4OWFA

Crystal structure of the nemo cozi in complex with hoip nzf1 domain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
83
structure length
83
Chain Sequence
QLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NF-kappa-B essential modulator
publication title Mechanism Underlying I kappa B Kinase Activation Mediated by the Linear Ubiquitin Chain Assembly Complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/protein binding
total genus 38
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.990 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Nemo cc2-lz domain - 1d5 darpin complex 4owfA00
4OWFA 4BWNA 3JSVC 3F89A 3FX0A 2ZVNB 2V4HA 2ZVOB
chains in the Genus database with same CATH superfamily
3RGUA 1M57D 3JSVC 3C9IA 3CCMP 1IFPA 4ASWA 1NTMK 1KC8Q 3BRTB 2W27A 1NTZJ 2HLOA 2W83C 3OA7A 4WWIA 3E7KA 3USSA 3KHUA 4AYCA 1HBWA 3VN0A 3CXHH 1LWUC 3EWKA 1L4AD 2KI7B 2E76B 1YTZT 2CPBA 5KLVK 3CXHE 5AVUB 3RK3D 1FOSF 4AQRD 1P84H 3GHGA 3L70G 4IL6H 3S9OA 5CBNA 3L72D 1LT1A 2ZXEB 1LT9B 1HVVA 4IOIH 4W80A 1P84E 1NVOA 4IL6E 3D71A 4D6TD 1CZQA 5AVRB 2OARA 1EZVE 1IK7A 1VQ6P 1CSBA 2GM4A 4WVZA 2FXOA 2ZT9C 3GLMA 1N7SA 3H1IE 1EC5A 1JY2O 1RE3A 4JF7A 3OJAB 1ZOYC 5CCHC 1FJPA 1JY3P 4KHXA 2QRXA 3CMAP 5GTHE 1KFNA 5AVWB 2O01N 2WSEJ 1X8YA 3M9BA 3RK2C 4WY4B 1NTMJ 1J1DB 2NZ2A 4NPFX 3KQGA 1XTGB 3B71A 1EDLA 2KS1B 3CLQA 4B86A 1ZP0C 1E5WA 2XU6A 1Q81Q 1N7SD 2YNYA 3MHVA 1YHQP 5DJTB 1W2EA 2E75B 2I1KA 3MZWB 1VQ8P 1L0ND 2KLUA 1GDTA 3C8VA 3L70E 1SQPD 2WSFH 4Y28J 3TNUA 1A02F 5KLVJ 1NO4A 2IX7C 3CWBJ 1MKMA 1RE4C 1KYOE 2O3JA 1UIIA 2XNXA 1G2CB 4H13D 1YYCA 3SFEC 4H44C 1GL2B 2GA1A 2Q5UA 1FS0E 1KORA 1OW7A 4UB6H 2KUBA 1YTZI 2YIUB 3S1KA 2K1AA 2Y0EA 1LTJC 3KYQA 5CMZA 4UB6E 4I2LC 2KXPB 1EXJA 3L72G 1OFCX 1WRGA 1SQXG 3MUDC 4JYBA 3AEFC 4ASVA 4D6TG 3W68A 2A45G 2HODB 4R4MA 2NPSA 1KB9H 3BCCJ 1K05A 4XE5B 4GOEA 1BGYG 1EDIA 2IBZD 1SQVD 2ITAA 4ZMDA 3N4XA 3HD7B 1NYHA 1MZ9A 4YPCA 2XZRA 3BVHA 1LTIC 2C0XA 3H32B 1LTAC 2BEQD 1VQ5P 3TGUJ 1L4AB 2O1KA 4N78E 3NFQA 5KLVD 3AE6C 2OYOA 1S5LH 3CWBD 1H0TB 1PP9J 3AEGC 3H6PA 3RK3B 1NH4A 2QVAA 1R5LA 1FZCB 5APVA 2NPSD 2WQYC 3CCRP 1YITP 3E1IA 1FDOA 1YJWP 1NTZG 1OZHA 3CX5I 1FZAA 3VYIA 2AEFA 1HTLC 1XTCC 2O01H 4ZKUA 4KT0J 3CXHD 2IFMA 2Q7CA 2ZFCA 1LT9A 3B4SA 1A02J 3A3YB 2A06D 2JJLA 1OVRA 3R2PA 1KQSO 4MN4C 1JY2P 1H89A 1NOHA 1T3UA 3EFGA 5C39A 2ZAEB 3V4QA 1L0NG 4PD4D 1SQPG 2POHA 2Q6QA 5BU5A 2XNDH 1FBMA 1SQXE 2A45H 2FYZA 3GHGB 2H8PD 5AVXB 3WU2H 4D6TE 3D70A 1GTWA 5KAFH 1IFJA 2IPPA 1LGHB 3CI9A 4U7JA 1J1EB 3HUSC 1BGYE 2HPCA 3WU2E 5TISH 2QJYC 1OW6A 4PV1B 1PGJA 1JUNA 2JDIH 2FYNB 5CCHA 1KTMA 3LIEA 1FZFA 4CPGA 3CCUP 3L4FA 5TISE 1X22A 2XDJA 1VQNP 2BCCJ 2Q9IA 4N3YB 1DD4A 3S4RA 1N7SB 1M90Q 3L71J 1KQFB 2Y0DA 