2KZJA

Solution structure of the zher2 affibody (alternative)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
58
structure length
58
Chain Sequence
VDNKFNKEMRNAYWEIALLPNLNNQQKRAFIRSLYDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for high-affinity HER2 receptor binding by an engineered protein.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
molecule keywords Engineered protein, ZHER2 Affibody
total genus 21
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2010-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2kzjA00
2KZIA 4GOEA 5DJUB 4ZNCA 4BXLA 1EDIA 4ASVA 5DJTB 2R44A 2UWJE 1EDLA 4NPEA 1SS1A 2JWDA 2HR3A 1JM0A 2RKLA 5CBNA 4WWIA 1U7JA 2ZAEB 2B88A 1BDDA 2M0BA 1X0TA 3QWOC 3MZWB 3FXDA 1MFTA 5CBOA 1OVRA 1BDCA 1LP1B 4NPDA 1H0TA 2KIKA 3S1KA 2OTKE 1Q2NA 1LT1A 4HJGH 3RGUA 4K3AA 1JMBA 1EDKA 4MN4C 1NVOA 2SPZA 1U7MA 2LXCB 1DEEG 2Q1KA 2KS1B 1EC5A 3PH0A 4NPFX 4JBZA 1LP1A 4K35A 4IOIH 1S3JA 3MHVA 1OVUA 2KUBA 4EYYQ 5K5GB 2P58A 1ZW0A 4HKZH 4HB1A 3ZDMA 2QRXA 2WMMA 2LXBA 2KZJA 1EDJA 1OVVA 2B89A 4ZMDA 2I8DA 5EFWB 2KI7B 2QVAA 1H0TB 1ZXGA 4GOFA 2LR2A 4GODA 2B87A 5C39A 2M5AA 2B87B 4CPGA 2M5AB 1FC2C 4ASWA 1Y47A 2K3RA 3FXEA 4KJMA
chains in the Genus database with same CATH superfamily
3GF7A 4B86A 1MFZA 1DX7A 2KZIA 5KLVE 3FX0A 5KKZC 2W6BA 3CX5D 2IYPA 4C7NB 4UB6H 5KJ7D 3L74J 3TGUG 2ZVOB 3H1KG 3KXDA 2OYHA 4BXLA 1FZCC 1ZMEC 1EDIA 3CXHE 1L4AD 1YI2P 4IFDK 2FYUK 1KORA 1USDA 2GUSA 4QMAA 5KLVJ 3M9HA 3GF3A 1SQBJ 2ZT9C 1SLQA 3A7OA 3VOPA 2W90A 4WB4A 1EDLA 3CMEP 1NTME 3G4SP 2POHA 4NPEA 3BASA 3H1HE 1KILD 2QJPB 2YO2A 2E76D 2ITAA 1OW8A 3Q5RA 1YIJP 1N86A 1SQBE 1FOSE 2KNCA 2R5BA 4LC1A 3V2QA 3VMYA 3L71J 3RK3E 3JCUE 1GD2E 1NTMJ 2KSEA 2YIUB 1U7JA 1AVYA 4U3FJ 1EZVE 4W80A 1JY2O 2IYOA 2ZXEB 5AVWB 2FXPA 2N9YB 2CK3H 3V4WA 3V6IA 3C1LA 1HJBA 2YO3A 2Y0EA 5CMZA 3Q3DA 2YXRB 1SQPK 3L71E 2FBWC 3KHUA 1X22A 3GHGA 1VF5C 3QWOC 3RL0B 3S9OA 1LGHB 1LP1B 1LTJC 2E76C 3GMAA 4N78D 3L70E 4U3FE 4WY4C 1FZAA 3RL0D 3TGUE 1N73C 1DD3A 1FZCB 2P7JA 3AE8C 3L74D 2E5TA 3MD0A 1W2BO 5KLVG 1YITP 1RF1A 4HJGH 2OYIA 2J58A 1KN7A 1W2EA 2WVRA 3L74G 4W7ZA 3TGUJ 1GMJA 3B5NC 3AE4C 2NPSD 3PHLA 1KQFB 3W67A 4D6TD 2H7HA 3CI9A 1RE4A 3CMAP 3Q5SA 1IFNA 4TT3H 3SFDC 3R2PA 3VYIA 3EQ2A 3PH0A 2QSIA 4D6TG 3HE5B 2YNYA 1FZGA 3HD7D 1CI6B 1VQ9P 1YQ4C 3H1KD 1KB9D 2FYUG 3IF4A 5GTHE 1NWQA 1PV3A 1Q81Q 1JY3O 1S2EA 2Q6QA 4IOIH 4DZOA 1T6AA 1YTZT 3H1IJ 3H32B 3MHVA 1KTMA 1HUCA 2WT7B 1IO4A 4KT0J 1G2CA 3BVHA 1KYOH 4I7ZB 1SQPE 2P58A 2QJYB 3O6QB 1VF5D 3TDKA 1HVVA 3II6A 1KYOI 3TNUA 2Q3IA 1EQ7A 3WMM0 1ZRTE 2QRXA 3ZDMA 1DIPA 1RQUA 3C8VA 1LTJA 4DJGA 2E75D 3L73G 3L70G 2WPRA 3WUUA 4H13C 2AEFA 1KC8Q 1X79B 3L75G 3E1IA 2WSEH 3R4YA 2IBZI 2KZJA 2ZT9B 3RBZA 3V2NA 2FFDC 1WT6A 2OYOA 1HF9A 4IL6H 3CWBG 1JCDA 1M57D 3L70D 1MUUA 1SQXE 4D6TJ 2KB7P 2W27A 1ZR4A 1SFCA 2I8DA 1BCCD 3H1LG 3CCJP 1ZXGA 2JJLA 1ZRTD 2KNCB 3L72E 2KSJA 2LR2A 1LTGC 2B9BA 1SFCD 3L4FA 4UB8E 5C39A 2KYVA 1MKMA 3H1HG 4D6TE 1NTZJ 3G3ZA 3V4QA 2XZRA 2WPQA 1SFCB 5H2FH 3CWBE 3LW5J 1SQBK 3NTNA 1L4AA 3LW5H 3H1HD 3L74E 4OVNF 1JY3N 2Z5HA 5KKZB 3V2PA 