3T97B

Molecular architecture of the transport channel of the nuclear pore complex: nup62/nup54
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
58
structure length
58
Chain Sequence
HMTKQHQTRLDIISEDISELQKNQTTTMAKIAQYKRKLMDLSHRTLQVLIKQEIQRKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Nuclear pore complex protein Nup54
publication title Molecular architecture of the transport channel of the nuclear pore complex.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 27
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2011-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3t97B00
3T97B 1EXJA 3IAOA 1EXIA 2J5UA 2OQQA 3Q5PA 3D6YA 3D70A 3Q1MA 3Q5SA 3D71A 3D6ZA 3G9RA 3Q2YA 4R4LA 3Q5RA 4R4MA 3Q3DA 1R8EA 1DIPA
chains in the Genus database with same CATH superfamily
2W27A 2M5AB 3OA7A 2QIWA 1LWUB 3VP8A 2E74C 5CCGA 3NTNA 1S9KD 1RE3C 4H44B 5H2FE 4ASWA 2FYUD 3M91A 1SQVG 4HH2A 1NTZG 4IOIH 3HD7D 3AE9C 5AW9B 2A06G 2WSCJ 1DX7A 1KN7A 2GA1A 1KB9D 1SQVJ 1NTZJ 1KYOH 5KLIC 1LP1B 3KDPB 2M0BA 1SQVE 4B86A 3A5TA 3BRVB 2B87B 2FYUJ 1NTZE 1U7JA 1S9KE 3KHUA 2A06E 2HFED 2XU6A 1ZR2A 3S4RA 1LTSC 5CCGD 1YYCA 2WMMA 1G1JA 3O6QB 4PD4D 3H1HE 3AEAC 4N78E 1OVVA 3GLMA 3VMXA 1CZQA 3L75E 1IFPA 1SFCC 2YIUB 2O1KA 3H32B 3RK2D 1T3JA 2I1KA 5APQA 1GTWA 3RL0B 2PAJA 3IN6A 2E5TA 2K37A 5APVA 2IX7C 2HODB 2KXPB 5E79H 5KAFH 3BASA 1YBKA 5AVYB 2GM4A 2XNXA 3HE5B 1GU4A 4K3AA 4EYYQ 4W7ZA 2Q3IA 2QJKB 1RH5B 1AA0A 1N7SB 4DJGA 1W5CE 2WSSH 2W6JH 3GHGA 1FZCC 1IFDA 1SQXK 2E75D 3JCUE 2QJYC 1N73A 3G71P 5AVVB 1YQ3C 2IYOA 5KJ7C 3CL3D 2K9YA 2O01N 2DW3A 3F5HA 2ZT9C 1GL2C 1HWTC 1EDIA 1A02J 1M1KQ 2O01J 3CPWO 1Y9BA 1IZNB 1XTGB 3WMM0 2E42A 1FZFA 3JSVC 3OAKA 4N3YB 4BXLA 4D6TD 5KTBA 3RK3E 1M7LA 5AVQB 2C9LY 2KYVA 3ITKA 2FBWC 5AW5B 1VF5B 4D6TG 1NTKG 2KK7A 5H2FH 3L71D 2I8DA 5KJ7A 4D6TJ 3OJAB 1LTGC 3M0DC 1VL2A 1NTKJ 1G1IA 2FYNC 2Q6QA 1G2CB 3L72G 3L71G 1NTKE 4AQRD 3L72J 3CX5I 1S4XA 1HJBA 2RN0A 3L71J 2XNDH 1FJKA 3EQ2A 2H7HA 2NRGA 2ZFCA 3HE4A 2E74B 3L72E 2B9BA 1ZN5A 4YTPC 1X9VA 5DJTB 2OTJP 3CXHE 3L71E 1T2KC 1GK4A 1GDTA 1AVOA 1NU1K 4H0LC 2WT7A 2BCCD 1QVFO 2C0WA 2QE7H 3S9OA 1URQA 4NPEA 1L4AA 2KNCB 5AVTB 2BCCG 3EWKA 2V7QH 3KPEA 5KLIB 1FU1A 3FXEA 1PP9D 1IC2A 2KB7P 3NFQA 2HPCA 2BCCJ 3Q1MA 2ZYGA 1IFNA 1NO4A 3V2NA 2PRRA 4ZKUA 1PIXA 4WBAA 1PP9G 1SQPG 3AE4C 3U59A 1SFCB 3TF5A 1PP9J 4UB6E 5AW4B 1QGKB 2AXCA 1KD1Q 1URQD 1NOHA 3O8ZA 1L4AD 1SQPE 4JQ0D 1JMBA 3AECC 1BSNA 1KB9I 1JO5A 1H0TA 4JBZA 4KJMA 2FXPA 1WMKA 3RBXA 1NH4A 5AVUB 2KSJA 1DD4A 2V4HA 2ZYDA 4WVZA 3NXSA 3V2QA 4PD4I 4PV1C 1KMIZ 3A2AA 1FZCB 2W6BA 2WPVB 1KQFB 4C7RA 1N8RQ 2IBZD 3MTUE 1KYOD 2QJYB 4RKUJ 1OW7A 2OARA 3BCCE 1RF1C 3VYIA 1FZBA 1HVVA 2Y0CA 2G3AA 2KIKA 3BVHA 2Y0DA 3C8VA 1OMIA 2CK3H 5CJ4A 3VMYA 1KILA 2ZT9B 1M90Q 1GW4A 4GDOA 3I55P 1Q82Q 1GL2B 4DZOA 3MGNA 1JY3N 2ZVNB 3CMAP 1NAYA 4PJ0H 3A0BH 1LGHB 1AJYA 1EQ7A 1YJ9P 5CJ0A 3CCVP 1SQBD 4WWIA 1RE4A 4OGQD 4WB4A 3H1ID 3CXHH 3EFFK 1FAVA 5GTIE 3WUVA 4IFDK 2RH0A 1L2PA 2FYNB 1SQBJ 3CWBG 2CPBA 3A0HE 2A45H 5CCHC 3FGAD 2L91A 2IDBA 3AEFC 3CLQA 3CCUP 1K8AQ 2P67A 2R3CA 1KV4A 5KLVG 3H6PA 4R4LA 