4TLFA 3KZIH 3F5HA 1RQVA 3CCEP 1N86A 1NTZE 1NTMG 2SPZA 3U59A 4C7NB 3AE8C 5CCHD 2VRSA 1SQVG 4U3FJ 3L70D 1BSHA 2E74B 2P10A 2W90A 4LLHA 1BCCJ 1DH3A 2CK3H 2FY8A 1KYOD 1L0NE 3RK2D 4DZOA 5K5GB 3CCQP 4KJMA 2E43A 1N73C 2KB7P 5KLVG 1T2KC 3CWBG 3FXDA 2OYHC 3H1LD 1FJKA 2RN0A 1MFZA 3E1RA 4YXWH 1HGZA 3A5TA 3QH9A 5APTA 1PV3A 1ZN5A 1VQLP 2OYIC 2NRGA 1TU3F 2KZIA 3IR9A 2E5YA 2R44A 3IFMA 2A06G 4AUWA 3GMAA 3PHLA 3MUDA 1PGQA 1KMIZ 3FGAD 3MTUE 1R5SA 1R8EA 2BCCD 2FYUK 2HODA 2WSEH 1VL2A 2AXTH 4DOJA 1JCDA 1M1JC 3A7OA 1PZQA 1YJNP 1K9MQ 3HD7A 3O8ZA 3H1KJ 2YKPA 3WMM0 4TT3H 2R5DA 3TDKA 3O6QB 1NTME 3H1HJ 1OW8A 2WMMA 4H0LC 4N6JA 1SQVE 2NPSB 3OW2O 5KJ7C 4N78D 1Q90D 1FZCA 1AQ5A 3Q1MA 3FXEA 2YO3A 2V7QH 2KYVA 5KKZC 1IFDA 5DJUB 5KLVE 3AEBC 1FZGA 1NU1K 2WSCJ 3AE3C 3NXSA 3TGUG 3CWBE 3L74D 3HD7D 4Y99C 1QEXA 2Y9ZA 1EDJA 2UWJE 3B5NC 2R5BA 1YI2P 1PP9G 2CPSA 1Y47A 2V4HA 1U7JA 1OVVA 1IFMA 1NHLA 3OAKA 1LWUB 3A2AA 1QL1A 3FWLA 1VF5C 1VQ7P 3ZDMA 1VQOP 2K88A 2A06E 1S9KE 1SQBK 4PD4H 3GF7A 1J2JB 3C1LA 1YJ9P 3H1JD 1SS1A 1SQXD 3I5CA 3M9QA 1KD1Q 3G4SP 4PD4E 3V6IA 2FYUJ 1ZW0A 2M3EA 2I1JA 1BGYD 1HJ0A 3H1LG 1DEBA 3P8MC 3RBXA 5CBOA 3VMYA 2WPQA 1YQ3C 3MP7B 2W6JH 3PP5A 2BASA 2P67A 3G6EP 1L0LK 2W8ZA 2ZT9B 1DX7A 3SWFA 2Y0CA 5GTHH 2C9LY 2HPCB 4OGQC 1G1IA 2KNCA 3F89A 1IJDB 3PRJA 2D2CC 4M3LA 2Q3IA 4W7YA 1BE3J 2BCCG 4L76A 1GK6A 2WPRA 2HR3A 3TGUE 4PV1D 2WZ7A 1JY2N 1EXIA 4C7NA 3L71G 1NTZD 4OVNF 1GMJA 1PP9E 3HRNA 2PFXA 3RK2B 1NU1J 3RL0C 5AVQB 3AE7C 1KB9I 2YMKA 4DJGA 2BEZF 1SQQK 1PPJE 2Q1KA 1SFCC 2W6AA 3PLNA 3QWOC 2J5UA 1KYOH 1N73A 3CX5D 2WPSA 1D7MA 2OYHA 1KZUB 1LP1B 4IFMA 1SQBJ 1VPCA 1JEKA 1Q86Q 2YO2A 4EDFA 2Z4EA 3VP8A 1FAVA 2IYOA 4BWNA 3L74G 3W67A 2E74D 2J58A 3H1LE 4O9BA 2O1JA 1USEA 1HF9A 5CHXA 1PFIA 1JMBA 2WTYA 3EFFK 3M91A 5CCGC 3TF5A 1T2KD 1GK4A 2PP6A 1LTJB 3BATA 1L0LJ 2JP3A 1M1JA 2C9NY 3GG2A 2XV5A 3H1JG 4EYYQ 4DCKA 1DIPA 2BCCE 3O6QA 2N1TC 1BE3D 5AW3B 1JNMA 3LW5H 3L71E 2FFDC 5APQA 1Q82Q 1NTMD 1WMKA 5AVSB 4JBZA 1Z56A 1JMMA 3ABVC 1PGPA 3H1KG 1GD2E 3Q5RA 2P2UA 3V2PA 2FKWB 5KJ7A 2YMYA 1MUUA 3Q2YA 1NWQA 1NTKK 1IZNB 1ZRTE 1SQQJ 2LKMA 2JKVA 3D6ZA 5AVZB 3SWKA 3H1IJ 5AW4B 4U3FE 3IAOA 1OX3A 3CCVP 2JEEA 1BCCE 3B5NA 1EDKA 1SQBD 2QSIA 3A0HH 4H0LD 1LWUA 3G71P 3L74E 1FE6A 2QJKC 3B8EB 3A0HE 3KDPB 2K9JA 5KJ7D 1GU4A 4R4LA 1KFMA 3MGNA 1S3JA 1ZR2A 3JC22 1WT6A 1S9KD 1VQMP 1QVFO 2YXQB 4I7ZC 1BSNA 3L36A 4IFDK 2KSJA 2QJPC 5AW8B 1LJ2A 2P7JA 4BRYB 3HE4A 3B5ND 4GIFA 1URQC 4WBAA 2ZYDA 3H1JE 1RF1C 4LGDE 2H7HA 1ZMEC 1H8AA 2B88A 1CW5A 5AW2B 3L75J 1N2DC 2WSFJ 3R4YA 1VF5D 3M0AA 2FYUG 4GODA 3BCCD 1OVUA 4K3AA 3H1KE 3SFDC 3HUSB 3JCUE 2YKQA 2B87A 2WT7A 2QJYB 2AEJA 3VOPA 2I8DA 1E79H 1SQQD 2L91A 3CC4P 1NTKJ 1PL5A 5APSA 3KPEA 3TGUD 1PP9D 2KNCB 2ZT9D 1BE3G 4EIJA 1RQUA 