1KB9E 1SQVK 3CL3D 3Q2YA 1S72P 1NOHA 1VQKP 1D7MA 2R3CA 2H89C 2M3EA 1OMIA 1AQ5A 1RQVA 1TU3F 3M9BA 4YPCA 1VQ5P 2A06G 5H2FE 3CXHH 2WSFH 3HUSA 4DCKA 1KQLA 3CCSP 3Q1MA 1JY3P 2ZFCA 1N8RQ 4GDOA 3SFEC 3KPEA 3L71G 1GL2D 1U57A 3GHGB 5GTIH 1LT9A 1Y9BA 3F89A 2H8PD 2I1KA 2WPVB 2JKVA 3M06A 4YXDC 3MUDA 4L75A 2WT7A 1LJ2A 4O9BA 1IFMA 2E42A 4PV1B 3OJAB 1S5LE 1NTKG 5DJTB 2IBZD 2R44A 5AW2B 5AW1B 5AW9B 3MTUE 3P8MC 1YJWP 3H1IG 5KJ7A 1NAFA 3VTPC 3CPWO 1BE3D 5L8RJ 1M90Q 1GDTA 3L35A 5APUA 2WSCJ 2O1KA 4RKUJ 1KYOD 1NU1J 1X8YA 1QVFO 3USSA 1EZVD 1JM0A 1BE3G 3NMDA 3H1LJ 4KJMA 4XFJA 2RKLA 3H1LD 1GU4A 3MP7B 1IFIA 4U7JA 1HBWA 1L0LD 1NU1D 2O01J 3PTZA 3BCCJ 1SQXG 4JF7A 5KAIH 2K1AA 1HTLC 3RK2C 5APSA 2Y9YA 1JY2P 5BU8B 2I1JA 1BGYJ 2YKOA 1VQ7P 1FAVA 1BGYD 1P84E 1KQGB 1BDCA 1H0TA 3GW6A 5BVZA 3BCCE 5B5EH 3TYYA 4L76A 3IR9A 1N7SA 3L72D 1L4AB 1LTBC 1IFPA 2V7QJ 1NTMK 1QEXA 3H1JG 1SQPD 2E75C 2KIKA 2R3SA 1AV1A 3H1IE 3JSVC 2OTLP 3OAKA 1LWUB 1T8ZA 3GHGC 4H13D 3RGUA 3T97B 1Q7YQ 3D6YA 3K5BA 3H1JD 1S9KE 1J2JB 1SQPJ 1ZLLA 4MN4C 2G3AA 1NVOA 1SVFA 2SPZA 3RK2B 2HPCB 4L74A 1U7MA 2D2CB 1PGOA 3HE5A 1DEEG 1QL2A 3M0AA 2R5DA 1BE3J 1KMIZ 2QJYC 2WQYC 2WSCH 2WPSA 1XTGB 1PPJE 2IDBA 2XNDH 1NTKK 1WMKA 2JO1A 2O01H 4C46A 5CCHC 1K05A 2NRGA 3P8CE 4K35A 1GZLA 4AUWA 4R4MA 2HG5D 1XTCC 1IFJA 1S3JA 4RJTA 3FWNA 1OVUA 3B71A 2KUBA 3M91A 3HUSB 3PRJA 5AVTB 3WU2E 1JNMA 5KAIE 3HD7C 2PGDA 3EFFK 4EI2A 1DH3A 3N4XA 2MJZA 4H0LB 1ZW0A 1S5LH 1VQLP 5KLVK 2A06E 2BASA 4UB6E 4C7RA 1H88A 1RHZB 2E74D 3L72J 1NKNA 1OX3A 1RF0C 1QGKB 1FJKA 1JMMA 2NPSB 1BCCJ 2RMZA 2WMMA 4KHXA 3CCVP 1NTZE 3B5NB 1IK7A 1SQQD 2GUVA 1JEKA 1LTIC 2LXBA 2WSSH 2YXQB 1FBMA 3CWBJ 5APVA 1HH0A 1OVVA 2C9LY 1JTHA 2GM4A 3AE6C 4LGDE 3L75J 1QLED 3ITKA 2QG4A 2QA4P 1NYHA 2O01N 1EZVG 2KK7A 1L0NE 5EFWB 2QE7H 4ZMDA 3CCMP 1IK9A 2QM7A 5AW3B 3B5NA 5AW6B 1GK4A 3I56P 4GOFA 5TJHA 5CCHD 1NH4A 1Y8AA 3H25A 1LNQA 2P67A 3L75E 1NTKE 5BU5A 1KFNA 2OQQA 4GODA 1PIXA 2B87A 4BWNA 1BCCG 1SQVE 2M5AA 1GTWA 5B5EE 3A5TA 4I7ZC 1HJ0A 4CPGA 1KILC 1WRGA 3P32A 1NJIQ 1OZHA 1VDFA 1DEBA 3AE1C 4H44D 4PD4D 1NTKJ 2E76B 1HGVA 2XDJA 3AE5C 5AVVB 3D70A 1VQ4P 1FDIA 2BCCG 2JWAA 3HRNA 3BCCD 4JYCA 3L73E 5APWA 3HD7A 4OGQC 4HH2A 5KLVD 2K9JA 3WUTA 3S4RA 2LKMA 2K3RA 3HE4B 5E79H 1GL2C 1NTZK 2BCCD 1EXIA 1Z56A 2QJKB 1KILE 3M0DC 3A0BH 3KZIH 3L73J 3AEFC 1NU1E 3G9RA 4I2LC 5APQA 3NXSA 3H1LE 4GOEA 1UIIA 4ZNCA 1HGZA 5KAFH 2WSEJ 2ZYDA 3AEAC 1CSBA 5APTA 2C9NY 1IZNB 1YYCA 2E5YA 5AW4B 2ZXXA 5AVRB 1M1KQ 4ZKPA 1VF5B 1SFCC 5AW7B 3RK3D 1BGYE 3IAOA 2UWJE 3JC22 3G71P 2ZYAA 2W83C 4EDFA 1M7LA 1NTKD 1JCCA 2K9JB 1SQQK 4OGQB 1RE4C 1L0LG 3P7KA 1KILB 1LTAC 2BCCE 1SS1A 2N1TA 4U3FG 2HR3A 1EXJA 5GTHH 1AA0A 4OH8B 2Y9ZA 1OW7A 3SSUA 2KLVA 1KFMA 2QJKC 2AXCA 4I1LA 1GL2B 1YTZI 2A45H 3I5CA 1M56D 2FKWB 3IFMA 4Z1MH 2BCCJ 4PV1C 2PP6A 1RH5B 2B88A 2M0BA 3ABVC 3EFGA 1LWUC 2WSFJ 2FFDB 1VQOP 1Q82Q 1X0TA 4WY4A 4XE5B 1N73A 1BE3E 1FE6A 1NU1G 3FXDA 1H8AA 1SQPG 4JQ0D 1OVRA 1NU1K 1SQXD 1SQVD 2G8YA 5CBOA 4BRYA 1KV4A 4XA4A 3D71A 3A0BE 3KZIE 1P84I 1URQD 1RY3A 3OA7A 2CPSA 1S1CX 2XV5A 2YIUC 2HODA 1KQSO 3CCUP 1NTMD 3BRTB 3S1KA 1FDOA 