3T97B

Molecular architecture of the transport channel of the nuclear pore complex: nup62/nup54
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
58
structure length
58
Chain Sequence
HMTKQHQTRLDIISEDISELQKNQTTTMAKIAQYKRKLMDLSHRTLQVLIKQEIQRKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear pore complex protein Nup54
publication title Molecular architecture of the transport channel of the nuclear pore complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
total genus 27
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2011-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3t97B00
3Q2YA 3D6ZA 3Q1MA 4R4MA 1EXJA 1DIPA 3T97B 1EXIA 3G9RA 3D70A 3Q3DA 3D6YA 3Q5PA 3Q5SA 3D71A 3Q5RA 3IAOA 4R4LA 2J5UA 2OQQA 1R8EA
chains in the Genus database with same CATH superfamily
1GK4A 3D6ZA 1KILD 3H1LE 4H0LB 2Y0CA 1R5LA 2FYUD 3CCMP 5TJHA 2OYIB 1JUNA 4U3FE 3E7KA 1SS1A 2ZYAA 3V2PA 2IBZD 4GOEA 2HLOA 1CI6B 4GDOA 3A7OA 5K5GB 1OFCX 1WRGA 5B5EE 1NTZE 3CCLP 3CCJP 1NU1G 1URQA 4K3AA 1QLED 4UB8H 2KS1B 1SQXK 1SFCA 3CXHD 1RE3C 2Q9IA 1FE6A 1BGYE 5AW3B 3L70G 4IL6X 3U1CA 1KB9H 1PL5A 3M06A 1S5LE 1T8ZA 1DH3A 1Q81Q 2Z5IA 1S72P 1NU1E 3CI9A 1LTBC 3OAKA 2I1JA 2Q1KA 1X79B 1KB9E 2W8ZA 1FZAA 1FZGA 2CK3H 3CX5D 3SWFA 1XTGB 1JTHA 1NWQA 2N1TC 3JSVC 3L73D 1GZLA 2NRGA 5H2FE 1IK7A 2ZT9D 2W6BA 3M9QA 3NXSA 1QL2A 1FDIA 3L70E 1TU3F 4YXWH 3G71P 3B71A 1WT6A 2BEQD 1FDMA 2AEMA 3EWKA 1IO4A 1MZ9A 3VP8A 3L71G 1FJKA 2PP6A 2FY8A 3G6EP 3CMAP 1VQ6P 3VMXA 2YNYA 2OYHB 1CI6A 4IL6H 1NTZD 1GL2C 1W5CE 2UWJE 3II6A 2JKVA 1L0NJ 1EC5A 1KILB 4IL6E 2C9LY 2NPSC 4YTPC 1IFDA 2KS1A 3WU2E 1JY2P 3Q5PA 3A5TA 1ZN5A 2ZYDA 3QH9A 2D2CC 3TGUG 1NH4A 3L75J 2J58A 1RQVA 1FAVA 1J2JB 1HJBA 1L0LJ 1NTMG 1KQFB 1NU1D 2P10A 2KUBA 2GUSA 4PV1C 5KKZC 2NZ2A 1Y8AA 1G1JA 4PJ0E 4KHXA 1S9KE 3USSA 3L70D 2YO3A 3D70A 3L72J 4I7ZC 3C8VA 2FXOA 3AEDC 2JWDA 1BDDA 5BVZA 3C9IA 2W90A 4WWIA 3RL0C 3WUUA 1EXJA 5DJUB 3TF5A 2JDIH 4ASVA 2OYHA 3EFGA 2JP3A 3GHGC 3BVHA 2E74C 2ZT9B 1K73Q 3CPWO 5AW7B 1VQ8P 4L74A 4N78D 2E75D 3L71D 3OA7A 3KHUA 5B66E 3BCCG 1HGZA 2KZIA 1KQGB 4I2LC 1HGVA 3H1LJ 1PZQA 1NTKK 1SQPK 1VQ4P 1QL1A 3VMAA 4U3FJ 2YKPA 2QM7A 3AEGC 2A06E 2WPVB 3BRVB 1ZMEC 3TYYA 5CJ4A 5CHXA 1BCCE 4JYCA 3H1IG 3NFQA 2YIUC 1S9KD 4ZMDA 2P67A 1R8EA 3TGUD 1FZFA 3MHVA 1L4AC 3L74E 5KLVE 2E5YA 1BGYJ 1NTMD 4PD4H 3CMEP 3LW5H 4HKZH 2W27A 1HUCA 5CCHC 2I8DA 3KPEA 1NKNA 2JWAA 1JY3O 3FXDA 3PH0A 3AE4C 4D6TE 3LIEA 3MTUE 1M1JC 4Y99B 1M90Q 3G3ZA 2XNXA 1LTTC 2QG4A 4H13D 2G3AA 5AVYB 4HH2A 3HRNA 1BDCA 2P58A 1M8OB 5GTIH 3K5BA 2FFDB 1BE3E 3CCSP 2M0BA 1PIXA 4W7YA 2R5DA 1LT1A 2FYNB 2FYUK 1AA0A 4GODA 1N7SD 4I6MC 1NTKE 2XKMA 3HE4A 2AXTH 3LIDA 3PTZA 2BCCE 2E75B 1FJPA 2XDJA 1Q2NA 1J1DC 3BCCD 1VF5C 3U59A 1GU5A 1LWUB 3M0DC 3RK3E 1KQSO 5KLVD 1DEEG 2PAJA 1T3JA 1RY3A 1SQXJ 1H0TB 4NPFX 2WITA 3ABVC 3L4FA 1VQNP 2WSCH 4PD4D 5AW8B 3EFFK 3H1ID 4EI2A 4OGQC 1IFMA 1EQ7A 2M3BA 1JY3P 1L0NG 2HODB 2M5AB 1KQLA 2O3JA 1E5WA 2WSEJ 1AFOA 2Q5UA 1K05A 1N7LA 2JO1A 2FBWC 2FFDA 2WSFH 1GU4A 3C1LA 3RK2C 1AJYA 1SQQG 2N1TD 1L0LG 4H13B 1KILE 1LNQA 2FYUE 5APSA 1M57D 3VTPC 1OVUA 