4HKZH 2N9BA 1YBKA 1PPJD 4HB1A 4OGQD 2IBZI 5EFWB 4YTPC 2B89A 5BVZA 4JQ0D 1LP1A 4GT1A 3CX5H 1RE4A 4L73A 2RKLA 2E42A 4GKGA 2Q3EA 1T3JA 2IZ0A 3CX5E 4H13C 1RY3A 5KLIC 3RL0D 1M8OB 1N73B 3RL0g 1QX8A 5KAIH 3CCJP 1SQBG 5APWA 3V5BA 1AVOA 3TYYA 1Q7YQ 2OYHB 4GDOA 1JY3N 1LTGC 2R32A 2FYUE 5KAIE 5CCGA 2OTJP 2Y9YA 2G3AA 4OH8B 1MFTA 1LTJA 1ZV8A 3Q5PA 2IZ1A 2GUSA 3CXHI 2OYIB 2B9BA 4W7ZA 1OIPA 3V4WA 2OQQA 1L2PA 1KV4A 1KILC 1L0NK 2P58A 2N1TA 1JTHA 1NAYA 2K3RA 1P84I 2PAJA 1SQPK 2O01J 4H44D 3AE4C 4GOFA 1L0LG 2AEMA 3P32A 2IDBA 3L71D 1EZVI 1YQ4C 2YXRB 3L72J 1BE3E 1M1JB 5CCGD 1BDCA 2H88C 2QIWA 5AVVB 2WVRA 1W5CE 2HFED 3G3ZA 1NU1E 3BCCG 1ZRTD 2KZJA 2ZVNB 3KXDA 4H0LB 3M06A 5CJ4A 4C7RA 2N1TD 4U3FD 5L8RJ 3EQ2A 1NKNA 2FBWC 1QL2A 1BCCD 1SQQG 2IYPA 2OTKE 1HJBA 2R3SA 1FDMA 4XA4A 4HYTB 2M5AB 5KKZB 5TJHA 4WB4A 3CCSP 1SQBE 4Y99B 1S2EA 1DEEG 3PTZA 3WUVA 3B5NB 3HTKA 3P8CD 4QMAA 1LTTC 1T8ZA 1KQGB 1PPJG 4BRYA 5APXA 2ZVOB 1SQVK 3VMXA 1OMIA 2H43A 1FOSE 4BXLA 1URQA 1NJIQ 1VF5B 3U1AA 2K9JB 1RF1A 2E76C 1KYOI 1Q2NA 3CC2P 3AE9C 1JB0J 1L0LE 1L0NJ 2KIKA 2KK7A 1FDIA 2QE7H 4EI2A 3U1CA 1SQPJ 3HUSA 2R3CA 3HE4B 1LT9C 3L73J 3H1KD 5B66H 3L75G 3H1HD 1U7MA 3BCCE 5B66E 1URQD 5AW9B 3M9HA 2YKOA 1PIXA 2LXBA 4RKUJ 3VMAA 1NGMB 3H25A 4OGQB 2QM8A 4C46A 2B87B 1SQQE 5AW1B 4L75A 2WT7B 1RH5B 3CMEP 3V2RA 3AE1C 2WPVB 2D2CB 5AVTB 1NTKG 1G1JA 2ZXXA 4PJ0H 2FXPA 1RHZB 1JM0A 1U57A 5M1BA 1AVYA 4PJ0E 3CL3D 3RL0B 4WY4C 1J1DC 3CPWO 1QGKB 1SFCB 3P7KA 4NPEA 1X79B 1N8RQ 1S4XA 1IFIA 3MIWA 1SQVJ 2M3BA 3IN6A 3VP9A 4U3FG 5AVYB 3SWYA 4YXDC 2E75C 1BCCG 1KQLA 3T97A 1AJYA 3NTNA 3WUUA 2FYUD 2H89C 1MV8A 5AW5B 2OYIA 3GW6A 3UIAA 3CCLP 2V7QJ 1N7LA 3L73D 3V2NA 3L75E 4H44B 1OXZA 1KILA 1RF0C 1S1CX 4UB8H 3I55P 1GL2C 1AFOA 4I6MC 2KOGA 2E5TA 4ZNCA 4UB8E 5AW6B 2WWWA 4A7PA 2JWAA 2YIUC 3Q3DA 3VMZA 2PRRA 3FWNA 4NPDA 1NTKE 2N1TB 4IL6X 3ITKA 2A45I 4RJTA 1JTHB 1ZLLA 1GZLA 3CC7P 2MJZA 2FFDB 1GW3A 1VDFA 2OTLP 1NU1D 2WSSH 4LC1A 1K04A 3TSIA 3HE5A 2RH0A 1KILD 2MKVA 5E79H 3TK1A 3M0DC 3H1HG 1VQPP 1CI6A 4HJGH 5E79E 2M5AA 1ZXGA 3HD7C 1PGOA 4JPZB 1IC2A 4L74A 1KB9E 1EQ7A 1GU5A 1FU1A 4EOTA 2IFNA 3CD6P 1OWAA 1UIXA 2WITA 1X9VA 2KP8A 1L4AC 2JO1A 5APUA 3AE5C 2C0WA 3AEDC 2QJKB 2Z5HA 1GW4A 3RK3C 3MD0A 1FZCC 3BASA 3P8CE 5B5EH 1DD3A 3Q5SA 1S5LE 3HTKB 2AXCA 1H88A 2QG4A 2Z5IA 4I7ZB 5B5EE 1JCCA 5AW0B 1K8AQ 2QJPB 1W2BO 1L0LD 4HH2A 1T6AA 3SSUA 5H2FH 1HWTC 4IFFA 1AV1A 3L70J 1URQB 2LXCB 1YIJP 2K37A 1RF1B 5H2FE 1LNQA 4DT0A 3RK3E 1VQ4P 1P84D 3JCUH 1USDA 1Y8AA 3WUTA 3L72E 3GHGC 5CJ0A 3GF3A 1LTBC 1FZEA 3RBZA 2LR2A 3H1LJ 2E76D 1EZVD 3L73G 3H1HE 3II6A 1J1EC 1BDDA 2L5GB 3V2QA 2OGUA 4PV1C 5KTBA 5KAFE 3H1ID 2FYNC 3L37A 1JOCA 1JO5A 1FC2C 1SQXK 2WSCH 3IF4A 3I56P 1ZR4A 2JR8A 1N7SC 4WY4A 1SFCA 1RE3C 5APYA 