2N1TD 1Q2NA 1LT1A 2VRSA 1FZFA 5KJ7C 2C0WA 5KLIB 3RK3B 3CXHI 1ZV8A 2FFDA 1KD1Q 1EDKA 5AVUB 1VQPP 2H43A 1AVOA 1NTMG 1N7SC 1ZP0C 2IZ0A 1L2PA 1GL2A 2LXCB 2YKPA 2M8RA 2A45G 2J59M 1SP4A 2KS1B 2Q1KA 3HD7B 2JDIH 4IL6E 1BCCE 3GG2A 3CX5E 3MIWA 2PRRA 1R8EA 3HUSC 1LTJB 4JBZA 3SWFA 1YHQP 1ZR2A 1FDMA 2N1TC 2WZ7A 1K9MQ 1LP1A 3TNUB 1IC2A 1PP9E 3I55P 4PJ0H 4M3LA 1M1JC 2BEZF 2NPSC 1MZ9A 3L36A 4EYYQ 1L0ND 1S5LX 2K88A 4L73A 3LIDA 1L0NJ 2CPBA 1PPJG 5K5GB 3CC7P 3L73D 5KTBA 1JO5A 2O1JA 1L0LK 1QL1A 3WUVA 1PP9J 3P8CD 4HKZH 1SQQG 2BEQD 4HB1A 4AYCA 2QIWA 1UIXA 1L0NG 1X9VA 2HODB 3N7NA 4H44B 3LIEA 2P1JA 1PPJD 4PD4H 3H1KJ 1PGPA 2HPCA 1SQVJ 3VMXA 2E75B 1NO4A 5GTIE 2WITA 4N3YB 2O3JA 1EDJA 2A45I 2D2CD 3M0DA 3E1RA 2B89A 3TSIA 4IFMA 3E7KA 2E43A 3H1KE 4N78E 4U3FD 3VP9A 1N7SB 4ZKUA 2AXTE 4UB8H 1LT9C 5AVZB 1Q86Q 1OIPA 1VQ6P 3M9QA 1BSNA 2QVAA 3U1CA 1H0TB 3RK3C 1M1JB 1KB9H 2IX7C 5AW8B 2W8ZA 1RE3A 4RO0A 5CCGA 1M1JA 2Q5UA 2H88C 3EWKA 3AE2C 2FYNC 1SQBD 2B87B 1RF1B 1LTTC 2KS1A 1P84H 1BGYG 2KLUA 2M5AB 2V4HA 1FC2C 1YBKA 3CLQA 3D6ZA 1AJYA 2XU6A 4DOJA 3A0HE 1T3JA 2E74C 2K9YA 1LTSC 2A06D 3B4SA 1L0LE 3HTKA 1Y47A 5AVYB 3VMZA 3G6EP 3SWKA 3PP5A 1T3UA 2GA1A 1NAYA 3B5ND 2Q3EA 3KDPB 1FZBA 3L71D 3PLNA 1IFDA 4R4LA 2Y0CA 1PGJA 1G1IA 3BCCG 5AVQB 4BRYB 2IFMA 1FJPA 3T97A 1JTHB 1YJNP 4WY4B 2XKMA 1VL2A 3SWYA 1N73B 3CC2P 3A0HH 1J1EB 3BATA 4H44C 3RL0C 1RF1C 2JR8A 2OARA 2OYIC 4WY4D 2NPSA 1PP9G 5APXA 5DJUB 2IBZE 1OWAA 5AVSB 4EIJA 1ZOYC 2Q9IA 1E79H 4ASVA 2L5GB 3H6PA 1URQB 3PJSK 3VMAA 1IJDB 3UIAA 2R32A 4DT0A 3JCUH 2OYHB 4N6JA 4Y99B 1VQNP 1URQA 3AEEC 1T2KD 3CCLP 2E74B 2P2UA 2PFXA 1KILA 2N1TB 1K04A 1N7LA 1RE3C 5CCGC 3CX5I 4GIFA 1A02J 5CCHA 4PD4E 2K37A 2ZJSE 2JP3A 2JWDA 1GK6A 5CJ0A 2ZYGA 3CCEP 1KB9I 1GW3A 1PZQA 3AE3C 4IFFA 1YQ3C 1P84D 3RK2D 5CBNA 3AE7C 1L4AC 4WWIA 4A7PA 1PGQA 2IZ1A 1OXZA 2QM8A 1HWTC 5CCGD 1SQVG 1J1DB 2ZAEB 3RL0g 4PJ0E 1BDDA 1JOCA 1GW4A 2KP8A 3OW2O 4IL6X 2HYNA 1CI6A 1R5SA 4I6MC 3L72G 3V5BA 1K73Q 1SQQJ 3CWBD 1SQBG 1AQTA 2PAJA 1MFTA 3MZWB 3Q5PA 3CD6P 2KOGA 4NPDA 3U1AA 2HFED 3CCQP 3H1HJ 3L37A 4Y28J 2HLOA 1FU1A 4PD4I 2FYZA 2J5UA 3WU2H 2Y0DA 3HE4A 3FWLA 1SQQE 2D2CC 3QH9A 4H13B 4W7YA 4YTPC 3TF5A 2OTKE 4YXWH 3W68A 3NFQA 4C7NA 1CW5A 5TISE 1EZVI 4K3AA 5B66H 4EOTA 1JMBA 2FXOA 2L91A 1JUNA 1OFCX 1NGMB 1FZCA 2M3BA 2XNXA 4HYTB 2FYUD 1Q90D 3KYQA 2ZT9D 2AXTH 1EC5A 3A2AA 3BRVB 1URQC 2KXPB 5AW0B 1PFIA 1G1JA 1G2CB 4NPFX 3TK1A 4GKGA 1JB0J 2NZ2A 1S4XA 3L70J 3O6QA 1FZEA 1QVGO 3U59A 2YKQA 1PL5A 3FGAD 1N2DC 1SQXK 2IBZG 3AE9C 4RESB 2N9BA 2Q7CA 4PV1D 1VQ8P 2QEXP 1J1DC 3H1JJ 1KZUB 4JYBA 1NTZD 1L0NK 3CX5H 3CC4P 2FXMA 4AQRD 2OTJP 1MV8A 3MGNA 1R5LA 4WVZA 5AVXB 1PP9D 1VQMP 3RBXA 2WWWA 1DD4A 1M8OB 2AEJA 3L75D 5AW5B 5KAFE 3V2RA 1K8AQ 1H89A 4H0LD 1NTZG 4JPZB 3H1JE 5KLIC 1S9KD 5M1BA 4TLFA 1CZQA 3H1ID 4OWFA 1ZN5A 4WBAA 1LT9B 3KQGA 1E5WA 4Y99C 2FYUJ 1NHLA 3VP8A 3CCRP 2OYHC 4H0LC 2FYNB 1FS0E 1L0LJ 1RF0A 4GT1A 1JY2N 3A3YB 3B8EB 1A02F 3AEDC 4LLHA 2OGUA 2DW3A 2KI7B 3AEGC 2IFNA 3C9IA 3TGUD 1VPCA 2YMKA 2V7QH 2FYUE 1W5CE 2AEMA 3AEBC 3O8ZA 2ZVNB 1AFOA 1BSHA 5CJ4A 3H32A 2RN0A 2Z5IA 2JEEA 3AECC 5E79E 2Z4EA 3GLMA 1T2KC 2IPPA 3IN6A 3CXHD 1KYOE 4OGQD 1USEA 3VN0A 2W6AA 2W6JH 2P10A 4ASWA 1SQXJ 5TISH 1LWUA 5APYA 2QJPC 3HTKB 2OYIB 1OW6A 2WTYA 1J1EC 2C0XA 1FOSF 1QX8A 3FXEA 3MUDC 2RH0A 1N7SD 1YJ9P 5CHXA 1GU5A 2MKVA 2YMYA 5B66E 2FY8A 1NKZB 3F5HA