5KAFE 3CWBE 1GD2E 3HD7C 1JTHB 1J1EC 4H0LB 1EXJA 3MIWA 3HRNA 4EIJA 5KLVE 4UB6H 1ZP0C 3LIEA 3M9BA 4UB8E 3L73G 2Q1KA 3GMAA 1BGYE 1OVUA 4I1LA 4XE5B 1VQNP 3IF4A 1NWQA 1EC5A 1BCCD 1IO4A 4L75A 4NPDA 3HTKB 1YI2P 2E43A 3FX0A 5CCGC 3V4WA 2YKQA 3L73E 3N4XA 1USEA 1ZW0A 5APUA 1BCCG 2QEXP 1OIPA 3AE3C 2KZIA 5L8RJ 3RK2C 4Z1MH 1BCCJ 2R3SA 3G3ZA 2UWJE 5KKZC 4HJGH 1HGVA 3TYYA 1SQQE 4BRYA 1KC8Q 3CMEP 2ZAEB 4GOFA 4C7NA 2R5BA 3SWFA 2FXMA 1SQVD 2K9JB 2YKPA 4BWNA 1NTZD 1MUUA 2A06D 2WPQA 1LTJA 5AW0B 3H1HD 3PTZA 2R32A 2Z5HA 4N78D 2KI7B 3SFDC 2E75C 3L75D 2FY8A 3MZWB 4PV1B 1AFOA 1IJDB 4XFJA 1X8YA 1SQQK 1NHLA 1PGQA 3H1HG 3ZDMA 4GODA 1YIJP 2XV5A 3M9HA 3L75G 3CC7P 1KFNA 2BEQD 3SWKA 3H1HJ 3TNUB 1RF1B 3V4QA 2NZ2A 1KQLA 4DCKA 3L75J 3R2PA 1JOCA 1RQVA 2ITAA 3KYQA 4I2LC 1JY3O 5BU5A 1SQXG 5GTIH 1J1DC 2NPSA 3Q5RA 3GHGC 2V7QJ 3BRTB 4GKGA 1OW6A 1PL5A 3A0HH 1K9MQ 1AVYA 1SQXE 1CI6B 2OYIA 1N73C 1BSHA 1SLQA 3S1KA 1FDOA 2BEZF 2K1AA 1PPJD 1MV8A 2ZJSE 3Q3DA 2IBZI 5C39A 2N1TA 4KHXA 4I6MC 1KYOI 1SS1A 3IR9A 2N9YB 2OYHA 1PPJG 1JY2N 1Z56A 1S72P 3VOPA 2IYPA 1X79B 3D6YA 4UB8H 2M3EA 2NPSD 3A3YB 3TGUG 1OXZA 2YO3A 5AVWB 4WY4A 1S3JA 2FYUK 3QWOC 4HYTB 3TGUJ 1PGJA 3KZIE 1PPJE 1JY3P 4JPZB 2M8RA 3TGUE 3MD0A 3C1LA 2WPRA 5APTA 4TLFA 1YTZI 4IFMA 3RK3D 3L74D 3HD7B 1J1EB 2N1TD 1EZVG 2WZ7A 3G4SP 1WRGA 5CBNA 2YMKA 3L74G 1L0LK 4GOEA 4ZKPA 2HYNA 2FYZA 4WY4D 3A7OA 3L74J 1NU1G 1M1JA 4I7ZC 1EZVE 4C7NB 1HF9A 1S2EA 3I56P 1NTKD 3L74E 4H13D 1NU1J 4OWFA 5BVZA 1P84I 3CC2P 3PH0A 1VQOP 1UIIA 1NKZB 1NU1E 1GZLA 3L72D 3AEEC 1URQC 3RK2B 3CXHD 1L4AC 2QRXA 5KKZB 1NYHA 3CD6P 1Q2NA 4HKZH 3C9IA 3W67A 1L0NE 1Q81Q 1K73Q 4GT1A 2C0XA 4PJ0E 1FC2C 3A0BE 1VDFA 3P32A 1HGZA 3L70D 1EDLA 2A45G 2H89C 3SSUA 2Y9YA 2FXOA 3L70G 3G9RA 2QG4A 4RO0A 1N7LA 5BU8B 2KLVA 3B4SA 1YJWP 4HB1A 2E75B 3L70J 1EDJA 3B5NA 1QL1A 1AV1A 1L0NK 5B66E 3L70E 3CCQP 1KB9H 2FFDA 2AEJA 1SQPD 3FWLA 3U1AA 5AVXB 3JC22 1A02F 1NAFA 1Y47A 3VMZA 2JO1A 1GL2D 2K3RA 1QEXA 3H1KG 1J1DB 3B8EB 3T97A 2FKWB 2P7JA 1SQPJ 2QJPC 3GHGB 3D6ZA 2I1JA 2Z5IA 2D2CD 3B5ND 5APYA 3KZIH 1N73B 3H1KE 3RL0g 4OGQC 1JY2O 3L4FA 1MKMA 2KS1A 3CCJP 1VQ4P 4GIFA 3BCCD 1KILC 1W2BO 4AYCA 3H25A 2IPPA 1QVGO 2LXCB 1ZXGA 3BCCG 1NTME 1S1CX 3V2PA 3BCCJ 2PGDA 1RE4C 1ZRTD 3HUSA 1FOSE 1PFIA 2J58A 3N7NA 1IFMA 4U3FG 2PFXA 3LW5J 4U3FJ 1LT9A 1JY2P 2Y0EA 2E76D 4K35A 2XZRA 1NTMK 3AE6C 1ZLLA 2M5AA 1LWUA 3AE2C 4U3FE 3F89A 2JDIH 2WVRA 1ZRTE 3VP9A 4L73A 2E5YA 4I7ZB 3HE4B 4EOTA 1OX3A 1GW3A 2WT7B 1JB0J 4RJTA 4ZNCA 2RKLA 3AEBC 3PRJA 1ZV8A 2B89A 3FWNA 1ZR4A 2WSFH 1URQB 3CWBD 1NGMB 2AEMA 1L4AB 1ZMEC 2CPSA 1IK7A 1LP1A 1UIXA 2B87A 1FDMA 2MKVA 2WWWA 2QVAA 3KXDA 1AQ5A 5KLVD 2OGUA 3EFGA 3H1LE 4RESB 4DT0A 3G6EP 2HPCB 1H8AA 5B66H 2J5UA 1BGYD 1YHQP 3CWBJ 3O6QA 3I5CA 3RGUA 1BE3G 4H44D 2JWDA 1RY3A 4XA4A 3SWYA 1BGYG 2C9NY 3H32A 5AVZB 1VQMP 5KLVJ 3M06A 3L73D 4LGDE 2IZ0A 1JNMA 1BGYJ 5TJHA 2BASA 2MJZA 1BE3E 4MN4C 5AW3B 2HODA 1KZUB 3MUDA 2IFMA 3CXHI 3L73J 2YNYA 3IFMA 1Y8AA 3HE5A 1H0TB 1JCCA 1R5LA 1SQQD 3WU2E 5AW2B 1H89A 3D71A 1YQ4C 1N7SA 5KAIE 1LTJC 2Q3EA 1VQ5P 1SQBK 1SQQG 2H43A 3QH9A 3RL0D 2L5GB 1OVRA 2QJPB 1SQQJ 