3N7NA 5BU8B 3A0BH 3AE2C 1AA0A 1HGVA 1NU1G 2KS1A 2DW3A 3L35A 3AEEC 2D2CD 3LW5J 3BRVB 3A0BE 2JWDA 3KZIE 1QVGO 1SVFA 2IBZG 2KSEA 2G8YA 2E74C 4H13B 1SP4A 5KLIB 1HH0A 4WY4D 1G2CA 1SFCD 1QLED 3NMDA 4JYCA 2P1JA 2J59M 2M8RA 2PGDA 1HUCA 1JY3O 3L75D 1M7LA 2XKMA 4I1LA 1NTZK 1SQPE 1RF0A 1IO4A 1S5LX 2KLVA 1GL2A 3T97B 3L74J 2QM7A 3L73E 5GTIH 3PH0A 3TNUB 3VTPC 1FZBA 1M1KQ 2ZYAA 4Z1MH 2E75D 2QA4P 5GTIE 1KN7A 1M56D 1KILB 1Y9BA 4PD4I 2ZJSE 2HG5D 2N9YB 1NTKD 5AW7B 2FFDA 3LIDA 1AQTA 3D6YA 1LTSC 2M0BA 3H1JJ 2FXMA 1SQXJ 1S72P 2K9YA 2W6BA 1GL2D 3M0DA 1NAFA 3AEAC 4D6TJ 4OWFA 1KILE 3K5BA 4RESB 1BGYJ 4RO0A 4ZKPA 1EZVG 4XFJA 1X0TA 3G9RA 2AXTE 1NKZB 2RMZA 3HE5B 2ZYGA 3AECC 1KB9D 1K73Q 1IK9A 1SLQA 2IBZE 2NPSC 3H32A 1IFNA 1L4AA 2QEXP 1VQKP 1CI6B 2GUVA 3H1IG 4K35A 1VQ9P 1H0TA 2HYNA 3PJSK 3FX0A
chains in the Genus database with same CATH topology
4OWFA 4BWNA 3JSVC 3F89A 3FX0A 2ZVNB 2V4HA 2ZVOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OWF A;  4BWN A;  3JSV C;  3F89 A;  3FX0 A;  2ZVN B;  2V4H A;  2ZVO B; 
#chains in the Genus database with same CATH topology
 3RGU A;  1M57 D;  3JSV C;  3C9I A;  3CCM P;  1IFP A;  4ASW A;  1NTM K;  1KC8 Q;  3BRT B;  2W27 A;  1NTZ J;  2HLO A;  2W83 C;  3OA7 A;  4WWI A;  3E7K A;  3USS A;  3KHU A;  4AYC A;  1HBW A;  3VN0 A;  3CXH H;  1LWU C;  3EWK A;  1L4A D;  2KI7 B;  2E76 B;  1YTZ T;  2CPB A;  5KLV K;  3CXH E;  5AVU B;  3RK3 D;  1FOS F;  4AQR D;  1P84 H;  3GHG A;  3L70 G;  4IL6 H;  3S9O A;  5CBN A;  3L72 D;  1LT1 A;  2ZXE B;  1LT9 B;  1HVV A;  4IOI H;  4W80 A;  1P84 E;  1NVO A;  4IL6 E;  3D71 A;  4D6T D;  1CZQ A;  5AVR B;  2OAR A;  1EZV E;  1IK7 A;  1VQ6 P;  1CSB A;  2GM4 A;  4WVZ A;  2FXO A;  2ZT9 C;  3GLM A;  1N7S A;  3H1I E;  1EC5 A;  1JY2 O;  1RE3 A;  4JF7 A;  3OJA B;  1ZOY C;  5CCH C;  1FJP A;  1JY3 P;  4KHX A;  2QRX A;  3CMA P;  5GTH E;  1KFN A;  5AVW B;  2O01 N;  2WSE J;  1X8Y A;  3M9B A;  3RK2 C;  4WY4 B;  1NTM J;  1J1D B;  2NZ2 A;  4NPF X;  3KQG A;  1XTG B;  3B71 A;  1EDL A;  2KS1 B;  3CLQ A;  4B86 A;  1ZP0 C;  1E5W A;  2XU6 A;  1Q81 Q;  1N7S D;  2YNY A;  3MHV A;  1YHQ P;  5DJT B;  1W2E A;  2E75 B;  2I1K A;  3MZW B;  1VQ8 P;  1L0N D;  2KLU A;  1GDT A;  3C8V A;  3L70 E;  1SQP D;  2WSF H;  4Y28 J;  3TNU A;  1A02 F;  5KLV J;  1NO4 A;  2IX7 C;  3CWB J;  1MKM A;  1RE4 C;  1KYO E;  2O3J A;  1UII A;  2XNX A;  1G2C B;  4H13 D;  1YYC A;  3SFE C;  4H44 C;  1GL2 B;  2GA1 A;  2Q5U A;  1FS0 E;  1KOR A;  1OW7 A;  4UB6 H;  2KUB A;  1YTZ I;  2YIU B;  3S1K A;  2K1A A;  2Y0E A;  1LTJ C;  3KYQ A;  5CMZ A;  4UB6 E;  4I2L C;  2KXP B;  1EXJ A;  3L72 G;  1OFC X;  1WRG A;  1SQX G;  3MUD C;  4JYB A;  3AEF C;  4ASV A;  4D6T G;  3W68 A;  2A45 G;  2HOD B;  4R4M A;  2NPS A;  