chains in the Genus database with same CATH topology
2KZIA 4GOEA 5DJUB 4ZNCA 4BXLA 1EDIA 4ASVA 5DJTB 2R44A 2UWJE 1EDLA 4NPEA 1SS1A 2JWDA 2HR3A 1JM0A 2RKLA 5CBNA 4WWIA 1U7JA 2ZAEB 2B88A 1BDDA 2M0BA 1X0TA 3QWOC 3MZWB 3FXDA 1MFTA 5CBOA 1OVRA 1BDCA 1LP1B 4NPDA 1H0TA 2KIKA 3S1KA 2OTKE 1Q2NA 1LT1A 4HJGH 3RGUA 4K3AA 1JMBA 1EDKA 4MN4C 1NVOA 2SPZA 1U7MA 2LXCB 1DEEG 2Q1KA 2KS1B 1EC5A 3PH0A 4NPFX 4JBZA 1LP1A 4K35A 4IOIH 1S3JA 3MHVA 1OVUA 2KUBA 4EYYQ 5K5GB 2P58A 1ZW0A 4HKZH 4HB1A 3ZDMA 2QRXA 2WMMA 2LXBA 2KZJA 1EDJA 1OVVA 2B89A 4ZMDA 2I8DA 5EFWB 2KI7B 2QVAA 1H0TB 1ZXGA 4GOFA 2LR2A 4GODA 2B87A 5C39A 2M5AA 2B87B 4CPGA 2M5AB 1FC2C 4ASWA 1Y47A 2K3RA 3FXEA 4KJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZI A;  4GOE A;  5DJU B;  4ZNC A;  4BXL A;  1EDI A;  4ASV A;  5DJT B;  2R44 A;  2UWJ E;  1EDL A;  4NPE A;  1SS1 A;  2JWD A;  2HR3 A;  1JM0 A;  2RKL A;  5CBN A;  4WWI A;  1U7J A;  2ZAE B;  2B88 A;  1BDD A;  2M0B A;  1X0T A;  3QWO C;  3MZW B;  3FXD A;  1MFT A;  5CBO A;  1OVR A;  1BDC A;  1LP1 B;  4NPD A;  1H0T A;  2KIK A;  3S1K A;  2OTK E;  1Q2N A;  1LT1 A;  4HJG H;  3RGU A;  4K3A A;  1JMB A;  1EDK A;  4MN4 C;  1NVO A;  2SPZ A;  1U7M A;  2LXC B;  1DEE G;  2Q1K A;  2KS1 B;  1EC5 A;  3PH0 A;  4NPF X;  4JBZ A;  1LP1 A;  4K35 A;  4IOI H;  1S3J A;  3MHV A;  1OVU A;  2KUB A;  4EYY Q;  5K5G B;  2P58 A;  1ZW0 A;  4HKZ H;  4HB1 A;  3ZDM A;  2QRX A;  2WMM A;  2LXB A;  2KZJ A;  1EDJ A;  1OVV A;  2B89 A;  4ZMD A;  2I8D A;  5EFW B;  2KI7 B;  2QVA A;  1H0T B;  1ZXG A;  4GOF A;  2LR2 A;  4GOD A;  2B87 A;  5C39 A;  2M5A A;  2B87 B;  4CPG A;  2M5A B;  1FC2 C;  4ASW A;  1Y47 A;  2K3R A;  3FXE A;  4KJM A; 
#chains in the Genus database with same CATH topology
 3GF7 A;  4B86 A;  1MFZ A;  1DX7 A;  2KZI A;  5KLV E;  3FX0 A;  5KKZ C;  2W6B A;  3CX5 D;  2IYP A;  4C7N B;  4UB6 H;  5KJ7 D;  3L74 J;  3TGU G;  2ZVO B;  3H1K G;  3KXD A;  2OYH A;  4BXL A;  1FZC C;  1ZME C;  1EDI A;  3CXH E;  1L4A D;  1YI2 P;  4IFD K;  2FYU K;  1KOR A;  1USD A;  2GUS A;  4QMA A;  5KLV J;  3M9H A;  3GF3 A;  1SQB J;  2ZT9 C;  1SLQ A;  3A7O A;  3VOP A;  2W90 A;  4WB4 A;  1EDL A;  3CME P;  1NTM E;  3G4S P;  2POH A;  4NPE A;  3BAS A;  3H1H E;  1KIL D;  2QJP B;  2YO2 A;  2E76 D;  2ITA A;  1OW8 A;  3Q5R A;  1YIJ P;  1N86 A;  1SQB E;  1FOS E;  2KNC A;  2R5B A;  4LC1 A;  3V2Q A;  3VMY A;  3L71 J;  3RK3 E;  3JCU E;  1GD2 E;  1NTM J;  2KSE A;  2YIU B;  1U7J A;  1AVY A;  4U3F J;  1EZV E;  4W80 A;  1JY2 O;  2IYO A;  2ZXE B;  5AVW B;  2FXP A;  2N9Y B;  2CK3 H;  3V4W A;  3V6I A;  3C1L A;  1HJB A;  2YO3 A;  2Y0E A;  5CMZ A;  3Q3D A;  2YXR B;  1SQP K;  3L71 E;  2FBW C;  3KHU A;  1X22 A;  3GHG A;  1VF5 C;  3QWO C;  3RL0 B;  3S9O A;  1LGH B;  1LP1 B;  1LTJ C;  2E76 C;  3GMA A;  4N78 D;  3L70 E;  4U3F E;  4WY4 C;  1FZA A;  3RL0 