3V5BA 3VMYA 1NTZK 3H1JG 3VMZA 1J1EB 2RKLA 3A0BH 1CZQA 2KP8A 3A2AA 3RK3D 5TISH 2B88A 1LWUA 1H89A 1RF0C 1GL2D 5CBNA 1N7SB 4QMAA 5TISE 2IZ1A 1H0TA 4N3YB 2B87B 1UIXA 2G8YA 2POHA 3BRTB 4OH8B 1S1CX 2QM8A 1NU1K 3CC2P 5KAIE 3OW2O 2Q3EA 1LTGC 1Z56A 2Q6QA 2FKWB 1YITP 1VQLP 2HODA 2M5AA 3H1HG 1OW6A 4RKUJ 3JC22 1VQPP 4PV1D 2OYOA 1N86A 1P84I 3L73E 1NYHA 2ITAA 3A0HH 3HTKB 1EDLA 3HUSB 2WPQA 1Q90D 2M3EA 1L0ND 1HTLC 4WVZA 3E1RA 5CBOA 4C7RA 4H44C 3A0HE 3H1HE 4D6TJ 1S2EA 2WQYC 1D7MA 5M1BA 1YQ4C 3RL0D 2KSJA 2JEEA 4U7JA 3V6IA 2N1TB 2V7QH 1LTAC 1SQQD 3GMAA 1L0LD 1L2PA 2YKOA 1N7SA 3E1IA 4JYBA 1DX7A 3EQ2A 3RGUA 1VL2A 1YHQP 3M91A 3H1JD 2B87A 4HJGH 1HF9A 4UB8E 1IZNB 1NTKJ 1SQPJ 2PGDA 1VQ5P 2Y0DA 2YXQB 3RK3B 2XZRA 2BCCJ 1GL2B 1PP9G 4ZKPA 3CCRP 2LKMA 4IFFA 4Z1MH 3V2QA 3P8MC 3V2NA 1QX8A 1K9MQ 1EZVI 1NTMK 3AE3C 3HTKA 3HUSA 1DD3A 1FS0E 2P2UA 1RE4A 1IC2A 5AW0B 2Y9YA 3FX0A 3H1HD 2ZJSE 2V4HA 1N8RQ 1L4AD 4LC1A 1PP9E 2WTYA 2OYIA 4B86A 3HD7D 4PV1B 1OVVA 1X22A 5CCHD 1VDFA 1FZCC 3S1KA 3H1KJ 2N1TA 1RF1C 3CWBG 1S3JA 2Z5HA 3A3YB 1IFNA 2KOGA 4I7ZB 4N78E 1OX3A 3TSIA 3L71E 2QJPB 2AXCA 1PFIA 3R4YA 3RL0B 3B5NC 3MZWB 2SPZA 4WBAA 5AVSB 2K3RA 3O6QB 3FXEA 2IFMA 2K9JB 3R2PA 3GHGB 3CCUP 2R32A 1PV3A 5EFWB 5KLIC 1GL2A 1AV1A 3PP5A 3AE6C 3GW6A 2K1AA 5BU8B 4R4MA 5KLVK 1G1IA 1KD1Q 3CX5I 4XA4A 5KTBA 3TGUE 2IYOA 3ZDMA 1M7LA 1VF5D 1SQBJ 1PPJG 1H8AA 2XU6A 5KAFH 1NTME 5CJ0A 4YXDC 1GW4A 2O01J 2DW3A 1PP9D 1NKZB 2QJKB 4CPGA 3NMDA 5APVA 2Y9ZA 1QVGO 3GF3A 3IF4A 5AW2B 3P8CD 5AVQB 1SQVJ 5AVWB 1LT9B 1WMKA 4XFJA 1KILA 3L73J 3MD0A 1L4AB 2R3SA 1GTWA 1Q86Q 4LLHA 3HD7B 3NTNA 1KFNA 1KZUB 3AE9C 3RK2D 2L5GB 2WPSA 4N6JA 5APYA 1Q82Q 3O6QA 1LTJC 2QEXP 2K9JA 3ITKA 2QJYC 3CWBD 3GHGA 2C0WA 1NTZJ 1NHLA 1HH0A 5CCGC 5KJ7C 1JY2N 1KB9I 3IN6A 1KC8Q 5AW5B 1FZEA 2BEZF 3BCCE 3WUTA 1GW3A 1T2KC 1X0TA 2MJZA 3VP9A 3V4WA 3P32A 3I5CA 2ZT9C 4MN4C 1IJDB 4Y28J 3OJAB 4UB6H 2AEJA 2WSSH 1IK9A 4TLFA 2PRRA 4PD4E 1NU1J 3M9HA 3H1IE 4JF7A 5AW6B 1U7MA 1J1DB 1VF5B 1LT9A 2OTJP 1JOCA 3KDPB 1PPJD 2HPCB 4R4LA 2H8PD 3MUDA 4WY4C 3L70J 1LTSC 4NPDA 1RHZB 1P84H 3HD7A 1SQPG 5GTIE 3AE8C 3Q3DA 5CCHA 4DZOA 3IR9A 3AEFC 2FYZA 4GT1A 1SVFA 2HYNA 3F5HA 3F89A 2QSIA 1OIPA 4H44D 1USEA 1FZBA 2QVAA 1SQQK 3MIWA 1KYOI 1L0LK 2AXTE 1AQTA 2QE7H 1ZXGA 5AVTB 1GDTA 3RK2B 2N9YB 3T97B 2PFXA 1N73C 2IDBA 1ZW0A 4IFDK 2KNCB 4I1LA 4DOJA 2WVRA 4WB4A 4DT0A 2YXRB 3H1KG 3RL0g 5AVZB 3G4SP 1EZVG 1JCDA 4W80A 2FYNC 1KN7A 3M0DA 4JBZA 2E76C 4EIJA 5E79H 2C0XA 1T3UA 3L75G 3RBZA 2HR3A 1P84D 2KLUA 4IFMA 1Q7YQ 1KORA 4TT3H 1L0NE 1FOSE 4M3LA 1OMIA 2AEFA 1IFJA 3Q5RA 3IAOA 4LGDE 1FBMA 3PLNA 2OARA 4GIFA 3CCEP 3FWNA 1LP1B 1ZLLA 1VQ7P 2CPBA 5AVVB 1SQPD 2K88A 3AE5C 3L72G 2YMYA 1SQBG 3D71A 1SQQE 1JO5A 1RH5B 3CC4P 3A0BE 1L0LE 1JB0J 2BASA 3L35A 2A45I 5APQA 2KB7P 3T97A 1XTCC 1YBKA 2RH0A 1QVFO 2KNCA 2NPSD 4H44B 3H1JE 2W6AA 4RO0A 1KTMA 1SQVG 5AW1B 3JCUH 1CW5A 1USDA 1U57A 2D2CD 1BCCJ 3B5ND 1K8AQ 1HBWA 5APXA 5AW9B 3TNUB 1PGPA 3JCUE 2IYPA 1YQ3C 3M9BA 3B8EB 4EYYQ 1OWAA 2YKQA 3L74J 1YTZI 3H1LG 2GA1A 5KLVJ 2QA4P 2OQQA 4U3FG 4NPEA 1DEBA 1OW8A 2K37A 2HG5D 3H1KD 1OVRA 2WZ7A 1VPCA 2KI7B 1S5LX 