1KB9 H;  3BCC J;  1K05 A;  4XE5 B;  4GOE A;  1BGY G;  1EDI A;  2IBZ D;  1SQV D;  2ITA A;  4ZMD A;  3N4X A;  3HD7 B;  1NYH A;  1MZ9 A;  4YPC A;  2XZR A;  3BVH A;  1LTI C;  2C0X A;  3H32 B;  1LTA C;  2BEQ D;  1VQ5 P;  3TGU J;  1L4A B;  2O1K A;  4N78 E;  3NFQ A;  5KLV D;  3AE6 C;  2OYO A;  1S5L H;  3CWB D;  1H0T B;  1PP9 J;  3AEG C;  3H6P A;  3RK3 B;  1NH4 A;  2QVA A;  1R5L A;  1FZC B;  5APV A;  2NPS D;  2WQY C;  3CCR P;  1YIT P;  3E1I A;  1FDO A;  1YJW P;  1NTZ G;  1OZH A;  3CX5 I;  1FZA A;  3VYI A;  2AEF A;  1HTL C;  1XTC C;  2O01 H;  4ZKU A;  4KT0 J;  3CXH D;  2IFM A;  2Q7C A;  2ZFC A;  1LT9 A;  3B4S A;  1A02 J;  3A3Y B;  2A06 D;  2JJL A;  1OVR A;  3R2P A;  1KQS O;  4MN4 C;  1JY2 P;  1H89 A;  1NOH A;  1T3U A;  3EFG A;  5C39 A;  2ZAE B;  3V4Q A;  1L0N G;  4PD4 D;  1SQP G;  2POH A;  2Q6Q A;  5BU5 A;  2XND H;  1FBM A;  1SQX E;  2A45 H;  2FYZ A;  3GHG B;  2H8P D;  5AVX B;  3WU2 H;  4D6T E;  3D70 A;  1GTW A;  5KAF H;  1IFJ A;  2IPP A;  1LGH B;  3CI9 A;  4U7J A;  1J1E B;  3HUS C;  1BGY E;  2HPC A;  3WU2 E;  5TIS H;  2QJY C;  1OW6 A;  4PV1 B;  1PGJ A;  1JUN A;  2JDI H;  2FYN B;  5CCH A;  1KTM A;  3LIE A;  1FZF A;  4CPG A;  3CCU P;  3L4F A;  5TIS E;  1X22 A;  2XDJ A;  1VQN P;  2BCC J;  2Q9I A;  4N3Y B;  1DD4 A;  3S4R A;  1N7S B;  1M90 Q;  3L71 J;  1KQF B;  2Y0D A;  4TLF A;  3KZI H;  3F5H A;  1RQV A;  3CCE P;  1N86 A;  1NTZ E;  1NTM G;  2SPZ A;  3U59 A;  4C7N B;  3AE8 C;  5CCH D;  2VRS A;  1SQV G;  4U3F J;  3L70 D;  1BSH A;  2E74 B;  2P10 A;  2W90 A;  4LLH A;  1BCC J;  1DH3 A;  2CK3 H;  2FY8 A;  1KYO D;  1L0N E;  3RK2 D;  4DZO A;  5K5G B;  3CCQ P;  4KJM A;  2E43 A;  1N73 C;  2KB7 P;  5KLV G;  1T2K C;  3CWB G;  3FXD A;  2OYH C;  3H1L D;  1FJK A;  2RN0 A;  1MFZ A;  3E1R A;  4YXW H;  1HGZ A;  3A5T A;  3QH9 A;  5APT A;  1PV3 A;  1ZN5 A;  1VQL P;  2OYI C;  2NRG A;  1TU3 F;  2KZI A;  3IR9 A;  2E5Y A;  2R44 A;  3IFM A;  2A06 G;  4AUW A;  3GMA A;  3PHL A;  3MUD A;  1PGQ A;  1KMI Z;  3FGA D;  3MTU E;  1R5S A;  1R8E A;  2BCC D;  2FYU K;  2HOD A;  2WSE H;  1VL2 A;  2AXT H;  4DOJ A;  1JCD A;  1M1J C;  3A7O A;  1PZQ A;  1YJN P;  1K9M Q;  3HD7 A;  3O8Z A;  3H1K J;  2YKP A;  3WMM 0;  4TT3 H;  2R5D A;  3TDK A;  3O6Q B;  1NTM E;  3H1H J;  1OW8 A;  2WMM A;  4H0L C;  4N6J A;  1SQV E;  2NPS B;  3OW2 O;  5KJ7 C;  4N78 D;  1Q90 D;  1FZC A;  1AQ5 A;  3Q1M A;  3FXE A;  2YO3 A;  2V7Q H;  2KYV A;  5KKZ C;  1IFD A;  5DJU B;  5KLV E;  3AEB C;  1FZG A;  1NU1 K;  2WSC J;  3AE3 C;  3NXS A;  3TGU G;  3CWB E;  3L74 D;  3HD7 D;  4Y99 C;  1QEX A;  2Y9Z A;  1EDJ A;  2UWJ E;  3B5N C;  2R5B A;  1YI2 P;  1PP9 G;  2CPS A;  1Y47 A;  2V4H A;  1U7J A;  1OVV A;  1IFM A;  1NHL A;  3OAK A;  1LWU B;  3A2A A;  1QL1 A;  