4OWFA

Crystal structure of the nemo cozi in complex with hoip nzf1 domain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
83
structure length
83
Chain Sequence
QLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/protein binding
molecule keywords NF-kappa-B essential modulator
publication title Mechanism Underlying I kappa B Kinase Activation Mediated by the Linear Ubiquitin Chain Assembly Complex.
pubmed doi rcsb
source organism Mus musculus
total genus 38
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.990 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Nemo cc2-lz domain - 1d5 darpin complex 4owfA00
3F89A 2ZVNB 4OWFA 2V4HA 4BWNA 3FX0A 3JSVC 2ZVOB
chains in the Genus database with same CATH superfamily
1PP9G 2ZT9B 3CWBE 1FDIA 3LW5H 1CI6B 3O8ZA 1S5LH 3AE3C 2H88C 2JWDA 1L4AD 1JTHB 1LJ2A 1YYCA 3A7OA 1K8AQ 1ZN5A 1RF1A 2KLVA 5C39A 5GTIE 3EWKA 1KD1Q 1NKNA 2RH0A 1HJ0A 1Y9BA 3L70E 3PP5A 1M1JB 4L74A 2QJPC 2AEJA 3H1HG 1KYOH 1PGPA 4H13B 3MP7B 1GK4A 1XTGB 4UB8H 2W6BA 5KJ7D 4QMAA 3SSUA 3H1JD 3RK3E 1BCCJ 5AVUB 2KSEA 1NTKK 4XA4A 2M5AA 4GKGA 2ZAEB 3VN0A 3CWBG 1KN7A 5KTBA 2B9BA 1T2KD 2L5GB 5CMZA 1UIIA 4OVNF 2KNCB 2Y0DA 3M0DC 2W83C 3V6IA 3V4WA 2OYIC 4KHXA 2VRSA 1NOHA 2W6JH 1IO4A 3A5TA 3IF4A 1FZBA 2R5BA 1W2BO 3RK3C 1LWUC 2ZFCA 2LXBA 2KB7P 2YMYA 3L70G 1S5LE 1SQQE 1VQOP 3CX5H 1L0LK 2Z5HA 1PGQA 2FFDC 1HGVA 5TJHA 1BE3E 3NFQA 1JY3P 3GMAA 5KAFE 1VQ6P 2O01H 3UIAA 3H1JJ 3IN6A 3AEAC 1W2EA 3MUDC 2W90A 4EI2A 3A0BE 1KQLA 3L74E 2Q9IA 5KLVD 1N86A 1FJKA 1DD4A 2ZXXA 2AXTH 1R8EA 3VOPA 1LTBC 3GG2A 1SQPD 3QWOC 3TGUJ 3D6YA 1HUCA 3A0HH 1LP1B 2MKVA 1LTTC 4DZOA 1PP9J 2JDIH 1P84D 3CMEP 3RK2D 3MGNA 3L71D 1NKZB 1SQQG 2E74B 5AW0B 1YQ4C 4BRYA 3ZDMA 1JNMA 4PD4E 2FFDB 5CCHA 2IFNA 2Q7CA 4M3LA 3L72E 1RE4A 4UB6H 1BE3G 2QM7A 3CC2P 2N1TB 2H7HA 3H1ID 4GOEA 4IFFA 3H1HJ 3L74G 1N8RQ 2W27A 4IFDK 3KYQA 1Q90D 5KLVJ 2FXMA 4TLFA 5APSA 2M0BA 2P1JA 2D2CC 1KB9H 1JY2O 1T6AA 3USSA 1KMIZ 1J1DC 3C1LA 4PD4I 3H6PA 1DEBA 1U7MA 2CPBA 1MKMA 3F5HA 2GM4A 3CWBJ 2E74D 4GT1A 4H0LC 4R4LA 2QJYC 2QA4P 2IFMA 1YQ3C 1S9KD 2H8PD 1KORA 3HD7A 3NTNA 1SQXD 2K88A 1Y47A 3P8CE 3L71J 2RMZA 1H8AA 4WY4C 3EQ2A 2FXPA 1NTKE 2OQQA 4Y99C 5KLIC 1QLED 3CL3D 2IZ1A 1RE3C 3L72G 3AEGC 3VMZA 1Y8AA 1MUUA 2OYHA 3L70J 3SWFA 3CXHE 5B5EE 1URQC 3U1CA 2E75C 1KTMA 5APTA 2E5YA 3VMAA 2WSEJ 4I7ZC 5BVZA 3L75E 1OVVA 1NGMB 2D2CB 1X8YA 3VTPC 1PPJE 2R3CA 2NPSA 3B5NB 2XNXA 2WT7B 3QH9A 1JY2N 1LTGC 5CCHD 1KYOD 4DCKA 1BDDA 4H0LB 4ZMDA 1USEA 3CLQA 1ZRTD 3LIEA 3RL0g 3AEFC 1FDOA 1VF5B 4HKZH 4PJ0H 3CXHI 1FE6A 1FOSE 1KB9E 1PGOA 1LT9A 1ZMEC 3CMAP 3E1IA 4U3FD 1IJDB 2O1KA 1KFNA 1NTZK 2YXRB 1LT1A 2OYHB 1NTKG 2IDBA 3WMM0 3RBZA 2J59M 1G1IA 5KKZB 1SQBD 1BSNA 1HVVA 2ZYDA 1EZVG 1VQ4P 