2KZJA

Solution structure of the zher2 affibody (alternative)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
58
structure length
58
Chain Sequence
VDNKFNKEMRNAYWEIALLPNLNNQQKRAFIRSLYDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Engineered protein, ZHER2 Affibody
publication title Structural basis for high-affinity HER2 receptor binding by an engineered protein.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
total genus 21
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2010-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2kzjA00
4ASWA 5CBNA 1Y47A 5DJUB 2KZJA 4K35A 2UWJE 2B89A 4NPEA 3MHVA 2KZIA 1SS1A 4JBZA 1U7JA 1FC2C 2KIKA 4WWIA 4EYYQ 4GODA 1DEEG 1H0TB 2Q1KA 4IOIH 4GOFA 3PH0A 2B87B 1NVOA 1OVUA 1LP1A 2M5AA 5DJTB 5K5GB 3RGUA 4HKZH 1X0TA 4HB1A 2K3RA 1MFTA 4ASVA 3QWOC 5C39A 3FXEA 1BDCA 1EC5A 1OVVA 2JWDA 4K3AA 2R44A 2WMMA 2QVAA 1EDLA 4NPFX 1JM0A 2QRXA 3ZDMA 2P58A 4BXLA 1LT1A 1EDJA 5EFWB 2KI7B 4MN4C 1S3JA 3FXDA 1BDDA 4HJGH 4KJMA 1LP1B 2I8DA 2M5AB 1JMBA 4GOEA 5CBOA 1OVRA 2B88A 2LR2A 2KS1B 1U7MA 1ZW0A 4NPDA 2KUBA 1ZXGA 2LXBA 1EDKA 1Q2NA 4ZNCA 2M0BA 2OTKE 1H0TA 2SPZA 2LXCB 3S1KA 1EDIA 4ZMDA 2B87A 3MZWB 2ZAEB 4CPGA 2RKLA 2HR3A
chains in the Genus database with same CATH superfamily
5DJUB 1QVFO 3CLQA 3Q1MA 1VQLP 2ZVOB 4GT1A 1NU1J 3A0HE 3L72G 2WSCJ 4GIFA 1SS1A 1CI6A 1WMKA 3G4SP 1VQ4P 2XNXA 3CWBD 1L0LE 3GLMA 2E43A 2GUVA 1N7SC 4DJGA 2N1TD 3AEBC 1PPJD 2Y0CA 3K5BA 1JEKA 1SQQG 3BATA 3IFMA 3I5CA 2A06D 5K5GB 3AE5C 3CX5E 5AW6B 2BASA 1OW7A 5AW5B 1N73C 1HUCA 2ZFCA 3L75D 3NXSA 2OARA 1HJ0A 2IYPA 3L73J 1JY2P 1LT1A 4OH8B 1NU1D 3P32A 1SQVJ 2N1TB 3B5NC 2WQYC 3CCUP 2WSEJ 4KT0J 1KQFB 3HE5A 5BU8B 5APXA 2E74B 3CXHD 1VPCA 1IFNA 4UB6E 3RK3D 1K73Q 1AVYA 1KILE 1RHZB 3B5ND 3MIWA 5KJ7D 1R8EA 4ZMDA 4IFMA 1SQVD 3CCJP 3H1IE 4RESB 2OQQA 2NRGA 5AVTB 3TNUB 4CPGA 1H89A 1LWUA 1EXJA 2WSCH 3L72J 1URQC 3RK3B 2AEMA 3CXHH 2N9BA 1NTZG 2KK7A 4U7JA 1SQQJ 1DEBA 1RF0C 2OYOA 1LTTC 1KB9E 3L70E 2IZ0A 3AECC 3QH9A 2YXQB 1NYHA 2J59M 2BCCG 1SLQA 1GU4A 1FZFA 4YPCA 3L72D 1BSHA 1BGYG 1FDMA 3KXDA 2WSEH 4WY4A 2Z5HA 3G6EP 1AV1A 3PP5A 2YO3A 1GL2D 3H1KE 3WU2H 1SQQD 1LT9A 3D70A 3A0BH 2AXTH 2LXBA 1KYOD 2NZ2A 2KSJA 2O01J 2R5BA 4XA4A 1FBMA 1FJKA 4H0LB 2FXOA 3CI9A 1KFMA 5CCGC 1L0LG 1FZBA 2W6AA 4JYBA 5CBNA 1VF5C 3EFGA 1NTZJ 1ZP0C 1HH0A 3CXHI 3RK2D 2OTJP 1DEEG 2G3AA 4TT3H 3V2NA 3H1JE 1LTBC 3Q5PA 3VTPC 3M9BA 5APYA 1KYOH 1RQVA 1NTMJ 1SQPK 3G71P 4KHXA 1HWTC 3M9QA 3AEGC 3N7NA 2JWDA 1JY2O 1RE3A 2A06E 5CCHD 1FU1A 3RK2B 1X79B 1LJ2A 2KYVA 2KI7B 1NTZD 3BASA 2QSIA 4C7NA 5B5EE 2Q7CA 1QVGO 2NPSA 4HH2A 3LIEA 1CZQA 1T2KC 1YQ4C 1DD4A 2LR2A 2BCCD 4W7ZA 4JQ0D 1AVOA 1KC8Q 2O01H 3H1IG 1NGMB 1W2EA 2JR8A 1BGYD 3ABVC 2WPVB 3AE2C 3T97A 3RK3E 1L0LJ 2AEFA 3A7OA 3G3ZA 1L4AD 1OW6A 2QM8A 2G8YA 5AW0B 5AVUB 1JCCA 1M1JB 1P84H 1RE4A 3L70G 4K35A 3TF5A 2GUSA 4JBZA 5GTIE 3CD6P 1IFMA 2E76D 1L4AB 1HTLC 2OYHC 1SFCC 3H1HE 2B87B 5H2FE 1KYOI 1ZN5A 1L0LD 3KHUA 1HJBA 1AQTA 3MUDA 1Q82Q 3PLNA 3H1KG 5TISE 1OVVA 4PJ0E 2VRSA 1NU1K 1KQSO 1EZVI 2R44A 1FZCC 2E76B 1RF1A 2YKQA 3M0AA 1SFCD 3WUVA 