3FWL A;  1VF5 C;  1VQ7 P;  3ZDM A;  1VQO P;  2K88 A;  2A06 E;  1S9K E;  1SQB K;  4PD4 H;  3GF7 A;  1J2J B;  3C1L A;  1YJ9 P;  3H1J D;  1SS1 A;  1SQX D;  3I5C A;  3M9Q A;  1KD1 Q;  3G4S P;  4PD4 E;  3V6I A;  2FYU J;  1ZW0 A;  2M3E A;  2I1J A;  1BGY D;  1HJ0 A;  3H1L G;  1DEB A;  3P8M C;  3RBX A;  5CBO A;  3VMY A;  2WPQ A;  1YQ3 C;  3MP7 B;  2W6J H;  3PP5 A;  2BAS A;  2P67 A;  3G6E P;  1L0L K;  2W8Z A;  2ZT9 B;  1DX7 A;  3SWF A;  2Y0C A;  5GTH H;  2C9L Y;  2HPC B;  4OGQ C;  1G1I A;  2KNC A;  3F89 A;  1IJD B;  3PRJ A;  2D2C C;  4M3L A;  2Q3I A;  4W7Y A;  1BE3 J;  2BCC G;  4L76 A;  1GK6 A;  2WPR A;  2HR3 A;  3TGU E;  4PV1 D;  2WZ7 A;  1JY2 N;  1EXI A;  4C7N A;  3L71 G;  1NTZ D;  4OVN F;  1GMJ A;  1PP9 E;  3HRN A;  2PFX A;  3RK2 B;  1NU1 J;  3RL0 C;  5AVQ B;  3AE7 C;  1KB9 I;  2YMK A;  4DJG A;  2BEZ F;  1SQQ K;  1PPJ E;  2Q1K A;  1SFC C;  2W6A A;  3PLN A;  3QWO C;  2J5U A;  1KYO H;  1N73 A;  3CX5 D;  2WPS A;  1D7M A;  2OYH A;  1KZU B;  1LP1 B;  4IFM A;  1SQB J;  1VPC A;  1JEK A;  1Q86 Q;  2YO2 A;  4EDF A;  2Z4E A;  3VP8 A;  1FAV A;  2IYO A;  4BWN A;  3L74 G;  3W67 A;  2E74 D;  2J58 A;  3H1L E;  4O9B A;  2O1J A;  1USE A;  1HF9 A;  5CHX A;  1PFI A;  1JMB A;  2WTY A;  3EFF K;  3M91 A;  5CCG C;  3TF5 A;  1T2K D;  1GK4 A;  2PP6 A;  1LTJ B;  3BAT A;  1L0L J;  2JP3 A;  1M1J A;  2C9N Y;  3GG2 A;  2XV5 A;  3H1J G;  4EYY Q;  4DCK A;  1DIP A;  2BCC E;  3O6Q A;  2N1T C;  1BE3 D;  5AW3 B;  1JNM A;  3LW5 H;  3L71 E;  2FFD C;  5APQ A;  1Q82 Q;  1NTM D;  1WMK A;  5AVS B;  4JBZ A;  1Z56 A;  1JMM A;  3ABV C;  1PGP A;  3H1K G;  1GD2 E;  3Q5R A;  2P2U A;  3V2P A;  2FKW B;  5KJ7 A;  2YMY A;  1MUU A;  3Q2Y A;  1NWQ A;  1NTK K;  1IZN B;  1ZRT E;  1SQQ J;  2LKM A;  2JKV A;  3D6Z A;  5AVZ B;  3SWK A;  3H1I J;  5AW4 B;  4U3F E;  3IAO A;  1OX3 A;  3CCV P;  2JEE A;  1BCC E;  3B5N A;  1EDK A;  1SQB D;  2QSI A;  3A0H H;  4H0L D;  1LWU A;  3G71 P;  3L74 E;  1FE6 A;  2QJK C;  3B8E B;  3A0H E;  3KDP B;  2K9J A;  5KJ7 D;  1GU4 A;  4R4L A;  1KFM A;  3MGN A;  1S3J A;  1ZR2 A;  3JC2 2;  1WT6 A;  1S9K D;  1VQM P;  1QVF O;  2YXQ B;  4I7Z C;  1BSN A;  3L36 A;  4IFD K;  2KSJ A;  2QJP C;  5AW8 B;  1LJ2 A;  2P7J A;  4BRY B;  3HE4 A;  3B5N D;  4GIF A;  1URQ C;  4WBA A;  2ZYD A;  3H1J E;  1RF1 C;  4LGD E;  2H7H A;  1ZME C;  1H8A A;  2B88 A;  1CW5 A;  5AW2 B;  3L75 J;  1N2D C;  2WSF J;  3R4Y A;  1VF5 D;  3M0A A;  2FYU G;  4GOD A;  3BCC D;  1OVU A;  4K3A A;  3H1K E;  3SFD C;  3HUS B;  3JCU E;  2YKQ A;  2B87 A;  2WT7 A;  2QJY B;  2AEJ A;  3VOP A;  2I8D A;  1E79 H;  1SQQ D;  2L91 A;  3CC4 P;  1NTK J;  1PL5 A;  5APS A;  3KPE A;  3TGU D;  1PP9 D;  2KNC B;  2ZT9 D;  1BE3 G;  4EIJ A;  1RQU A;  4HKZ H;  2N9B A;  1YBK A;  