 1FF9A 4CUKA 5BR7A 2DBZA 3JD1A 2X6TA 4HX5A 3HG7A 1AHIA 3RUIA 3WIEA 3OF2A 3VC7A 4MP3A 1ISHA 1EDZA 3QVOA 1HZZA 2WMDA 2YY7A 4S3MA 3M2TA 4B79A 5CAEA 3FF4A 4KTTE 4J16A 3W4IA 3GZNB 3SXPA 3KHUA 2FN7A 3QHAA 2W98A 4Y8VA 1I2CA 1P74A 2AE1A 1KC3A 4FFOA 3ZWNA 1IB6A 4IDEA 4OXNA 1VSVA 5HS6A 4YAKA 1VJ1A 4NQZA 5J23A 2PZLA 4CODB 4BB6A 3GPDG 4YT4A 3GQVA 3GPIA 4DPMA 1N9GB 3G17A 1JLLA 2YDYA 5CEJA 4MVJE 1KVQA 4XKJA 4XR9A 4TRMA 1JWAB 1NASA 2VRBA 3BA1A 4U6QA 4XQ9A 1Q1NA 1G0OA 4D42A 1QYVA 2G5CA 3G49A 1NXQA 5KVCA 5THKA 3IIEA 3RI3A 3ST7A 1PZHA 2XPCA 1LRKA 3FNFA 1V3VA 1BSVA 4B3JA 3NT4A 4RF2A 4RORA 3NGXA 4WCFA 2O2SA 1WLYA 3DZHA 4BB5A 2G1UA 1IHYA 4BQPA 4DRYA 4OSOA 2DFVA 4ND4A 1ZJZA 5IDWA 1IPEA 3N74A 2V6MA 1HF3A 4XGIA 4HNHA 3QVTA 3AI1A 5CG2A 1DLJA 2Y99A 4ND3A 3NDIA 4CLRA 4CV3A 3BAZA 4XB1A 3AK4A 4B4UA 1R4NA 2NU8A 3ZW8A 3FNGA 3NT2A 2CMDA 2W2KB 5IDYA 2JKVA 5LC1A 1EMDA 3HWRA 2OBNA 4NFYA 3KZVA 2CF5A 5HM8A 3L6OO 1HE3A 2CVOA 3DOOA 3GA0A 3QVSA 2HQ1A 1Q7BA 1C0KA 3AW9A 1K89A 3MTGA 3GG2A 4CMEA 3M1LA 2O48X 4U8GA 2B35A 4NFHA 4MJLA 1TXGA 2DT5A 3N58A 4AJ2A 1QYCA 3OIDA 5F21A 1GV0A 3R1IA 4YRAA 3TL3A 4TWRA 4M54A 3G1UA 7ADHA 2X5KO 4DBVO 4FR5A 4DVJA 5ILOA 3ZWBA 3K96A 1EQUA 5L9AA 2GN8A 2HRBA 1N1GA 1ZJYA 3F47A 1GZ4A 3UVEA 1DIHA 4PN3A 3IAHA 3MJ4A 4M87A 4AVYA 4YAIA 4ZICA 4CPDA 4CM8B 2DTXA 4LRSB 5IZCA 4R69A 2ZYDA 1LRJA 2TMGA 1IOLA 5GZ1A 3E18A 3VKVA 3MJEA 1B8VA 2G82A 4O5OA 4ALNA 4PCVA 3GDOA 2XOXA 4KUHA 2FPGA 1E3WA 2OMEA 1Y1PA 1MG5A 4FB5A 2UV8A 1ZMTA 1BG6A 1ZCJA 1I8TA 1ZH8A 4OIMA 4YT8A 3H9QA 2D1YA 1JQBA 1Q0QA 3OIFA 3F4BA 2NU7A 4NJMB 4R01A 4XGNA 1A4UA 2IRWA 3LT1A 5JMPA 4WASA 4J43A 5G0TA 3VPXA 3PVZA 1ADFA 4XA8A 3RUEA 2HO5A 1XDWA 4ZJUA 1WZIA 3RFTA 4CM7A 4LVCA 5JC1A 1PGQA 4CM1A 1UXIA 3OBBA 3PQDA 4HFRA 1ADGA 4OJNA 3LLSA 5F5LA 1NWCA 2QIOA 5L51A 1W8DA 3PRJA 1HETA 4XJTA 2RBEA 3WBFA 3AWDA 1NVMB 3BHMA 1LQUA 3F4LA 1EVYA 3RSHA 1EFLA 3L4BC 4GX5A 2IZ0A 4BNLA 5JXWA 2GYYA 3P2YA 3S1LA 3OECA 5KTKA 3WYBA 4BKRA 2O2YA 3ZU4A 2VUSA 4CLDA 4CMBA 3RFVA 1YBAA 1DJQA 1NNUA 1GAEO 1NBOA 3AOGA 3BYZA 4YR9A 4BNZA 3ASUA 4RZHA 5A02A 4URFA 4HFMA 1SOVA 4TVBA 4IXWA 2OFPA 1X1EA 3SEFA 5TF4A 3WGOA 1GUZA 4OQZA 4L9RA 3I5MA 3EUWA 3KYBA 3LLVA 4DYDA 1E1NA 2B4TO 4NG5A 4PLZA 5B37A 2B4RO 2EKPA 3RBZA 3VDRA 4B4WA 3VKUA 5BSEA 3H7AA 3Q9NA 2AE2A 4LCJA 3ZWOA 3GNTA 4XD2A 4J2OA 4WOKA 3HNPA 4JP2A 3H2ZA 1WAMA 4WJZA 1B14A 4A5OA 5L4SA 5HRUA 2QW8A 4CUJA 2DUUA 3PTZA 2Y0CA 1P33A 1V3UA 1BHSA 3QA9A 2V65A 5THQA 1QSGA 1U2GA 3DZFA 2CFCA 4QEDA 2QZZA 1CRWG 3KETA 1EBFA 3DTYA 3OJFA 1KOLA 4BGVA 3MJTA 1HE4A 2Y05A 3WNVA 1GCOA 2QG4A 4A73A 4QQRA 3NRCA 1GTMA 2ZIZA 3CTVA 3RIHA 1E6UA 4BKUA 2IEDA 4U6SA 3FPCA 4BKPA 5FF9A 4D44A 1LRLA 3QY9A 4LW8A 1DFIA 2Y1DA 1WP4A 5CPFA 4E5MA 4R41A 1UR5A 2PKRA 2X23A 3CINA 1Y8QA 4XQCA 2C7VA 3PHIA 4H16A 4LK3A 5IXSA 1LU9A 1V35A 2I3GA 3O03A 3LZ6A 4EUHA 5BQFA 1Z7BA 3OJ0A 1P31A 3KYCA 4ZQBA 4OKNA 1YBVA 1ML3A 1V3TA 2QX7A 3DQPA 3PLRA 3JYQA 4KDEA 5DBGA 3FNHA 3WGHA 2PZJA 3AFMA 1YO6A 4KMSA 3V5NA 1ZZEA 1C0PA 3SJ7A 4BIIA 3JYPA 3X2FA 2A94A 5DDIP 3GRKA 4MVJI 5H81A 1DOHA 3DZGA 1P1IA 1ZEMA 4KDFA 3JYLA 1RYDA 5ER9A 4BNNA 1QR6A 5TT1A 4MDHA 3WWYA 3PI7A 4D0SA 3VHRA 5JYEA 1VL6A 2HRZA 5JAZA 5B12A 4A2CA 3JV7A 4PZCA 1BW9A 5I8WA 3DZIA 3MJSA 5U1PA 5FEUA 1DIAA 5ILGA 1LDYA 4RCVA 4UEKA 5CFZA 3GRPA 1NWHA 2PLAA 2H6EA 5EJ2A 4GKBA 3TDKA 4BNYA 1DFGA 1YBMA 3C1AA 1ENOA 2OO5A 3DBRB 3I9LA 3VZSA 1LTHR 3V1UA 2AQHA 1RJWA 3N7UA 3PFFA 2YQ4A 2Q45A 1DPGA 4NK5A 4DL9A 2O4CA 3GUYA 1L7EA 5IDQA 4CM3A 1Z82A 4U0KA 2D0IA 4MIOA 4RGBA 4J91A 4JGBA 3WG9A 4Z3DA 2VRCD 1P0FA 2BD0A 3A4VA 1F0YA 3P19A 1B15A 2FMUA 4IDBA 1RYEA 4AJLA 1G0NA 2NQTA 1H9BA 3D7LA 1A71A 2O50A 7MDHA 4CMJA 1UDCA 1ZK4A 4TQGA 4I08A 3DHEA 4FFNA 3HN2A 4KWHA 3UW3A 1IPFA 3KYDB 1EUCA 3TN7A 4JBIA 4NDNE 1A72A 1NFFA 1FXSA 2YHIB 4YA6A 2BH9A 1EE2A 5FI5A 4EUFA 1TT5B 4B4VA 3KO8A 4TRJA 2Q46A 1DXYA 5L53A 5JDIC 1XCBA 4Y67A 1YB5A 1T26A 2EG9A 4WEQA 1ENPA 3RC2A 1PL6A 3OJEA 1G1AA 4G65A 2GR9A 4L75A 1TT7A 3SVTA 3V1YA 3UICA 3C7DB 5I8ZA 2Y1EA 1H94A 1XLTA 1T1SA 1ZSVA 4ZU3A 3EVTA 1YQXA 1U5AA 4TVOA 3OJOA 5B1YA 5MDHA 2H1SA 4E5PA 2ZCUA 1G6KA 5G0UA 1M6WA 4RVUA 3H9UA 4E0BA 1M67A 5KJFA 3DL2A 3QJ5A 1PR9A 5T57A 3PJFA 5G4KB 4E2ZA 2Q50A 1QYXA 1YJQA 3QWAA 4WNIA 1PQPA 2BFPA 4YAGA 1ADBA 2X86A 4ND1A 5TIIA 3FI9A 4QECA 3ULKA 1JW9B 3QE3A 3A9WA 4RVSA 3VTZA 5JW6A 3JQAD 4II2A 5H82A 3EZLA 1F12A 4CM9D 2Y1GA 2UVDA 4OXKA 4E5YA 1RM3A 1R15A 3C24A 3IC5A 2POQX 3OA2A 3G1TA 5JMWA 1FJHA 1E77A 1U3WA 2I5PO 4J7XA 2LDXA 4NFSA 1Q7CA 4FS3A 4Y9DA 2W90A 4ND2A 5EINA 1WW8A 4J2HA 2PNFA 4XDYA 4BV8A 1F06A 4LRTB 1ZVMA 3U3XA 2WTBA 1KBZA 3GK3A 4BO1A 1CQJA 1B2LA 1AA0A 2OXIA 2P5UA 3UFXA 3CKYA 1ZFNA 3MZ0A 4H7PA 4TROA 2Y0DA 2DTEA 4YWJA 3VAZA 1GEEA 4I5GA 2NWQA 1M76A 2ZB7A 1GU7A 3MOGA 3GVIA 1EK6A 1KVTA 2RAFA 2VZ8A 1U5CA 4CLOB 1NVGA 1P1FA 2VWQA 3Q1LA 5ENVA 3QSGA 1CF2O 1PJ2A 1O94A 1Y5RA 2E49A 3GC6A 1X7HA 2BGMA 1Z45A 3GDGA 5IZ4A 3PPIA 1BVRA 3OETA 1GYRA 1HL3A 1LLUA 4DLLA 2RH4A 1WDKA 4BO7A 4E2XA 2IODA 5HS4A 2VN8A 3CEAA 3D4NA 2ZYGA 2PKQO 1V8BA 4F45A 2I9PA 4YJGA 4BNHA 4QSMA 5TS3A 5U4QA 1F14A 1DC5A 3DC2A 3RU9A 3I9OA 1Y8RA 4FC6A 2OP1A 5LDHA 4R5HA 3BMNB 1I24A 3JQ8B 4P22A 3F1LA 4XRRA 4BGUA 2Y1OA 3ROQA 4EJ0A 1U3VA 3LQFA 1SCUA 1YDWA 4WOJA 2C5EA 4J4HA 4A03A 2EJWA 3BZUA 4GVXA 4YRDA 5JFOA 3GN2A 2HMVA 3P7MA 2DKNA 3E9MA 3TFQA 2X1HA 4KTVE 1WXDA 4YAEA 4DWVA 2GF2A 3RC9A 4IY1A 1PJBA 4RDIA 3GZNA 3IKVA 4ITUA 4BNUA 1HSOA 3C85A 1EVJA 1PWXA 3NUGA 5H83A 1F8GA 2IXBA 2FOIA 2XXJA 5I9NA 2BI7A 3UCFA 2V7PA 4CQLA 2HUNA 2ZJ0A 2J3JA 3GMDA 4NIMA 1T4DA 4AL4A 3GEDA 3RWBA 2AW5A 3K9QO 5COQA 4MOWA 4EZBA 3T4EA 3ANMA 1CQIA
chains in the Genus database with same CATH superfamily
3E1IA 4BZWA 4F12A 2KHZA 2Q2NA 1NOHA 3ZY6A 4DUGD 1R0KA 3QEKA 2GS9A 3AEKA 3PFNA 1Q90D 2JVKA 4KITB 4LOAA 3ZX5A 4CCYA 2VBCA 1DUSA 2YKGA 4EW2A 1DTSA 4U3FD 4B3BA 4EW3A 1Q21A 4RA9A 4PPFA 1Z5OA 3IESA 5HNKA 2P79A 4EI2A 5F3DA 2E4UA 2G06A 3SS8A 1CUVA 4WKPA 1IUNA 2YXPX 2HI0A 5BWCA 2BP7A 4B2PA 4ARVA 3WK9A 1RHJA 2DFKB 3U7JA 4QXRA 4JLMA 1HT1E 1W48A 5AXAA 1K88A 4C29A 5JWRA 1ZD9A 1A9YA 3Q8KA 4JPZB 4FZVA 2PXHA 4X7RA 2IUSA 4MWBA 5BN3B 1O89A 4MWZA 3T5TA 1YWGO 4M6WB 1TIBA 1WD5A 1PHRA 1LW7A 2QGZA 3PKJA 5TR9A 1UF9A 3TQCA 3DVAB 1NQTA 