3TYYA 2P67A 3M0DA 1S72P 3GHGB 1H8AA 2M5AB 1ZR2A 3L37A 2ZT9D 3A0HH 3HUSA 4NPDA 5AW9B 4BRYB 1IFIA 1EDKA 1U57A 1FZEA 3M9HA 4AUWA 2KOGA 1K04A 1YITP 1FOSF 4YTPC 3L4FA 1SQVK 4AYCA 3SFDC 1AFOA 1LTJB 4N3YB 3VMXA 2FYZA 1SQBE 1KILD 2ZAEB 2FBWC 5APVA 3RL0C 3L70J 3CX5H 3H1JG 2ZT9B 1P84I 1GU5A 2KLUA 3L71E 2C0XA 4H44C 4N78E 3MHVA 3H1ID 2IPPA 5CJ0A 1LTAC 2ZJSE 1N7SA 1KILB 3CCLP 1KQGB 1KN7A 3H1KJ 4HB1A 1PGOA 1MFTA 5APUA 4OGQD 2Z4EA 4UB6H 5AW8B 3VP9A 2FYUE 5KLVE 1KB9D 3L70D 3RL0g 1N73A 5KLIB 1VQ9P 3E1RA 1OX3A 4K3AA 2OYIC 3NTNA 1VQ8P 1M56D 1SQQK 3B5NA 3AE9C 2WT7A 3CPWO 1ZRTE 4OGQB 3O6QB 2ZYGA 1U7MA 4L74A 3H1KD 5GTHE 3IR9A 5M1BA 2ZYAA 2M0BA 1KB9H 2SPZA 5AW3B 2QA4P 1EQ7A 1PGQA 3CX5I 3HUSC 3CWBJ 2JO1A 1GD2E 3H1HG 1GZLA 1JB0J 3M06A 1VQOP 1URQA 2QJYB 4U3FG 1EXIA 1G2CB 1Z56A 3BRTB 1JNMA 2WSFJ 3KPEA 3A5TA 2WSSH 2IBZE 2N1TC 4RO0A 1N2DC 1H0TB 1RF0A 3EQ2A 1FAVA 3HE4B 3P8CE 1FDIA 2ZXXA 2FFDA 3LW5H 1GL2A 3HD7D 2K3RA 3H1JD 5C39A 1DX7A 3OW2O 2IYOA 2HODB 1GTWA 2YKOA 3OJAB 2CK3H 1FZAA 1NTZK 3CL3D 2QVAA 1JTHA 3V4WA 2KB7P 1J1EB 3O8ZA 2L91A 5TJHA 2RN0A 3I55P 4HJGH 3HD7B 1NTKE 1NTMK 2E74D 4WBAA 3A2AA 3V2QA 4H13B 2B88A 3RK3C 1SQBG 1RQUA 3HRNA 4EIJA 1LTSC 1Y8AA 1GMJA 5KJ7C 3L71G 5APQA 3S1KA 1NHLA 1NKZB 2HPCA 2DW3A 5CCGA 2WPSA 2WPRA 2POHA 2QM7A 1JY3P 3LIDA 2WSFH 1MKMA 3PHLA 1PL5A 1L0NE 1YHQP 2FYUG 2KIKA 4IL6X 5KLVG 4EYYQ 3WUUA 1J2JB 2C9LY 1YYCA 5B5EH 2QJKB 2N9YB 1L0LK 3OAKA 1LTGC 3JSVC 4IOIH 1LGHB 3V6IA 5CHXA 2J5UA 3I56P 1VQNP 1LNQA 1SP4A 1MFZA 1OFCX 2BEQD 4IL6E 1NKNA 3H1HD 4U3FD 2M8RA 4TLFA 2GM4A 4NPFX 2P58A 1EDJA 1QL2A 2PGDA 4UB8E 4R4MA 2FFDC 1GL2C 2YNYA 1BDDA 1GDTA 1VQKP 3CCQP 2L5GB 1SQBJ 1S2EA 4C7RA 2Y0EA 1MV8A 1G1JA 3PTZA 4I7ZB 2XV5A 4D6TE 1K8AQ 5GTIH 2FYNB 4L75A 4XE5B 5H2FH 4H0LD 3PRJA 2QEXP 4WB4A 3EFFK 1Q81Q 3VOPA 2IBZG 1SQPE 4JPZB 3GF3A 5TISH 4PJ0H 4ASWA 2HYNA 1VQ7P 3KZIE 1VQ6P 1KD1Q 1IK9A 1SQBD 2FYUJ 4Y99B 5KLVJ 3HTKB 4WVZA 4NPEA 3RK2C 2Q3EA 3U59A 3H32A 4A7PA 3L71D 4I1LA 2OYHA 4N78D 3VP8A 1SFCA 3MTUE 1NVOA 4C46A 1YJNP 2D2CD 3RGUA 5B66E 2FXMA 1IC2A 1BSNA 3QWOC 4M3LA 2KS1A 1T8ZA 1BDCA 5AVSB 5CCHC 1NTKG 3SWYA 3AE7C 1CI6B 2KNCA 1FZCA 2RMZA 1S5LX 2FYUD 5KLVD 2BCCJ 3G9RA 4L73A 2D2CB 1M1JC 1MZ9A 1OVRA 1BGYJ 2Y9YA 2ZVNB 2JP3A 1S5LE 4RJTA 1D7MA 1R5LA 3VMAA 1ZRTD 4LLHA 2B9BA 3GW6A 1DD3A 4ZNCA 1L4AC 2W27A 1M57D 1Q7YQ 3R2PA 1VQMP 3JC22 1L0NG 2E5TA 4ZKUA 3PJSK 1N86A 1JY3O 2H8PD 3HE5B 1SQXE 1VDFA 4EOTA 3OA7A 5CMZA 3AEDC 4Y28J 1VF5B 3II6A 2E76C 5KKZB 3CCVP 3M91A 1S1CX 5AW4B 3GHGC 1OMIA 2XNDH 3TSIA 3B71A 1LP1A 2OTLP 5DJTB 2ITAA 2IBZD 1X0TA 2YMYA 1NTKJ 1LWUB 3FXEA 2Q9IA 3KYQA 5GTHH 3VYIA 3P8CD 1LTIC 2Z5IA 2YKPA 2H43A 3EWKA 3ZDMA 2OYIA 1MUUA 4DOJA 3L73E 4HYTB 4D6TG 4U3FE 1LTJC 4WY4D 2W6BA 1WT6A 2ZT9C 2YIUB 4GDOA 1ZW0A 1FS0E 1AA0A 1BCCE 1SQPG 1NTKD 2Y0DA 1M8OB 1XTGB 5AW1B 1L0NJ 4OWFA 4W80A 4WY4B 1KILC 1JMMA 1KTMA 1ZMEC 3H1IJ 4PD4E 3B4SA 3IF4A 2V7QJ 5AVYB 1LT9B 4LC1A 3JCUE 2BEZF 1UIXA 2CPSA 5KLIC 1RY3A 5AVZB 2E75D 3Q2YA 1WRGA 3V4QA 2N1TA 5AVQB 1K9MQ 1KFNA 3PH0A 1L0ND 3D71A 4OGQC 4HKZH 1T3UA 1PFIA 3VN0A 1S9KE 2Q3IA 3L74E 1Q86Q 2IFMA 1NWQA 2E75B 