3SWYA 1EZVD 1URQC 3LW5J 4BWNA 3Q5SA 4ZNCA 1SFCC 4DCKA 1LP1A 4EDFA 3L75D 2ZYGA 5B5EH 2IX7C 3CCQP 1BE3J 1EXIA 1K04A 2B89A 2E74D 1BGYG 1X9VA 4W7ZA 2OGUA 1JCCA 2XV5A 1KV4A 3QWOC 2W6JH 4XE5B 1HWTC 1JMMA 2OTLP 3PRJA 1NO4A 1YI2P 1OZHA 3I56P 1U7JA 4ZKUA 1JY2O 1A02F 1PGQA 2Z4EA 3L72D 1S5LH 1SQBD 5CMZA 3AE1C 1FZCB 3CLQA 3HUSC 2KK7A 3KQGA 1RE4C 4K35A 3TNUA 1RF1B 3MGNA 3UIAA 1FDOA 4H0LC 1ZRTE 4KJMA 5GTHH 2NPSB 4C7NB 2OYIC 5CCGD 2O1JA 2C9NY 3PHLA 5KJ7D 3N4XA 1LGHB 1YTZT 1RE3A 3AE7C 1SQVD 2J59M 5H2FH 2XNDH 1BSNA 5GTHE 5DJTB 2D2CB 1SP4A 3AE2C 3B5NB 1T2KD 1LTIC 3VOPA 4HYTB 3SWKA 3P7KA 1ZV8A 5KLIB 5KKZB 2WSCJ 3KXDA 3H1LD 5AVUB 2J5UA 1UIIA 2IBZI 3P8CE 2Q7CA 1M1KQ 4U3FD 4KT0J 2JJLA 1DIPA 3TDKA 3H25A 1SQXG 4IOIH 3G9RA 3RK3C 1CSBA 1KMIZ 2Q3IA 2H7HA 2WSFJ 3WU2H 4WY4D 5BU5A 3VYIA 1FU1A 4O9BA 1FC2C 3CXHI 2FYUJ 4GKGA 2KSEA 2OTKE 2IZ0A 2R5BA 1EDKA 1GD2E 2E74B 4A7PA 3CWBE 1BGYD 2P7JA 1FZCA 5APTA 4BRYB 2FXMA 1SQXE 1RF1A 2MKVA 1ZRTD 1JM0A 4JQ0D 1MKMA 1SQQJ 1KYOH 2NPSA 2ZVOB 2WSEH 4PJ0H 4C7NA 2E42A 2KYVA 1X8YA 1GMJA 1KB9D 2OYHC 4HB1A 3B4SA 1KYOE 5APUA 3H1JJ 3BASA 1T6AA 1JEKA 3B5NA 3AECC 4JPZB 1KILC 1LTJB 4L75A 1YIJP 2QJYB 2O1KA 5KAFE 1E79H 1ZR2A 3W67A 2QJPC 3PJSK 2HFED 2YIUB 4RESB 1ZR4A 1VQMP 2O01N 1EDIA 4OGQD 2M8RA 3IFMA 3M0AA 1PPJE 3SFDC 1YJ9P 4OVNF 2H43A 3D6YA 2A06G 5AW4B 1W2EA 5B66H 2E76D 3H1HJ 3GLMA 2WT7B 1BCCG 1GK6A 2ZXEB 1ZOYC 1M1JB 3MP7B 1SQXD 2A45G 4BRYA 3L74G 5KLVG 3FWLA 3WUVA 1NJIQ 4WY4B 3SFEC 2QJKC 3CL3D 2L91A 3HE4B 3N7NA 2V7QJ 1OXZA 3GF7A 1KYOD 4DJGA 1W2BO 1OW7A 2A45H 1AVYA 4D6TG 3O8ZA 2JR8A 2E43A 1LT9C 1H88A 2B9BA 4EOTA 2QIWA 4GOFA 1LTJA 3MUDC 2WWWA 5L8RJ 2H89C 2H88C 5CCGA 2RN0A 4RJTA 4OWFA 3HD7C 1BE3G 1A02J 5KJ7A 1KFMA 4UB6E 2R3CA 2CPSA 4YPCA 4AQRD 3VN0A 1ZP0C 3KZIH 2ZXXA 5AVRB 3I55P 1L4AA 2WPRA 1JMBA 1NTKG 1YJWP 1N73B 3CCVP 3L36A 3KZIE 1L0NK 3H32B 3S4RA 1JNMA 2GM4A 2BCCG 2WT7A 1PP9J 1P84E 1MFZA 2RMZA 1QEXA 3FGAD 3GG2A 1NOHA 4OGQB 1M1JA 2IFNA 2LXBA 5APWA 1URQD 1NGMB 1LJ2A 2A06D 4WY4A 2E76B 1SQPE 1SFCD 3CD6P 3BATA 4Y99C 3L71J 1BCCD 2Y0EA 4BXLA 1YJNP 3AEAC 2I1KA 1NVOA 4ASWA 2VRSA 1HVVA 2YMKA 1QGKB 3H6PA 5AVXB 3KYQA 2KIKA 3L74D 4AYCA 5C39A 1AVOA 2FFDC 2K9YA 1SQBK 2W83C 3CWBJ 1G2CB 1BSHA 2KXPB 1SLQA 3V4QA 1N2DC 4D6TD 2HPCA 3TGUJ 4L76A 2P1JA 1VQOP 1SQVK 3Q1MA 1RQUA 1Y9BA 1FOSF 1N73A 2FYUG 4AUWA 4H0LD 1NTMJ 3HE5B 2E75C 3H32A 3H1KE 2IBZG 1BE3D 5E79E 1LWUC 3W68A 1VQ9P 1EZVE 1VQKP 3S9OA 2GUVA 2LXCB 4C46A 1YYCA 1MV8A 1NTKD 1Y47A 2E5TA 3RBXA 1M56D 2KZJA 1IFIA 3L75E 2BCCD 3TK1A 3L37A 2IBZE 1R5SA 3Q2YA 2IPPA 1NAFA 1MUUA 2N9BA 1MFTA 1IFPA 1URQB 3AEBC 3CXHH 2FXPA 2O01H 1SFCB 4PD4I 2QRXA 1G2CA 3WMM0 3SSUA 1DD4A 3L72E 1SQBE 3CXHE 5KAIH 3L73G 4H13C 3BCCJ 2LR2A 2KLVA 1RF0A 2ZAEB 2R44A 1HJ0A 2ZVNB 3CX5H 3AEEC 1J1EC 3HE5A 2WMMA 2ZFCA 1SQVE 1JY3N 1NAYA 3U1AA 3CX5E 1JTHB 1PGOA 4L73A 1AQ5A 1NTZG 3CC7P 3H1IJ 3V2RA 1S4XA 1N7SC 1EDJA 2YO2A 1PGJA
chains in the Genus database with same CATH topology