D;  3TGU E;  1N73 C;  1DD3 A;  1FZC B;  2P7J A;  3AE8 C;  3L74 D;  2E5T A;  3MD0 A;  1W2B O;  5KLV G;  1YIT P;  1RF1 A;  4HJG H;  2OYI A;  2J58 A;  1KN7 A;  1W2E A;  2WVR A;  3L74 G;  4W7Z A;  3TGU J;  1GMJ A;  3B5N C;  3AE4 C;  2NPS D;  3PHL A;  1KQF B;  3W67 A;  4D6T D;  2H7H A;  3CI9 A;  1RE4 A;  3CMA P;  3Q5S A;  1IFN A;  4TT3 H;  3SFD C;  3R2P A;  3VYI A;  3EQ2 A;  3PH0 A;  2QSI A;  4D6T G;  3HE5 B;  2YNY A;  1FZG A;  3HD7 D;  1CI6 B;  1VQ9 P;  1YQ4 C;  3H1K D;  1KB9 D;  2FYU G;  3IF4 A;  5GTH E;  1NWQ A;  1PV3 A;  1Q81 Q;  1JY3 O;  1S2E A;  2Q6Q A;  4IOI H;  4DZO A;  1T6A A;  1YTZ T;  3H1I J;  3H32 B;  3MHV A;  1KTM A;  1HUC A;  2WT7 B;  1IO4 A;  4KT0 J;  1G2C A;  3BVH A;  1KYO H;  4I7Z B;  1SQP E;  2P58 A;  2QJY B;  3O6Q B;  1VF5 D;  3TDK A;  1HVV A;  3II6 A;  1KYO I;  3TNU A;  2Q3I A;  1EQ7 A;  3WMM 0;  1ZRT E;  2QRX A;  3ZDM A;  1DIP A;  1RQU A;  3C8V A;  1LTJ A;  4DJG A;  2E75 D;  3L73 G;  3L70 G;  2WPR A;  3WUU A;  4H13 C;  2AEF A;  1KC8 Q;  1X79 B;  3L75 G;  3E1I A;  2WSE H;  3R4Y A;  2IBZ I;  2KZJ A;  2ZT9 B;  3RBZ A;  3V2N A;  2FFD C;  1WT6 A;  2OYO A;  1HF9 A;  4IL6 H;  3CWB G;  1JCD A;  1M57 D;  3L70 D;  1MUU A;  1SQX E;  4D6T J;  2KB7 P;  2W27 A;  1ZR4 A;  1SFC A;  2I8D A;  1BCC D;  3H1L G;  3CCJ P;  1ZXG A;  2JJL A;  1ZRT D;  2KNC B;  3L72 E;  2KSJ A;  2LR2 A;  1LTG C;  2B9B A;  1SFC D;  3L4F A;  4UB8 E;  5C39 A;  2KYV A;  1MKM A;  3H1H G;  4D6T E;  1NTZ J;  3G3Z A;  3V4Q A;  2XZR A;  2WPQ A;  1SFC B;  5H2F H;  3CWB E;  3LW5 J;  1SQB K;  3NTN A;  1L4A A;  3LW5 H;  3H1H D;  3L74 E;  4OVN F;  1JY3 N;  2Z5H A;  5KKZ B;  3V2P A;  1KB9 E;  1SQV K;  3CL3 D;  3Q2Y A;  1S72 P;  1NOH A;  1VQK P;  1D7M A;  2R3C A;  2H89 C;  2M3E A;  1OMI A;  1AQ5 A;  1RQV A;  1TU3 F;  3M9B A;  4YPC A;  1VQ5 P;  2A06 G;  5H2F E;  3CXH H;  2WSF H;  3HUS A;  4DCK A;  1KQL A;  3CCS P;  3Q1M A;  1JY3 P;  2ZFC A;  1N8R Q;  4GDO A;  3SFE C;  3KPE A;  3L71 G;  1GL2 D;  1U57 A;  3GHG B;  5GTI H;  1LT9 A;  1Y9B A;  3F89 A;  2H8P D;  2I1K A;  2WPV B;  2JKV A;  3M06 A;  4YXD C;  3MUD A;  4L75 A;  2WT7 A;  1LJ2 A;  4O9B A;  1IFM A;  2E42 A;  4PV1 B;  3OJA B;  1S5L E;  1NTK G;  5DJT B;  2IBZ D;  2R44 A;  5AW2 B;  5AW1 B;  5AW9 B;  3MTU E;  3P8M C;  1YJW P;  3H1I G;  5KJ7 A;  1NAF A;  3VTP C;  3CPW O;  1BE3 D;  5L8R J;  1M90 Q;  1GDT A;  3L35 A;  5APU A;  2WSC J;  2O1K A;  4RKU J;  1KYO D;  1NU1 J;  1X8Y A;  1QVF O;  3USS A;  1EZV D;  1JM0 A;  1BE3 G;  3NMD A;  3H1L J;  4KJM A;  4XFJ A;  2RKL A;  3H1L D;  1GU4 A;  3MP7 B;  1IFI A;  4U7J A;  1HBW A;  1L0L D;  1NU1 D;  2O01 J;  3PTZ A;  3BCC J;  1SQX G;  4JF7 A;  5KAI H;  2K1A A;  1HTL C;  3RK2 C;  5APS A;  2Y9Y A;  1JY2 P;  5BU8 B;  2I1J A;  1BGY J;  2YKO A;  1VQ7 P;  1FAV A;  1BGY D;  1P84 E;  1KQG B;  1BDC A;  1H0T A;  3GW6 A;  5BVZ A;  3BCC E;  5B5E H;  3TYY A;  4L76 A;  3IR9 A;  1N7S A;  3L72 D;  1L4A B;  1LTB C;  1IFP A;  2V7Q J;  1NTM K;  1QEX A;  3H1J G;  1SQP D;  2E75 C;  2KIK A;  2R3S A;  1AV1 A;  3H1I E;  3JSV C;  2OTL P;  3OAK A;  1LWU B;  1T8Z A;  3GHG C;  