5GTHE 2E75B 1VQ5P 1YBKA 5AW1B 1SQQJ 1L4AC 5AVRB 1R5LA 5BU8B 1AA0A 1Q86Q 1KFMA 3H32A 1K9MQ 5E79E 2UWJE 2ZVNB 5CCGC 3G3ZA 5DJTB 4OH8B 1K04A 1R5SA 2HFED 3L75G 3HD7D 4JF7A 1S2EA 2FKWB 2YNYA 1S5LX 3O6QA 1BE3J 1PPJG 3T97B 4OWFA 2C0XA 2QJKB 4Z1MH 3EFGA 1OVRA 3D71A 3FGAD 3KZIE 3CX5D 2HODA 3GF3A 3L74J 1N73A 3GHGA 1LTJB 1L0LG 1N7LA 3JCUE 3M9QA 1PIXA 1U57A 1L2PA 2Q6QA 2KI7B 2RN0A 3M9BA 1FAVA 3RL0C 1LTIC 5KJ7C 1CI6A 4NPFX 2O01N 1JTHA 2KK7A 2I1KA 3PRJA 1HGZA 3WUTA 1RF0C 1ZW0A 2IX7C 3KHUA 2NPSD 1AQ5A 4LC1A 2WITA 3HE4B 2BCCE 4PJ0E 1KZUB 1M1JA 1ZLLA 3VP8A 1FZCC 3IR9A 4IL6E 1VPCA 1BCCD 3AE9C 2V7QJ 4I6MC 1PGJA 1FZGA 1M57D 1OWAA 1SFCB 2LR2A 3L72J 1BGYE 1EZVD 3U59A 4L73A 1KV4A 2E76B 3Q5PA 3V5BA 1CW5A 1M8OB 4C7NB 1NU1E 4ZKUA 4ASVA 2O1JA 4JBZA 1ZV8A 4GODA 3N7NA 1VQLP 3TNUB 3RL0B 1OW8A 1LTAC 2OARA 1TU3F 3CCVP 3C8VA 2KNCA 2O01J 3FWNA 1AVYA 1BDCA 3CCLP 3G6EP 1PFIA 2PRRA 1NAFA 5KAFH 1RF1C 4EDFA 1L0LD 3Q5SA 3CCSP 4H44C 3A0BH 2BEZF 2BCCG 3H1LE 3L37A 2E76D 2ZT9D 1FBMA 2IPPA 4W7YA 1VQMP 1NTKJ 2B87B 1CSBA 4PV1B 1BGYG 1L0NK 2AEMA 2Q3IA 3MIWA 1OZHA 5TISE 2WSFH 1OMIA 3RK2C 2ZXEB 4JQ0D 2FYUE 1IC2A 1NU1G 3TGUD 2KS1B 1Q7YQ 3L75J 3H1KE 1NTZE 1NTMK 2PGDA 2KIKA 1G2CB 4PD4H 1PP9D 1JY2P 1HF9A 2V7QH 5AW2B 1ZP0C 4IFMA 1W5CE 4GOFA 1UIXA 4EOTA 3N4XA 4H13D 3AE4C 1LP1A 3FX0A 2HPCA 2KP8A 2QJPB 1IFIA 1L0LJ 1NWQA 3HTKB 2CK3H 4GIFA 3M9HA 3W68A 2YO3A 1RQVA 1S4XA 1RY3A 1HBWA 2PP6A 1DD3A 4RJTA 3H1LG 2V4HA 4N78D 2WPVB 2FFDA 2R3SA 1EXJA 3H1HD 4TT3H 3HRNA 2YKQA 1KQGB 2K37A 4ZNCA 2C9LY 3PHLA 3NXSA 2N1TA 1S3JA 4D6TE 3P8MC 2FYUG 4KT0J 1OW6A 1FU1A 3L36A 2OYIB 1H88A 3H1KG 1NTZG 2PFXA 2AEFA 1JO5A 3E1RA 3KDPB 2QG4A 3CWBD 1PZQA 1EDKA 2HPCB 3RK3B 1LWUB 2M3BA 1PV3A 5EFWB 2KLUA 3JSVC 1KC8Q 2BASA 1H0TA 1BSHA 3VP9A 3CXHH 5B5EH 1QGKB 2YO2A 2W8ZA 4RESB 2Y9YA 1Q81Q 1AV1A 2JR8A 2YIUC 1GTWA 1MFTA 3L70D 3L73E 2R5DA 3R2PA 5CCHC 1FZEA 2GUSA 1YI2P 1PL5A 2KYVA 5CBNA 2WZ7A 2ZJSE 2BCCJ 4D6TG 1SQVE 1OX3A 3V4QA 3G4SP 2XZRA 2HG5D 2DW3A 3RK3D 1KILE 1GL2C 3HUSC 1BGYJ 3B71A 3MHVA 3NMDA 5AW7B 1H0TB 3B5NA 2KXPB 2WT7A 3A2AA 1K73Q 2K9JB 5AVZB 3CCEP 1JCCA 3BCCE 2XNDH 1IFPA 1NU1J 1OIPA 1VDFA 5CJ4A 1OFCX 5GTHH 3S4RA 4JYBA 1NU1K 2QRXA 1SQPK 2N1TD 5E79H 3HD7C 2I1JA 2WSCJ 1J1EC 1L0NE 4L76A 2A06E 1KILC 1GD2E 2P7JA 4N6JA 5AVXB 5APVA 3A3YB 2WVRA 1SQQD 1MFZA 3KZIH 2I8DA 1CZQA 4HYTB 3KQGA 1FS0E 1NTME 2IBZE 3MZWB 1MZ9A 3JCUH 1BE3D 2WPRA 1SLQA 3H1LJ 1WRGA 1OXZA 5AW3B 2GA1A 5AW8B 1X22A 3HUSB 1IFNA 1J1DB 1X79B 1SP4A 3PJSK 3L74D 4ASWA 1RQUA 2IYOA 1VL2A 2QVAA 2NPSC 4D6TD 3T97A 3RGUA 4EYYQ 2QJYB 2P10A 2SPZA 4B86A 3BCCG 1AJYA 1JMBA 3K5BA 1N7SC 2FYUK 1LTJA 3H1KJ 1NTZJ 2IBZI 3V2NA 4IL6H 4WY4B 4OGQC 1J1EB 3CI9A 4Y99B 1VQ8P 1L0NG 3CCRP 3P7KA 2A06G 5KLIB 2NRGA 3E7KA 1RHZB 1HJBA 