4RKUJ 1OW6A 4OGQC 3AE4C 3D6ZA 4OGQB 4Z1MH 3EWKA 4R4MA 1EXJA 1ZOYC 3T97B 2WSEJ 4H0LB 4H44B 2IDBA 2JP3A 4H13D 1K05A 2G3AA 2ZT9C 4PV1D 2E74C 2ZT9B 2E74B 1NGMB 1VF5D 2JO1A 2FBWC 1KTMA 3AE3C 4Y28J 1NYHA 4GDOA 3AE1C 1DD3A 2E76B 4YXDC 1U57A 2D2CD 2O01J 2MKVA 3SFEC 3Q2YA 2QJKC 1PIXA 1Q90D 3RL0g 1AJYA 1MKMA 1FDOA 2E75D 2V7QJ 4H0LC 1ZRTE 4H44C 4YTPC 3GF7A 1GMJA 3AEAC 2FYNC 4H13B 1OW7A 1YQ3C 3GF3A 4PV1B 1KQGB 1KILE 2WQYC 3AEBC 1VF5B 3Q5PA 2YMKA 2FXPA 3AE7C 2E76C 5M1BA 2QIWA 4R4LA 2OQQA 2D2CC 2K9YA 2D2CB 3AECC 1WMKA 4XFJA 1YQ4C 3AEGC 1DD4A 3AE2C 1OW8A 1RQVA 4U7JA 4IL6X 2WPVB 5L8RJ 2E75B 2H89C 2H88C 1PL5A 1S5LX 1KQFB 2P10A 4H13C 1ZMEC 3AE8C 3GMAA 3Q3DA 4PV1C 4I7ZB 5KKZC 1KORA 2NZ2A 4TT3H 1VF5C 2WSCJ 3LW5J 1OMIA 3Q5SA 1HJ0A 2QJPC 2YIUC 3Q5RA 3AE9C 3IAOA 3RK3E 1ZP0C 1VL2A 2J5UA 3AEFC 1R8EA 3AEEC 4OGQD 3Q1MA 3R4YA 1RQUA 3O6QA 1Y9BA 4KT0J 1HF9A 1DIPA 2G8YA 1UIXA 2QJYC 2QSIA 4H0LD 2E75C 3SFDC 3H25A 1S1CX 4H44D 1EXIA 1K04A 3G9RA 3D70A 1IK7A 1KMIZ 3ABVC 2ZT9D 3AE5C 1PV3A 2E74D 3C8VA 4I7ZC 5KLIC 3D6YA 1FDIA 3AEDC 1TU3F 3IN6A 3D71A 2WSFJ 3AE6C 2E76D 3B71A 2BEZF 3GLMA 1JB0J 2BEQD 3FGAD 3S9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q2Y A;  3D6Z A;  3Q1M A;  4R4M A;  1EXJ A;  1DIP A;  3T97 B;  1EXI A;  3G9R A;  3D70 A;  3Q3D A;  3D6Y A;  3Q5P A;  3Q5S A;  3D71 A;  3Q5R A;  3IAO A;  4R4L A;  2J5U A;  2OQQ A;  1R8E A; 
#chains in the Genus database with same CATH topology
 1GK4 A;  3D6Z A;  1KIL D;  3H1L E;  4H0L B;  2Y0C A;  1R5L A;  2FYU D;  3CCM P;  5TJH A;  2OYI B;  1JUN A;  4U3F E;  3E7K A;  1SS1 A;  2ZYA A;  3V2P A;  2IBZ D;  4GOE A;  2HLO A;  1CI6 B;  4GDO A;  3A7O A;  5K5G B;  1OFC X;  1WRG A;  5B5E E;  1NTZ E;  3CCL P;  3CCJ P;  1NU1 G;  1URQ A;  4K3A A;  1QLE D;  4UB8 H;  2KS1 B;  1SQX K;  1SFC A;  3CXH D;  1RE3 C;  2Q9I A;  1FE6 A;  1BGY E;  5AW3 B;  3L70 G;  4IL6 X;  3U1C A;  1KB9 H;  1PL5 A;  3M06 A;  1S5L E;  1T8Z A;  1DH3 A;  1Q81 Q;  2Z5I A;  1S72 P;  1NU1 E;  3CI9 A;  1LTB C;  3OAK A;  2I1J A;  2Q1K A;  1X79 B;  1KB9 E;  2W8Z A;  1FZA A;  1FZG A;  2CK3 H;  3CX5 D;  3SWF A;  1XTG B;  1JTH A;  1NWQ A;  2N1T C;  3JSV C;  3L73 D;  1GZL A;  2NRG A;  5H2F E;  1IK7 A;  2ZT9 D;  2W6B A;  3M9Q A;  3NXS A;  1QL2 A;  1FDI A;  3L70 E;  1TU3 F;  4YXW H;  3G71 P;  3B71 A;  1WT6 A;  2BEQ D;  1FDM A;  2AEM A;  3EWK A;  1IO4 A;  1MZ9 A;  3VP8 A;  3L71 G;  1FJK A;  2PP6 A;  2FY8 A;  3G6E P;  3CMA P;  1VQ6 P;  3VMX A;  2YNY A;  2OYH B;  1CI6 A;  4IL6 H;  1NTZ D;  1GL2 C;  1W5C E;  2UWJ E;  3II6 A;  2JKV A;  1L0N J;  1EC5 A;  1KIL B;  4IL6 E;  2C9L Y;  2NPS C;  4YTP C;  1IFD A;  2KS1 A;  3WU2 E;  1JY2 P;  3Q5P A;  3A5T A;  1ZN5 A;  2ZYD A;  3QH9 A;  2D2C C;  3TGU G;  1NH4 A;  3L75 J;  2J58 A;  1RQV A;  1FAV A;  1J2J B;  1HJB A;  1L0L J;  1NTM G;  1KQF B;  1NU1 D;  2P10 A;  2KUB A;  2GUS A;  4PV1 C;  5KKZ C;  2NZ2 A;  1Y8A A;  1G1J A;  4PJ0 E;  4KHX A;  1S9K E;  3USS A;  3L70 D;  2YO3 A;  3D70 A;  3L72 J;  4I7Z C;  3C8V A;  2FXO A;  3AED C;  2JWD A;  1BDD A;  5BVZ A;  3C9I A;  2W90 A;  4WWI A;  3RL0 C;  3WUU A;  1EXJ A;  5DJU B;  3TF5 A;  2JDI H;  4ASV A;  2OYH A;  3EFG A;  2JP3 A;  3GHG C;  3BVH A;  2E74 C;  2ZT9 B;  1K73 Q;  3CPW O;  5AW7 B;  1VQ8 P;  4L74 A;  4N78 