4H13 D;  3RGU A;  3T97 B;  1Q7Y Q;  3D6Y A;  3K5B A;  3H1J D;  1S9K E;  1J2J B;  1SQP J;  1ZLL A;  4MN4 C;  2G3A A;  1NVO A;  1SVF A;  2SPZ A;  3RK2 B;  2HPC B;  4L74 A;  1U7M A;  2D2C B;  1PGO A;  3HE5 A;  1DEE G;  1QL2 A;  3M0A A;  2R5D A;  1BE3 J;  1KMI Z;  2QJY C;  2WQY C;  2WSC H;  2WPS A;  1XTG B;  1PPJ E;  2IDB A;  2XND H;  1NTK K;  1WMK A;  2JO1 A;  2O01 H;  4C46 A;  5CCH C;  1K05 A;  2NRG A;  3P8C E;  4K35 A;  1GZL A;  4AUW A;  4R4M A;  2HG5 D;  1XTC C;  1IFJ A;  1S3J A;  4RJT A;  3FWN A;  1OVU A;  3B71 A;  2KUB A;  3M91 A;  3HUS B;  3PRJ A;  5AVT B;  3WU2 E;  1JNM A;  5KAI E;  3HD7 C;  2PGD A;  3EFF K;  4EI2 A;  1DH3 A;  3N4X A;  2MJZ A;  4H0L B;  1ZW0 A;  1S5L H;  1VQL P;  5KLV K;  2A06 E;  2BAS A;  4UB6 E;  4C7R A;  1H88 A;  1RHZ B;  2E74 D;  3L72 J;  1NKN A;  1OX3 A;  1RF0 C;  1QGK B;  1FJK A;  1JMM A;  2NPS B;  1BCC J;  2RMZ A;  2WMM A;  4KHX A;  3CCV P;  1NTZ E;  3B5N B;  1IK7 A;  1SQQ D;  2GUV A;  1JEK A;  1LTI C;  2LXB A;  2WSS H;  2YXQ B;  1FBM A;  3CWB J;  5APV A;  1HH0 A;  1OVV A;  2C9L Y;  1JTH A;  2GM4 A;  3AE6 C;  4LGD E;  3L75 J;  1QLE D;  3ITK A;  2QG4 A;  2QA4 P;  1NYH A;  2O01 N;  1EZV G;  2KK7 A;  1L0N E;  5EFW B;  2QE7 H;  4ZMD A;  3CCM P;  1IK9 A;  2QM7 A;  5AW3 B;  3B5N A;  5AW6 B;  1GK4 A;  3I56 P;  4GOF A;  5TJH A;  5CCH D;  1NH4 A;  1Y8A A;  3H25 A;  1LNQ A;  2P67 A;  3L75 E;  1NTK E;  5BU5 A;  1KFN A;  2OQQ A;  4GOD A;  1PIX A;  2B87 A;  4BWN A;  1BCC G;  1SQV E;  2M5A A;  1GTW A;  5B5E E;  3A5T A;  4I7Z C;  1HJ0 A;  4CPG A;  1KIL C;  1WRG A;  3P32 A;  1NJI Q;  1OZH A;  1VDF A;  1DEB A;  3AE1 C;  4H44 D;  4PD4 D;  1NTK J;  2E76 B;  1HGV A;  2XDJ A;  3AE5 C;  5AVV B;  3D70 A;  1VQ4 P;  1FDI A;  2BCC G;  2JWA A;  3HRN A;  3BCC D;  4JYC A;  3L73 E;  5APW A;  3HD7 A;  4OGQ C;  4HH2 A;  5KLV D;  2K9J A;  3WUT A;  3S4R A;  2LKM A;  2K3R A;  3HE4 B;  5E79 H;  1GL2 C;  1NTZ K;  2BCC D;  1EXI A;  1Z56 A;  2QJK B;  1KIL E;  3M0D C;  3A0B H;  3KZI H;  3L73 J;  3AEF C;  1NU1 E;  3G9R A;  4I2L C;  5APQ A;  3NXS A;  3H1L E;  4GOE A;  1UII A;  4ZNC A;  1HGZ A;  5KAF H;  2WSE J;  2ZYD A;  3AEA C;  1CSB A;  5APT A;  2C9N Y;  1IZN B;  1YYC A;  2E5Y A;  5AW4 B;  2ZXX A;  5AVR B;  1M1K Q;  4ZKP A;  1VF5 B;  1SFC C;  5AW7 B;  3RK3 D;  1BGY E;  3IAO A;  2UWJ E;  3JC2 2;  3G71 P;  2ZYA A;  2W83 C;  4EDF A;  1M7L A;  1NTK D;  1JCC A;  2K9J B;  1SQQ K;  4OGQ B;  1RE4 C;  1L0L G;  3P7K A;  1KIL B;  1LTA C;  2BCC E;  1SS1 A;  2N1T A;  4U3F G;  2HR3 A;  1EXJ A;  5GTH H;  1AA0 A;  4OH8 B;  2Y9Z A;  1OW7 A;  3SSU A;  2KLV A;  1KFM A;  2QJK C;  2AXC A;  4I1L A;  1GL2 B;  1YTZ I;  2A45 H;  3I5C A;  1M56 D;  2FKW B;  3IFM A;  4Z1M H;  2BCC J;  4PV1 C;  2PP6 A;  1RH5 B;  2B88 A;  2M0B A;  3ABV C;  3EFG A;  1LWU C;  2WSF J;  2FFD B;  1VQO P;  1Q82 Q;  1X0T A;  4WY4 A;  4XE5 B;  1N73 A;  1BE3 E;  1FE6 A;  1NU1 G;  3FXD A;  1H8A A;  1SQP G;  4JQ0 D;  1OVR A;  1NU1 K;  1SQX D;  1SQV D;  2G8Y A;  5CBO A;  4BRY A;  1KV4 A;  4XA4 A;  3D71 A;  3A0B E;  3KZI E;  1P84 I;  1URQ D;  1RY3 A;  3OA7 A;  