5APWA 1CW5A 1GK6A 3R4YA 3CX5E 4U7JA 2JEEA 2ZXEB 3GF7A 1KQGB 4OGQB 2QM8A 1VQ8P 2K88A 5APXA 4L74A 2NPSC 1N7SD 5TISH 1KILB 4QMAA 1GMJA 3U1CA 4YPCA 1NJIQ 3VN0A 1T3UA 3LW5H 5APSA 2OYIC 2QSIA 4EI2A 1PV3A 2W83C 4KT0J 3CI9A 3L37A 5B5EE 3RK3C 1SQXD 1RF0A 2Q9IA 2J59M 2N1TC 2KP8A 2WITA 2FYUG 4JF7A 2OYHC 1FBMA 1G2CA 5EFWB 4WY4C 2KZJA 3E1IA 2POHA 1SQXJ 2FYUE 1JUNA 1S5LE 1U57A 2QA4P 4H13C 1L0LD 4CPGA 1RE3A 1YTZT 1KB9E 2M3BA 4W80A 2LXBA 3Q5SA 1VF5D 2WSEH 3CCEP 1L0LG 4IFFA 3AE5C 3V6IA 1IFIA 3TGUD 1Q90D 3PHLA 2KNCA 1L0LJ 2B88A 3CC4P 1SQVK 4EDFA 1NTZK 1U7MA 3ABVC 4PD4E 1L0LE 4IL6X 1M1JC 1QX8A 1R5SA 2E74D 3AE1C 1MFTA 1M8OB 2KLUA 2SPZA 1NVOA 5AW6B 1P84H 3KQGA 3WU2H 5CBOA 2ZYAA 1SFCA 1EZVD 1MZ9A 1FZAA 3MP7B 1LT1A 5KAIH 3CCSP 2JJLA 1D7MA 4N6JA 4IL6H 3L35A 5K5GB 1NU1D 3USSA 2Q7CA 1FJPA 4Y99C 1N86A 4AUWA 4BRYB 3AE8C 1OW8A 1KQSO 5AW7B 3CX5H 3UIAA 1HBWA 2WPSA 5AVSB 1L0ND 5AVRB 5CHXA 4YXWH 1SFCD 3Q5PA 1LTJB 1L0NG 2QM7A 4L76A 1FZCA 1HUCA 5AW8B 2D2CC 1KTMA 3LIDA 3B5NC 1L0NJ 1FZGA 1GU5A 2P10A 3IAOA 2FFDC 5GTHE 1LTBC 5B5EH 4R4MA 1S5LX 3V5BA 2R44A 1VQ6P 2WSFJ 1CSBA 1T8ZA 4D6TE 1GL2A 2YXQB 2NPSB 2WSCH 1KFMA 4NPFX 1TU3F 2JWAA 2W90A 3TK1A 3PJSK 3H1JD 1WT6A 1S5LH 2OYIB 2AXTE 4O9BA 4Y28J 1W2EA 3FXDA 2YO2A 2OQQA 5M1BA 1SP4A 1N2DC 1KORA 3RK3B 3H1JG 2YKOA 1FZEA 5KJ7D 4JYCA 2N1TB 3H1KD 1LTTC 1BDDA 3M0DA 2OYHB 4YXDC 3H1JJ 2ZT9D 3II6A 1NTKK 1M57D 2IZ1A 2E76C 1VPCA 1IFJA 3H1JE 4WY4B 4OH8B 1JCDA 3PLNA 4PD4H 4LC1A 3TSIA 2BCCE 2OTKE 3H1KJ 1T6AA 2Q5UA 2HR3A 1VQPP 3V2RA 4H13B 1OZHA 1H88A 1NTMD 3HUSC 1JTHA 4C46A 1SVFA 3L36A 3CCLP 1J2JB 3CCRP 3GF3A 2LR2A 1DEBA 2OYOA 1NTMG 1PP9E 2Z4EA 1DH3A 2XKMA 1LT9C 2YMYA 1NTMJ 3JCUH 1LWUC 3CCMP 4A7PA 3HTKA 3WUTA 1M1JB 1PZQA 4JYBA 2R5DA 4H44C 3B71A 2LKMA 2KSEA 1FE6A 4U3FD 1T2KD 2W8ZA 1K05A 4H0LD 1HH0A 2P1JA 2H88C 1SQPK 2GUVA 5TISE 2O01H 1MFZA 1EDKA 2OTLP 4Y99B 1DEEG 1M56D 2IBZG 1VQLP 1YJNP 3K5BA 2JP3A 1HJ0A 1Q7YQ 5GTHH 1HTLC 2K9JA 1LTIC 2PP6A 3H1LD 2YIUC 1FS0E 3PP5A 1DIPA 3P8MC 2H8PD 3MHVA 2IBZE 1E5WA 2O1JA 2YXRB 1VQ7P 3TDKA 1KYOE 3H1LG 3RL0C 2XDJA 2JR8A 1LTAC 2W6AA 1RHZB 1X22A 1EZVI 1RQUA 2D2CB 3H1LJ 3MUDC 3B5NB 1BE3D 2HLOA 2AXTH 1E79H 3M0AA 3TNUA 1RF1A 2JKVA 2ZXXA 2FFDB 2WSEJ 3E1RA 4M3LA 5AW1B 1SQBG 3AEDC 2QJKC 1DD3A 3Q2YA 2P2UA 3H1IG 3GG2A 1N7SC 4OVNF 5DJUB 1KILD 3W68A 2HG5D 4ZMDA 2WQYC 1P84D 3H1IJ 4LLHA 1BE3J 3BATA 3T97B 2GUSA 2KOGA 1BDCA 1SQBE 1EXIA 1FOSF 4W7YA 3P8CD 2VRSA 3VTPC 1YITP 2IFNA 4PV1D 1VQKP 3H1IE 1CI6A 2G8YA 2RMZA 5E79E 3OW2O 1AQTA 1R8EA 2N9BA 3SFEC 2WTYA 3GW6A 3VMAA 1KILE 2KS1B 4TT3H 1OWAA 2KUBA 1P84E 3CX5D 3M9QA 3WUUA 3D70A 1NKNA 3P8CE 2P58A 1VQ9P 2A45I 1QL2A 4IL6E 1K04A 1XTCC 1QLED 2E76B 1USDA 5CCHA 1IK9A 1Q86Q 4ASVA 3RBZA 2AEFA 1LNQA 1PGOA 1X0TA 3AE7C 1FDIA 1VF5C 2O3JA 3P7KA 5CMZA 1PGPA 1RF0C 3HUSB 3E7KA 3HD7A 5KLVK 2ZVOB 1JEKA 1BCCE 3AEGC 4DOJA 2Y9ZA 3NMDA 1LJ2A 1ZOYC 1JMMA 1LT9B 1OFCX 1JM0A 5CCHD
chains in the Genus database with same CATH topology