D;  2E75 D;  3L71 D;  3OA7 A;  3KHU A;  5B66 E;  3BCC G;  1HGZ A;  2KZI A;  1KQG B;  4I2L C;  1HGV A;  3H1L J;  1PZQ A;  1NTK K;  1SQP K;  1VQ4 P;  1QL1 A;  3VMA A;  4U3F J;  2YKP A;  2QM7 A;  3AEG C;  2A06 E;  2WPV B;  3BRV B;  1ZME C;  3TYY A;  5CJ4 A;  5CHX A;  1BCC E;  4JYC A;  3H1I G;  3NFQ A;  2YIU C;  1S9K D;  4ZMD A;  2P67 A;  1R8E A;  3TGU D;  1FZF A;  3MHV A;  1L4A C;  3L74 E;  5KLV E;  2E5Y A;  1BGY J;  1NTM D;  4PD4 H;  3CME P;  3LW5 H;  4HKZ H;  2W27 A;  1HUC A;  5CCH C;  2I8D A;  3KPE A;  1NKN A;  2JWA A;  1JY3 O;  3FXD A;  3PH0 A;  3AE4 C;  4D6T E;  3LIE A;  3MTU E;  1M1J C;  4Y99 B;  1M90 Q;  3G3Z A;  2XNX A;  1LTT C;  2QG4 A;  4H13 D;  2G3A A;  5AVY B;  4HH2 A;  3HRN A;  1BDC A;  2P58 A;  1M8O B;  5GTI H;  3K5B A;  2FFD B;  1BE3 E;  3CCS P;  2M0B A;  1PIX A;  4W7Y A;  2R5D A;  1LT1 A;  2FYN B;  2FYU K;  1AA0 A;  4GOD A;  1N7S D;  4I6M C;  1NTK E;  2XKM A;  3HE4 A;  2AXT H;  3LID A;  3PTZ A;  2BCC E;  2E75 B;  1FJP A;  2XDJ A;  1Q2N A;  1J1D C;  3BCC D;  1VF5 C;  3U59 A;  1GU5 A;  1LWU B;  3M0D C;  3RK3 E;  1KQS O;  5KLV D;  1DEE G;  2PAJ A;  1T3J A;  1RY3 A;  1SQX J;  1H0T B;  4NPF X;  2WIT A;  3ABV C;  3L4F A;  1VQN P;  2WSC H;  4PD4 D;  5AW8 B;  3EFF K;  3H1I D;  4EI2 A;  4OGQ C;  1IFM A;  1EQ7 A;  2M3B A;  1JY3 P;  1L0N G;  2HOD B;  2M5A B;  1KQL A;  2O3J A;  1E5W A;  2WSE J;  1AFO A;  2Q5U A;  1K05 A;  1N7L A;  2JO1 A;  2FBW C;  2FFD A;  2WSF H;  1GU4 A;  3C1L A;  3RK2 C;  1AJY A;  1SQQ G;  2N1T D;  1L0L G;  4H13 B;  1KIL E;  1LNQ A;  2FYU E;  5APS A;  1M57 D;  3VTP C;  1OVU A;  3V5B A;  3VMY A;  1NTZ K;  3H1J G;  3VMZ A;  1J1E B;  2RKL A;  3A0B H;  1CZQ A;  2KP8 A;  3A2A A;  3RK3 D;  5TIS H;  2B88 A;  1LWU A;  1H89 A;  1RF0 C;  1GL2 D;  5CBN A;  1N7S B;  4QMA A;  5TIS E;  2IZ1 A;  1H0T A;  4N3Y B;  2B87 B;  1UIX A;  2G8Y A;  2POH A;  3BRT B;  4OH8 B;  1S1C X;  2QM8 A;  1NU1 K;  3CC2 P;  5KAI E;  3OW2 O;  2Q3E A;  1LTG C;  1Z56 A;  2Q6Q A;  2FKW B;  1YIT P;  1VQL P;  2HOD A;  2M5A A;  3H1H G;  1OW6 A;  4RKU J;  3JC2 2;  1VQP P;  4PV1 D;  2OYO A;  1N86 A;  1P84 I;  3L73 E;  1NYH A;  2ITA A;  3A0H H;  3HTK B;  1EDL A;  3HUS B;  2WPQ A;  1Q90 D;  2M3E A;  1L0N D;  1HTL C;  4WVZ A;  3E1R A;  5CBO A;  4C7R A;  4H44 C;  3A0H E;  3H1H E;  4D6T J;  1S2E A;  2WQY C;  1D7M A;  5M1B A;  1YQ4 C;  3RL0 D;  2KSJ A;  2JEE A;  4U7J A;  3V6I A;  2N1T B;  2V7Q H;  1LTA C;  1SQQ D;  3GMA A;  1L0L D;  1L2P A;  2YKO A;  1N7S A;  3E1I A;  4JYB A;  1DX7 A;  3EQ2 A;  3RGU A;  1VL2 A;  1YHQ P;  3M91 A;  3H1J D;  2B87 A;  4HJG H;  1HF9 A;  4UB8 E;  1IZN B;  1NTK J;  1SQP J;  2PGD A;  1VQ5 P;  2Y0D A;  2YXQ B;  3RK3 B;  2XZR A;  2BCC J;  1GL2 B;  1PP9 G;  4ZKP A;  3CCR P;  2LKM A;  4IFF A;  4Z1M H;  3V2Q A;  3P8M C;  3V2N A;  1QX8 A;  1K9M Q;  1EZV I;  1NTM K;  3AE3 C;  3HTK A;  3HUS A;  1DD3 A;  1FS0 E;  2P2U A;  1RE4 A;  1IC2 A;  5AW0 B;  2Y9Y A;  3FX0 A;  3H1H D;  2ZJS E;  2V4H A;  1N8R Q;  1L4A D;  4LC1 A;  1PP9 E;  2WTY A;  2OYI A;  4B86 A;  3HD7 D;  4PV1 B;  1OVV A;  1X22 A;  5CCH D;  1VDF A;  1FZC C;  