2CPS A;  1S1C X;  2XV5 A;  2YIU C;  2HOD A;  1KQS O;  3CCU P;  1NTM D;  3BRT B;  3S1K A;  1FDO A;  2N1T D;  1Q2N A;  1LT1 A;  2VRS A;  1FZF A;  5KJ7 C;  2C0W A;  5KLI B;  3RK3 B;  3CXH I;  1ZV8 A;  2FFD A;  1KD1 Q;  1EDK A;  5AVU B;  1VQP P;  2H43 A;  1AVO A;  1NTM G;  1N7S C;  1ZP0 C;  2IZ0 A;  1L2P A;  1GL2 A;  2LXC B;  2YKP A;  2M8R A;  2A45 G;  2J59 M;  1SP4 A;  2KS1 B;  2Q1K A;  3HD7 B;  2JDI H;  4IL6 E;  1BCC E;  3GG2 A;  3CX5 E;  3MIW A;  2PRR A;  1R8E A;  3HUS C;  1LTJ B;  4JBZ A;  3SWF A;  1YHQ P;  1ZR2 A;  1FDM A;  2N1T C;  2WZ7 A;  1K9M Q;  1LP1 A;  3TNU B;  1IC2 A;  1PP9 E;  3I55 P;  4PJ0 H;  4M3L A;  1M1J C;  2BEZ F;  2NPS C;  1MZ9 A;  3L36 A;  4EYY Q;  1L0N D;  1S5L X;  2K88 A;  4L73 A;  3LID A;  1L0N J;  2CPB A;  1PPJ G;  5K5G B;  3CC7 P;  3L73 D;  5KTB A;  1JO5 A;  2O1J A;  1L0L K;  1QL1 A;  3WUV A;  1PP9 J;  3P8C D;  4HKZ H;  1SQQ G;  2BEQ D;  4HB1 A;  4AYC A;  2QIW A;  1UIX A;  1L0N G;  1X9V A;  2HOD B;  3N7N A;  4H44 B;  3LIE A;  2P1J A;  1PPJ D;  4PD4 H;  3H1K J;  1PGP A;  2HPC A;  1SQV J;  3VMX A;  2E75 B;  1NO4 A;  5GTI E;  2WIT A;  4N3Y B;  2O3J A;  1EDJ A;  2A45 I;  2D2C D;  3M0D A;  3E1R A;  2B89 A;  3TSI A;  4IFM A;  3E7K A;  2E43 A;  3H1K E;  4N78 E;  4U3F D;  3VP9 A;  1N7S B;  4ZKU A;  2AXT E;  4UB8 H;  1LT9 C;  5AVZ B;  1Q86 Q;  1OIP A;  1VQ6 P;  3M9Q A;  1BSN A;  2QVA A;  3U1C A;  1H0T B;  3RK3 C;  1M1J B;  1KB9 H;  2IX7 C;  5AW8 B;  2W8Z A;  1RE3 A;  4RO0 A;  5CCG A;  1M1J A;  2Q5U A;  2H88 C;  3EWK A;  3AE2 C;  2FYN C;  1SQB D;  2B87 B;  1RF1 B;  1LTT C;  2KS1 A;  1P84 H;  1BGY G;  2KLU A;  2M5A B;  2V4H A;  1FC2 C;  1YBK A;  3CLQ A;  3D6Z A;  1AJY A;  2XU6 A;  4DOJ A;  3A0H E;  1T3J A;  2E74 C;  2K9Y A;  1LTS C;  2A06 D;  3B4S A;  1L0L E;  3HTK A;  1Y47 A;  5AVY B;  3VMZ A;  3G6E P;  3SWK A;  3PP5 A;  1T3U A;  2GA1 A;  1NAY A;  3B5N D;  2Q3E A;  3KDP B;  1FZB A;  3L71 D;  3PLN A;  1IFD A;  4R4L A;  2Y0C A;  1PGJ A;  1G1I A;  3BCC G;  5AVQ B;  4BRY B;  2IFM A;  1FJP A;  3T97 A;  1JTH B;  1YJN P;  4WY4 B;  2XKM A;  1VL2 A;  3SWY A;  1N73 B;  3CC2 P;  3A0H H;  1J1E B;  3BAT A;  4H44 C;  3RL0 C;  1RF1 C;  2JR8 A;  2OAR A;  2OYI C;  4WY4 D;  2NPS A;  1PP9 G;  5APX A;  5DJU B;  2IBZ E;  1OWA A;  5AVS B;  4EIJ A;  1ZOY C;  2Q9I A;  1E79 H;  4ASV A;  2L5G B;  3H6P A;  1URQ B;  3PJS K;  3VMA A;  1IJD B;  3UIA A;  2R32 A;  4DT0 A;  3JCU H;  2OYH B;  4N6J A;  4Y99 B;  1VQN P;  1URQ A;  3AEE C;  1T2K D;  3CCL P;  2E74 B;  2P2U A;  2PFX A;  1KIL A;  2N1T B;  1K04 A;  1N7L A;  1RE3 C;  5CCG C;  3CX5 I;  4GIF A;  1A02 J;  5CCH A;  4PD4 E;  2K37 A;  2ZJS E;  2JP3 A;  2JWD A;  1GK6 A;  5CJ0 A;  2ZYG A;  3CCE P;  1KB9 I;  1GW3 A;  1PZQ A;  3AE3 C;  4IFF A;  1YQ3 C;  1P84 D;  3RK2 D;  5CBN A;  3AE7 C;  1L4A C;  4WWI A;  4A7P A;  1PGQ A;  2IZ1 A;  1OXZ A;  2QM8 A;  1HWT C;  5CCG D;  1SQV G;  1J1D B;  2ZAE B;  3RL0 g;  4PJ0 E;  1BDD A;  1JOC A;  1GW4 A;  2KP8 A;  3OW2 O;  4IL6 X;  2HYN A;  1CI6 A;  1R5S A;  4I6M C;  3L72 G;  3V5B A;  1K73 Q;  1SQQ J;  3CWB D;  1SQB G;  1AQT A;  2PAJ A;  1MFT A;  3MZW B;  3Q5P A;  3CD6 P;  2KOG A;  4NPD A;  3U1A A;  2HFE D;  3CCQ P;  3H1H J;  3L37 A;  4Y28 J;  2HLO A;  1FU1 A;  4PD4 I;  2FYZ A;  2J5U A;  3WU2 H;  2Y0D A;  3HE4 A;  3FWL A;  1SQQ E;  2D2C C;  3QH9 A;  4H13 B;  4W7Y A;  4YTP C;  3TF5 A;  2OTK E;  4YXW H;  3W68 A;  3NFQ A;  4C7N A;  1CW5 A;  5TIS E;  1EZV I;  4K3A A;  5B66 H;  4EOT A;  1JMB A;  2FXO A;  2L91 A;  1JUN A;  1OFC X;  1NGM B;  1FZC A;  2M3B A;  2XNX A;  4HYT B;  2FYU D;  1Q90 D;  3KYQ A;  2ZT9 D;  2AXT H;  1EC5 A;  3A2A A;  3BRV B;  1URQ C;  2KXP B;  5AW0 B;  1PFI A;  1G1J A;  1G2C B;  4NPF X;  3TK1 A;  4GKG A;  1JB0 J;  2NZ2 A;  1S4X A;  3L70 J;  3O6Q A;  1FZE A;  1QVG O;  3U59 A;  2YKQ A;  1PL5 A;  3FGA D;  1N2D C;  1SQX K;  2IBZ G;  3AE9 C;  4RES B;  2N9B A;  2Q7C A;  4PV1 D;  1VQ8 P;  2QEX P;  1J1D C;  3H1J J;  1KZU B;  4JYB A;  1NTZ D;  1L0N K;  3CX5 H;  3CC4 P;  2FXM A;  4AQR D;  2OTJ P;  1MV8 A;  3MGN A;  1R5L A;  4WVZ A;  5AVX B;  1PP9 D;  1VQM P;  3RBX A;  2WWW A;  1DD4 A;  1M8O B;  2AEJ A;  3L75 D;  5AW5 B;  5KAF E;  3V2R A;  1K8A Q;  1H89 A;  4H0L D;  1NTZ G;  4JPZ B;  3H1J E;  5KLI C;  1S9K D;  5M1B A;  4TLF A;  1CZQ A;  3H1I D;  4OWF A;  1ZN5 A;  4WBA A;  1LT9 B;  3KQG A;  1E5W A;  4Y99 C;  2FYU J;  1NHL A;  3VP8 A;  3CCR P;  2OYH C;  4H0L C;  2FYN B;  1FS0 E;  1L0L J;  1RF0 A;  4GT1 A;  1JY2 N;  3A3Y B;  3B8E B;  1A02 F;  3AED C;  4LLH A;  2OGU A;  2DW3 A;  2KI7 B;  3AEG C;  2IFN A;  3C9I A;  3TGU D;  1VPC A;  2YMK A;  2V7Q H;  2FYU E;  1W5C E;  2AEM A;  3AEB C;  3O8Z A;  2ZVN B;  1AFO A;  1BSH A;  5CJ4 A;  3H32 A;  2RN0 A;  2Z5I A;  2JEE A;  3AEC C;  5E79 E;  2Z4E A;  3GLM A;  1T2K C;  2IPP A;  3IN6 A;  3CXH D;  1KYO E;  4OGQ D;  1USE A;  3VN0 A;  2W6A A;  2W6J H;  2P10 A;  4ASW A;  1SQX J;  5TIS H;  1LWU A;  5APY A;  2QJP C;  3HTK B;  2OYI B;  1OW6 A;  2WTY A;  1J1E C;  2C0X A;  1FOS F;  1QX8 A;  3FXE A;  3MUD C;  2RH0 A;  1N7S D;  1YJ9 P;  5CHX A;  1GU5 A;  2MKV A;  2YMY A;  5B66 E;  2FY8 A;  1NKZ B;  3F5H A; 
#chains in the Genus database with same CATH homology
 2KZI A;  4GOE A;  5DJU B;  4ZNC A;  4BXL A;  1EDI A;  4ASV A;  5DJT B;  2R44 A;  2UWJ E;  1EDL A;  4NPE A;  1SS1 A;  2JWD A;  2HR3 A;  1JM0 A;  2RKL A;  5CBN A;  4WWI A;  1U7J A;  2ZAE B;  2B88 A;  1BDD A;  2M0B A;  1X0T A;  3QWO C;  3MZW B;  3FXD A;  1MFT A;  5CBO A;  1OVR A;  1BDC A;  1LP1 B;  4NPD A;  1H0T A;  2KIK A;  3S1K A;  2OTK E;  1Q2N A;  1LT1 A;  4HJG H;  3RGU A;  4K3A A;  1JMB A;  1EDK A;  4MN4 C;  1NVO A;  2SPZ A;  1U7M A;  2LXC B;  1DEE G;  2Q1K A;  2KS1 B;  1EC5 A;  3PH0 A;  4NPF X;  4JBZ A;  1LP1 A;  4K35 A;  4IOI H;  1S3J A;  3MHV A;  1OVU A;  2KUB A;  4EYY Q;  5K5G B;  2P58 A;  1ZW0 A;  4HKZ H;  4HB1 A;  3ZDM A;  2QRX A;  2WMM A;  2LXB A;  2KZJ A;  1EDJ A;  1OVV A;  2B89 A;  4ZMD A;  2I8D A;  5EFW B;  2KI7 B;  2QVA A;  1H0T B;  1ZXG A;  4GOF A;  2LR2 A;  4GOD A;  2B87 A;  5C39 A;  2M5A A;  2B87 B;  4CPG A;  2M5A B;  1FC2 C;  4ASW A;  1Y47 A;  2K3R A;  3FXE A;  4KJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...