2JO1A 1PL5A 2WQYC 3AECC 2QIWA 4OGQD 4H13D 2E76D 4Y28J 3T97B 1K05A 2E74C 4H0LD 5KKZC 1EXIA 3AE6C 4Z1MH 3AE2C 2H88C 2OQQA 1FDOA 5M1BA 4PV1D 2BEZF 1ZRTE 1KORA 2G8YA 2QJPC 4H44B 3D71A 1YQ4C 3D6ZA 3AE8C 1OW8A 4I7ZB 3AEEC 2FXPA 1WMKA 3Q3DA 2D2CD 1R8EA 3AE9C 2E74B 3SFEC 4YTPC 4YXDC 2WSCJ 1NYHA 2ZT9D 2E75D 3FGAD 2IDBA 1KILE 1JB0J 1DD4A 1U57A 3AEFC 3RL0g 4OGQC 4H13C 2E76C 2QJYC 3AEBC 4H0LC 4TT3H 1MKMA 2JP3A 1HJ0A 3Q5PA 3D6YA 3D70A 1NGMB 4PV1C 3Q5SA 1KMIZ 5KLIC 1KQFB 2WPVB 1VF5D 1YQ3C 3S9OA 3R4YA 1ZMEC 4R4LA 1IK7A 2YIUC 4U7JA 1UIXA 2K9YA 2D2CC 2MKVA 3AE5C 3GF7A 1K04A 1DIPA 1KQGB 4OGQB 4H13B 2E76B 3H25A 1KTMA 4RKUJ 1Q90D 3EWKA 4H0LB 1OW7A 3SFDC 2ZT9C 1EXJA 2E75C 2P10A 3IAOA 2H89C 4PV1B 2J5UA 3AEAC 1ZP0C 2G3AA 2O01J 3GLMA 4XFJA 1Y9BA 3Q1MA 3O6QA 3C8VA 3ABVC 1FDIA 3AE7C 3G9RA 3GF3A 3GMAA 1OMIA 1S1CX 4H44D 1RQUA 1VF5C 2D2CB 4IL6X 1GMJA 4R4MA 2BEQD 1S5LX 1PIXA 2ZT9B 2E75B 4GDOA 3RK3E 2NZ2A 2WSFJ 3AE4C 2E74D 3AE1C 1RQVA 2YMKA 2WSEJ 3IN6A 3AEGC 2FBWC 3AEDC 2QJKC 1VF5B 1PV3A 2QSIA 4KT0J 1DD3A 3Q2YA 1AJYA 1ZOYC 3Q5RA 2V7QJ 4H44C 3AE3C 3B71A 1TU3F 3LW5J 4I7ZC 5L8RJ 1HF9A 1VL2A 1OW6A 2FYNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T97 B;  1EXJ A;  3IAO A;  1EXI A;  2J5U A;  2OQQ A;  3Q5P A;  3D6Y A;  3D70 A;  3Q1M A;  3Q5S A;  3D71 A;  3D6Z A;  3G9R A;  3Q2Y A;  4R4L A;  3Q5R A;  4R4M A;  3Q3D A;  1R8E A;  1DIP A; 
#chains in the Genus database with same CATH topology
 2W27 A;  2M5A B;  3OA7 A;  2QIW A;  1LWU B;  3VP8 A;  2E74 C;  5CCG A;  3NTN A;  1S9K D;  1RE3 C;  4H44 B;  5H2F E;  4ASW A;  2FYU D;  3M91 A;  1SQV G;  4HH2 A;  1NTZ G;  4IOI H;  3HD7 D;  3AE9 C;  5AW9 B;  2A06 G;  2WSC J;  1DX7 A;  1KN7 A;  2GA1 A;  1KB9 D;  1SQV J;  1NTZ J;  1KYO H;  5KLI C;  1LP1 B;  3KDP B;  2M0B A;  1SQV E;  4B86 A;  3A5T A;  3BRV B;  2B87 B;  2FYU J;  1NTZ E;  1U7J A;  1S9K E;  3KHU A;  2A06 E;  2HFE D;  2XU6 A;  1ZR2 A;  3S4R A;  1LTS C;  5CCG D;  1YYC A;  2WMM A;  1G1J A;  3O6Q B;  4PD4 D;  3H1H E;  3AEA C;  4N78 E;  1OVV A;  3GLM A;  3VMX A;  1CZQ A;  3L75 E;  1IFP A;  1SFC C;  2YIU B;  2O1K A;  3H32 B;  3RK2 D;  1T3J A;  2I1K A;  5APQ A;  1GTW A;  3RL0 B;  2PAJ A;  3IN6 A;  2E5T A;  2K37 A;  5APV A;  2IX7 C;  2HOD B;  2KXP B;  5E79 H;  5KAF H;  3BAS A;  1YBK A;  5AVY B;  2GM4 A;  2XNX A;  3HE5 B;  1GU4 A;  4K3A A;  4EYY Q;  4W7Z A;  2Q3I A;  2QJK B;  1RH5 B;  1AA0 A;  1N7S B;  4DJG A;  1W5C E;  2WSS H;  2W6J H;  3GHG A;  1FZC C;  1IFD A;  1SQX K;  2E75 D;  3JCU E;  2QJY C;  1N73 A;  3G71 P;  5AVV B;  1YQ3 C;  2IYO A;  5KJ7 C;  3CL3 D;  2K9Y A;  2O01 N;  2DW3 A;  3F5H A;  2ZT9 C;  1GL2 C;  1HWT C;  1EDI A;  1A02 J;  1M1K Q;  2O01 J;  3CPW O;  1Y9B A;  1IZN B;  1XTG B;  3WMM 0;  2E42 A;  1FZF A;  3JSV C;  3OAK A;  4N3Y B;  4BXL A;  4D6T D;  5KTB A;  3RK3 E;  1M7L A;  5AVQ B;  2C9L Y;  2KYV A;  3ITK A;  2FBW C;  5AW5 B;  1VF5 B;  4D6T G;  1NTK G;  2KK7 A;  5H2F H;  3L71 D;  2I8D A;  5KJ7 A;  4D6T J;  3OJA B;  1LTG C;  3M0D C;  1VL2 A;  1NTK J;  1G1I A;  2FYN C;  2Q6Q A;  1G2C B;  3L72 G;  3L71 G;  1NTK E;  4AQR D;  3L72 J;  3CX5 I;  1S4X A;  1HJB A;  2RN0 A;  3L71 J;  2XND H;  1FJK A;  3EQ2 A;  2H7H A;  2NRG A;  2ZFC A;  3HE4 A;  2E74 B;  3L72 E;  2B9B A;  1ZN5 A;  4YTP C;  