2GA1A 2QJPB 3TGUE 2A45G 3MD0A 4MN4C 1EZVE 3R4YA 4LGDE 3LW5J 2NPSD 3TNUA 3F89A 2W8ZA 2QJYC 1YI2P 5AVXB 5KAIE 1BE3E 1JUNA 1SQXG 2IBZI 2I1JA 5BU5A 1NAYA 5KJ7A 2V7QH 3W67A 1YIJP 1NU1G 2WZ7A 4D6TD 1R5SA 3WMM0 4C7NB 2Q5UA 3B8EB 1GW4A 2NPSB 1J1DB 1PV3A 3SWFA 4IL6H 3BCCE 1SQBK 1PP9E 1RH5B 3H1LE 2Q6QA 1PGJA 1NH4A 3FWLA 5L8RJ 2KZIA 1SQPD 4BWNA 4UB8H 3S9OA 4OVNF 3H1JJ 3VMYA 2W90A 4GODA 3T97B 1IO4A 3HD7C 3Q3DA 2E42A 3L73G 1KMIZ 4DCKA 4ASVA 2JEEA 1FDOA 2FYUK 5KLVK 2WMMA 3FWNA 1K05A 1IFJA 4I6MC 4PV1D 1BCCG 3L36A 1X9VA 2E74C 1DIPA 1YJWP 4KJMA 1IK7A 3AEFC 2ZXEB 4H13D 3KZIH 1GK4A 3N4XA 1S4XA 4Z1MH 1SQXJ 2IDBA 5KAFE 2PRRA 1UIIA 4ZKPA 3AEAC 3SWKA 4PV1B 1IFDA 3H6PA 2QJKC 1RF1B 1OZHA 1HBWA 3MZWB 5B66H 2XDJA 3FGAD 2RKLA 2QIWA 4I2LC 3HUSB 2O3JA 1KZUB 2B89A 1KB9I 1SQXD 3TDKA 5APSA 3L74G 1YTZI 3U1AA 3H1HJ 3Q5SA 1N7SD 4GOFA 4U3FJ 3TGUG 4YXDC 2K9JA 1CW5A 1S5LH 1HVVA 1OIPA 1EZVG 2JKVA 1E5WA 1A02J 2A45H 4I7ZC 2OGUA 5CCHA 2FYNC 1BCCJ 2E5YA 5APWA 2QRXA 3P7KA 2R3CA 2YO2A 3ITKA 1NAFA 2FY8A 1TU3F 1BE3G 3AE3C 1N7SB 4L76A 3TK1A 2HG5D 2Y9ZA 1M1KQ 2I8DA 3L73D 5AW7B 1AQ5A 3CC4P 5CBOA 1M1JA 1QX8A 1NTKK 4R4LA 1M90Q 3F5HA 4Y99C 1N73B 1W2BO 3BCCG 3E1IA 2JDIH 2J58A 3CMAP 1W5CE 1PP9G 1L2PA 4IFDK 4H0LC 3H1LG 2OTKE 1L4AA 1CSBA 3W68A 3B5NB 1BCCD 2JJLA 1YTZT 2WT7B 3CCMP 2B87A 1YBKA 3U1CA 3CMEP 5E79E 3V5BA 2IX7C 2HR3A 4EI2A 1OWAA 3L71J 3BVHA 2WVRA 4RKUJ 4PD4D 3L74J 1NTMG 1URQD 2AXCA 1U7JA 1XTCC 2PAJA 2P7JA 4WWIA 2R5DA 5AW2B 1L0NK 3E7KA 3TGUJ 2H89C 3A3YB 3USSA 2W83C 2JWAA 3GHGA 2D2CC 3D6YA 4EDFA 2M5AA 2O01N 2K1AA 2A45I 4BRYA 1URQB 1X22A 2CPBA 1BE3J 1JM0A 1S9KD 2KLVA 3L74D 2WTYA 4PD4H 1LTJA 1OXZA 2IFNA 4B86A 2FFDB 3TGUD 1GL2B 4GOEA 3JCUH 3AEEC 3BCCJ 3FX0A 1EZVD 1IJDB 1PP9J 2KUBA 3VMZA 3WUTA 1QL1A 2R32A 3H1LJ 1JTHB 1N7LA 5KKZC 2YMKA 1GK6A 3P8MC 2MJZA 1NJIQ 3V2RA 1BE3D 1HGVA 1KILA 2AEJA 5CCGD 1LWUC 2P2UA 3CWBE 1Y47A 1QGKB 2XKMA 3RBXA 2XZRA 1VF5D 1GW3A 1PPJE 3BCCD 1ZV8A 1FC2C 5AVRB 1PP9D 4DZOA 3H1LD 1G1IA 2KXPB 1YQ3C 1P84D 2HPCB 3L75E 3V2PA 2HLOA 3O6QA 2R3SA 2YIUC 4O9BA 2K9JB 5KAIH 1NU1E 3IN6A 4AQRD 3GMAA 5AVVB 1QLED 1NTMD 1EDLA 3C1LA 2M3EA 3IAOA 1NO4A 5KTBA 5EFWB 4WY4C 3CXHE 2FXPA 4PD4I 3L35A 2LKMA 1JO5A 1ZLLA 1JMBA 1NOHA 1LT9C 1T6AA 1ZOYC 3CC7P 1SVFA 3MGNA 2W6JH 1T2KD 1G2CA 1ZXGA 3GF7A 1Q2NA 1Q90D 2QG4A 4IFFA 1SQVE 4QMAA 5AVWB 5APTA 3CC2P 1H0TA 3D6ZA 2LXCB 1EDIA 3HE4A 1OW8A 2P1JA 3GG2A 2WPQA 4GKGA 3WU2E 1KORA 2KZJA 1SQXK 2C0WA 1VQ5P 2HODA 3RBZA 2E75C 2UWJE 3A0BE 2AXTE 1JY2N 2QJPC 1X8YA 2ZYDA 1FOSE 2Q1KA 3CX5D 2H88C 3HD7A 1OVUA 2MKVA 3L72E 5KAFH 1A02F 1HF9A 1YJ9P 1JY3N 2M3BA 1RE3C 3BRVB 1N8RQ 3SFEC 1E79H 1SQQE 3AE4C 2P10A 1H88A 3H32B 3FXDA 1HGZA 2OYHB 1SFCB 2NPSC 1J1DC 2WITA 1FZGA 1KQLA 3NMDA 1KYOE 1JOCA 2H7HA 3H25A 2KS1B 3CCRP 4D6TJ 1KV4A 4W7YA 4YXWH 3NFQA 3CWBG 2KNCB 1FZCB 1VQPP 1USEA 2O1KA 1PPJG 1USDA 1Y9BA 2A06G 1SQPJ 2C9NY 2K9YA 1RE4C 2V4HA 3RL0D 1DH3A 2IZ1A 3CCEP 1QEXA 1PZQA 1IFPA 1FE6A 3L75G 4JF7A 5BVZA 1T3JA 3C8VA 2PFXA 1AJYA 4H44D 2I1KA 2O1JA 1ZR4A 3AE6C 3RL0B 3Q5RA 1PIXA 3MUDC 3AE1C 2FKWB 1P84E 4JYCA 3CCSP 1IZNB 1EC5A 1NTZE 4XFJA 1J1EC 4H44B 1JCDA 4PV1C 4BXLA 4DT0A 3SSUA 1RF1C 1S3JA 2BCCE 3KDPB 3M0DC 4N6JA 1NTME 2YXRB 3KQGA 5E79H 4H13C 1SQVG 1LP1B 1PGPA 2QE7H 5CJ4A 3MP7B 1BGYE 3AE8C 2PP6A 3HTKA 3S4RA 2WWWA 2OYIB 2K37A 2KSEA 3UIAA 2HFED 1M7LA 1FJPA 1VL2A 3C9IA 2KP8A 2RH0A 2XU6A 3L75J 2K88A