1PPJ D;  4HB1 A;  4OGQ D;  2IBZ I;  5EFW B;  4YTP C;  2B89 A;  5BVZ A;  4JQ0 D;  1LP1 A;  4GT1 A;  3CX5 H;  1RE4 A;  4L73 A;  2RKL A;  2E42 A;  4GKG A;  2Q3E A;  1T3J A;  2IZ0 A;  3CX5 E;  4H13 C;  1RY3 A;  5KLI C;  3RL0 D;  1M8O B;  1N73 B;  3RL0 g;  1QX8 A;  5KAI H;  3CCJ P;  1SQB G;  5APW A;  3V5B A;  1AVO A;  3TYY A;  1Q7Y Q;  2OYH B;  4GDO A;  1JY3 N;  1LTG C;  2R32 A;  2FYU E;  5KAI E;  5CCG A;  2OTJ P;  2Y9Y A;  2G3A A;  4OH8 B;  1MFT A;  1LTJ A;  1ZV8 A;  3Q5P A;  2IZ1 A;  2GUS A;  3CXH I;  2OYI B;  2B9B A;  4W7Z A;  1OIP A;  3V4W A;  2OQQ A;  1L2P A;  1KV4 A;  1KIL C;  1L0N K;  2P58 A;  2N1T A;  1JTH A;  1NAY A;  2K3R A;  1P84 I;  2PAJ A;  1SQP K;  2O01 J;  4H44 D;  3AE4 C;  4GOF A;  1L0L G;  2AEM A;  3P32 A;  2IDB A;  3L71 D;  1EZV I;  1YQ4 C;  2YXR B;  3L72 J;  1BE3 E;  1M1J B;  5CCG D;  1BDC A;  2H88 C;  2QIW A;  5AVV B;  2WVR A;  1W5C E;  2HFE D;  3G3Z A;  1NU1 E;  3BCC G;  1ZRT D;  2KZJ A;  2ZVN B;  3KXD A;  4H0L B;  3M06 A;  5CJ4 A;  4C7R A;  2N1T D;  4U3F D;  5L8R J;  3EQ2 A;  1NKN A;  2FBW C;  1QL2 A;  1BCC D;  1SQQ G;  2IYP A;  2OTK E;  1HJB A;  2R3S A;  1FDM A;  4XA4 A;  4HYT B;  2M5A B;  5KKZ B;  5TJH A;  4WB4 A;  3CCS P;  1SQB E;  4Y99 B;  1S2E A;  1DEE G;  3PTZ A;  3WUV A;  3B5N B;  3HTK A;  3P8C D;  4QMA A;  1LTT C;  1T8Z A;  1KQG B;  1PPJ G;  4BRY A;  5APX A;  2ZVO B;  1SQV K;  3VMX A;  1OMI A;  2H43 A;  1FOS E;  4BXL A;  1URQ A;  1NJI Q;  1VF5 B;  3U1A A;  2K9J B;  1RF1 A;  2E76 C;  1KYO I;  1Q2N A;  3CC2 P;  3AE9 C;  1JB0 J;  1L0L E;  1L0N J;  2KIK A;  2KK7 A;  1FDI A;  2QE7 H;  4EI2 A;  3U1C A;  1SQP J;  3HUS A;  2R3C A;  3HE4 B;  1LT9 C;  3L73 J;  3H1K D;  5B66 H;  3L75 G;  3H1H D;  1U7M A;  3BCC E;  5B66 E;  1URQ D;  5AW9 B;  3M9H A;  2YKO A;  1PIX A;  2LXB A;  4RKU J;  3VMA A;  1NGM B;  3H25 A;  4OGQ B;  2QM8 A;  4C46 A;  2B87 B;  1SQQ E;  5AW1 B;  4L75 A;  2WT7 B;  1RH5 B;  3CME P;  3V2R A;  3AE1 C;  2WPV B;  2D2C B;  5AVT B;  1NTK G;  1G1J A;  2ZXX A;  4PJ0 H;  2FXP A;  1RHZ B;  1JM0 A;  1U57 A;  5M1B A;  1AVY A;  4PJ0 E;  3CL3 D;  3RL0 B;  4WY4 C;  1J1D C;  3CPW O;  1QGK B;  1SFC B;  3P7K A;  4NPE A;  1X79 B;  1N8R Q;  1S4X A;  1IFI A;  3MIW A;  1SQV J;  2M3B A;  3IN6 A;  3VP9 A;  4U3F G;  5AVY B;  3SWY A;  4YXD C;  2E75 C;  1BCC G;  1KQL A;  3T97 A;  1AJY A;  3NTN A;  3WUU A;  2FYU D;  2H89 C;  1MV8 A;  5AW5 B;  2OYI A;  3GW6 A;  3UIA A;  3CCL P;  2V7Q J;  1N7L A;  3L73 D;  3V2N A;  3L75 E;  4H44 B;  1OXZ A;  1KIL A;  1RF0 C;  1S1C X;  4UB8 H;  3I55 P;  1GL2 C;  1AFO A;  4I6M C;  2KOG A;  2E5T A;  4ZNC A;  4UB8 E;  5AW6 B;  2WWW A;  4A7P A;  2JWA A;  2YIU C;  3Q3D A;  3VMZ A;  2PRR A;  3FWN A;  4NPD A;  1NTK E;  2N1T B;  4IL6 X;  