1X9V A;  5DJT B;  2OTJ P;  3CXH E;  3L71 E;  1T2K C;  1GK4 A;  1GDT A;  1AVO A;  1NU1 K;  4H0L C;  2WT7 A;  2BCC D;  1QVF O;  2C0W A;  2QE7 H;  3S9O A;  1URQ A;  4NPE A;  1L4A A;  2KNC B;  5AVT B;  2BCC G;  3EWK A;  2V7Q H;  3KPE A;  5KLI B;  1FU1 A;  3FXE A;  1PP9 D;  1IC2 A;  2KB7 P;  3NFQ A;  2HPC A;  2BCC J;  3Q1M A;  2ZYG A;  1IFN A;  1NO4 A;  3V2N A;  2PRR A;  4ZKU A;  1PIX A;  4WBA A;  1PP9 G;  1SQP G;  3AE4 C;  3U59 A;  1SFC B;  3TF5 A;  1PP9 J;  4UB6 E;  5AW4 B;  1QGK B;  2AXC A;  1KD1 Q;  1URQ D;  1NOH A;  3O8Z A;  1L4A D;  1SQP E;  4JQ0 D;  1JMB A;  3AEC C;  1BSN A;  1KB9 I;  1JO5 A;  1H0T A;  4JBZ A;  4KJM A;  2FXP A;  1WMK A;  3RBX A;  1NH4 A;  5AVU B;  2KSJ A;  1DD4 A;  2V4H A;  2ZYD A;  4WVZ A;  3NXS A;  3V2Q A;  4PD4 I;  4PV1 C;  1KMI Z;  3A2A A;  1FZC B;  2W6B A;  2WPV B;  1KQF B;  4C7R A;  1N8R Q;  2IBZ D;  3MTU E;  1KYO D;  2QJY B;  4RKU J;  1OW7 A;  2OAR A;  3BCC E;  1RF1 C;  3VYI A;  1FZB A;  1HVV A;  2Y0C A;  2G3A A;  2KIK A;  3BVH A;  2Y0D A;  3C8V A;  1OMI A;  2CK3 H;  5CJ4 A;  3VMY A;  1KIL A;  2ZT9 B;  1M90 Q;  1GW4 A;  4GDO A;  3I55 P;  1Q82 Q;  1GL2 B;  4DZO A;  3MGN A;  1JY3 N;  2ZVN B;  3CMA P;  1NAY A;  4PJ0 H;  3A0B H;  1LGH B;  1AJY A;  1EQ7 A;  1YJ9 P;  5CJ0 A;  3CCV P;  1SQB D;  4WWI A;  1RE4 A;  4OGQ D;  4WB4 A;  3H1I D;  3CXH H;  3EFF K;  1FAV A;  5GTI E;  3WUV A;  4IFD K;  2RH0 A;  1L2P A;  2FYN B;  1SQB J;  3CWB G;  2CPB A;  3A0H E;  2A45 H;  5CCH C;  3FGA D;  2L91 A;  2IDB A;  3AEF C;  3CLQ A;  3CCU P;  1K8A Q;  2P67 A;  2R3C A;  1KV4 A;  5KLV G;  3H6P A;  4R4L A;  5KAF E;  3CWB E;  1GD2 E;  3HD7 C;  1JTH B;  1J1E C;  4H0L B;  1EXJ A;  3MIW A;  3HRN A;  4EIJ A;  5KLV E;  4UB6 H;  1ZP0 C;  3LIE A;  3M9B A;  4UB8 E;  3L73 G;  2Q1K A;  3GMA A;  1BGY E;  1OVU A;  4I1L A;  4XE5 B;  1VQN P;  3IF4 A;  1NWQ A;  1EC5 A;  1BCC D;  1IO4 A;  4L75 A;  4NPD A;  3HTK B;  1YI2 P;  2E43 A;  3FX0 A;  5CCG C;  3V4W A;  2YKQ A;  3L73 E;  3N4X A;  1USE A;  1ZW0 A;  5APU A;  1BCC G;  2QEX P;  1OIP A;  3AE3 C;  2KZI A;  5L8R J;  3RK2 C;  4Z1M H;  1BCC J;  2R3S A;  3G3Z A;  2UWJ E;  5KKZ C;  4HJG H;  1HGV A;  3TYY A;  1SQQ E;  4BRY A;  1KC8 Q;  3CME P;  2ZAE B;  4GOF A;  4C7N A;  2R5B A;  3SWF A;  2FXM A;  1SQV D;  2K9J B;  2YKP A;  4BWN A;  1NTZ D;  1MUU A;  2A06 D;  2WPQ A;  1LTJ A;  5AW0 B;  3H1H D;  3PTZ A;  2R32 A;  2Z5H A;  4N78 D;  2KI7 B;  3SFD C;  2E75 C;  3L75 D;  2FY8 A;  3MZW B;  4PV1 B;  1AFO A;  1IJD B;  4XFJ A;  1X8Y A;  1SQQ K;  1NHL A;  1PGQ A;  3H1H G;  3ZDM A;  4GOD A;  1YIJ P;  2XV5 A;  3M9H A;  3L75 G;  3CC7 P;  1KFN A;  2BEQ D;  3SWK A;  3H1H J;  3TNU B;  1RF1 B;  3V4Q A;  2NZ2 A;  1KQL A;  4DCK A;  3L75 J;  3R2P A;  1JOC A;  1RQV A;  2ITA A;  3KYQ A;  4I2L C;  1JY3 O;  5BU5 A;  1SQX G;  5GTI H;  1J1D C;  2NPS A;  3Q5R A;  3GHG C;  2V7Q J;  3BRT B;  4GKG A;  1OW6 A;  1PL5 A;  3A0H H;  1K9M Q;  1AVY A;  1SQX E;  1CI6 B;  2OYI A;  1N73 C;  1BSH A;  1SLQ A;  3S1K A;  1FDO A;  2BEZ F;  2K1A A;  1PPJ D;  1MV8 A;  2ZJS E;  3Q3D A;  2IBZ I;  5C39 A;  2N1T A;  4KHX A;  4I6M