chains in the Genus database with same CATH topology
4ASWA 5CBNA 1Y47A 5DJUB 2KZJA 4K35A 2UWJE 2B89A 4NPEA 3MHVA 2KZIA 1SS1A 4JBZA 1U7JA 1FC2C 2KIKA 4WWIA 4EYYQ 4GODA 1DEEG 1H0TB 2Q1KA 4IOIH 4GOFA 3PH0A 2B87B 1NVOA 1OVUA 1LP1A 2M5AA 5DJTB 5K5GB 3RGUA 4HKZH 1X0TA 4HB1A 2K3RA 1MFTA 4ASVA 3QWOC 5C39A 3FXEA 1BDCA 1EC5A 1OVVA 2JWDA 4K3AA 2R44A 2WMMA 2QVAA 1EDLA 4NPFX 1JM0A 2QRXA 3ZDMA 2P58A 4BXLA 1LT1A 1EDJA 5EFWB 2KI7B 4MN4C 1S3JA 3FXDA 1BDDA 4HJGH 4KJMA 1LP1B 2I8DA 2M5AB 1JMBA 4GOEA 5CBOA 1OVRA 2B88A 2LR2A 2KS1B 1U7MA 1ZW0A 4NPDA 2KUBA 1ZXGA 2LXBA 1EDKA 1Q2NA 4ZNCA 2M0BA 2OTKE 1H0TA 2SPZA 2LXCB 3S1KA 1EDIA 4ZMDA 2B87A 3MZWB 2ZAEB 4CPGA 2RKLA 2HR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ASW A;  5CBN A;  1Y47 A;  5DJU B;  2KZJ A;  4K35 A;  2UWJ E;  2B89 A;  4NPE A;  3MHV A;  2KZI A;  1SS1 A;  4JBZ A;  1U7J A;  1FC2 C;  2KIK A;  4WWI A;  4EYY Q;  4GOD A;  1DEE G;  1H0T B;  2Q1K A;  4IOI H;  4GOF A;  3PH0 A;  2B87 B;  1NVO A;  1OVU A;  1LP1 A;  2M5A A;  5DJT B;  5K5G B;  3RGU A;  4HKZ H;  1X0T A;  4HB1 A;  2K3R A;  1MFT A;  4ASV A;  3QWO C;  5C39 A;  3FXE A;  1BDC A;  1EC5 A;  1OVV A;  2JWD A;  4K3A A;  2R44 A;  2WMM A;  2QVA A;  1EDL A;  4NPF X;  1JM0 A;  2QRX A;  3ZDM A;  2P58 A;  4BXL A;  1LT1 A;  1EDJ A;  5EFW B;  2KI7 B;  4MN4 C;  1S3J A;  3FXD A;  1BDD A;  4HJG H;  4KJM A;  1LP1 B;  2I8D A;  2M5A B;  1JMB A;  4GOE A;  5CBO A;  1OVR A;  2B88 A;  2LR2 A;  2KS1 B;  1U7M A;  1ZW0 A;  4NPD A;  2KUB A;  1ZXG A;  2LXB A;  1EDK A;  1Q2N A;  4ZNC A;  2M0B A;  2OTK E;  1H0T A;  2SPZ A;  2LXC B;  3S1K A;  1EDI A;  4ZMD A;  2B87 A;  3MZW B;  2ZAE B;  4CPG A;  2RKL A;  2HR3 A; 
#chains in the Genus database with same CATH topology
 5DJU B;  1QVF O;  3CLQ A;  3Q1M A;  1VQL P;  2ZVO B;  4GT1 A;  1NU1 J;  3A0H E;  3L72 G;  2WSC J;  4GIF A;  1SS1 A;  1CI6 A;  1WMK A;  3G4S P;  1VQ4 P;  2XNX A;  3CWB D;  1L0L E;  3GLM A;  2E43 A;  2GUV A;  1N7S C;  4DJG A;  2N1T D;  3AEB C;  1PPJ D;  2Y0C A;  3K5B A;  1JEK A;  1SQQ G;  3BAT A;  3IFM A;  3I5C A;  2A06 D;  5K5G B;  3AE5 C;  3CX5 E;  5AW6 B;  2BAS A;  1OW7 A;  5AW5 B;  1N73 C;  1HUC A;  2ZFC A;  3L75 D;  3NXS A;  2OAR A;  1HJ0 A;  2IYP A;  3L73 J;  1JY2 P;  1LT1 A;  4OH8 B;  1NU1 D;  3P32 A;  1SQV J;  2N1T B;  3B5N C;  2WQY C;  3CCU P;  2WSE J;  4KT0 J;  1KQF B;  3HE5 A;  5BU8 B;  5APX A;  2E74 B;  3CXH D;  1VPC A;  1IFN A;  4UB6 E;  3RK3 D;  1K73 Q;  1AVY A;  1KIL E;  1RHZ B;  3B5N D;  3MIW A;  5KJ7 D;  1R8E A;  4ZMD A;  4IFM A;  1SQV D;  3CCJ P;  3H1I E;  4RES B;  2OQQ A;  2NRG A;  5AVT B;  3TNU B;  4CPG A;  1H89 A;  1LWU A;  1EXJ A;  2WSC H;  3L72 J;  1URQ C;  3RK3 B;  2AEM A;  3CXH H;  2N9B A;  1NTZ G;  2KK7 A;  4U7J A;  1SQQ J;  1DEB A;  1RF0 C;  2OYO A;  1LTT C;  1KB9 E;  3L70 E;  2IZ0 A;  3AEC