1GU4A 3OW2O 1LNQA 2D2CD 1URQB 2Y0EA 1SQXK 3VMYA 3B5ND 1DIPA 4N3YB 2JKVA 4PD4D 4WBAA 3H1JE 3CD6P 1NTMG 4I7ZB 3HE4A 2IBZG 3VMXA 4DT0A 1IFDA 1EDIA 1HTLC 1L4AA 2FYNC 3L72D 4AQRD 3OA7A 2WSCH 4H0LD 5CCGA 1NO4A 2C9NY 2B89A 3TYYA 3C9IA 5AVTB 1D7MA 1SFCA 1VF5D 2JP3A 1G1JA 2FXOA 4D6TJ 2AXCA 1FDMA 2KZIA 1QL1A 3GHGC 4C7NA 4YXWH 1QX8A 2ZT9C 3WU2E 4OGQB 1YJWP 5APQA 3TNUA 3PTZA 3OAKA 2HYNA 5AW6B 5AVYB 2E75D 1IFMA 4U7JA 1ZR4A 3I5CA 2WSFJ 3L4FA 2CPSA 5AW5B 1Q82Q 5TISH 1SS1A 4CPGA 1E79H 2LXCB 1T2KC 3P8CD 1L4AB 4KJMA 1NTKD 3KPEA 1Q2NA 2ITAA 1USDA 1M1JC 4BXLA 5KLVE 1JUNA 3CXHD 4MN4C 2B87A 1SQBK 1T8ZA 3B4SA 4DJGA 1GDTA 1VQ7P 5AVWB 5DJUB 3PH0A 1YIJP 3L75D 1SQPE 1FZAA 1PPJD 3AE1C 3BVHA 1VQ9P 2HLOA 1SQVK 1K05A 3OJAB 2KS1A 3AE6C 1P84E 3HE5B 1FOSF 1NHLA 4WVZA 2J5UA 1H89A 1G2CA 4O9BA 2ZVOB 1AFOA 2E42A 3L71E 5H2FE 4C46A 4C7RA 4K35A 2Y9ZA 5CCGD 2N9BA 3BCCJ 3Q1MA 2G3AA 1KQSO 1KB9D 1SFCD 2YKPA 3CCUP 2FYZA 2JWAA 4L75A 3D6ZA 1FZCB 3HTKA 5L8RJ 4W7ZA 1LGHB 3M91A 3CPWO 3CC4P 2HR3A 1L0NJ 3L35A 3I56P 2JO1A 1JCDA 1WMKA 3H1IE 3B8EB 4HH2A 5KLVG 3RL0D 1P84I 2KUBA 1FZFA 5M1BA 1X0TA 1VQPP 2OYOA 2IZ0A 5BU5A 2PAJA 1NTMJ 1NVOA 1SQPG 3LIDA 3G9RA 2K1AA 5CJ0A 2QSIA 1AQTA 4LLHA 3M0DA 2OYIA 4YXDC 1M1KQ 2WPQA 1FC2C 1M90Q 1RF1B 1S9KE 2XV5A 5AVVB 2WPSA 1SQXE 3L71G 2B88A 4H44B 4HJGH 3V2QA 1LWUA 1GU5A 1X9VA 4PV1D 3S1KA 1IK9A 1JB0J 3CCQP 3BASA 2XKMA 4ZKPA 3G71P 4WB4A 3CCJP 2A45I 1YJ9P 3H1IG 4RO0A 2C0WA 2E74C 5AVQB 4NPDA 1GZLA 4YPCA 3GLMA 2BCCD 3CC7P 3RK2B 1ZR2A 3MUDA 4WWIA 2M5AB 3KXDA 1DEEG 2BEQD 1HWTC 3EFFK 2N1TC 2POHA 3AE5C 1YTZI 1BGYD 2A45G 1NH4A 2YXQB 1KYOE 4H44D 5CBOA 5AW9B 1EDJA 4UB8E 1ZRTE 4RKUJ 4AUWA 1QVFO 4Y28J 1NU1D 2OGUA 1HH0A 1SQXG 3AE8C 2Q3EA 1NYHA 3U1AA 1OW7A 1NJIQ 2K9JA 2W6AA 4U3FE 3AEBC 1MV8A 3PLNA 3D70A 1YHQP 2QEXP 3BATA 1SQBE 2P2UA 1KYOI 1Z56A 3AECC 1QEXA 4AYCA 2N9YB 1RE4C 2R44A 5APYA 3V2PA 3Q3DA 3SFDC 3SFEC 3H1LD 1IK7A 3M0AA 2Y0CA 3W67A 1JM0A 5B66H 1EQ7A 5APWA 1U7JA 3CX5E 1GL2A 1GW3A 1VQKP 3II6A 3HUSA 4IL6X 2FYUD 2Q5UA 5KLVK 4R4MA 3FWLA 1YITP 2KOGA 3SWYA 3CCMP 2R32A 3B5NC 3H1KD 1SQPJ 1NTZD 2J58A 1YJNP 2H89C 4XFJA 3S9OA 1EC5A 4GDOA 4U3FG 5APUA 1GK6A 5KAIH 3R4YA 3I55P 1ZXGA 1VQNP 2QIWA 3VYIA 5AW4B 2H43A 2YIUB 3MTUE 2AXTE 1DX7A 4BRYB 2XU6A 1JEKA 1SQBG 4WY4A 1VF5C 1A02F 3AEDC 3L73G 3Q2YA 2M8RA 1KILA 3CX5I 1RE3A 3A0HE 2OTKE 1JY3O 1BCCE 2OYHC 3V2RA 2Q1KA 3TDKA 4JYCA 1URQA 1SQVG 2FBWC 1EZVE 5KKZC 1N2DC 1GL2B 3WU2H 3H1IJ 1FJPA 1M56D 2OTJP 2WQYC 3M06A 2WMMA 2K3RA 1IZNB 3ITKA 5CHXA 1T3UA 4UB6E 2E5TA 2FYUJ 3IFMA 1E5WA 2QJKC 2NZ2A 2G8YA 1GMJA 1EXIA 3Q5RA 3HD7B 5B66E 1N7SA 1SVFA 2KSJA 1L0LE 3MD0A 1KILB 2O3JA 4DOJA 1EZVI 1LTJC 2K9YA 2Z5IA 5K5GB 1LT9C 4HB1A 1WT6A 1SQXJ 1IFJA 1GL2D 1QL2A 4W80A 3TSIA 2YMKA 3JC22 1JY3N 