C;  1KYO I;  1SS1 A;  3IR9 A;  2N9Y B;  2OYH A;  1PPJ G;  1JY2 N;  1Z56 A;  1S72 P;  3VOP A;  2IYP A;  1X79 B;  3D6Y A;  4UB8 H;  2M3E A;  2NPS D;  3A3Y B;  3TGU G;  1OXZ A;  2YO3 A;  5AVW B;  4WY4 A;  1S3J A;  2FYU K;  3QWO C;  4HYT B;  3TGU J;  1PGJ A;  3KZI E;  1PPJ E;  1JY3 P;  4JPZ B;  2M8R A;  3TGU E;  3MD0 A;  3C1L A;  2WPR A;  5APT A;  4TLF A;  1YTZ I;  4IFM A;  3RK3 D;  3L74 D;  3HD7 B;  1J1E B;  2N1T D;  1EZV G;  2WZ7 A;  3G4S P;  1WRG A;  5CBN A;  2YMK A;  3L74 G;  1L0L K;  4GOE A;  4ZKP A;  2HYN A;  2FYZ A;  4WY4 D;  3A7O A;  3L74 J;  1NU1 G;  1M1J A;  4I7Z C;  1EZV E;  4C7N B;  1HF9 A;  1S2E A;  3I56 P;  1NTK D;  3L74 E;  4H13 D;  1NU1 J;  4OWF A;  5BVZ A;  1P84 I;  3CC2 P;  3PH0 A;  1VQO P;  1UII A;  1NKZ B;  1NU1 E;  1GZL A;  3L72 D;  3AEE C;  1URQ C;  3RK2 B;  3CXH D;  1L4A C;  2QRX A;  5KKZ B;  1NYH A;  3CD6 P;  1Q2N A;  4HKZ H;  3C9I A;  3W67 A;  1L0N E;  1Q81 Q;  1K73 Q;  4GT1 A;  2C0X A;  4PJ0 E;  1FC2 C;  3A0B E;  1VDF A;  3P32 A;  1HGZ A;  3L70 D;  1EDL A;  2A45 G;  2H89 C;  3SSU A;  2Y9Y A;  2FXO A;  3L70 G;  3G9R A;  2QG4 A;  4RO0 A;  1N7L A;  5BU8 B;  2KLV A;  3B4S A;  1YJW P;  4HB1 A;  2E75 B;  3L70 J;  1EDJ A;  3B5N A;  1QL1 A;  1AV1 A;  1L0N K;  5B66 E;  3L70 E;  3CCQ P;  1KB9 H;  2FFD A;  2AEJ A;  1SQP D;  3FWL A;  3U1A A;  5AVX B;  3JC2 2;  1A02 F;  1NAF A;  1Y47 A;  3VMZ A;  2JO1 A;  1GL2 D;  2K3R A;  1QEX A;  3H1K G;  1J1D B;  3B8E B;  3T97 A;  2FKW B;  2P7J A;  1SQP J;  2QJP C;  3GHG B;  3D6Z A;  2I1J A;  2Z5I A;  2D2C D;  3B5N D;  5APY A;  3KZI H;  1N73 B;  3H1K E;  3RL0 g;  4OGQ C;  1JY2 O;  3L4F A;  1MKM A;  2KS1 A;  3CCJ P;  1VQ4 P;  4GIF A;  3BCC D;  1KIL C;  1W2B O;  4AYC A;  3H25 A;  2IPP A;  1QVG O;  2LXC B;  1ZXG A;  3BCC G;  1NTM E;  1S1C X;  3V2P A;  3BCC J;  2PGD A;  1RE4 C;  1ZRT D;  3HUS A;  1FOS E;  1PFI A;  2J58 A;  3N7N A;  1IFM A;  4U3F G;  2PFX A;  3LW5 J;  4U3F J;  1LT9 A;  1JY2 P;  2Y0E A;  2E76 D;  4K35 A;  2XZR A;  1NTM K;  3AE6 C;  1ZLL A;  2M5A A;  1LWU A;  3AE2 C;  4U3F E;  3F89 A;  2JDI H;  2WVR A;  1ZRT E;  3VP9 A;  4L73 A;  2E5Y A;  4I7Z B;  3HE4 B;  4EOT A;  1OX3 A;  1GW3 A;  2WT7 B;  1JB0 J;  4RJT A;  4ZNC A;  2RKL A;  3AEB C;  3PRJ A;  1ZV8 A;  2B89 A;  3FWN A;  1ZR4 A;  2WSF H;  1URQ B;  3CWB D;  1NGM B;  2AEM A;  1L4A B;  1ZME C;  2CPS A;  1IK7 A;  1LP1 A;  1UIX A;  2B87 A;  1FDM A;  2MKV A;  2WWW A;  2QVA A;  3KXD A;  1AQ5 A;  5KLV D;  2OGU A;  3EFG A;  3H1L E;  4RES B;  4DT0 A;  3G6E P;  2HPC B;  1H8A A;  5B66 H;  2J5U A;  1BGY D;  1YHQ P;  3CWB J;  3O6Q A;  3I5C A;  3RGU A;  1BE3 G;  4H44 D;  2JWD A;  1RY3 A;  4XA4 A;  3SWY A;  1BGY G;  2C9N Y;  3H32 A;  5AVZ B;  1VQM P;  5KLV J;  3M06 A;  3L73 D;  4LGD E;  2IZ0 A;  1JNM A;  1BGY J;  5TJH A;  2BAS A;  2MJZ A;  1BE3 E;  4MN4 C;  5AW3 B;  2HOD A;  1KZU B;  3MUD A;  2IFM A;  3CXH I;  3L73 J;  2YNY A;  3IFM A;  1Y8A A;  3HE5 A;  1H0T B;  1JCC A;  1R5L A;  1SQQ D;  3WU2 E;  5AW2 B;  1H89 A;  3D71 A;  1YQ4 C;  1N7S A;  5KAI E;  1LTJ C;  2Q3E A;  1VQ5 P;  1SQB K;  1SQQ G;  2H43 A;  3QH9 A;  