4GICA 1Y1SA 1MENA 1WNTA 1Q7YQ 5FP0A 2ZJZA 4B33A 1ABBA 1RNLA 4RH1A 4PLGA 1J4AA 4N49A 3OC0A 4YJFA 1HDCA 1L4FA 3OEEA 1Z12A 1ML4A 4BKOA 3VOAA 2HIAA 4ZARA 3ELDA 1M1NB 4AUNA 1BSNA 3X44A 3ZU3A 3OKAA 5APWA 2GO1A 3V8RA 1W96A 2FZGA 1BCRA 1OZGA 5DCWA 4IP0A 1YZNA 3OOEA 5DM70 3N2IA 4N3BA 3DTNA 3O8OA 3LY5A 2DBVO 2ZCJA 3ZDMA 2Y0PA 1J5EB 3SEQA 1Q82Q 3T3DA 2GZ1A 4GMXA 3UIEA 4L4RA 1MAHA 2G4VA 3CKLA 3ZIDA 1LWOA 2HQSA 1FP2A 5AVUB 1Z22A 4CDRA 2ET6A 3SK0A 1CUSA 2GEFA 4ISCA 1KMHA 1ZK3A 3GEMA 3JQGA 1AVOA 2QY9A 3UGJA 1QB7A 1SHJA 1JHOA 1SHUX 3T7RA 2OFWA 2WQYC 3LUHA 1THZA 4EENA 1R64A 2E18A 1IATA 1SVNA 1VQPP 4GU5A 2C2KA 1D9ZA 1MB0A 3LX8A 5ED0A 1EFPB 4TWZA 2NO7A 3IP5A 1ZNZA 5F2EA 3ESBA 1V1MB 2OV3A 3OUTA 4GOKA 4XGRA 3FOFC 5JQWA 4UNQA 1HZJA 5HSGA 3NP7A 2MOKA 3JS5A 3N2LA 2ZSAA 2ZIAA 1L4EA 1M1XB 4BE7B 4L6AA 3JQ9A 2CNWD 1IDN1 1KS2A 2WHPA 4W5WA 3RS8A 5IT5A 4OQDA 2MR6A 3VSDA 4MA4A 3QFCA 4LMBA 1VF5B 4FBGA 5E8JA 3CT4A 1EZVI 4B8WA 2VYCA 5T8KC 1SU4A 2VJPA 4BFXA 1TDJA 1PCXA 3C1UA 1OR8A 1SR8A 4KVFA 1BXKA 2LV8A 1TUIA 3RODA 5AW6B 2IWRA 3U0BA 1XTBA 2WTXA 3PDUA 4OHWA 3D7SA 3GZ4A 3B7PA 2PUAA 1KU6A 3S68A 4DEYA 2Z83A 1XZEA 3MAAC 3I3OA 4KK3A 2K7FA 4G8CA 5BN5A 1A4IA 1GUFA 1TM1E 1GAWA 3V2QA 4F4CA 4JKIA 4URWR 4CKEA 1TAGA 4GQIA 2R8RA 2G88A 3HEBA 3L01A 3KQHA 2J9RA 3QMVA 3I6BA 4CCWA 3G3ZA 1MXFA 3EDMA 4X61A 2H9AA 2WTNA 1D0VA 1C3VA 4NYMR 3IQFA 1UOEA 3S8YA 2JFWA 4G0XA 2HRCA 1H5QA 1T24A 1KEKA 1Z4LA 5AW9B 3WB2A 3JQBA 3HJNA 4J7AA 4FJ2A 1LP1B 2JH9A 5B4UA 2O7QA 1E96A 2O8BA 3KV3O 1LWNA 2XGGA 4AJ9A 3IKTA 1A9OA 1O6CA 5I7WA 3MMPA 4UHBA 4EG8A 3PC8A 3FXAA 4I8XA 3D5TA 4TMFA 4J07A 1W4AA 3KKNA 1SKAA 3VTFA 1KE2A 4AJ4A 5JAPA 4E4RA 5AYVA 5C5EA 5JO0A 2D2EA 4XARA 2YWFA 3W6NA 3Q1KA 1SU7A 4DCCA 1W36D 5H9VA 3MHTA 4DR6B 4ILEA 1OC4A 1K4KA 1BW9B 5KX5F 5C51B 1GU0A 3IQIX 4RMNA 1JFTA 1U28A 4YFYA 3C6KA 4NCAA 2X0FA 2ZUVA 1O0SA 4ZYUA 4A7PA 2H0AA 2P69A 2PMDA 2EFDB 1ZPDA 3KT6A 1C3JA 2RHJA 1FNNA 5DRYA 1S7CA 1LJUA 4B83A 1H2FA 1I3CA 1O5TA 3H1HJ 2HT6A 3HBNA 2B88A 1MNQA 2JHPA 3HWWA 4G81A 1C1DA 4QHSA 3JQRA 2E6KA 2HXSA 2C5GA 1Y42X 4YI5A 2ONYA 1QO0D 1IHPA 2BY4A 2XWBF 1R3UA 2E48A 2ZUSA 4HYQA 3V48A 4IUCS 1KYYA 2DOKA 1PR1A 3OZTA 4TUYF 4URYR 3I9NA 3HY4A 1U9CA 4I8IA 4Y6QA 5C1BA 4CIDA 1P7VA 2PEZA 3NLLA 3QV1A 1BQ3A 5IW8A 3O1HB 4FYVA 1XHFA 3V4PB 4TXMA 4Q21A 4BVLA 4ZQGA 2BHLA 2QTZA 3JYNA 1M2OA 3DG9A 5B1EA 5EHNA 1BCCJ 3NTOA 3Q6MA 2YVQA 2NVUB 2XUGA 5JXIA 1ULTA 2FSFA 2O8EA 3K16A 1JH8A 4LDZA 3R0IA 3USCS 4ID3A 3IALA 2QN2A 2BSXA 3T9BA 2IXTA 2XGJA 3TSIA 4LCEA 4XEUA 5B5EE 5ES4B 3EASA 3DD1A 2QUKA 1NXTA 3LC0A 3EXG2 3I6QA 4JIGA 4G9BA 4FD3A 1C4XA 3E5NA 1SUAA 4CJXA 4EMSA 3TPCA 4NESA 4GWKA 3K09A 1HRKA 1OXZA 1CUWA 4ZYYA 1NR7A 4ZYZA 4IBOA 3A6KA 4HR7A 3K4PA 1XCOA 2ZJ4A 1Z6YA 3DOCA 3IAEA 5JALA 1RP7A 4PZ9A 2IIPA 4JIMA 1LNZA 3HZHA 1FFWA 1YA6A 5AKEA 4UU1A 4WKBA 3BCCG 4DIKA 4BGIA 3QKIA 4CTJA 5LMCA 5HBGA 1VQ8P 4KW7A 2WUWE 3ZK9A 4R83A 2WR8A 1AF7A 1I51A 3HYLA 1E61A 3NDJA 4K6CA 1LDGA 4FHFA 1FA9A 3VYUB 1UMDB 1YFKA 1VI5A 2GZ3A 1C7RA 3L7OA 1GKKA 2ZYIA 2OO5C 4LVOA 1A8HA 3NM4A 4KE8A 1CEXA 4JV5B 4P0TA 2YKOA 3ZQJA 2NVBA 