1BCCG 4A7PA 5KAIE 3F89A 1A02J 2ZYAA 4BWNA 2JEEA 3L73D 2MJZA 3LW5J 3ABVC 2L91A 3RBXA 1P84H 1M7LA 3AE7C 2NPSB 1SQQK 1S72P 5H2FH 3TGUE 1AVOA 1SQVD 2YKOA 4WY4D 5APXA 1EDLA 3TK1A 1SFCC 3BRTB 2ZYGA 4XE5B 1KB9I 3SWKA 5GTIH 2P67A 2LKMA 1KILD 2QM8A 3BRVB 1N7SB 1N73C 3WUVA 1PP9E 4NPEA 1S1CX 4I1LA 2E76C 5AVSB 4LGDE 1DH3A 4K3AA 1OVUA 2OTLP 2M3EA 5KJ7A 1YTZT 1NAYA 1URQD 2KZJA 1LT9B 3H25A 1KQFB 3BCCD 3GF7A 2P58A 1LTSC 2WSEH 3AE2C 3HE5A 2FY8A 1JMMA 3FXEA 1ZOYC 3WUUA 1RF0A 3TF5A 3P32A 2IYPA 3AEEC 1T3JA 4U3FJ 1L0ND 2A06D 3H1JG 4N78E 2QE7H 1RH5B 4IOIH 2FYNB 1J2JB 4JPZB 2JJLA 2A45H 2E43A 3H32B 2RKLA 3H1HE 2Z4EA 1GW4A 1FZCA 1SQBJ 4YTPC 2XDJA 3L73J 4H13C 3GW6A 2WTYA 1QVGO 3O6QB 1N7SD 4EIJA 3FXDA 2WSSH 4I2LC 1NTMD 3IAOA 2IBZD 2GUVA 1XTCC 4OGQD 1JOCA 3TGUG 4PV1C 2HODB 1N73B 2WWWA 1SQVJ 3GHGB
chains in the Genus database with same CATH topology
3F89A 2ZVNB 4OWFA 2V4HA 4BWNA 3FX0A 3JSVC 2ZVOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F89 A;  2ZVN B;  4OWF A;  2V4H A;  4BWN A;  3FX0 A;  3JSV C;  2ZVO B; 
#chains in the Genus database with same CATH topology
 1PP9 G;  2ZT9 B;  3CWB E;  1FDI A;  3LW5 H;  1CI6 B;  3O8Z A;  1S5L H;  3AE3 C;  2H88 C;  2JWD A;  1L4A D;  1JTH B;  1LJ2 A;  1YYC A;  3A7O A;  1K8A Q;  1ZN5 A;  1RF1 A;  2KLV A;  5C39 A;  5GTI E;  3EWK A;  1KD1 Q;  1NKN A;  2RH0 A;  1HJ0 A;  1Y9B A;  3L70 E;  3PP5 A;  1M1J B;  4L74 A;  2QJP C;  2AEJ A;  3H1H G;  1KYO H;  1PGP A;  4H13 B;  3MP7 B;  1GK4 A;  1XTG B;  4UB8 H;  2W6B A;  5KJ7 D;  4QMA A;  3SSU A;  3H1J D;  3RK3 E;  1BCC J;  5AVU B;  2KSE A;  1NTK K;  4XA4 A;  2M5A A;  4GKG A;  2ZAE B;  3VN0 A;  3CWB G;  1KN7 A;  5KTB A;  2B9B A;  1T2K D;  2L5G B;  5CMZ A;  1UII A;  4OVN F;  2KNC B;  2Y0D A;  3M0D C;  2W83 C;  3V6I A;  3V4W A;  2OYI C;  4KHX A;  2VRS A;  1NOH A;  2W6J H;  1IO4 A;  3A5T A;  3IF4 A;  1FZB A;  2R5B A;  1W2B O;  3RK3 C;  1LWU C;  2ZFC A;  2LXB A;  2KB7 P;  2YMY A;  3L70 G;  1S5L E;  1SQQ E;  1VQO P;  3CX5 H;  1L0L K;  2Z5H A;  1PGQ A;  2FFD C;  1HGV A;  5TJH A;  1BE3 E;  3NFQ A;  1JY3 P;  3GMA A;  5KAF E;  1VQ6 P;  2O01 H;  3UIA A;  3H1J J;  3IN6 A;  3AEA C;  1W2E A;  3MUD C;  2W90 A;  4EI2 A;  3A0B E;  1KQL A;  3L74 E;  2Q9I A;  5KLV D;  1N86 A;  1FJK A;  1DD4 A;  2ZXX A;  2AXT H;  1R8E A;  3VOP A;  1LTB C;  3GG2 A;  1SQP D;  3QWO C;  3TGU J;  3D6Y A;  1HUC A;  3A0H H;  1LP1 B;  2MKV A;  1LTT C;  4DZO A;  1PP9 J;  2JDI H;  1P84 D;  3CME P;  3RK2 D;  3MGN A;  3L71 D;  1NKZ B;  1SQQ G;  2E74 B;  5AW0 B;  1YQ4 C;  4BRY A;  3ZDM A;  1JNM A;  4PD4 E;  2FFD B;  5CCH A;  2IFN A;  2Q7C A;  4M3L A;  3L72 E;  1RE4 A;  4UB6 H;  1BE3 G;  2QM7 A;  3CC2 P;  2N1T B;  2H7H A;  3H1I D;  4GOE A;  4IFF A;  3H1H J;  3L74 