3RL0 D;  2L5G B;  1OVR A;  2QJP B;  1SQQ J;  5APW A;  1CW5 A;  1GK6 A;  3R4Y A;  3CX5 E;  4U7J A;  2JEE A;  2ZXE B;  3GF7 A;  1KQG B;  4OGQ B;  2QM8 A;  1VQ8 P;  2K88 A;  5APX A;  4L74 A;  2NPS C;  1N7S D;  5TIS H;  1KIL B;  4QMA A;  1GMJ A;  3U1C A;  4YPC A;  1NJI Q;  3VN0 A;  1T3U A;  3LW5 H;  5APS A;  2OYI C;  2QSI A;  4EI2 A;  1PV3 A;  2W83 C;  4KT0 J;  3CI9 A;  3L37 A;  5B5E E;  3RK3 C;  1SQX D;  1RF0 A;  2Q9I A;  2J59 M;  2N1T C;  2KP8 A;  2WIT A;  2FYU G;  4JF7 A;  2OYH C;  1FBM A;  1G2C A;  5EFW B;  4WY4 C;  2KZJ A;  3E1I A;  2POH A;  1SQX J;  2FYU E;  1JUN A;  1S5L E;  1U57 A;  2QA4 P;  4H13 C;  1L0L D;  4CPG A;  1RE3 A;  1YTZ T;  1KB9 E;  2M3B A;  4W80 A;  2LXB A;  3Q5S A;  1VF5 D;  2WSE H;  3CCE P;  1L0L G;  4IFF A;  3AE5 C;  3V6I A;  1IFI A;  3TGU D;  1Q90 D;  3PHL A;  2KNC A;  1L0L J;  2B88 A;  3CC4 P;  1SQV K;  4EDF A;  1NTZ K;  1U7M A;  3ABV C;  4PD4 E;  1L0L E;  4IL6 X;  1M1J C;  1QX8 A;  1R5S A;  2E74 D;  3AE1 C;  1MFT A;  1M8O B;  2KLU A;  2SPZ A;  1NVO A;  5AW6 B;  1P84 H;  3KQG A;  3WU2 H;  5CBO A;  2ZYA A;  1SFC A;  1EZV D;  1MZ9 A;  1FZA A;  3MP7 B;  1LT1 A;  5KAI H;  3CCS P;  2JJL A;  1D7M A;  4N6J A;  4IL6 H;  3L35 A;  5K5G B;  1NU1 D;  3USS A;  2Q7C A;  1FJP A;  4Y99 C;  1N86 A;  4AUW A;  4BRY B;  3AE8 C;  1OW8 A;  1KQS O;  5AW7 B;  3CX5 H;  3UIA A;  1HBW A;  2WPS A;  5AVS B;  1L0N D;  5AVR B;  5CHX A;  4YXW H;  1SFC D;  3Q5P A;  1LTJ B;  1L0N G;  2QM7 A;  4L76 A;  1FZC A;  1HUC A;  5AW8 B;  2D2C C;  1KTM A;  3LID A;  3B5N C;  1L0N J;  1FZG A;  1GU5 A;  2P10 A;  3IAO A;  2FFD C;  5GTH E;  1LTB C;  5B5E H;  4R4M A;  1S5L X;  3V5B A;  2R44 A;  1VQ6 P;  2WSF J;  1CSB A;  1T8Z A;  4D6T E;  1GL2 A;  2YXQ B;  2NPS B;  2WSC H;  1KFM A;  4NPF X;  1TU3 F;  2JWA A;  2W90 A;  3TK1 A;  3PJS K;  3H1J D;  1WT6 A;  1S5L H;  2OYI B;  2AXT E;  4O9B A;  4Y28 J;  1W2E A;  3FXD A;  2YO2 A;  2OQQ A;  5M1B A;  1SP4 A;  1N2D C;  1KOR A;  3RK3 B;  3H1J G;  2YKO A;  1FZE A;  5KJ7 D;  4JYC A;  2N1T B;  3H1K D;  1LTT C;  1BDD A;  3M0D A;  2OYH B;  4YXD C;  3H1J J;  2ZT9 D;  3II6 A;  1NTK K;  1M57 D;  2IZ1 A;  2E76 C;  1VPC A;  1IFJ A;  3H1J E;  4WY4 B;  4OH8 B;  1JCD A;  3PLN A;  4PD4 H;  4LC1 A;  3TSI A;  2BCC E;  2OTK E;  3H1K J;  1T6A A;  2Q5U A;  2HR3 A;  1VQP P;  3V2R A;  4H13 B;  1OZH A;  1H88 A;  1NTM D;  3HUS C;  1JTH A;  4C46 A;  1SVF A;  3L36 A;  3CCL P;  1J2J B;  3CCR P;  3GF3 A;  2LR2 A;  1DEB A;  2OYO A;  1NTM G;  1PP9 E;  2Z4E A;  1DH3 A;  2XKM A;  1LT9 C;  2YMY A;  1NTM J;  3JCU H;  1LWU C;  3CCM P;  4A7P A;  3HTK A;  3WUT A;  1M1J B;  1PZQ A;  4JYB A;  2R5D A;  4H44 C;  3B71 A;  2LKM A;  2KSE A;  1FE6 A;  4U3F D;  1T2K D;  2W8Z A;  1K05 A;  4H0L D;  1HH0 A;  2P1J A;  2H88 C;  1SQP K;  2GUV A;  5TIS E;  2O01 H;  1MFZ A;  1EDK A;  2OTL P;  4Y99 B;  1DEE G;  1M56 D;  2IBZ G;  1VQL P;  1YJN P;  3K5B A;  2JP3 A;  1HJ0 A;  1Q7Y Q;  5GTH H;  1HTL C;  2K9J A;  1LTI C;  2PP6 A;  3H1L D;  2YIU C;  1FS0 E;  3PP5 A;  1DIP A;  3P8M C;  2H8P D;  3MHV A;  2IBZ E;  1E5W A;  2O1J A;  2YXR B;  1VQ7 P;  3TDK