4B09A 4BMVA 1LPPA 3KOZA 1V1RA 3V5BA 4DA8A 1IQUA 3ZV3A 2V7QD 4JHLA 2GD0A 1EGVB 3IP7A 4XUEA 5FTJA 1HI9A 1WJGA 2HJHA 4H13B 2VSOA 2HNKA 2WNIA 2YHIA 1DWOA 2XKAA 1K4YA 4ZK2A 2NP7A 4Y2UA 4WACA 16PKA 1JU3A 4AMGA 1ADJA 1YOVB 4KQ1A 3WLJA 2FN3A 4H3VA 4HAIA 5DSTA 4KGZA 4F4JA 5LWQA 4R05A 1GLVA 3IPXA 1PJZA 1I4OA 1U2QA 4FDUA 1HE1C 3JVDA 4CF4A 3EH2A 4NR0A 4RK1A 2BM0A 2VATA 3V2UA 3EDYA 2JCXA 1GADO 4KRGA 3IUEA 1XELA 1QF6A 2CCKA 3MAJA 2AG5A 3OG9A 1P4HA 3FKSA 3KSDO 1D04A 2X5XA 4TOIA 4PTLA 2J0UB 2BTEA 4RKRA 3QYAA 4ZALA 3HXLA 4DOJA 1P0MA 2AFIE 1J49A 3L71G 5APXA 3QELA 1FJ2A 3F6RA 4DZZA 4G5OA 3WMRA 3K1AA 3VAAA 4FE4A 5L8RJ 4D82A 5BSHA 2H7CA 5TQ2A 1NUQA 3RFCA 4DAEA 4CTMA 3L40A 3ORHA 1JVSA 3OFVA 5MGNA 5FR1A 1HWTC 5BQ5A 2P2SA 4C6RA 1AN9A 3ETEA 4LHWA 4OKIA 1QU3A 1R0LA 3B1FA 3FOEC 2R1VB 1JYEA 2DPYA 3M9QA 2C3PA 1HUCA 4Q3DA 4JK3A 4DLWA 3IEPA 3L04A 1R10A 2VTBA 1FP7A 1OOEA 4IGFA 3QIVA 3IBTA 1L5OA 2XCTB 2Y76A 3FSRA 2X4IA 3TGLA 1ZZGA 1IFMA 1VP9A 3SHTA 4NU0A 2JFOA 1RI1A 4HZUB 5F9MA 4P83A 1EVQA 4D99A 4HXYA 4D9KA 2EJUA 2VSYA 3FPHA 2M6LA 4OGQD 4JGIA 4IDHA 3DUFA 1OAAA 5TMPA 2H2HA 4LWPA 1O4WA 2Q3EA 4NMHA 4J0EA 1TC2A 3E1SA 3DZJA 2B3TA 3MFQA 3VMZA 3V2NA 2OFFA 2YICA 5LA6B 1IFPA 1EDJA 1QH9A 1R8YA 4FFPA 2GVDC 1IHUA 1ZBDA 2Z5IA 4F86A 4EG5A 2QT1A 2ORVA 1B3RA 3FUWA 1WPQA 4OAPA 2IHNA 2VUHB 2GA8A 1DC3A 3RFXA 1HTTA 1B26A 1US8A 1OFCX 3TE7A 4WOPA 3DTTA 2GXSA 1HTBA 1D0IA 3CO0S 3RVPA 2YWRA 3LUDA 1H6AA 2AOUB 1T4MA 3H17A 1UPXA 3HL4A 4MEBA 2PU5A 3TX6A 1A4XA 1ZRTD 1A2QA 1Z06A 1IJEA 2AVNA 1AS0A 3WYCA 4Q0MA 4QBKA 5CK4A 1RKXA 4TQ9A 4EL5A 1UBHS 3ONVA 1RE4C 1NVVQ 4GM0A 2WD7A 2R6DA 1CVLA 4JL5A 1KYVA 4LY6A 3ZNNA 4RTSA 1DJPA 3G9QA 3UCXA 3I12A 4WNAB 3RS7A 1GL7A 4G1EB 3TRHA 3EW7A 3N5CA 4EKEA 4LF6B 2NPSB 2VRCA 3BFXA 4KLCA 3CJQA 2FE4A 4FGUA 2F8SA 2BEJA 5KJ1A 5KX5A 1NTZG 2G67A 5IUKC 2O8FA 3TBFA 5BV1A 2JEEA 1JLMA 3K5HA 4PANA 2YKQA 1SLQA 5B36A 4WN9A 1OXSC 5C4IA 3DHNA 5CFLA 1S89A 4J49A 3HXMA 1OGJA 4OP3A 2HADA 1F9EA 3HB0A 3UHOA 3HD7A 5K3FB 1KB9I 5APTA 5I9BA 5ICSA 1DO8A 2NRGA 4X24A 4C4OA 3IDAA 4J0DA 4MP6A 4A6PA 3O7MA 2FCAA 5HFNA 4YCLA 2J58A 2EARA 5GIOE 2JB9A 1NBEA 3THWB 3A5TA 3R4CA 1XNGA 3E3LA 1P5FA 2HGSA 1U81A 3OF2A 3WLRA 5EKTA 4V1CB 4O4HF 1O87A 4BMOB 2W6PA 1KTIA 2FN7A 3N5KA 1I2CA 3WY9A 1KC3A 2E3JA 1JMKC 1XEFA 1M0EA 1NRJB 3GQVA 3H9BA 1Y82A 5AKGA 2Y2UA 4JI5B 4TRMA 4WK0B 5BQ3A 2B2CA 5FV4A 3RI3A 1E2LA 2CLSA 3C1LA 3FDXA 2DFVA 3P5BA 2RB4A 1K05A 1SXPA 3QBEA 3I37X 2Y99A 4ASVA 4BQOA 3BRQA 4LMAA 1Q1GA 4RK0A 4YRSA 5HM8A 1Z18A 3QVSA 2C4NA 2JDIH 3HCAA 2EJBA 2B35A 3MWEA 5TF0A 4OXQA 2X40A 2VP9A 4Q3KA 1NV8A 3GV0A 3TL3A 4PIMA 3CEPB 3PL5A 5EIWA 4L9WA 2RGUA 3OIWA 3F47A 5CVJA 4LRSB 5EAIA 4ZAGA 1P2DA 3A1UA 4BTLA 1HQKA 2YC4C 4C0QC 4OU5A 3OIFA 2PLWA 1A4UA 3PVZA 1ADFA 1PR2A 1YHYA 5JC1A 1UXIA 4IFMA 4IYRA 2W6ID 2GVNA 2E43A 4TLLB 5CVCA 1G4AE 3OECA 1DI0A 3O2JA 1X8XA 3GBSA 2BKXA 2PMEA 5HK9A 3S40A 1RQGA 2OFPA 1GK6A 4ZQIA 3QYJA 4WK4B 1Y3AA 2B4RO 1YA4A 1WP9A 3N59A 1WHSB 4MNTA 5ECDA 4V0ME 4TUYB 1S5LX 3PEEA 4X63A 4FZJA 3HY6A 3PC8C 1RLMA 1EBFA 1LS1A 3PTLA 2ZIZA 3C6QA 5IHPA 4XTRA 1QUFA 4PCLA 