C;  3QH9 A;  2YXQ B;  1NYH A;  2J59 M;  2BCC G;  1SLQ A;  1GU4 A;  1FZF A;  4YPC A;  3L72 D;  1BSH A;  1BGY G;  1FDM A;  3KXD A;  2WSE H;  4WY4 A;  2Z5H A;  3G6E P;  1AV1 A;  3PP5 A;  2YO3 A;  1GL2 D;  3H1K E;  3WU2 H;  1SQQ D;  1LT9 A;  3D70 A;  3A0B H;  2AXT H;  2LXB A;  1KYO D;  2NZ2 A;  2KSJ A;  2O01 J;  2R5B A;  4XA4 A;  1FBM A;  1FJK A;  4H0L B;  2FXO A;  3CI9 A;  1KFM A;  5CCG C;  1L0L G;  1FZB A;  2W6A A;  4JYB A;  5CBN A;  1VF5 C;  3EFG A;  1NTZ J;  1ZP0 C;  1HH0 A;  3CXH I;  3RK2 D;  2OTJ P;  1DEE G;  2G3A A;  4TT3 H;  3V2N A;  3H1J E;  1LTB C;  3Q5P A;  3VTP C;  3M9B A;  5APY A;  1KYO H;  1RQV A;  1NTM J;  1SQP K;  3G71 P;  4KHX A;  1HWT C;  3M9Q A;  3AEG C;  3N7N A;  2JWD A;  1JY2 O;  1RE3 A;  2A06 E;  5CCH D;  1FU1 A;  3RK2 B;  1X79 B;  1LJ2 A;  2KYV A;  2KI7 B;  1NTZ D;  3BAS A;  2QSI A;  4C7N A;  5B5E E;  2Q7C A;  1QVG O;  2NPS A;  4HH2 A;  3LIE A;  1CZQ A;  1T2K C;  1YQ4 C;  1DD4 A;  2LR2 A;  2BCC D;  4W7Z A;  4JQ0 D;  1AVO A;  1KC8 Q;  2O01 H;  3H1I G;  1NGM B;  1W2E A;  2JR8 A;  1BGY D;  3ABV C;  2WPV B;  3AE2 C;  3T97 A;  3RK3 E;  1L0L J;  2AEF A;  3A7O A;  3G3Z A;  1L4A D;  1OW6 A;  2QM8 A;  2G8Y A;  5AW0 B;  5AVU B;  1JCC A;  1M1J B;  1P84 H;  1RE4 A;  3L70 G;  4K35 A;  3TF5 A;  2GUS A;  4JBZ A;  5GTI E;  3CD6 P;  1IFM A;  2E76 D;  1L4A B;  1HTL C;  2OYH C;  1SFC C;  3H1H E;  2B87 B;  5H2F E;  1KYO I;  1ZN5 A;  1L0L D;  3KHU A;  1HJB A;  1AQT A;  3MUD A;  1Q82 Q;  3PLN A;  3H1K G;  5TIS E;  1OVV A;  4PJ0 E;  2VRS A;  1NU1 K;  1KQS O;  1EZV I;  2R44 A;  1FZC C;  2E76 B;  1RF1 A;  2YKQ A;  3M0A A;  1SFC D;  3WUV A;  3TYY A;  2P67 A;  3M0D A;  1S72 P;  3GHG B;  1H8A A;  2M5A B;  1ZR2 A;  3L37 A;  2ZT9 D;  3A0H H;  3HUS A;  4NPD A;  5AW9 B;  4BRY B;  1IFI A;  1EDK A;  1U57 A;  1FZE A;  3M9H A;  4AUW A;  2KOG A;  1K04 A;  1YIT P;  1FOS F;  4YTP C;  3L4F A;  1SQV K;  4AYC A;  3SFD C;  1AFO A;  1LTJ B;  4N3Y B;  3VMX A;  2FYZ A;  1SQB E;  1KIL D;  2ZAE B;  2FBW C;  5APV A;  3RL0 C;  3L70 J;  3CX5 H;  3H1J G;  2ZT9 B;  1P84 I;  1GU5 A;  2KLU A;  3L71 E;  2C0X A;  4H44 C;  4N78 E;  3MHV A;  3H1I D;  2IPP A;  5CJ0 A;  1LTA C;  2ZJS E;  1N7S A;  1KIL B;  3CCL P;  1KQG B;  1KN7 A;  3H1K J;  4HB1 A;  1PGO A;  1MFT A;  5APU A;  4OGQ D;  2Z4E A;  4UB6 H;  5AW8 B;  3VP9 A;  2FYU E;  5KLV E;  1KB9 D;  3L70 D;  3RL0 g;  1N73 A;  5KLI B;  1VQ9 P;  3E1R A;  1OX3 A;  4K3A A;  2OYI C;  3NTN A;  1VQ8 P;  1M56 D;  1SQQ K;  3B5N A;  3AE9 C;  2WT7 A;  3CPW O;  1ZRT E;  4OGQ B;  3O6Q B;  2ZYG A;  1U7M A;  4L74 A;  3H1K D;  5GTH E;  3IR9 A;  5M1B A;  2ZYA A;  2M0B A;  1KB9 H;  2SPZ A;  5AW3 B;  2QA4 P;  1EQ7 A;  1PGQ A;  3CX5 I;  3HUS C;  3CWB J;  2JO1 A;  1GD2 E;  3H1H G;  1GZL A;  1JB0 J;  3M06 A;  1VQO P;  1URQ A;  2QJY B;  4U3F G;  1EXI A;  1G2C B;  1Z56 A;  3BRT B;  1JNM A;  2WSF J;  3KPE A;  3A5T A;  2WSS H;  2IBZ E;  2N1T C;  4RO0 A;  1N2D C;  1H0T B;  1RF0 A;  3EQ2 A;  1FAV A;  3HE4 B;  3P8C E;  1FDI A;  2ZXX A;  2FFD A;  3LW5 H;  1GL2 A;  3HD7 D;  2K3R A;  3H1J D;  5C39 A;  1DX7 A;  3OW2 O;  2IYO A;  2HOD B;  1GTW A;  2YKO A;  3OJA B;  2CK3 H;  1FZA A;  1NTZ K;  3CL3 D;  2QVA A;  1JTH A;  3V4W A;  2KB7 P;  1J1E B;  3O8Z A;  2L91 A;  5TJH A;  2RN0 A;  3I55 P;  4HJG H;  3HD7 B;  1NTK E;  1NTM K;  2E74 D;  4WBA A;  3A2A A;  3V2Q A;  4H13 B;  2B88 A;  3RK3 C;  1SQB G;  1RQU A;  3HRN A;  4EIJ A;  1LTS C;  1Y8A A;  1GMJ A;  5KJ7 C;  3L71 G;  5APQ A;  3S1K A;  1NHL A;  1NKZ B;  2HPC A;  2DW3 A;  5CCG A;  2WPS A;  2WPR A;  2POH A;  2QM7 A;  1JY3 P;  3LID A;  2WSF H;  1MKM A;  3PHL A;  1PL5 A;  1L0N E;  1YHQ P;  2FYU G;  2KIK A;  4IL6 X;  5KLV G;  4EYY Q;  3WUU A;  1J2J B;  2C9L Y;  1YYC A;  5B5E H;  2QJK B;  2N9Y B;  1L0L K;  3OAK A;  1LTG C;  3JSV C;  4IOI H;  1LGH B;  3V6I A;  5CHX A;  2J5U A;  3I56 P;  1VQN P;  1LNQ A;  1SP4 A;  1MFZ A;  1OFC X;  2BEQ D;  4IL6 E;  1NKN A;  3H1H D;  4U3F D;  2M8R A;  4TLF A;  2GM4 A;  4NPF X;  2P58 A;  1EDJ A;  1QL2 A;  2PGD A;  4UB8 E;  4R4M A;  2FFD C;  1GL2 C;  2YNY A;  1BDD A;  1GDT A;  1VQK P;  3CCQ P;  2L5G B;  1SQB J;  1S2E A;  4C7R A;  2Y0E A;  1MV8 A;  1G1J A;  3PTZ A;  4I7Z B;  2XV5 A;  4D6T E;  1K8A Q;  5GTI H;  2FYN B;  4L75 A;  4XE5 B;  5H2F H;  4H0L D;  3PRJ A;  2QEX P;  4WB4 A;  3EFF K;  1Q81 Q;  3VOP A;  2IBZ G;  1SQP E;  4JPZ B;  3GF3 A;  5TIS H;  4PJ0 H;  4ASW A;  2HYN A;  1VQ7 P;  3KZI E;  1VQ6 P;  1KD1 Q;  1IK9 A;  1SQB D;  2FYU J;  4Y99 B;  5KLV J;  3HTK B;  4WVZ A;  4NPE A;  3RK2 C;  2Q3E A;  3U59 A;  3H32 A;  4A7P A;  3L71 D;  4I1L A;  2OYH A;  4N78 D;  3VP8 A;  1SFC A;  3MTU E;  1NVO A;  4C46 A;  1YJN P;  2D2C D;  3RGU A;  5B66 E;  2FXM A;  1IC2 A;  1BSN A;  3QWO C;  4M3L A;  2KS1 A;  1T8Z A;  1BDC A;  5AVS B;  5CCH C;  1NTK G;  3SWY A;  3AE7 C;  1CI6 B;  2KNC A;  1FZC A;  2RMZ A;  1S5L X;  2FYU D;  5KLV D;  2BCC J;  3G9R A;  4L73 A;  2D2C B;  1M1J C;  1MZ9 A;  1OVR A;  1BGY J;  2Y9Y A;  2ZVN B;  2JP3 A;  1S5L E;  4RJT A;  1D7M A;  1R5L A;  3VMA A;  1ZRT D;  4LLH A;  2B9B A;  3GW6 A;  1DD3 A;  4ZNC A;  1L4A C;  2W27 A;  1M57 D;  1Q7Y Q;  3R2P A;  1VQM P;  3JC2 2;  1L0N G;  2E5T A;  4ZKU A;  3PJS K;  1N86 A;  1JY3 O;  2H8P D;  3HE5 B;  1SQX E;  1VDF A;  4EOT A;  3OA7 A;  5CMZ A;  3AED C;  4Y28 J;  1VF5 B;  3II6 A;  2E76 C;  5KKZ B;  3CCV P;  3M91 A;  1S1C X;  5AW4 B;  3GHG C;  1OMI A;  2XND H;  3TSI A;  3B71 A;  1LP1 A;  2OTL P;  5DJT B;  2ITA A;  2IBZ D;  1X0T A;  2YMY A;  1NTK J;  1LWU B;  3FXE A;  2Q9I A;  3KYQ A;  5GTH H;  3VYI A;  3P8C D;  1LTI C;  2Z5I A;  2YKP A;  2H43 A;  3EWK A;  3ZDM A;  2OYI A;  1MUU A;  4DOJ A;  3L73 E;  4HYT B;  4D6T G;  4U3F E;  1LTJ C;  4WY4 D;  2W6B A;  1WT6 A;  2ZT9 C;  2YIU B;  4GDO A;  1ZW0 A;  1FS0 E;  1AA0 A;  1BCC E;  1SQP G;  1NTK D;  2Y0D A;  1M8O B;  1XTG B;  5AW1 B;  1L0N J;  4OWF A;  4W80 A;  4WY4 B;  1KIL C;  1JMM A;  1KTM A;  1ZME C;  3H1I J;  4PD4 E;  3B4S A;  3IF4 A;  2V7Q J;  5AVY B;  1LT9 B;  4LC1 A;  3JCU E;  2BEZ F;  1UIX A;  2CPS A;  5KLI C;  1RY3 A;  5AVZ B;  2E75 D;  3Q2Y A;  1WRG A;  3V4Q A;  2N1T A;  5AVQ B;  1K9M Q;  1KFN A;  3PH0 A;  1L0N D;  3D71 A;  4OGQ C;  4HKZ H;  1T3U