A;  1KYO E;  3H1L G;  3RL0 C;  2XDJ A;  2JR8 A;  1LTA C;  2W6A A;  1RHZ B;  1X22 A;  1EZV I;  1RQU A;  2D2C B;  3H1L J;  3MUD C;  3B5N B;  1BE3 D;  2HLO A;  2AXT H;  1E79 H;  3M0A A;  3TNU A;  1RF1 A;  2JKV A;  2ZXX A;  2FFD B;  2WSE J;  3E1R A;  4M3L A;  5AW1 B;  1SQB G;  3AED C;  2QJK C;  1DD3 A;  3Q2Y A;  2P2U A;  3H1I G;  3GG2 A;  1N7S C;  4OVN F;  5DJU B;  1KIL D;  3W68 A;  2HG5 D;  4ZMD A;  2WQY C;  1P84 D;  3H1I J;  4LLH A;  1BE3 J;  3BAT A;  3T97 B;  2GUS A;  2KOG A;  1BDC A;  1SQB E;  1EXI A;  1FOS F;  4W7Y A;  3P8C D;  2VRS A;  3VTP C;  1YIT P;  2IFN A;  4PV1 D;  1VQK P;  3H1I E;  1CI6 A;  2G8Y A;  2RMZ A;  5E79 E;  3OW2 O;  1AQT A;  1R8E A;  2N9B A;  3SFE C;  2WTY A;  3GW6 A;  3VMA A;  1KIL E;  2KS1 B;  4TT3 H;  1OWA A;  2KUB A;  1P84 E;  3CX5 D;  3M9Q A;  3WUU A;  3D70 A;  1NKN A;  3P8C E;  2P58 A;  1VQ9 P;  2A45 I;  1QL2 A;  4IL6 E;  1K04 A;  1XTC C;  1QLE D;  2E76 B;  1USD A;  5CCH A;  1IK9 A;  1Q86 Q;  4ASV A;  3RBZ A;  2AEF A;  1LNQ A;  1PGO A;  1X0T A;  3AE7 C;  1FDI A;  1VF5 C;  2O3J A;  3P7K A;  5CMZ A;  1PGP A;  1RF0 C;  3HUS B;  3E7K A;  3HD7 A;  5KLV K;  2ZVO B;  1JEK A;  1BCC E;  3AEG C;  4DOJ A;  2Y9Z A;  3NMD A;  1LJ2 A;  1ZOY C;  1JMM A;  1LT9 B;  1OFC X;  1JM0 A;  5CCH D; 
#chains in the Genus database with same CATH homology
 2JO1 A;  1PL5 A;  2WQY C;  3AEC C;  2QIW A;  4OGQ D;  4H13 D;  2E76 D;  4Y28 J;  3T97 B;  1K05 A;  2E74 C;  4H0L D;  5KKZ C;  1EXI A;  3AE6 C;  4Z1M H;  3AE2 C;  2H88 C;  2OQQ A;  1FDO A;  5M1B A;  4PV1 D;  2BEZ F;  1ZRT E;  1KOR A;  2G8Y A;  2QJP C;  4H44 B;  3D71 A;  1YQ4 C;  3D6Z A;  3AE8 C;  1OW8 A;  4I7Z B;  3AEE C;  2FXP A;  1WMK A;  3Q3D A;  2D2C D;  1R8E A;  3AE9 C;  2E74 B;  3SFE C;  4YTP C;  4YXD C;  2WSC J;  1NYH A;  2ZT9 D;  2E75 D;  3FGA D;  2IDB A;  1KIL E;  1JB0 J;  1DD4 A;  1U57 A;  3AEF C;  3RL0 g;  4OGQ C;  4H13 C;  2E76 C;  2QJY C;  3AEB C;  4H0L C;  4TT3 H;  1MKM A;  2JP3 A;  1HJ0 A;  3Q5P A;  3D6Y A;  3D70 A;  1NGM B;  4PV1 C;  3Q5S A;  1KMI Z;  5KLI C;  1KQF B;  2WPV B;  1VF5 D;  1YQ3 C;  3S9O A;  3R4Y A;  1ZME C;  4R4L A;  1IK7 A;  2YIU C;  4U7J A;  1UIX A;  2K9Y A;  2D2C C;  2MKV A;  3AE5 C;  3GF7 A;  1K04 A;  1DIP A;  1KQG B;  4OGQ B;  4H13 B;  2E76 B;  3H25 A;  1KTM A;  4RKU J;  1Q90 D;  3EWK A;  4H0L B;  1OW7 A;  3SFD C;  2ZT9 C;  1EXJ A;  2E75 C;  2P10 A;  3IAO A;  2H89 C;  4PV1 B;  2J5U A;  3AEA C;  1ZP0 C;  2G3A A;  2O01 J;  3GLM A;  4XFJ A;  1Y9B A;  3Q1M A;  3O6Q A;  3C8V A;  3ABV C;  1FDI A;  3AE7 C;  3G9R A;  3GF3 A;  3GMA A;  1OMI A;  1S1C X;  4H44 D;  1RQU A;  1VF5 C;  2D2C B;  4IL6 X;  1GMJ A;  4R4M A;  2BEQ D;  1S5L X;  1PIX A;  2ZT9 B;  2E75 B;  4GDO A;  3RK3 E;  2NZ2 A;  2WSF J;  3AE4 C;  2E74 D;  3AE1 C;  1RQV A;  2YMK A;  2WSE J;  3IN6 A;  3AEG C;  2FBW C;  3AED C;  2QJK C;  1VF5 B;  1PV3 A;  2QSI A;  4KT0 J;  1DD3 A;  3Q2Y A;  1AJY A;  1ZOY C;  3Q5R A;  2V7Q J;  4H44 C;  3AE3 C;  3B71 A;  1TU3 F;  3LW5 J;  4I7Z C;  5L8R J;  1HF9 A;  1VL2 A;  1OW6 A;  2FYN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...