3S1K A;  3H1K J;  2N1T A;  1RF1 C;  3CWB G;  1S3J A;  2Z5H A;  3A3Y B;  1IFN A;  2KOG A;  4I7Z B;  4N78 E;  1OX3 A;  3TSI A;  3L71 E;  2QJP B;  2AXC A;  1PFI A;  3R4Y A;  3RL0 B;  3B5N C;  3MZW B;  2SPZ A;  4WBA A;  5AVS B;  2K3R A;  3O6Q B;  3FXE A;  2IFM A;  2K9J B;  3R2P A;  3GHG B;  3CCU P;  2R32 A;  1PV3 A;  5EFW B;  5KLI C;  1GL2 A;  1AV1 A;  3PP5 A;  3AE6 C;  3GW6 A;  2K1A A;  5BU8 B;  4R4M A;  5KLV K;  1G1I A;  1KD1 Q;  3CX5 I;  4XA4 A;  5KTB A;  3TGU E;  2IYO A;  3ZDM A;  1M7L A;  1VF5 D;  1SQB J;  1PPJ G;  1H8A A;  2XU6 A;  5KAF H;  1NTM E;  5CJ0 A;  4YXD C;  1GW4 A;  2O01 J;  2DW3 A;  1PP9 D;  1NKZ B;  2QJK B;  4CPG A;  3NMD A;  5APV A;  2Y9Z A;  1QVG O;  3GF3 A;  3IF4 A;  5AW2 B;  3P8C D;  5AVQ B;  1SQV J;  5AVW B;  1LT9 B;  1WMK A;  4XFJ A;  1KIL A;  3L73 J;  3MD0 A;  1L4A B;  2R3S A;  1GTW A;  1Q86 Q;  4LLH A;  3HD7 B;  3NTN A;  1KFN A;  1KZU B;  3AE9 C;  3RK2 D;  2L5G B;  2WPS A;  4N6J A;  5APY A;  1Q82 Q;  3O6Q A;  1LTJ C;  2QEX P;  2K9J A;  3ITK A;  2QJY C;  3CWB D;  3GHG A;  2C0W A;  1NTZ J;  1NHL A;  1HH0 A;  5CCG C;  5KJ7 C;  1JY2 N;  1KB9 I;  3IN6 A;  1KC8 Q;  5AW5 B;  1FZE A;  2BEZ F;  3BCC E;  3WUT A;  1GW3 A;  1T2K C;  1X0T A;  2MJZ A;  3VP9 A;  3V4W A;  3P32 A;  3I5C A;  2ZT9 C;  4MN4 C;  1IJD B;  4Y28 J;  3OJA B;  4UB6 H;  2AEJ A;  2WSS H;  1IK9 A;  4TLF A;  2PRR A;  4PD4 E;  1NU1 J;  3M9H A;  3H1I E;  4JF7 A;  5AW6 B;  1U7M A;  1J1D B;  1VF5 B;  1LT9 A;  2OTJ P;  1JOC A;  3KDP B;  1PPJ D;  2HPC B;  4R4L A;  2H8P D;  3MUD A;  4WY4 C;  3L70 J;  1LTS C;  4NPD A;  1RHZ B;  1P84 H;  3HD7 A;  1SQP G;  5GTI E;  3AE8 C;  3Q3D A;  5CCH A;  4DZO A;  3IR9 A;  3AEF C;  2FYZ A;  4GT1 A;  1SVF A;  2HYN A;  3F5H A;  3F89 A;  2QSI A;  1OIP A;  4H44 D;  1USE A;  1FZB A;  2QVA A;  1SQQ K;  3MIW A;  1KYO I;  1L0L K;  2AXT E;  1AQT A;  2QE7 H;  1ZXG A;  5AVT B;  1GDT A;  3RK2 B;  2N9Y B;  3T97 B;  2PFX A;  1N73 C;  2IDB A;  1ZW0 A;  4IFD K;  2KNC B;  4I1L A;  4DOJ A;  2WVR A;  4WB4 A;  4DT0 A;  2YXR B;  3H1K G;  3RL0 g;  5AVZ B;  3G4S P;  1EZV G;  1JCD A;  4W80 A;  2FYN C;  1KN7 A;  3M0D A;  4JBZ A;  2E76 C;  4EIJ A;  5E79 H;  2C0X A;  1T3U A;  3L75 G;  3RBZ A;  2HR3 A;  1P84 D;  2KLU A;  4IFM A;  1Q7Y Q;  1KOR A;  4TT3 H;  1L0N E;  1FOS E;  4M3L A;  1OMI A;  2AEF A;  1IFJ A;  3Q5R A;  3IAO A;  4LGD E;  1FBM A;  3PLN A;  2OAR A;  4GIF A;  3CCE P;  3FWN A;  1LP1 B;  1ZLL A;  1VQ7 P;  2CPB A;  5AVV B;  1SQP D;  2K88 A;  3AE5 C;  3L72 G;  2YMY A;  1SQB G;  3D71 A;  1SQQ E;  1JO5 A;  1RH5 B;  3CC4 P;  3A0B E;  1L0L E;  1JB0 J;  2BAS A;  3L35 A;  2A45 I;  5APQ A;  2KB7 P;  3T97 A;  1XTC C;  1YBK A;  2RH0 A;  1QVF O;  2KNC A;  2NPS D;  4H44 B;  3H1J E;  2W6A A;  4RO0 A;  1KTM A;  1SQV G;  5AW1 B;  3JCU H;  1CW5 A;  1USD A;  1U57 A;  2D2C D;  1BCC J;  3B5N D;  1K8A Q;  1HBW A;  5APX A;  5AW9 B;  3TNU B;  1PGP A;  3JCU E;  2IYP A;  1YQ3 C;  3M9B A;  3B8E B;  4EYY Q;  1OWA A;  2YKQ A;  3L74 J;  1YTZ I;  3H1L G;  2GA1 A;  5KLV J;  2QA4 P;  2OQQ A;  4U3F G;  4NPE A;  1DEB A;  1OW8 A;  2K37 A;  2HG5 D;  3H1K