A;  1PFI A;  3VN0 A;  1S9K E;  2Q3I A;  3L74 E;  1Q86 Q;  2IFM A;  1NWQ A;  2E75 B;  2GA1 A;  2QJP B;  3TGU E;  2A45 G;  3MD0 A;  4MN4 C;  1EZV E;  3R4Y A;  4LGD E;  3LW5 J;  2NPS D;  3TNU A;  3F89 A;  2W8Z A;  2QJY C;  1YI2 P;  5AVX B;  5KAI E;  1BE3 E;  1JUN A;  1SQX G;  2IBZ I;  2I1J A;  5BU5 A;  1NAY A;  5KJ7 A;  2V7Q H;  3W67 A;  1YIJ P;  1NU1 G;  2WZ7 A;  4D6T D;  1R5S A;  3WMM 0;  4C7N B;  2Q5U A;  3B8E B;  1GW4 A;  2NPS B;  1J1D B;  1PV3 A;  3SWF A;  4IL6 H;  3BCC E;  1SQB K;  1PP9 E;  1RH5 B;  3H1L E;  2Q6Q A;  1PGJ A;  1NH4 A;  3FWL A;  5L8R J;  2KZI A;  1SQP D;  4BWN A;  4UB8 H;  3S9O A;  4OVN F;  3H1J J;  3VMY A;  2W90 A;  4GOD A;  3T97 B;  1IO4 A;  3HD7 C;  3Q3D A;  2E42 A;  3L73 G;  1KMI Z;  4DCK A;  4ASV A;  2JEE A;  1FDO A;  2FYU K;  5KLV K;  2WMM A;  3FWN A;  1K05 A;  1IFJ A;  4I6M C;  4PV1 D;  1BCC G;  3L36 A;  1X9V A;  2E74 C;  1DIP A;  1YJW P;  4KJM A;  1IK7 A;  3AEF C;  2ZXE B;  4H13 D;  3KZI H;  1GK4 A;  3N4X A;  1S4X A;  4Z1M H;  1SQX J;  2IDB A;  5KAF E;  2PRR A;  1UII A;  4ZKP A;  3AEA C;  3SWK A;  4PV1 B;  1IFD A;  3H6P A;  2QJK C;  1RF1 B;  1OZH A;  1HBW A;  3MZW B;  5B66 H;  2XDJ A;  3FGA D;  2RKL A;  2QIW A;  4I2L C;  3HUS B;  2O3J A;  1KZU B;  2B89 A;  1KB9 I;  1SQX D;  3TDK A;  5APS A;  3L74 G;  1YTZ I;  3U1A A;  3H1H J;  3Q5S A;  1N7S D;  4GOF A;  4U3F J;  3TGU G;  4YXD C;  2K9J A;  1CW5 A;  1S5L H;  1HVV A;  1OIP A;  1EZV G;  2JKV A;  1E5W A;  1A02 J;  2A45 H;  4I7Z C;  2OGU A;  5CCH A;  2FYN C;  1BCC J;  2E5Y A;  5APW A;  2QRX A;  3P7K A;  2R3C A;  2YO2 A;  3ITK A;  1NAF A;  2FY8 A;  1TU3 F;  1BE3 G;  3AE3 C;  1N7S B;  4L76 A;  3TK1 A;  2HG5 D;  2Y9Z A;  1M1K Q;  2I8D A;  3L73 D;  5AW7 B;  1AQ5 A;  3CC4 P;  5CBO A;  1M1J A;  1QX8 A;  1NTK K;  4R4L A;  1M90 Q;  3F5H A;  4Y99 C;  1N73 B;  1W2B O;  3BCC G;  3E1I A;  2JDI H;  2J58 A;  3CMA P;  1W5C E;  1PP9 G;  1L2P A;  4IFD K;  4H0L C;  3H1L G;  2OTK E;  1L4A A;  1CSB A;  3W68 A;  3B5N B;  1BCC D;  2JJL A;  1YTZ T;  2WT7 B;  3CCM P;  2B87 A;  1YBK A;  3U1C A;  3CME P;  5E79 E;  3V5B A;  2IX7 C;  2HR3 A;  4EI2 A;  1OWA A;  3L71 J;  3BVH A;  2WVR A;  4RKU J;  4PD4 D;  3L74 J;  1NTM G;  1URQ D;  2AXC A;  1U7J A;  1XTC C;  2PAJ A;  2P7J A;  4WWI A;  2R5D A;  5AW2 B;  1L0N K;  3E7K A;  3TGU J;  2H89 C;  3A3Y B;  3USS A;  2W83 C;  2JWA A;  3GHG A;  2D2C C;  3D6Y A;  4EDF A;  2M5A A;  2O01 N;  2K1A A;  2A45 I;  4BRY A;  1URQ B;  1X22 A;  2CPB A;  1BE3 J;  1JM0 A;  1S9K D;  2KLV A;  3L74 D;  2WTY A;  4PD4 H;  1LTJ A;  1OXZ A;  2IFN A;  4B86 A;  2FFD B;  3TGU D;  1GL2 B;  4GOE A;  3JCU H;  3AEE C;  3BCC J;  3FX0 A;  1EZV D;  1IJD B;  1PP9 J;  2KUB A;  3VMZ A;  3WUT A;  1QL1 A;  2R32 A;  3H1L J;  1JTH B;  1N7L A;  5KKZ C;  2YMK A;  1GK6 A;  3P8M C;  2MJZ A;  1NJI Q;  3V2R A;  1BE3 D;  1HGV A;  1KIL A;  2AEJ A;  5CCG D;  1LWU C;  2P2U A;  3CWB E;  1Y47 A;  1QGK B;  2XKM A;  3RBX A;  2XZR A;  1VF5 D;  1GW3 A;  1PPJ E;  3BCC D;  1ZV8 A;  1FC2 C;  5AVR B;  1PP9 D;  4DZO A;  3H1L D;  1G1I A;  2KXP B;  1YQ3 C;  1P84 D;  2HPC B;  