G;  1N8R Q;  2W27 A;  4IFD K;  3KYQ A;  1Q90 D;  5KLV J;  2FXM A;  4TLF A;  5APS A;  2M0B A;  2P1J A;  2D2C C;  1KB9 H;  1JY2 O;  1T6A A;  3USS A;  1KMI Z;  1J1D C;  3C1L A;  4PD4 I;  3H6P A;  1DEB A;  1U7M A;  2CPB A;  1MKM A;  3F5H A;  2GM4 A;  3CWB J;  2E74 D;  4GT1 A;  4H0L C;  4R4L A;  2QJY C;  2QA4 P;  2IFM A;  1YQ3 C;  1S9K D;  2H8P D;  1KOR A;  3HD7 A;  3NTN A;  1SQX D;  2K88 A;  1Y47 A;  3P8C E;  3L71 J;  2RMZ A;  1H8A A;  4WY4 C;  3EQ2 A;  2FXP A;  1NTK E;  2OQQ A;  4Y99 C;  5KLI C;  1QLE D;  3CL3 D;  2IZ1 A;  1RE3 C;  3L72 G;  3AEG C;  3VMZ A;  1Y8A A;  1MUU A;  2OYH A;  3L70 J;  3SWF A;  3CXH E;  5B5E E;  1URQ C;  3U1C A;  2E75 C;  1KTM A;  5APT A;  2E5Y A;  3VMA A;  2WSE J;  4I7Z C;  5BVZ A;  3L75 E;  1OVV A;  1NGM B;  2D2C B;  1X8Y A;  3VTP C;  1PPJ E;  2R3C A;  2NPS A;  3B5N B;  2XNX A;  2WT7 B;  3QH9 A;  1JY2 N;  1LTG C;  5CCH D;  1KYO D;  4DCK A;  1BDD A;  4H0L B;  4ZMD A;  1USE A;  3CLQ A;  1ZRT D;  3LIE A;  3RL0 g;  3AEF C;  1FDO A;  1VF5 B;  4HKZ H;  4PJ0 H;  3CXH I;  1FE6 A;  1FOS E;  1KB9 E;  1PGO A;  1LT9 A;  1ZME C;  3CMA P;  3E1I A;  4U3F D;  1IJD B;  2O1K A;  1KFN A;  1NTZ K;  2YXR B;  1LT1 A;  2OYH B;  1NTK G;  2IDB A;  3WMM 0;  3RBZ A;  2J59 M;  1G1I A;  5KKZ B;  1SQB D;  1BSN A;  1HVV A;  2ZYD A;  1EZV G;  1VQ4 P;  5GTH E;  2E75 B;  1VQ5 P;  1YBK A;  5AW1 B;  1SQQ J;  1L4A C;  5AVR B;  1R5L A;  5BU8 B;  1AA0 A;  1Q86 Q;  1KFM A;  3H32 A;  1K9M Q;  5E79 E;  2UWJ E;  2ZVN B;  5CCG C;  3G3Z A;  5DJT B;  4OH8 B;  1K04 A;  1R5S A;  2HFE D;  3L75 G;  3HD7 D;  4JF7 A;  1S2E A;  2FKW B;  2YNY A;  1S5L X;  3O6Q A;  1BE3 J;  1PPJ G;  3T97 B;  4OWF A;  2C0X A;  2QJK B;  4Z1M H;  3EFG A;  1OVR A;  3D71 A;  3FGA D;  3KZI E;  3CX5 D;  2HOD A;  3GF3 A;  3L74 J;  1N73 A;  3GHG A;  1LTJ B;  1L0L G;  1N7L A;  3JCU E;  3M9Q A;  1PIX A;  1U57 A;  1L2P A;  2Q6Q A;  2KI7 B;  2RN0 A;  3M9B A;  1FAV A;  3RL0 C;  1LTI C;  5KJ7 C;  1CI6 A;  4NPF X;  2O01 N;  1JTH A;  2KK7 A;  2I1K A;  3PRJ A;  1HGZ A;  3WUT A;  1RF0 C;  1ZW0 A;  2IX7 C;  3KHU A;  2NPS D;  1AQ5 A;  4LC1 A;  2WIT A;  3HE4 B;  2BCC E;  4PJ0 E;  1KZU B;  1M1J A;  1ZLL A;  3VP8 A;  1FZC C;  3IR9 A;  4IL6 E;  1VPC A;  1BCC D;  3AE9 C;  2V7Q J;  4I6M C;  1PGJ A;  1FZG A;  1M57 D;  1OWA A;  1SFC B;  2LR2 A;  3L72 J;  1BGY E;  1EZV D;  3U59 A;  4L73 A;  1KV4 A;  2E76 B;  3Q5P A;  3V5B A;  1CW5 A;  1M8O B;  4C7N B;  1NU1 E;  4ZKU A;  4ASV A;  2O1J A;  4JBZ A;  1ZV8 A;  4GOD A;  3N7N A;  1VQL P;  3TNU B;  3RL0 B;  1OW8 A;  1LTA C;  2OAR A;  1TU3 F;  3CCV P;  3C8V A;  2KNC A;  2O01 J;  3FWN A;  1AVY A;  1BDC A;  3CCL P;  3G6E P;  1PFI A;  2PRR A;  1NAF A;  5KAF H;  1RF1 C;  4EDF A;  1L0L D;  3Q5S A;  3CCS