D;  1OVR A;  2WZ7 A;  1VPC A;  2KI7 B;  1S5L X;  3SWY A;  1EZV D;  1URQ C;  3LW5 J;  4BWN A;  3Q5S A;  4ZNC A;  1SFC C;  4DCK A;  1LP1 A;  4EDF A;  3L75 D;  2ZYG A;  5B5E H;  2IX7 C;  3CCQ P;  1BE3 J;  1EXI A;  1K04 A;  2B89 A;  2E74 D;  1BGY G;  1X9V A;  4W7Z A;  2OGU A;  1JCC A;  2XV5 A;  1KV4 A;  3QWO C;  2W6J H;  4XE5 B;  1HWT C;  1JMM A;  2OTL P;  3PRJ A;  1NO4 A;  1YI2 P;  1OZH A;  3I56 P;  1U7J A;  4ZKU A;  1JY2 O;  1A02 F;  1PGQ A;  2Z4E A;  3L72 D;  1S5L H;  1SQB D;  5CMZ A;  3AE1 C;  1FZC B;  3CLQ A;  3HUS C;  2KK7 A;  3KQG A;  1RE4 C;  4K35 A;  3TNU A;  1RF1 B;  3MGN A;  3UIA A;  1FDO A;  4H0L C;  1ZRT E;  4KJM A;  5GTH H;  2NPS B;  4C7N B;  2OYI C;  5CCG D;  2O1J A;  2C9N Y;  3PHL A;  5KJ7 D;  3N4X A;  1LGH B;  1YTZ T;  1RE3 A;  3AE7 C;  1SQV D;  2J59 M;  5H2F H;  2XND H;  1BSN A;  5GTH E;  5DJT B;  2D2C B;  1SP4 A;  3AE2 C;  3B5N B;  1T2K D;  1LTI C;  3VOP A;  4HYT B;  3SWK A;  3P7K A;  1ZV8 A;  5KLI B;  5KKZ B;  2WSC J;  3KXD A;  3H1L D;  5AVU B;  2J5U A;  1UII A;  2IBZ I;  3P8C E;  2Q7C A;  1M1K Q;  4U3F D;  4KT0 J;  2JJL A;  1DIP A;  3TDK A;  3H25 A;  1SQX G;  4IOI H;  3G9R A;  3RK3 C;  1CSB A;  1KMI Z;  2Q3I A;  2H7H A;  2WSF J;  3WU2 H;  4WY4 D;  5BU5 A;  3VYI A;  1FU1 A;  4O9B A;  1FC2 C;  3CXH I;  2FYU J;  4GKG A;  2KSE A;  2OTK E;  2IZ0 A;  2R5B A;  1EDK A;  1GD2 E;  2E74 B;  4A7P A;  3CWB E;  1BGY D;  2P7J A;  1FZC A;  5APT A;  4BRY B;  2FXM A;  1SQX E;  1RF1 A;  2MKV A;  1ZRT D;  1JM0 A;  4JQ0 D;  1MKM A;  1SQQ J;  1KYO H;  2NPS A;  2ZVO B;  2WSE H;  4PJ0 H;  4C7N A;  2E42 A;  2KYV A;  1X8Y A;  1GMJ A;  1KB9 D;  2OYH C;  4HB1 A;  3B4S A;  1KYO E;  5APU A;  3H1J J;  3BAS A;  1T6A A;  1JEK A;  3B5N A;  3AEC C;  4JPZ B;  1KIL C;  1LTJ B;  4L75 A;  1YIJ P;  2QJY B;  2O1K A;  5KAF E;  1E79 H;  1ZR2 A;  3W67 A;  2QJP C;  3PJS K;  2HFE D;  2YIU B;  4RES B;  1ZR4 A;  1VQM P;  2O01 N;  1EDI A;  4OGQ D;  2M8R A;  3IFM A;  3M0A A;  1PPJ E;  3SFD C;  1YJ9 P;  4OVN F;  2H43 A;  3D6Y A;  2A06 G;  5AW4 B;  1W2E A;  5B66 H;  2E76 D;  3H1H J;  3GLM A;  2WT7 B;  1BCC G;  1GK6 A;  2ZXE B;  1ZOY C;  1M1J B;  3MP7 B;  1SQX D;  2A45 G;  4BRY A;  3L74 G;  5KLV G;  3FWL A;  3WUV A;  1NJI Q;  4WY4 B;  3SFE C;  2QJK C;  3CL3 D;  2L91 A;  3HE4 B;  3N7N A;  2V7Q J;  1OXZ A;  3GF7 A;  1KYO D;  4DJG A;  1W2B O;  1OW7 A;  2A45 H;  1AVY A;  4D6T G;  3O8Z A;  2JR8 A;  2E43 A;  1LT9 C;  1H88 A;  2B9B A;  4EOT A;  2QIW A;  4GOF A;  1LTJ A;  3MUD C;  2WWW A;  5L8R J;  2H89 C;  2H88 C;  5CCG A;  2RN0 A;  4RJT A;  4OWF A;  3HD7 C;  1BE3 G;  1A02 J;  5KJ7 A;  1KFM A;  4UB6 E;  2R3C A;  2CPS A;  4YPC A;  4AQR D;  3VN0 A;  1ZP0 C;  3KZI H;  2ZXX A;  5AVR B;  3I55 P;  1L4A A;  2WPR A;  1JMB A;  1NTK G;  1YJW P;  1N73 B;  3CCV P;  3L36 A;  3KZI E;  1L0N K;  3H32 B;  3S4R A;  1JNM A;  2GM4 A;  2BCC G;  2WT7 A;  1PP9 J;  1P84 E;  1MFZ A;  2RMZ A;  1QEX A;  3FGA D;  3GG2 A;  1NOH A;  4OGQ B;  1M1J A;  2IFN A;  2LXB A;  5APW A;  1URQ D;  1NGM B;  1LJ2 A;  2A06 D;  4WY4 A;  2E76 B;  1SQP E;  1SFC D;  3CD6 P;  3BAT A;  4Y99 C;  