3ITK A;  2A45 I;  4RJT A;  1JTH B;  1ZLL A;  1GZL A;  3CC7 P;  2MJZ A;  2FFD B;  1GW3 A;  1VDF A;  2OTL P;  1NU1 D;  2WSS H;  4LC1 A;  1K04 A;  3TSI A;  3HE5 A;  2RH0 A;  1KIL D;  2MKV A;  5E79 H;  3TK1 A;  3M0D C;  3H1H G;  1VQP P;  1CI6 A;  4HJG H;  5E79 E;  2M5A A;  1ZXG A;  3HD7 C;  1PGO A;  4JPZ B;  1IC2 A;  4L74 A;  1KB9 E;  1EQ7 A;  1GU5 A;  1FU1 A;  4EOT A;  2IFN A;  3CD6 P;  1OWA A;  1UIX A;  2WIT A;  1X9V A;  2KP8 A;  1L4A C;  2JO1 A;  5APU A;  3AE5 C;  2C0W A;  3AED C;  2QJK B;  2Z5H A;  1GW4 A;  3RK3 C;  3MD0 A;  1FZC C;  3BAS A;  3P8C E;  5B5E H;  1DD3 A;  3Q5S A;  1S5L E;  3HTK B;  2AXC A;  1H88 A;  2QG4 A;  2Z5I A;  4I7Z B;  5B5E E;  1JCC A;  5AW0 B;  1K8A Q;  2QJP B;  1W2B O;  1L0L D;  4HH2 A;  1T6A A;  3SSU A;  5H2F H;  1HWT C;  4IFF A;  1AV1 A;  3L70 J;  1URQ B;  2LXC B;  1YIJ P;  2K37 A;  1RF1 B;  5H2F E;  1LNQ A;  4DT0 A;  3RK3 E;  1VQ4 P;  1P84 D;  3JCU H;  1USD A;  1Y8A A;  3WUT A;  3L72 E;  3GHG C;  5CJ0 A;  3GF3 A;  1LTB C;  1FZE A;  3RBZ A;  2LR2 A;  3H1L J;  2E76 D;  1EZV D;  3L73 G;  3H1H E;  3II6 A;  1J1E C;  1BDD A;  2L5G B;  3V2Q A;  2OGU A;  4PV1 C;  5KTB A;  5KAF E;  3H1I D;  2FYN C;  3L37 A;  1JOC A;  1JO5 A;  1FC2 C;  1SQX K;  2WSC H;  3IF4 A;  3I56 P;  1ZR4 A;  2JR8 A;  1N7S C;  4WY4 A;  1SFC A;  1RE3 C;  5APY A;  3N7N A;  5BU8 B;  3A0B H;  3AE2 C;  1AA0 A;  1HGV A;  1NU1 G;  2KS1 A;  2DW3 A;  3L35 A;  3AEE C;  2D2C D;  3LW5 J;  3BRV B;  3A0B E;  2JWD A;  3KZI E;  1QVG O;  1SVF A;  2IBZ G;  2KSE A;  2G8Y A;  2E74 C;  4H13 B;  1SP4 A;  5KLI B;  1HH0 A;  4WY4 D;  1G2C A;  1SFC D;  1QLE D;  3NMD A;  4JYC A;  2P1J A;  2J59 M;  2M8R A;  2PGD A;  1HUC A;  1JY3 O;  3L75 D;  1M7L A;  2XKM A;  4I1L A;  1NTZ K;  1SQP E;  1RF0 A;  1IO4 A;  1S5L X;  2KLV A;  1GL2 A;  3T97 B;  3L74 J;  2QM7 A;  3L73 E;  5GTI H;  3PH0 A;  3TNU B;  3VTP C;  1FZB A;  1M1K Q;  2ZYA A;  4Z1M H;  2E75 D;  2QA4 P;  5GTI E;  1KN7 A;  1M56 D;  1KIL B;  1Y9B A;  4PD4 I;  2ZJS E;  2HG5 D;  2N9Y B;  1NTK D;  5AW7 B;  2FFD A;  3LID A;  1AQT A;  3D6Y A;  1LTS C;  2M0B A;  3H1J J;  2FXM A;  1SQX J;  1S72 P;  2K9Y A;  2W6B A;  1GL2 D;  3M0D A;  1NAF A;  3AEA C;  4D6T J;  4OWF A;  1KIL E;  3K5B A;  4RES B;  1BGY J;  4RO0 A;  4ZKP A;  1EZV G;  4XFJ A;  1X0T A;  3G9R A;  2AXT E;  1NKZ B;  2RMZ A;  3HE5 B;  2ZYG A;  3AEC C;  1KB9 D;  1K73 Q;  1IK9 A;  1SLQ A;  2IBZ E;  2NPS C;  3H32 A;  1IFN A;  1L4A A;  2QEX P;  1VQK P;  1CI6 B;  2GUV A;  3H1I G;  4K35 A;  1VQ9 P;  1H0T A;  2HYN A;  3PJS K;  3FX0 A; 
#chains in the Genus database with same CATH homology
 4OWF A;  4BWN A;  3JSV C;  3F89 A;  3FX0 A;  2ZVN B;  2V4H A;  2ZVO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...