3L75 E;  3V2P A;  2HLO A;  3O6Q A;  2R3S A;  2YIU C;  4O9B A;  2K9J B;  5KAI H;  1NU1 E;  3IN6 A;  4AQR D;  3GMA A;  5AVV B;  1QLE D;  1NTM D;  1EDL A;  3C1L A;  2M3E A;  3IAO A;  1NO4 A;  5KTB A;  5EFW B;  4WY4 C;  3CXH E;  2FXP A;  4PD4 I;  3L35 A;  2LKM A;  1JO5 A;  1ZLL A;  1JMB A;  1NOH A;  1LT9 C;  1T6A A;  1ZOY C;  3CC7 P;  1SVF A;  3MGN A;  2W6J H;  1T2K D;  1G2C A;  1ZXG A;  3GF7 A;  1Q2N A;  1Q90 D;  2QG4 A;  4IFF A;  1SQV E;  4QMA A;  5AVW B;  5APT A;  3CC2 P;  1H0T A;  3D6Z A;  2LXC B;  1EDI A;  3HE4 A;  1OW8 A;  2P1J A;  3GG2 A;  2WPQ A;  4GKG A;  3WU2 E;  1KOR A;  2KZJ A;  1SQX K;  2C0W A;  1VQ5 P;  2HOD A;  3RBZ A;  2E75 C;  2UWJ E;  3A0B E;  2AXT E;  1JY2 N;  2QJP C;  1X8Y A;  2ZYD A;  1FOS E;  2Q1K A;  3CX5 D;  2H88 C;  3HD7 A;  1OVU A;  2MKV A;  3L72 E;  5KAF H;  1A02 F;  1HF9 A;  1YJ9 P;  1JY3 N;  2M3B A;  1RE3 C;  3BRV B;  1N8R Q;  3SFE C;  1E79 H;  1SQQ E;  3AE4 C;  2P10 A;  1H88 A;  3H32 B;  3FXD A;  1HGZ A;  2OYH B;  1SFC B;  2NPS C;  1J1D C;  2WIT A;  1FZG A;  1KQL A;  3NMD A;  1KYO E;  1JOC A;  2H7H A;  3H25 A;  2KS1 B;  3CCR P;  4D6T J;  1KV4 A;  4W7Y A;  4YXW H;  3NFQ A;  3CWB G;  2KNC B;  1FZC B;  1VQP P;  1USE A;  2O1K A;  1PPJ G;  1USD A;  1Y9B A;  2A06 G;  1SQP J;  2C9N Y;  2K9Y A;  1RE4 C;  2V4H A;  3RL0 D;  1DH3 A;  2IZ1 A;  3CCE P;  1QEX A;  1PZQ A;  1IFP A;  1FE6 A;  3L75 G;  4JF7 A;  5BVZ A;  1T3J A;  3C8V A;  2PFX A;  1AJY A;  4H44 D;  2I1K A;  2O1J A;  1ZR4 A;  3AE6 C;  3RL0 B;  3Q5R A;  1PIX A;  3MUD C;  3AE1 C;  2FKW B;  1P84 E;  4JYC A;  3CCS P;  1IZN B;  1EC5 A;  1NTZ E;  4XFJ A;  1J1E C;  4H44 B;  1JCD A;  4PV1 C;  4BXL A;  4DT0 A;  3SSU A;  1RF1 C;  1S3J A;  2BCC E;  3KDP B;  3M0D C;  4N6J A;  1NTM E;  2YXR B;  3KQG A;  5E79 H;  4H13 C;  1SQV G;  1LP1 B;  1PGP A;  2QE7 H;  5CJ4 A;  3MP7 B;  1BGY E;  3AE8 C;  2PP6 A;  3HTK A;  3S4R A;  2WWW A;  2OYI B;  2K37 A;  2KSE A;  3UIA A;  2HFE D;  1M7L A;  1FJP A;  1VL2 A;  3C9I A;  2KP8 A;  2RH0 A;  2XU6 A;  3L75 J;  2K88 A; 
#chains in the Genus database with same CATH homology
 4ASW A;  5CBN A;  1Y47 A;  5DJU B;  2KZJ A;  4K35 A;  2UWJ E;  2B89 A;  4NPE A;  3MHV A;  2KZI A;  1SS1 A;  4JBZ A;  1U7J A;  1FC2 C;  2KIK A;  4WWI A;  4EYY Q;  4GOD A;  1DEE G;  1H0T B;  2Q1K A;  4IOI H;  4GOF A;  3PH0 A;  2B87 B;  1NVO A;  1OVU A;  1LP1 A;  2M5A A;  5DJT B;  5K5G B;  3RGU A;  4HKZ H;  1X0T A;  4HB1 A;  2K3R A;  1MFT A;  4ASV A;  3QWO C;  5C39 A;  3FXE A;  1BDC A;  1EC5 A;  1OVV A;  2JWD A;  4K3A A;  2R44 A;  2WMM A;  2QVA A;  1EDL A;  4NPF X;  1JM0 A;  2QRX A;  3ZDM A;  2P58 A;  4BXL A;  1LT1 A;  1EDJ A;  5EFW B;  2KI7 B;  4MN4 C;  1S3J A;  3FXD A;  1BDD A;  4HJG H;  4KJM A;  1LP1 B;  2I8D A;  2M5A B;  1JMB A;  4GOE A;  5CBO A;  1OVR A;  2B88 A;  2LR2 A;  2KS1 B;  1U7M A;  1ZW0 A;  4NPD A;  2KUB A;  1ZXG A;  2LXB A;  1EDK A;  1Q2N A;  4ZNC A;  2M0B A;  2OTK E;  1H0T A;  2SPZ A;  2LXC B;  3S1K A;  1EDI A;  4ZMD A;  2B87 A;  3MZW B;  2ZAE B;  4CPG A;  2RKL A;  2HR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...