3TRFA 1TL7C 3W3AA 1TUEA 4GP7A 1EHCA 4HMQA 3KBBA 4H16A 1V35A 2HEGA 3NVAA 1W1UA 4B84A 1VYHA 1NYRA 3JYPA 4TYPA 4P5PA 2QT0A 2Q0XA 3ORSA 2V7UA 3RWMB 3OF5A 4XI9A 4S24A 2HRZA 5JAZA 4ZU1X 4AP6A 1U28C 4EG6A 3ETNA 3JV7A 1F4LA 4N7BA 4BZQA 5FXMA 2O0KA 1R6VA 2ZSDA 4G2TA 1KDZA 5IBQA 2HDNB 4UAUA 2AQHA 3I64A 1YJ9P 3AHDA 2L69A 1GG9A 3GHGB 5KO2A 4RGBA 4ZVMA 2XWJI 3RSOA 3N75A 1SUSA 1U31A 4KNWA 2C4WA 2VP6A 4X3CA 3AFHA 3B1YA 4TMYA 4B4VA 1IAVA 5JDIC 1YRWA 2NSYA 5DU2A 2A5YB 5DJTB 1L8OA 4O4IA 3V7WA 1HOTA 1H8EA 1G59A 1L5YA 5U4XA 2WTMA 1GSOA 3TZEA 1VE6A 2JLSA 4P9NA 2JEOA 4E2ZA 1QYXA 3QWAA 5JMOA 2QG6A 1VGRA 4FQ7A 4XFKA 4MJ3A 3CCSP 2ONJA 3FI9A 2PP6A 4QECA 4C4YA 3V6IA 2YJ5A 3H2HA 1F12A 2YWGA 3Q9LA 3F5FA 1R8XA 5JMWA 5I3CA 4N41A 3HU1A 2PNFA 5EZSA 3EODA 3W8RA 2G7MC 3HVUA 3VAZA 5A3RA 1M1YA 2AEEA 4C0XA 3CR3C 5NLLA 3GVIA 3AKZA 4UEWA 1WKCA 4WZ6A 3X1ZA 1T34A 1ZM2A 1O94A 5CB8A 1BS1A 1GYRA 2ZRGA 3HU3A 4E2XA 3CEAA 3D4NA 5D3MA 2ZBDA 1J39A 1FTNA 5BSUA 3BS4A 3WYDA 3ZLUA 3WNBA 5FUBA 2AOWA 4FMPA 3CUWA 1ZJ6A 2EWWA 1FU8A 1G21E 1SUPA 4RSGA 1KFCB 4US1R 2C5EA 2EJWA 2B9VA 1CV2A 4YRDA 2HMVA 2O2GA 2DKNA 2A45G 2QAGC 4LYGA 1IOZA 3UWDA 3EH1A 4C30A 5AW8B 2VSXA 3C85A 3U16A 3NUGA 4WXMA 4BUZA 1R88A 2XBLA 3K09C 2GN2A 3BK1A 3LXUX 4E33A 3MHPA 1S1MA 1UJ4A 1DD3A 1EX9A 5FOTA 4OV6B 3D1LA 1J1IA 4AY2A 1KDOA 2BGTA 3OMXA 2X4GA 1RC8A 2BEWA 3S55A 1PR0A 2KE5A 3KTAB 3HJCA 3D3WA 3PG5A 3O5AA 5DM60 3THYA 3QKWA 4PAGA 3TKAA 1GTRA 1W76A 3OW2O 4DDKA 1NTKE 3ZZMA 4HX2A 3R5FA 1WPXA 2E74B 4RK5A 4MCJA 1N3IA 2XGSA 5J63A 1P1KA 2FZEA 1JKFA 3L72J 1KMCA 3GJXC 3LUGA 3Q2KA 4BNFA 4QEZA 2WBLC 1GG5A 3WAJA 1J1DC 2VHVA 4WESA 1ZCZA 3JARB 3T5MA 1YOBA 4YXWH 3TEFA 4Y6PA 3ZOZA 4FYHA 3OTIA 2DR3A 3A9CA 2AXTE 4DSZA 2QRUA 1KH2A 4BNKA 5K5GB 1I3MA 3HUSA 5FB3A 1G20A 3H1ID 3DB1A 2IP1A 4ZANA 2E6UX 2Q1TA 2P35A 2V1XA 5C7IO 1EP3B 2JRLA 1GQRA 4HGRA 1Z6XA 1GPLA 4LJ5A 4B3XA 4BWVA 3SU8A 3H11B 2DP4E 3VJLA 1FFEA 4TTJA 4PV1D 4HDAA 2O7RA 4C7KA 5M5BA 3D4LA 3V00A 4FXOA 4NDAA 3JWJA 1T6NA 1EFKA 2ADOA 1FDRA 4CM4B 4EQ6B 1O97C 2GNPA 3TQTA 2JANA 1W88A 2BPOA 4NMWA 2X8LA 2E4VA 4F3NA 4QQ8A 3CV3A 2BBSA 3QLUA 1U2EA 3LDUA 1TAQA 5KLVJ 4I7ZC 3GF4A 3OPYB 5HTKA 1QVRA 4OL9A 1CRZA 3AT1A 3HDGA 1ZC3A 2OQQA 3FBTA 1EESA 4GKKB 3MMXA 4XUDA 2OTCA 4G89A 2NVWA 5G53C 4OJMX 1NI5A 1NVOA 3H9EO 3PFWO 2LWIA 5E6UA 1GA4A 1JCCA 2PCLA 5FKJA 1TTQB 5DYWA 1AHPA 1JKXA 1I9CA 1H0HA 3H8SA 4Y99C 4GL4A 1W46A 4WAUA 3UT6A 1GPDG 4F2WA 3DOJA 1TJ4A 4S1OA 3A11A 3RL0B 1DDIA 1LPAB 4TMXA 2VNJA 4OHMA 2I1QA 4DCPA 3W2HA 4URZR 3CISA 5EQFA 2EQ5A 3U37A 3AFIA 3L1HA 4IDGA 3VPAA 5B7QA 4FMDB 3JAKA 4F2GA 4JLKA 2D59A 3EMVA 4EGCB 2CNKA 3IKMB 2JF0A 2NX2A 4DWWA 4AKHA 5EIXA 1IHOA 1N92A 3G79A 1U4OA 3MQ2A 4K3UA 1XO1A 3FWZA 3HSKA 2GN9A 1N6HA 2YRWA 4TXJA 1JHDA 5EZYA 3TLMA 3B78A 2N9YB 5KLVK 2PT9A 5FQOA 3JXEA 2G71A 2DPXA 3VR3A 1YRYE 2AFHB 1Z2NX 4C3OB 1WWKA 5H4GA 1P44A 2OTKE 1EZ1A 4D3FA 1AS2A 3UENA 4X7BA 2P2UA 4K9MA 3SF8A 2D13A 3T3IA 1OW3B 5KKCA 2BKEA 5LYJB 4PPQA 3IHTA 5P8WA 4D8XA 1P7PA 3CEHA 8AT1A 2Z95A 2YMKA 1AGXA 3U1VA 1OVMA 3HYSA 4QOHA 2X41A 1M6NA 3LK7A 1MORA 4PO3X 4KVGA 4JX8A 