3L71 J;  1BCC D;  2Y0E A;  4BXL A;  1YJN P;  3AEA C;  2I1K A;  1NVO A;  4ASW A;  2VRS A;  1HVV A;  2YMK A;  1QGK B;  3H6P A;  5AVX B;  3KYQ A;  2KIK A;  3L74 D;  4AYC A;  5C39 A;  1AVO A;  2FFD C;  2K9Y A;  1SQB K;  2W83 C;  3CWB J;  1G2C B;  1BSH A;  2KXP B;  1SLQ A;  3V4Q A;  1N2D C;  4D6T D;  2HPC A;  3TGU J;  4L76 A;  2P1J A;  1VQO P;  1SQV K;  3Q1M A;  1RQU A;  1Y9B A;  1FOS F;  1N73 A;  2FYU G;  4AUW A;  4H0L D;  1NTM J;  3HE5 B;  2E75 C;  3H32 A;  3H1K E;  2IBZ G;  1BE3 D;  5E79 E;  1LWU C;  3W68 A;  1VQ9 P;  1EZV E;  1VQK P;  3S9O A;  2GUV A;  2LXC B;  4C46 A;  1YYC A;  1MV8 A;  1NTK D;  1Y47 A;  2E5T A;  3RBX A;  1M56 D;  2KZJ A;  1IFI A;  3L75 E;  2BCC D;  3TK1 A;  3L37 A;  2IBZ E;  1R5S A;  3Q2Y A;  2IPP A;  1NAF A;  1MUU A;  2N9B A;  1MFT A;  1IFP A;  1URQ B;  3AEB C;  3CXH H;  2FXP A;  2O01 H;  1SFC B;  4PD4 I;  2QRX A;  1G2C A;  3WMM 0;  3SSU A;  1DD4 A;  3L72 E;  1SQB E;  3CXH E;  5KAI H;  3L73 G;  4H13 C;  3BCC J;  2LR2 A;  2KLV A;  1RF0 A;  2ZAE B;  2R44 A;  1HJ0 A;  2ZVN B;  3CX5 H;  3AEE C;  1J1E C;  3HE5 A;  2WMM A;  2ZFC A;  1SQV E;  1JY3 N;  1NAY A;  3U1A A;  3CX5 E;  1JTH B;  1PGO A;  4L73 A;  1AQ5 A;  1NTZ G;  3CC7 P;  3H1I J;  3V2R A;  1S4X A;  1N7S C;  1EDJ A;  2YO2 A;  1PGJ A; 
#chains in the Genus database with same CATH homology
 4RKU J;  1OW6 A;  4OGQ C;  3AE4 C;  3D6Z A;  4OGQ B;  4Z1M H;  3EWK A;  4R4M A;  1EXJ A;  1ZOY C;  3T97 B;  2WSE J;  4H0L B;  4H44 B;  2IDB A;  2JP3 A;  4H13 D;  1K05 A;  2G3A A;  2ZT9 C;  4PV1 D;  2E74 C;  2ZT9 B;  2E74 B;  1NGM B;  1VF5 D;  2JO1 A;  2FBW C;  1KTM A;  3AE3 C;  4Y28 J;  1NYH A;  4GDO A;  3AE1 C;  1DD3 A;  2E76 B;  4YXD C;  1U57 A;  2D2C D;  2O01 J;  2MKV A;  3SFE C;  3Q2Y A;  2QJK C;  1PIX A;  1Q90 D;  3RL0 g;  1AJY A;  1MKM A;  1FDO A;  2E75 D;  2V7Q J;  4H0L C;  1ZRT E;  4H44 C;  4YTP C;  3GF7 A;  1GMJ A;  3AEA C;  2FYN C;  4H13 B;  1OW7 A;  1YQ3 C;  3GF3 A;  4PV1 B;  1KQG B;  1KIL E;  2WQY C;  3AEB C;  1VF5 B;  3Q5P A;  2YMK A;  2FXP A;  3AE7 C;  2E76 C;  5M1B A;  2QIW A;  4R4L A;  2OQQ A;  2D2C C;  2K9Y A;  2D2C B;  3AEC C;  1WMK A;  4XFJ A;  1YQ4 C;  3AEG C;  1DD4 A;  3AE2 C;  1OW8 A;  1RQV A;  4U7J A;  4IL6 X;  2WPV B;  5L8R J;  2E75 B;  2H89 C;  2H88 C;  1PL5 A;  1S5L X;  1KQF B;  2P10 A;  4H13 C;  1ZME C;  3AE8 C;  3GMA A;  3Q3D A;  4PV1 C;  4I7Z B;  5KKZ C;  1KOR A;  2NZ2 A;  4TT3 H;  1VF5 C;  2WSC J;  3LW5 J;  1OMI A;  3Q5S A;  1HJ0 A;  2QJP C;  2YIU C;  3Q5R A;  3AE9 C;  3IAO A;  3RK3 E;  1ZP0 C;  1VL2 A;  2J5U A;  3AEF C;  1R8E A;  3AEE C;  4OGQ D;  3Q1M A;  3R4Y A;  1RQU A;  3O6Q A;  1Y9B A;  4KT0 J;  1HF9 A;  1DIP A;  2G8Y A;  1UIX A;  2QJY C;  2QSI A;  4H0L D;  2E75 C;  3SFD C;  3H25 A;  1S1C X;  4H44 D;  1EXI A;  1K04 A;  3G9R A;  3D70 A;  1IK7 A;  1KMI Z;  3ABV C;  2ZT9 D;  3AE5 C;  1PV3 A;  2E74 D;  3C8V A;  4I7Z C;  5KLI C;  3D6Y A;  1FDI A;  3AED C;  1TU3 F;  3IN6 A;  3D71 A;  2WSF J;  3AE6 C;  2E76 D;  3B71 A;  2BEZ F;  3GLM A;  1JB0 J;  2BEQ D;  3FGA D;  3S9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...