P;  4H44 C;  3A0B H;  2BEZ F;  2BCC G;  3H1L E;  3L37 A;  2E76 D;  2ZT9 D;  1FBM A;  2IPP A;  4W7Y A;  1VQM P;  1NTK J;  2B87 B;  1CSB A;  4PV1 B;  1BGY G;  1L0N K;  2AEM A;  2Q3I A;  3MIW A;  1OZH A;  5TIS E;  2WSF H;  1OMI A;  3RK2 C;  2ZXE B;  4JQ0 D;  2FYU E;  1IC2 A;  1NU1 G;  3TGU D;  2KS1 B;  1Q7Y Q;  3L75 J;  3H1K E;  1NTZ E;  1NTM K;  2PGD A;  2KIK A;  1G2C B;  4PD4 H;  1PP9 D;  1JY2 P;  1HF9 A;  2V7Q H;  5AW2 B;  1ZP0 C;  4IFM A;  1W5C E;  4GOF A;  1UIX A;  4EOT A;  3N4X A;  4H13 D;  3AE4 C;  1LP1 A;  3FX0 A;  2HPC A;  2KP8 A;  2QJP B;  1IFI A;  1L0L J;  1NWQ A;  3HTK B;  2CK3 H;  4GIF A;  3M9H A;  3W68 A;  2YO3 A;  1RQV A;  1S4X A;  1RY3 A;  1HBW A;  2PP6 A;  1DD3 A;  4RJT A;  3H1L G;  2V4H A;  4N78 D;  2WPV B;  2FFD A;  2R3S A;  1EXJ A;  3H1H D;  4TT3 H;  3HRN A;  2YKQ A;  1KQG B;  2K37 A;  4ZNC A;  2C9L Y;  3PHL A;  3NXS A;  2N1T A;  1S3J A;  4D6T E;  3P8M C;  2FYU G;  4KT0 J;  1OW6 A;  1FU1 A;  3L36 A;  2OYI B;  1H88 A;  3H1K G;  1NTZ G;  2PFX A;  2AEF A;  1JO5 A;  3E1R A;  3KDP B;  2QG4 A;  3CWB D;  1PZQ A;  1EDK A;  2HPC B;  3RK3 B;  1LWU B;  2M3B A;  1PV3 A;  5EFW B;  2KLU A;  3JSV C;  1KC8 Q;  2BAS A;  1H0T A;  1BSH A;  3VP9 A;  3CXH H;  5B5E H;  1QGK B;  2YO2 A;  2W8Z A;  4RES B;  2Y9Y A;  1Q81 Q;  1AV1 A;  2JR8 A;  2YIU C;  1GTW A;  1MFT A;  3L70 D;  3L73 E;  2R5D A;  3R2P A;  5CCH C;  1FZE A;  2GUS A;  1YI2 P;  1PL5 A;  2KYV A;  5CBN A;  2WZ7 A;  2ZJS E;  2BCC J;  4D6T G;  1SQV E;  1OX3 A;  3V4Q A;  3G4S P;  2XZR A;  2HG5 D;  2DW3 A;  3RK3 D;  1KIL E;  1GL2 C;  3HUS C;  1BGY J;  3B71 A;  3MHV A;  3NMD A;  5AW7 B;  1H0T B;  3B5N A;  2KXP B;  2WT7 A;  3A2A A;  1K73 Q;  2K9J B;  5AVZ B;  3CCE P;  1JCC A;  3BCC E;  2XND H;  1IFP A;  1NU1 J;  1OIP A;  1VDF A;  5CJ4 A;  1OFC X;  5GTH H;  3S4R A;  4JYB A;  1NU1 K;  2QRX A;  1SQP K;  2N1T D;  5E79 H;  3HD7 C;  2I1J A;  2WSC J;  1J1E C;  1L0N E;  4L76 A;  2A06 E;  1KIL C;  1GD2 E;  2P7J A;  4N6J A;  5AVX B;  5APV A;  3A3Y B;  2WVR A;  1SQQ D;  1MFZ A;  3KZI H;  2I8D A;  1CZQ A;  4HYT B;  3KQG A;  1FS0 E;  1NTM E;  2IBZ E;  3MZW B;  1MZ9 A;  3JCU H;  1BE3 D;  2WPR A;  1SLQ A;  3H1L J;  1WRG A;  1OXZ A;  5AW3 B;  2GA1 A;  5AW8 B;  1X22 A;  3HUS B;  1IFN A;  1J1D B;  1X79 B;  1SP4 A;  3PJS K;  3L74 D;  4ASW A;  1RQU A;  2IYO A;  1VL2 A;  2QVA A;  2NPS C;  4D6T D;  3T97 A;  3RGU A;  4EYY Q;  2QJY B;  2P10 A;  2SPZ A;  4B86 A;  3BCC G;  1AJY A;  1JMB A;  3K5B A;  1N7S C;  2FYU K;  1LTJ A;  3H1K J;  1NTZ J;  2IBZ I;  3V2N A;  4IL6 H;  4WY4 B;  4OGQ C;  1J1E B;  3CI9 A;  4Y99 B;  1VQ8 P;  1L0N G;  3CCR P;  3P7K A;  2A06 G;  5KLI B;  2NRG A;  3E7K A;  1RHZ B;  1HJB A;  1GU4 A;  3OW2 O;  1LNQ A;  2D2C D;  1URQ B;  2Y0E A;  1SQX K;  3VMY A;  3B5N D;  1DIP A;  4N3Y B;  2JKV A;  4PD4 D;  4WBA A;  3H1J E;  3CD6 P;  1NTM G;  4I7Z B;  3HE4 A;  2IBZ G;  3VMX A;  4DT0 A;  1IFD A;  1EDI A;  1HTL C;  1L4A A;  2FYN C;  3L72 D;  4AQR D;  3OA7 A;  2WSC H;  4H0L D;  5CCG A;  1NO4 A;  2C9N Y;  2B89 A;  3TYY A;  3C9I A;  5AVT B;  1D7M A;  1SFC A;  1VF5 D;  2JP3 A;  1G1J A;  2FXO A;  4D6T J;  2AXC A;  1FDM A;  2KZI A;  1QL1 A;  3GHG C;  4C7N A;  4YXW H;  1QX8 A;  2ZT9 C;  3WU2 E;  4OGQ B;  1YJW P;  5APQ A;  3TNU A;  3PTZ A;  3OAK A;  2HYN A;  5AW6 B;  5AVY B;  2E75 D;  1IFM A;  4U7J A;  1ZR4 A;  3I5C A;  2WSF J;  3L4F A;  2CPS A;  5AW5 B;  1Q82 Q;  5TIS H;  1SS1 A;  4CPG A;  1E79 H;  2LXC B;  1T2K C;  3P8C D;  1L4A B;  4KJM A;  1NTK D;  3KPE A;  1Q2N A;  2ITA A;  1USD A;  1M1J C;  4BXL A;  5KLV E;  1JUN A;  3CXH D;  4MN4 C;  2B87 A;  1SQB K;  1T8Z A;  3B4S A;  4DJG A;  1GDT A;  1VQ7 P;  5AVW B;  5DJU B;  3PH0 A;  1YIJ P;  3L75 D;  1SQP E;  1FZA A;  1PPJ D;  3AE1 C;  3BVH A;  1VQ9 P;  2HLO A;  1SQV K;  1K05 A;  3OJA B;  2KS1 A;  3AE6 C;  1P84 E;  3HE5 B;  1FOS F;  1NHL A;  4WVZ A;  2J5U A;  1H89 A;  1G2C A;  4O9B A;  2ZVO B;  1AFO A;  2E42 A;  3L71 E;  5H2F E;  4C46 A;  4C7R A;  4K35 A;  2Y9Z A;  5CCG D;  2N9B A;  3BCC J;  3Q1M A;  2G3A A;  1KQS O;  1KB9 D;  1SFC D;  2YKP A;  3CCU P;  2FYZ A;  2JWA A;  4L75 A;  3D6Z A;  1FZC B;  3HTK A;  5L8R J;  4W7Z A;  1LGH B;  3M91 A;  3CPW O;  3CC4 P;  2HR3 A;  1L0N J;  3L35 A;  3I56 P;  2JO1 A;  1JCD A;  1WMK A;  3H1I E;  3B8E B;  4HH2 A;  5KLV G;  3RL0 D;  1P84 I;  2KUB A;  1FZF A;  5M1B A;  1X0T A;  1VQP P;  2OYO A;  2IZ0 A;  5BU5 A;  2PAJ A;  1NTM J;  1NVO A;  1SQP G;  3LID A;  3G9R A;  2K1A A;  5CJ0 A;  2QSI A;  1AQT A;  4LLH A;  3M0D A;  2OYI A;  4YXD C;  1M1K Q;  2WPQ A;  1FC2 C;  1M90 Q;  1RF1 B;  1S9K E;  2XV5 A;  5AVV B;  2WPS A;  1SQX E;  3L71 G;  2B88 A;  4H44 B;  4HJG H;  3V2Q A;  1LWU A;  1GU5 A;  1X9V A;  4PV1 D;  3S1K A;  1IK9 A;  1JB0 J;  3CCQ P;  3BAS A;  2XKM A;  4ZKP A;  3G71 P;  4WB4 A;  3CCJ P;  2A45 I;  1YJ9 P;  3H1I G;  4RO0 A;  2C0W A;  2E74 C;  5AVQ B;  4NPD A;  1GZL A;  4YPC A;  3GLM A;  2BCC D;  3CC7 P;  3RK2 B;  1ZR2 A;  3MUD A;  4WWI A;  2M5A B;  3KXD A;  1DEE G;  2BEQ D;  1HWT C;  3EFF K;  2N1T C;  2POH A;  3AE5 C;  1YTZ I;  1BGY D;  2A45 G;  1NH4 A;  2YXQ B;  1KYO E;  4H44 D;  5CBO A;  5AW9 B;  1EDJ A;  4UB8 E;  1ZRT E;  4RKU J;  4AUW A;  1QVF O;  4Y28 J;  1NU1 D;  2OGU A;  1HH0 A;  1SQX G;  3AE8 C;  2Q3E A;  1NYH A;  3U1A A;  1OW7 A;  1NJI Q;  2K9J A;  2W6A A;  4U3F E;  3AEB C;  1MV8 A;  3PLN A;  3D70 A;  1YHQ P;  2QEX P;  3BAT A;  1SQB E;  2P2U A;  1KYO I;  1Z56 A;  3AEC C;  1QEX A;  4AYC A;  2N9Y B;  1RE4 C;  2R44 