3WGMA 4XE5A 4AG5A 2ORWA 4O4HB 3LW5H 1HGXA 3CLSC 3V6LA 3O2SB 3WYEA 3NEYA 1A5TA 1XDSA 2RHWA 4K9DA 3ONEA 2WD8A 1TADA 1GG2A 1JTVA 3ZZ0A 3EVZA 3IAM6 3KYIB 3E22B 2MJLA 3NHWA 1REQA 4HNRA 2AR7A 4TSKA 1U94A 3NDPA 5LNK6 4ICIA 2FKNA 1ZRHA 2ZETA 3QBTA 1SCAA 2WJJA 4DQVA 1KF0A 2WHEA 3CTPA 1P2GA 2E75B 1Z63A 3HPRA 4CW7A 1TQ2A 3ADDA 3DM9B 4J7CA 1JSCA 4HH3C 3ETDA 3GFVA 3T1VA 3RTCA 1VKZA 2ZB8A 3P0EA 2HPCA 2O2DA 4D7AA 3VOTA 1IOVA 2JGIA 3H1JJ 3R7WB 3WZMA 3UMRA 4ZOLA 3WLMA 5BPHA 2WJAA 3ZJYA 1AA6A 3QXXA 1Q0HA 4YP6A 5CDYA 1WF6A 1XALA 1FNSA 3FPBA 3CH4B 3AM1A 5EXEA 5DZSA 1YQUA 1JQ3A 5EIFA 2W2NA 5T8KA 4G09A 3OOSA 4X3PA 3KLPX 4ROTA 2GFQA 1G3QA 3FMFA 4Y28J 4YQEA 2BT4A 5H3CA 1BYUA 2H4WA 3BIFA 1AA9A 3HHEA 1XOIA 3SJBA 4FYJA 2BKLA 4UMVA 1KZ1A 2IUUA 1Q7GA 5ALLA 2ZI5A 3TLKA 4NATA 4EVQA 5L4LA 4HLUA 3KKMA 1JIUA 5CLLA 1OWPA 4PYOA 1ZNYA 3V1KA 1U7TA 1MU0A 3HYTA 6NULA 4CFSA 1CZOA 3OCVA 1SQVG 3IVMA 3IXMA 3R8CA 5EXTA 3DEAA 2ACEA 1KKUA 4Z99A 2WWGA 4XWYA 4OQNA 1TVMA 1H0TB 4GI2A 4NBSA 3K6JA 3VOBA 2MSDB 3UCEA 4EFMA 4E51A 2VZ0A 3DBVO 3GIWA 4PGFA 2D0DA 1CR1A 5JISA 4KYUA 1UP6A 2B1QA 3CLKA 2BFFB 4REQA 3RV4A 2NUTB 4AKTA 4E22A 5DNDA 3INYA 4IIVA 4QNNA 3RHZA 3Q0EA 4EW1A 2WYIA 3I3SR 1MO6A 1P7ZA 2QRJA 1URQD 3GOHA 4LG1A 3NASA 1WVGA 1OLXA 4EA9A 5AXDA 5LMZA 2BKAA 1EIWA 4BWGA 2ID7A 2J30A 3DNFA 2FQWA 1BRTA 3ESXA 1R12A 4PYNA 3I2HA 3IDFA 3E1KA 2J3KA 3VKGA 1ZLYA 2BGNA 3A6PC 5F1YA 1XA0A 4UTRA 1DBPA 1SH7A 3T3PB 4B6GA 1CY7A 3FPJA 5CJ2A 1XNRB 4HUQA 2H1IA 3T9FA 1XMVA 1AKEA 2AN5A 4UFNA 3DYBA 2J5RA 2QB5A 4KXXA 4JODA 4H7KA 3W06A 5SV2A 2I66A 4FYYA 4U7GA 2Z5FA 4BYMA 1PZXA 5JS7A 4P4LA 2W2LA 5AVRB 4NPCA 1ILWA 1JVNA 1Z7YA 4NZOA 4IINA 1RE3C 1CUJA 1SXJB 5ELXA 3GHYA 3MD0A 2OGSA 4R2XA 2W2VA 1TCCA 3OJCA 4RQUA 1MN6A 1D7OA 2G36A 1QORA 2QENA 1LC0A 1OV6A 4Q05A 4Z3KA 4YNBA 4W5RA 4N18A 1SVLA 3CB2A 3K53A 4YRBA 2BAGA 3FJ1A 3U7IA 3UB4A 1D09A 3N8NA 3VZPA 3G89A 5KS2A 2W2XA 2ES4A 5HQJA 3IERA 3C39A 2GRUA 5LL6P 4JMLA 3I28A 1AXEA 5GOZA 1RBQA 2PBZA 3Q3HA 4YCJA 2HTFA 3L36A 5AVQA 1RJFA 1I5OA 2PMBA 3CRZA 1QRDA 4UKDA 1NMXA 2XUKA 3GFPA 1YU9A 2E5TA 4LJKA 3UFBA 1RQRA 2XMPA 1M8PA 3OZ7A 1RWBA 4Q1CA 4MMZB 1IJKA 2QQ0A 3QI7A 4RLQA 2CSXA 2XNSA 1IMJA 1XRRA 2WSFH 1A69A 2PAAA 2VKQA 5EJFA 4N47A 1HYEA 5KTPA 1CUXA 1ULAA 8ADHA 3IUYA 1Z2PX 3C3BA 2IXGA 1YJXA 4RNCA 2XQVA 1W0CA 3K0AA 2AH5A 3JR7A 2SECE 5AK4A 2R6FA 3GLSA 4OAOA 4ISBA 3Q5PA 3BAFA 2GPBA 3AEQA 4JT9A 2HSZA 2UYQA 1X1RA 5FLEX 3P0JA 1KO8A 5H80A 2VPTA 4AMYA 3E5MA 3ZBTA 5JANA 4GW3A 3FDZB 4LV8B 3E9RA 3PF9A 4MAMA 2YKPA 3MVEA 4A8PA 1C7IA 5BSKA 1O94C 4KMRA 2A9FA 2ZTUA 3SYMA 1SQPD 4JYPA 2EXXA 1IQPA 3DTVD 4I5IA 5K3SA 3Q1MA 2WJ3A 4ZAWA 3OAAA 1E2BA 4I6EA 1QGOA 5FBRB 5A9SA 3AUAA 4MGEA 1PGJA 1K5DA 1MHPA 3T7EA 4WBXC 3A4YA 1C0EA 3KT3A 2RH8A 3CWBD 4P81A 4XRGA 5E4YA 1NDQA 1Z4KA 3VR4D 5JWHA 3NVMB 3RAGA 2DERA 2HQBA 1QHFA 4QPPA 3WISA 4L8VA 5HCIA 5K0BA 3BC1A 3OIYA 1W59A 2HJ9A 4M9ZA 4INZA 4OJYA 2JLBA 2ZT5A 1GPH1 2ZYSA 3U48A 3V2HA 4L74A 2FEMA 3QWHA 2RI0A 3EB9A 3FGAD 1Z83A 2AIRA 1DSSG 3EQ6A 3GRYA 3EGOA 2FEXA 2OQ2A 4IH1A 5AJZA 3MQFA 2CVQA 3U7RA 4M0DA 4ZPJA 2R6CA 1Z4PX 3NOXA 2ZI7A 2F1JA 3AYXB 4ASWA 1WS6A 1X7GA 2RGNC 1UM9B 3WADA 3FPFA 3OVMA 2D1FA 3FCSB 2A88A 4CHTA 2XTAA 3GEPA 4ZKUA 1LBTA 3CGGA 4RPLA 4M0UA 5JSQA 1N7JA 3LQKA 1YQ4C 4XYMA 1HZZC 4LSWA 1QQBA 4M9QA 3PIRA 3DPUA 3MG9A 4RF5A 1QE3A 4RE5A 5AKLA 4CPGA 2FFAA 1SEVA 3DVAA 1QRRA 5CYOA 4K86A 2C0XA 1Z6ZA 2ZRQA 2H16A 1KO1A 4J0KA 4BVEA 2OV6A 4EO4A 1Z0UA 4MGHA 1PFWA 2H5JA 5CTAA 1RYBA 5KSOA 5FA5A 3BERA 3D70A 2Z2YA 1O9HA 4GG1A 3QLUC 4NBVA 4JJZA 5J59A 3DW3X 3I34X 3GFSA 1E4EA 1YTZI 1WTAA 1WBBA 2B6HA 3JALA 1H5NA 3OP4A 3HE4A 2KI7B 1M33A 3G9UA 3HJBA 3T3MB 4GE3A 2EEPA 3SIWA 1WXWA 3KG2A 2Q8QA 2JGKA 1RM5A 2OKGA 1LDMA 3PHJA 4O2LA 3DYIA 1XEAA 4AYCA 2EZ9A 1H93A 4D9EA 2QBYA 3SS9X 2JA2A 3V4LA 4UBNA 4RVNA 1FDTA 3NKLA 1C30A 1EQ2A 1Z6QA 2AFVA 3IURA 4LIPD 2PYDA 2YVLA 2VH2A 4ZOBA 4FIDA 1DCFA 4OQFA 2HEIA 4IIJB 4K26A 1K8QA 3ANLA 1M2VA 4QUBA 4F97A 3QWOC 3G4SP 1XK7A 1H2BA 5KKAA 3U60B 2W5UA 1IIBA 2EZ4A 2BOVA 1V5WA 1S2EA 3DKPA 4R98A 1ZOYC 3T61A 3C8ZA 2BDUA 4RJKA 1ISHA 3M2TA 2R1ZA 3W4IA 4CU5A 2VR1A 4YAKA 1DNPA 3CIOA 2VXOA 5C80A 2W27A 1WUIS 2G5CA 1Q81Q 4HO1X 2IBZI 1V3VA 3NT4A 4G67A 4U2DA 1CS4C 821PA 3TQQA 1PP9D 3QVTA 4ME6A 3R5SA 1RE4A 2V7TA 1DLJA 1P9WA 4CRWB 2GBCA 2NU8A 2EDAA 2R47A 4LE1A 3HVIA 4X45A 1J8VA 2K9JA 3AW9A 1Z5UA 2KZJA 4NFHA 2BEZF 2G3YA 1GV0A 2Z4TA 4TWRA 3VNQA 2JASA 1Z4JA 3BKWA 3DW1X 1XQVA 3NBUA 3L73E 4CM8B 2JATA 3G8AA 4Q4HB 3VKVA 3MJEA 3Q8MA 2RGAA 3GDOA 3FVTA 2MIIA 1JRLA 2B7BA 4MUBA 4XGNA 3D8SA 1IAQA 4WASA 3HRIA 2BHTA 5LA6F 5FOVA 1DV2A 2XCLA 3L8DA 3HZOA 4H7JA 5L51A 1W8DA 3HR4A 3L74D 2C99A 1RKQA 4HN9A 3WGKA 3IAS1 1G9SA 1RQ2A 2NO4A 2EBWA 3HWX1 4MSUA 1H8HD 4PO9A 3TPZA 5KTRA 3DBOB 4J0HA 1K68A 4RZHA 4QULA 1Z37A 2ERCA 3SEFA 2XKKA 4DW8A 5L6MB 3KWFA 5B37A 5AW9A 3H97A 1BIFA 4GRDA 3FB1A 1IY2A 4U39A 2DUUA 2Y0CA 3IBFA 2QPTA 4QEDA 2VHCA 1RF1C 1CRWG 3KETA 2PH7A 3OQIB 3C3PA 4DHWA 6AT1A 2D0PB 2CB9A 2RH0A 1XK6A 3CTVA 1V8OA 1DDGA 1BGXT 1WP4A 4C03A 5K3OA 2R2AA 5BU8B 3CINA 4KXMA 3PHIA 4B6OA 4QVGA 3V4FA 1AC5A 3QEAZ 3QXJA 3DDZX 4OKNA 1YBVA 1ML3A 4YDHB 2FZVA 1YO6A 1TGYA 2X3FA 1X19A 2VXBA 4BIIA 1OKKD 5DDIP 4KT0J 1P1IA 3LKDA 4KDFA 3H1GA 4HQ6A 4GF5A 1FTYA 5C4MA 2HHJA 4HLUC 4YDQA 1BW9A 4FTWA 1Z0FA 5BQOA 3RRMA 4GPBA 5LMNB 2IFTA 5EWLA 5DGHA 2KS6A 4MHOA 2CYBA 3AE4C 4KGVA 3F49S 1KSHA 1RXUA 2CL0X 1HNWB 2AD5A 3KK0A 2QLBA 4K0KB 1P0FA 3A4VA 1E6LA 1G0NA 4BLUA 7MDHA 4MDEA 3KPUA 1FJXA 2QX9A 3VC3A 3AZQA 3BWEA 4RIGA 3MYYA 1RPJA 1RS0A 2R8BA 1D6NA 1C8KA 4IRXA 4YO8A 5JSKA 2V7QH 4KJMA 3W5HA 4O2BB 4L75A 5I8ZA 3P9QA 3EPRA 4ODIA 2NO6A 2VK4A 4BX2A 3BWVA 4FYXA 1Q17A 3CN7A 3MERA 3CCMP 4WNIA 3AE2C 1QV9A 2R44A 2V8OA 4IDOA 4R0NA 1LBQA 2F3SA 3RREA 3ZDAA 2UVDA 2NPIA 2XXAB 3B4SA 4PJ0E 1S3JA 3NIBA 4J2HA 4RJJA 3CKYA 3MZ0A 3OZCA 1GEEA 1BDCA 1U1CA 4EL0A 3RH0A 3UQZA 1RFGE 2XMRA 1INLA 3QYFA 1P1FA 1PJ2A 1X7ZA 5DM2A 1QVFO 6REQB 4RKUJ 5JT1A 2BCCG 4YPFA 3KDSE 1QG0A 1CVIA 4R5HA 6PFKA 1GW4A 1RMYA 3VSAA 2O54A 3P96A 2PX0A 1FW6A 4J4HA 1T9AA 5F98A 5TISH 5JFOA 3ZE0B 1V41E 2ZJYA 5FO0A 4RTPA 1PFGA 1TPZA 3UCFA 1O6GA 3RWBA 3TVDA 5T7BA 4EZBA 1ZA2A 1I14A 1U7MA 5E7MA 4II3A 2P9GA 5JDIA 1IEWA 2WKQA 