A;  5APY A;  3V2P A;  3Q3D A;  3SFD C;  3SFE C;  3H1L D;  1IK7 A;  3M0A A;  2Y0C A;  3W67 A;  1JM0 A;  5B66 H;  1EQ7 A;  5APW A;  1U7J A;  3CX5 E;  1GL2 A;  1GW3 A;  1VQK P;  3II6 A;  3HUS A;  4IL6 X;  2FYU D;  2Q5U A;  5KLV K;  4R4M A;  3FWL A;  1YIT P;  2KOG A;  3SWY A;  3CCM P;  2R32 A;  3B5N C;  3H1K D;  1SQP J;  1NTZ D;  2J58 A;  1YJN P;  2H89 C;  4XFJ A;  3S9O A;  1EC5 A;  4GDO A;  4U3F G;  5APU A;  1GK6 A;  5KAI H;  3R4Y A;  3I55 P;  1ZXG A;  1VQN P;  2QIW A;  3VYI A;  5AW4 B;  2H43 A;  2YIU B;  3MTU E;  2AXT E;  1DX7 A;  4BRY B;  2XU6 A;  1JEK A;  1SQB G;  4WY4 A;  1VF5 C;  1A02 F;  3AED C;  3L73 G;  3Q2Y A;  2M8R A;  1KIL A;  3CX5 I;  1RE3 A;  3A0H E;  2OTK E;  1JY3 O;  1BCC E;  2OYH C;  3V2R A;  2Q1K A;  3TDK A;  4JYC A;  1URQ A;  1SQV G;  2FBW C;  1EZV E;  5KKZ C;  1N2D C;  1GL2 B;  3WU2 H;  3H1I J;  1FJP A;  1M56 D;  2OTJ P;  2WQY C;  3M06 A;  2WMM A;  2K3R A;  1IZN B;  3ITK A;  5CHX A;  1T3U A;  4UB6 E;  2E5T A;  2FYU J;  3IFM A;  1E5W A;  2QJK C;  2NZ2 A;  2G8Y A;  1GMJ A;  1EXI A;  3Q5R A;  3HD7 B;  5B66 E;  1N7S A;  1SVF A;  2KSJ A;  1L0L E;  3MD0 A;  1KIL B;  2O3J A;  4DOJ A;  1EZV I;  1LTJ C;  2K9Y A;  2Z5I A;  5K5G B;  1LT9 C;  4HB1 A;  1WT6 A;  1SQX J;  1IFJ A;  1GL2 D;  1QL2 A;  4W80 A;  3TSI A;  2YMK A;  3JC2 2;  1JY3 N;  1BCC G;  4A7P A;  5KAI E;  3F89 A;  1A02 J;  2ZYA A;  4BWN A;  2JEE A;  3L73 D;  2MJZ A;  3LW5 J;  3ABV C;  2L91 A;  3RBX A;  1P84 H;  1M7L A;  3AE7 C;  2NPS B;  1SQQ K;  1S72 P;  5H2F H;  3TGU E;  1AVO A;  1SQV D;  2YKO A;  4WY4 D;  5APX A;  1EDL A;  3TK1 A;  1SFC C;  3BRT B;  2ZYG A;  4XE5 B;  1KB9 I;  3SWK A;  5GTI H;  2P67 A;  2LKM A;  1KIL D;  2QM8 A;  3BRV B;  1N7S B;  1N73 C;  3WUV A;  1PP9 E;  4NPE A;  1S1C X;  4I1L A;  2E76 C;  5AVS B;  4LGD E;  1DH3 A;  4K3A A;  1OVU A;  2OTL P;  2M3E A;  5KJ7 A;  1YTZ T;  1NAY A;  1URQ D;  2KZJ A;  1LT9 B;  3H25 A;  1KQF B;  3BCC D;  3GF7 A;  2P58 A;  1LTS C;  2WSE H;  3AE2 C;  3HE5 A;  2FY8 A;  1JMM A;  3FXE A;  1ZOY C;  3WUU A;  1RF0 A;  3TF5 A;  3P32 A;  2IYP A;  3AEE C;  1T3J A;  4U3F J;  1L0N D;  2A06 D;  3H1J G;  4N78 E;  2QE7 H;  1RH5 B;  4IOI H;  2FYN B;  1J2J B;  4JPZ B;  2JJL A;  2A45 H;  2E43 A;  3H32 B;  2RKL A;  3H1H E;  2Z4E A;  1GW4 A;  1FZC A;  1SQB J;  4YTP C;  2XDJ A;  3L73 J;  4H13 C;  3GW6 A;  2WTY A;  1QVG O;  3O6Q B;  1N7S D;  4EIJ A;  3FXD A;  2WSS H;  4I2L C;  1NTM D;  3IAO A;  2IBZ D;  2GUV A;  1XTC C;  4OGQ D;  1JOC A;  3TGU G;  4PV1 C;  2HOD B;  1N73 B;  2WWW A;  1SQV J;  3GHG B; 
#chains in the Genus database with same CATH homology
 3F89 A;  2ZVN B;  4OWF A;  2V4H A;  4BWN A;  3FX0 A;  3JSV C;  2ZVO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...