1Z0JA 4L78A 3W5VA 2AL7A 5JS8A 2XLCA 1U1GA 4I1SA 1ONBA 1SS1A 3CMMA 1J1UA 2RBKA 2QE6A 1TB4A 3FPAA 3H3XA 4DPKA 5JMTA 1FFXB 4P54A 2NXJA 5T41A 5LOVA 1Z25A 1CZUA 3GLIA 3MPOA 3U1BA 3VX3A 2YIDA 3CVWA 4MWEA 1MKYA 2I6QA 4FR0A 4B48A 1NJFA 2UVQA 4EY4A 5L3RA 1NVFA 1UMDA 3D6UA 4P7KA 1U0BB 2VHTA 4L0CA 1ECFA 1I4WA 4DVGA 4OI2A 2JJMA 3GFOA 2WMOB 4XWKA 3WHLA 1D07A 2HA6A 5I6DA 2YHUA 1DEBA 2O1XA 5AR1A 1A76A 5CDGA 1L3CA 1CIJA 2BW0A 3JR3A 1I1HA 3TKYA 4JJKA 2D62A 4AN0A 5MFZA 2QJWA 4RMHA 3K94A 4RANA 5I7EA 1YOVA 2QAGA 3PUHA 4X3OA 4KPUB 2Z5LA 3I1JA 1WPGA 3IUNA 3IP9A 3VVCA 4WTOA 5EMNA 4LF5B 3A3YB 1THGA 5T67A 1FX0B 2GDJA 3NPMA 4GX2A 1FLAA 4J6FA 3TL2A 4MVWA 3RC7A 3WP0A 3I62A 4ZRDA 2IY9A 3G0CA 5A04A 2J0UA 4J03A 3KXKA 1DEEG 4GUDA 4U7WA 3FOZA 4DCKA 4QPNA 1J9ZA 1GDTA 1R6TA 1VE5A 2AWNA 2JFPA 3EEOA 1P9LA 2QRGA 4EYOA 3SWKA 4OP1A 1PR6A 4X8LA 3MJCA 2PZ8A 1GUAA 1UAGA 2ZYUX 1G42A 2XKBA 2VEOA 3O9VA 3GF3A 5BR8B 1WL8A 2C7RA 1ZVKA 2Q9CA 5BWBA 1KY3A 4F8JA 2D1QA 3EY9A 2QI9F 3VC2A 5F64A 1TCVA 5FYDA 3N53A 2WPSA 4E5DA 2R1VA 1RKUA 4YAOA 2ZJ7A 1R2QA 2AG0A 3VXKA 1XAIA 5KWVA 3BZBA 3FSGD 2J4DA 4AFNA 3H1FA 1TKCA 1HKHA 2FVXA 4DOMA 3A0BE 4LJ7A 3S27A 1Y37A 1T6BY 5JD5A 2UUPA 2WY2D 2H3EA 4Z4FA 1WDMA 3ESRA 4LOKA 1N78A 1IBSA 4HZUA 1HURA 5BT8A 3AGQA 3CNEA 3ZIAA 2I03A 1SAYA 3FFXA 5TEWA 4Z9AA 2E9SA 3ILSA 1N2CB 1N3BA 4B6QA 2OFOA 1OT3A 5LA6A 3OE7A 2P91A 4DR1B 3A3PA 4LAFA 3H75A 1G60A 5DBIA 3QHPA 4OP2A 5KNBD 1BD4A 5BRJA 3B9RA 1NVEA 2DWCA 1DIOB 4DIOA 3ZC3A 4HMOA 5EVCA 4L3OA 4Z4CA 4AICA 1SK9A 2XAUA 3KJEA 4FS8A 4RV9A 4HGPA 2GCOA 2BVNA 5EPOA 3P4UA 1YAJA 2ZRIA 4AJJA 2ATIA 2ZGVA 1LB1B 1GQFA 4IW3B 1PFIA 3A9UA 3AY6A 1T4BA 4KYVA 3Q7IA 1QDEA 4INAA 1TI7A 4HH1A 1AS3A 4AG3A 1MX1A 2EERA 4J7UA 4BNMA 1EXDA 2FEOA 5CVVA 1ZRMA 1YHNA 1J5PA 5DMHA 3RFUA 4N6OA 1GUDA 4ASUA 1J2YA 3MC1A 5ETJA 3CZCA 5FTNA 3VSCA 2DYKA 3QFRA 1C50A 2GH1A 1MFPA 1E5VA 4KOEC 1SU8A 1NYHA 2RKOA 2AK3A 4BP8A 1VBNA 5FUVA 3CFYA 3E35A 3CIFA 4QYMA 1Y8QB 1GFSA 2PGDA 4YUYA 2R1TB 5F7ZA 4K9RA 1Q86Q 5AT1A 1JPJA 3IQHX 5E3JA 1FS0E 2FSHA 4PBSA 3DLHA 3ZCUA 2FPPB 3A0RB 1N0IA 4MUJA 3SYKA 3W7VA 1FZAA 2PX6A 2XVMA 2PVPA 2ZYRA 1KWKA 1QK4A 1CUEA 5K3FA 2CXRA 1W0JA 3G7SA 7REQB 2ZE8A 3AJ8A 2AC2A 2EEZA 4G0WA 3DE5X 3CKMA 1JCDA 1G3UA 5H2FE 2P7IA 2MSNA 4OM8A 2V9CA 1SQXJ 2OXCA 1H2EA 1U0OC 3N07A 4NJEB 1NTMJ 4V1CA 3E0XA 4UE3S 2VP3A 3RUDA 5CNKA 1PV2A 1LWUB 3UMYA 4P3OA 3Q5SA 2AJ8A 1NZFA 2WKWA 2ZUFA 2HKIA 3SQLA 5IF3A 2ZRKA 3CL3D 1YB7A 4BRYB 3WWDA 1VKRA 5D1NA 4FMDF 4EKDA 1VF5C 1T5TA 5LKAA 1UDAA 3CW8X 1E7WA 3L18A 3JWIA 2B20A 5K99A 1N2SA 4HDQB 1USKA 2G5PA 3IRUA 1JIQA 1UBFA 2CJXA 4L5YA 4N78E 2IYXA 3N6RA 1FS4A 1JIVA 3FH0A 3WV4A 1JALA 4F5WA 4HY3A 2Q99A 4D6TG 3G9RA 2BM1A 4PGGA 5K0ZA 4I1PA 1K5HA 2ZVNB 1SVIA 1M8JA 4R1OA 5L95A 4GX0A 4D4KA 1OX3A 3LQ1A 3O8QB 1WPRA 5MGBA 4HQRA 2I34A 2KPOA 3I2FA 4B3CA 4HEQA 3TNUB 3S2IA 5CX1B 2GZ2A 2EX4A 4UNIA 3T1OA 5LYJF 1SQXK 4CMCA 2G0AA 2ZR9A 4OTZA 1K7XB 2W58A 1NTMK 3ZOKA 5LQMA 3I1IA 3KZKA 3PD0A 3HJGA 1SXIA 4W6ZA 4OX9Y 2GX6A 2XDQB 2VJNA 3T7KA 4EHKA 3R0QA 2RGEA 5E2BA 1ZKMA 3BXPA 3VPGA 1WF3A 4AJNA 5HWSA 4AUMA 1DT3A